3TD3A

Crystal structure of ompa-like domain from acinetobacter baumannii in complex with glycine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
120
structure length
120
Chain Sequence
MELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLNERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of anchoring of OmpA protein to the cell wall peptidoglycan of the gram-negative bacterial outer membrane
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Membrane protein,peptide binding protein
molecule keywords Outer membrane protein omp38
total genus 39
structure length 120
sequence length 120
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3td3A00
4G4WA 4G88A 3TD4A 4ZHVA 3TD5A 3S0WA 4ZHWA 2ZOVA 3CYQA 3CYPB 5EB0A 3WPWA 4RHAA 1R1MA 3LDTA 3S06A 5EAZA 2LCAA 3KHNA 3OONA 2LBTA 4PWTA 4G4ZA 4ZHYB 3S0YA 2W8BC 4G4XA 3TD3A 4B5CA 4G4YA 2N48A 2ZVZA 3S0HA 3WPXA 4B62A 2ZVYA 1OAPA 3S02A 2MQEA 3S03A 2ZF8A 2KGWA 2HQSC 2K1SA 2L26A 5EB1B 4ERHA 4R40B 2AIZP 3IMPA 4G4VA
chains in the Genus database with same CATH superfamily
5JQGA 2FC3A 1H48A 1JD1A 3KJJA 4X3LA 1VQ9F 2CWJA 3JASA 3IKFA 5ITZB 2KTVA 4TV8B 3K0TA 4F6RA 1J7HA 2Q1YA 3GYQA 4TUYA 2DYYA 2KTUA 2IAFA 1RLUA 3WJQA 5EB0A 3WPWA 2BO1A 2BTQB 1R1MA 1M90H 3VYUC 3MBMA 3RYHA 3HTNA 5FNVB 4HNAB 1W41A 4BW0B 3L7QA 5HP7A 4WBNA 1VQNF 2CZWA 1VQ8F 3AGKA 5JH7A 3LWVC 3GTZA 4NWOB 4EI8A 2VAPA 5LYJA 1GO0A 4IIJA 2HX0A 5FJ4C 2VAWA 3RE3A 4I55B 4M8IA 3V7QA 4ZI7A 1QVFF 1YQNA 3JAWB 1QVGF 4X20A 1ONIA 3N2GB 1T0KB 2CW4A 1M1KH 1IV1A 1NJIH 3ZP4A 2VGNA 1SZQA 1QU9A 4PWTA 2H6LA 1XHOA 3RYIA 5AVMA 1FFXB 3OW2F 5GIOC 3E22B 4C8GA 4BVQA 4X1IB 5IJ0B 2KGWA 3DC2A 2WALA 5J2TA 3LMEA 4ZOLB 3CXCF 5LA6A 3M4SA 5EYPA 2HRYA 2PHNA 1PXWA 5EZYA 3HKDB 5EWRA 3K12A 5LXTB 3HKCA 3F0GA 3UT5B 5BMVB 3JARB 3S06A 5HXZA 4BT6A 1X7OA 5JVDA 5GONB 4BVSA 2F9ZC 2I6DA 5IYZB 2ZVYA 4U3JA 5EIBD 3E1YA 2I6RA 2KG4A 1IV3A 4ZK7A 1YI2F 3EORA 3BYQA 3PLAC 3CCQF 1W59A 2AIZP 3IMPA 4O4HA 2GZLA 1H47A 4BVTA 4BY9D 3D00A 1YITF 3IEQA 3LFOA 3P0ZA 4ZHWA 5ITZA 3CCRF 1JJ2F 1VQ7F 3JALB 5JCOC 3CYPB 1TVKB 3CCUF 2RHJA 4F6RB 1YJ9F 1W3EX 4O4LB 5IJ9B 3JAMM 1XV2A 3KJKA 1S72F 2RHLA 2CHTA 3F6MA 4DRXA 2N48A 3G4SF 3M84A 2YXZA 3WPXA 3CC4F 4X1KA 2OTMA 3WGKA 5HY2A 2BTUA 2ZF8A 4BT2A 1RQ2A 1SA0A 2OTLF 5EB1B 5J2UA 3SIUA 4G4VA 3JATB 3G6EF 3SIVA 1TUBB 4HNAA 3HKEB 4IHJB 5KX5B 1XRGA 2NMUA 1W40A 5CA0A 1H7MA 2JNBA 3VOAA 2CSLA 4DXDA 4LCKA 2Z1EA 3C8LA 2W8BC 3OBWA 1VK3A 5FLXM 5LP6B 4I55A 4YJ3A 2ALEA 1ZWZA 2ZVZA 3JAWA 1XBIA 1VQVA 2GVIA 1COMA 4I4TB 5HXUA 3N2GA 1CN7A 3ESJA 3LYBA 5EIBC 1CLIA 5MN4A 3LWOC 1UFYA 4O2AB 2PMPA 5KMGA 4XCQA 4E6EA 2H8CA 3P10A 3N4ZA 2UYNB 3E22A 1CK2A 4X1YA 5HY0A 2LBTA 3N2KA 4C8EA 2UYJA 4ZHYB 4X1IA 5IJ0A 1E7KA 5MN6A 3FPIA 5HP8A 3N4YA 1ODEA 2HP3A 3S02A 4C82A 3FFMA 3CCVF 3PAFA 3V4DA 4I50A 4O2BA 3MCAB 5JVDB 3E20B 3J81M 3VYSC 3JAKA 4BT5A 2DT4A 1FSZA 4U3JB 2UYPA 3ELCA 5HY4A 4NQ3A 3NK6A 4KWEA 3HKBA 3TD3A 3C9RA 1DT9A 3IR9A 4G4YA 2VGMA 3ZO8A 2Z1FA 4WBNB 1SDSA 2HP0B 2UYKA 1QD9A 1W42A 1RA4A 3P4EA 4C8IA 3JALA 4B46A 3F0FA 4IIJB 5GINC 1K73H 4O4JA 5MN5A 1GO1A 4O4LA 4NUTA 5IJ9A 4X20B 4DRXB 3CMEF 4X1KB 2HS3A 3OBYA 2Z1UA 3KHNA 3OONA 3S0YA 3K14A 1KD1H 1KQSF 3FD6A 5B8FA 3FBAA 1T0AA 2OZBA 3RYIB 2VXYA 4B62A 3JATA 2R751 5HY1A 1Q82H 5A2QM 2QEXF 3HKEA 4ZHQA 3CCJF 4TV9B 5C8YA 1KNJA 4R40B 4ZHVA 5LOVB 5LA6B 4C4WC 5EYPB 4EB6B 5LP6A 3I7TA 2EWCA 3C9TA 1QAHA 4YJ3B 5EZYB 3RYFB 5LXTA 5EAZA 3NK7A 2HS0A 1U3PA 3ERNA 5GONA 5JCOA 2V9YA 1IPAA 5IT9M 3LWPC 1OAPA 5GANK 1VQMF 1X7PA 3HJWC 1UI9A 2UYNA 4O4IA 1U43A 2UZHA 4YJ2B 1W581 1FNKA 1NMUB 4X1YB 3IEWA 2LBXA 3FD5A 4O4HB 2ZAUA 1GZ0A 3CPQA 4LNUB 1U40A 2B33A 3VMFB 3JASB 3VO8A 1JFFB 3LDTA 4B45A 5HWEA 1W5BA 3U0OA 2CVLA 2RB9A 3RYCB 5GIPC 1VQKF 3F0DA 4FFBA 4G4XA 1PF5A 1VH8A 1YHQF 1W55A 3QHDA 2ZODA 2VAMA 3CCLF 2CHSA 1KNKA 3O85A 4I50B 1YJNF 3WJPA 4RQOA 3WGJA 3WJRA 3JVHA 3B6NA 3G71F 2L26A 3JAKB 2QI2A 4G88A 3TD4A 5J2UB 1VQ5F 3VIUA 3HKBB 2QA4F 3HAXD 2ZOVA 5G4UC 1Z5WA 5KX5A 2HP0A 2RHHA 2HRUA 5G4VC 5JH7B 4U39A 1Q7YH 5LYJB 5GAPK 5CA1A 3CPWF 4I4TA 3Q8HA 3V3TA 4ZI7B 5CB4B 1YGYA 2FGYA 4C81A 1K8AH 1OFUA 1W5EA 4G4WA 3LWRC 3F0EA 3TD5A 3S0WA 5DCVA 5KMGB 3RA6A 3I55F 3VTIC 1IV4A 1IV2A 2BTOA 1W57A 3CCEF 1NQ3A 1VQ4F 1VQ6F 1VQOF 2HS4A 5JQGB 4EI9A 4ZHQB 3CC2F 3T80A 3N2KB 4TV9A 5C8YB 1VQPF 4TZZA 1W5FA 3CB2A 4BT4A 3CMAF 1VHAA 4EB6A 4TV8A 2OHWA 3WGLA 3RYFA 3HKDA 4BT7A 4TUYB 3KE1A 1KC8H 3J7AR 3UT5A 5BMVA 3MCQA 1JN1A 4O2BB 2RHOA 3M1XA 2LBWA 3C9SA 4G4ZA 2HVYD 3VCZA 5IYZA 1GX1A 4O4IB 3ZP7A 1DBFA 3HWUA 3CCSF 1Q86H 3JCMM 3S0HA 3I56F 3DDNA 3RYHB 2YYEA 5FNVA 1X52A 2AIFA 3ON1A 3QUWA 2Q1XA 4LNUA 3C9UA 3WXMB 1N8RH 4ERHA 1JFFA 1JY8A 1K9MH 1W2BF 3RYCA 3D54A 4O4JB 1TVKA 3I3FA 3MQWA 1Q81H 4FFBB 1FNJA 4RHAA 3V7EA 3VYTC 2P6YA 3CC7F 4B5CA 1W5AA 3IKEA 3KIZA 3LWQC 5LP6C 1SA0B 2IG8A 2MQEA 3S03A 2G9IA 1FFXA 2HQSC 1YIJF 3RA5A 3K2XA 1TUBA 3GHZA 4EI7A 4IHJA 1Q8RA 1Z5VA 2Z01A 5CA0B 1VQLF 2OTJF 1RQ7A 2Z1TA 3CYQA 5EO3A 5LOVA 5J2TB 4BVRA 5CA1B 4X3MA 4ZOLA 3D01A 2H8EA 1RLGA 3VI6A 3CD6F 2LCAA 2QTPA 3CCMF 3NVIB 2R6R1 4BT3A 5CB4A 3J80M 3HKCB 1YJWF 3JARA 2IQQA 2GLZA 3VOBA 1U3LA 2AMTA 3WGNA 1X25A 4O2AA 3QTYA 3R0PA 2K1SA 3MDOA 3NMUC 3NVKE 3CG6A 3WGMA 3ZOPA 4YJ2A
chains in the Genus database with same CATH topology
4G4WA 4G88A 3TD4A 4ZHVA 3TD5A 3S0WA 4ZHWA 2ZOVA 3CYQA 3CYPB 5EB0A 3WPWA 4RHAA 1R1MA 3LDTA 3S06A 5EAZA 2LCAA 3KHNA 3OONA 2LBTA 4PWTA 4G4ZA 4ZHYB 3S0YA 2W8BC 4G4XA 3TD3A 4B5CA 4G4YA 2N48A 2ZVZA 3S0HA 3WPXA 4B62A 2ZVYA 1OAPA 3S02A 2MQEA 3S03A 2ZF8A 2KGWA 2HQSC 2K1SA 2L26A 5EB1B 4ERHA 4R40B 2AIZP 3IMPA 4G4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4W A;  4G88 A;  3TD4 A;  4ZHV A;  3TD5 A;  3S0W A;  4ZHW A;  2ZOV A;  3CYQ A;  3CYP B;  5EB0 A;  3WPW A;  4RHA A;  1R1M A;  3LDT A;  3S06 A;  5EAZ A;  2LCA A;  3KHN A;  3OON A;  2LBT A;  4PWT A;  4G4Z A;  4ZHY B;  3S0Y A;  2W8B C;  4G4X A;  3TD3 A;  4B5C A;  4G4Y A;  2N48 A;  2ZVZ A;  3S0H A;  3WPX A;  4B62 A;  2ZVY A;  1OAP A;  3S02 A;  2MQE A;  3S03 A;  2ZF8 A;  2KGW A;  2HQS C;  2K1S A;  2L26 A;  5EB1 B;  4ERH A;  4R40 B;  2AIZ P;  3IMP A;  4G4V A; 
#chains in the Genus database with same CATH topology
 5JQG A;  2FC3 A;  1H48 A;  1JD1 A;  3KJJ A;  4X3L A;  1VQ9 F;  2CWJ A;  3JAS A;  3IKF A;  5ITZ B;  2KTV A;  4TV8 B;  3K0T A;  4F6R A;  1J7H A;  2Q1Y A;  3GYQ A;  4TUY A;  2DYY A;  2KTU A;  2IAF A;  1RLU A;  3WJQ A;  5EB0 A;  3WPW A;  2BO1 A;  2BTQ B;  1R1M A;  1M90 H;  3VYU C;  3MBM A;  3RYH A;  3HTN A;  5FNV B;  4HNA B;  1W41 A;  4BW0 B;  3L7Q A;  5HP7 A;  4WBN A;  1VQN F;  2CZW A;  1VQ8 F;  3AGK A;  5JH7 A;  3LWV C;  3GTZ A;  4NWO B;  4EI8 A;  2VAP A;  5LYJ A;  1GO0 A;  4IIJ A;  2HX0 A;  5FJ4 C;  2VAW A;  3RE3 A;  4I55 B;  4M8I A;  3V7Q A;  4ZI7 A;  1QVF F;  1YQN A;  3JAW B;  1QVG F;  4X20 A;  1ONI A;  3N2G B;  1T0K B;  2CW4 A;  1M1K H;  1IV1 A;  1NJI H;  3ZP4 A;  2VGN A;  1SZQ A;  1QU9 A;  4PWT A;  2H6L A;  1XHO A;  3RYI A;  5AVM A;  1FFX B;  3OW2 F;  5GIO C;  3E22 B;  4C8G A;  4BVQ A;  4X1I B;  5IJ0 B;  2KGW A;  3DC2 A;  2WAL A;  5J2T A;  3LME A;  4ZOL B;  3CXC F;  5LA6 A;  3M4S A;  5EYP A;  2HRY A;  2PHN A;  1PXW A;  5EZY A;  3HKD B;  5EWR A;  3K12 A;  5LXT B;  3HKC A;  3F0G A;  3UT5 B;  5BMV B;  3JAR B;  3S06 A;  5HXZ A;  4BT6 A;  1X7O A;  5JVD A;  5GON B;  4BVS A;  2F9Z C;  2I6D A;  5IYZ B;  2ZVY A;  4U3J A;  5EIB D;  3E1Y A;  2I6R A;  2KG4 A;  1IV3 A;  4ZK7 A;  1YI2 F;  3EOR A;  3BYQ A;  3PLA C;  3CCQ F;  1W59 A;  2AIZ P;  3IMP A;  4O4H A;  2GZL A;  1H47 A;  4BVT A;  4BY9 D;  3D00 A;  1YIT F;  3IEQ A;  3LFO A;  3P0Z A;  4ZHW A;  5ITZ A;  3CCR F;  1JJ2 F;  1VQ7 F;  3JAL B;  5JCO C;  3CYP B;  1TVK B;  3CCU F;  2RHJ A;  4F6R B;  1YJ9 F;  1W3E X;  4O4L B;  5IJ9 B;  3JAM M;  1XV2 A;  3KJK A;  1S72 F;  2RHL A;  2CHT A;  3F6M A;  4DRX A;  2N48 A;  3G4S F;  3M84 A;  2YXZ A;  3WPX A;  3CC4 F;  4X1K A;  2OTM A;  3WGK A;  5HY2 A;  2BTU A;  2ZF8 A;  4BT2 A;  1RQ2 A;  1SA0 A;  2OTL F;  5EB1 B;  5J2U A;  3SIU A;  4G4V A;  3JAT B;  3G6E F;  3SIV A;  1TUB B;  4HNA A;  3HKE B;  4IHJ B;  5KX5 B;  1XRG A;  2NMU A;  1W40 A;  5CA0 A;  1H7M A;  2JNB A;  3VOA A;  2CSL A;  4DXD A;  4LCK A;  2Z1E A;  3C8L A;  2W8B C;  3OBW A;  1VK3 A;  5FLX M;  5LP6 B;  4I55 A;  4YJ3 A;  2ALE A;  1ZWZ A;  2ZVZ A;  3JAW A;  1XBI A;  1VQV A;  2GVI A;  1COM A;  4I4T B;  5HXU A;  3N2G A;  1CN7 A;  3ESJ A;  3LYB A;  5EIB C;  1CLI A;  5MN4 A;  3LWO C;  1UFY A;  4O2A B;  2PMP A;  5KMG A;  4XCQ A;  4E6E A;  2H8C A;  3P10 A;  3N4Z A;  2UYN B;  3E22 A;  1CK2 A;  4X1Y A;  5HY0 A;  2LBT A;  3N2K A;  4C8E A;  2UYJ A;  4ZHY B;  4X1I A;  5IJ0 A;  1E7K A;  5MN6 A;  3FPI A;  5HP8 A;  3N4Y A;  1ODE A;  2HP3 A;  3S02 A;  4C82 A;  3FFM A;  3CCV F;  3PAF A;  3V4D A;  4I50 A;  4O2B A;  3MCA B;  5JVD B;  3E20 B;  3J81 M;  3VYS C;  3JAK A;  4BT5 A;  2DT4 A;  1FSZ A;  4U3J B;  2UYP A;  3ELC A;  5HY4 A;  4NQ3 A;  3NK6 A;  4KWE A;  3HKB A;  3TD3 A;  3C9R A;  1DT9 A;  3IR9 A;  4G4Y A;  2VGM A;  3ZO8 A;  2Z1F A;  4WBN B;  1SDS A;  2HP0 B;  2UYK A;  1QD9 A;  1W42 A;  1RA4 A;  3P4E A;  4C8I A;  3JAL A;  4B46 A;  3F0F A;  4IIJ B;  5GIN C;  1K73 H;  4O4J A;  5MN5 A;  1GO1 A;  4O4L A;  4NUT A;  5IJ9 A;  4X20 B;  4DRX B;  3CME F;  4X1K B;  2HS3 A;  3OBY A;  2Z1U A;  3KHN A;  3OON A;  3S0Y A;  3K14 A;  1KD1 H;  1KQS F;  3FD6 A;  5B8F A;  3FBA A;  1T0A A;  2OZB A;  3RYI B;  2VXY A;  4B62 A;  3JAT A;  2R75 1;  5HY1 A;  1Q82 H;  5A2Q M;  2QEX F;  3HKE A;  4ZHQ A;  3CCJ F;  4TV9 B;  5C8Y A;  1KNJ A;  4R40 B;  4ZHV A;  5LOV B;  5LA6 B;  4C4W C;  5EYP B;  4EB6 B;  5LP6 A;  3I7T A;  2EWC A;  3C9T A;  1QAH A;  4YJ3 B;  5EZY B;  3RYF B;  5LXT A;  5EAZ A;  3NK7 A;  2HS0 A;  1U3P A;  3ERN A;  5GON A;  5JCO A;  2V9Y A;  1IPA A;  5IT9 M;  3LWP C;  1OAP A;  5GAN K;  1VQM F;  1X7P A;  3HJW C;  1UI9 A;  2UYN A;  4O4I A;  1U43 A;  2UZH A;  4YJ2 B;  1W58 1;  1FNK A;  1NMU B;  4X1Y B;  3IEW A;  2LBX A;  3FD5 A;  4O4H B;  2ZAU A;  1GZ0 A;  3CPQ A;  4LNU B;  1U40 A;  2B33 A;  3VMF B;  3JAS B;  3VO8 A;  1JFF B;  3LDT A;  4B45 A;  5HWE A;  1W5B A;  3U0O A;  2CVL A;  2RB9 A;  3RYC B;  5GIP C;  1VQK F;  3F0D A;  4FFB A;  4G4X A;  1PF5 A;  1VH8 A;  1YHQ F;  1W55 A;  3QHD A;  2ZOD A;  2VAM A;  3CCL F;  2CHS A;  1KNK A;  3O85 A;  4I50 B;  1YJN F;  3WJP A;  4RQO A;  3WGJ A;  3WJR A;  3JVH A;  3B6N A;  3G71 F;  2L26 A;  3JAK B;  2QI2 A;  4G88 A;  3TD4 A;  5J2U B;  1VQ5 F;  3VIU A;  3HKB B;  2QA4 F;  3HAX D;  2ZOV A;  5G4U C;  1Z5W A;  5KX5 A;  2HP0 A;  2RHH A;  2HRU A;  5G4V C;  5JH7 B;  4U39 A;  1Q7Y H;  5LYJ B;  5GAP K;  5CA1 A;  3CPW F;  4I4T A;  3Q8H A;  3V3T A;  4ZI7 B;  5CB4 B;  1YGY A;  2FGY A;  4C81 A;  1K8A H;  1OFU A;  1W5E A;  4G4W A;  3LWR C;  3F0E A;  3TD5 A;  3S0W A;  5DCV A;  5KMG B;  3RA6 A;  3I55 F;  3VTI C;  1IV4 A;  1IV2 A;  2BTO A;  1W57 A;  3CCE F;  1NQ3 A;  1VQ4 F;  1VQ6 F;  1VQO F;  2HS4 A;  5JQG B;  4EI9 A;  4ZHQ B;  3CC2 F;  3T80 A;  3N2K B;  4TV9 A;  5C8Y B;  1VQP F;  4TZZ A;  1W5F A;  3CB2 A;  4BT4 A;  3CMA F;  1VHA A;  4EB6 A;  4TV8 A;  2OHW A;  3WGL A;  3RYF A;  3HKD A;  4BT7 A;  4TUY B;  3KE1 A;  1KC8 H;  3J7A R;  3UT5 A;  5BMV A;  3MCQ A;  1JN1 A;  4O2B B;  2RHO A;  3M1X A;  2LBW A;  3C9S A;  4G4Z A;  2HVY D;  3VCZ A;  5IYZ A;  1GX1 A;  4O4I B;  3ZP7 A;  1DBF A;  3HWU A;  3CCS F;  1Q86 H;  3JCM M;  3S0H A;  3I56 F;  3DDN A;  3RYH B;  2YYE A;  5FNV A;  1X52 A;  2AIF A;  3ON1 A;  3QUW A;  2Q1X A;  4LNU A;  3C9U A;  3WXM B;  1N8R H;  4ERH A;  1JFF A;  1JY8 A;  1K9M H;  1W2B F;  3RYC A;  3D54 A;  4O4J B;  1TVK A;  3I3F A;  3MQW A;  1Q81 H;  4FFB B;  1FNJ A;  4RHA A;  3V7E A;  3VYT C;  2P6Y A;  3CC7 F;  4B5C A;  1W5A A;  3IKE A;  3KIZ A;  3LWQ C;  5LP6 C;  1SA0 B;  2IG8 A;  2MQE A;  3S03 A;  2G9I A;  1FFX A;  2HQS C;  1YIJ F;  3RA5 A;  3K2X A;  1TUB A;  3GHZ A;  4EI7 A;  4IHJ A;  1Q8R A;  1Z5V A;  2Z01 A;  5CA0 B;  1VQL F;  2OTJ F;  1RQ7 A;  2Z1T A;  3CYQ A;  5EO3 A;  5LOV A;  5J2T B;  4BVR A;  5CA1 B;  4X3M A;  4ZOL A;  3D01 A;  2H8E A;  1RLG A;  3VI6 A;  3CD6 F;  2LCA A;  2QTP A;  3CCM F;  3NVI B;  2R6R 1;  4BT3 A;  5CB4 A;  3J80 M;  3HKC B;  1YJW F;  3JAR A;  2IQQ A;  2GLZ A;  3VOB A;  1U3L A;  2AMT A;  3WGN A;  1X25 A;  4O2A A;  3QTY A;  3R0P A;  2K1S A;  3MDO A;  3NMU C;  3NVK E;  3CG6 A;  3WGM A;  3ZOP A;  4YJ2 A; 
#chains in the Genus database with same CATH homology
 4G4W A;  4G88 A;  3TD4 A;  4ZHV A;  3TD5 A;  3S0W A;  4ZHW A;  2ZOV A;  3CYQ A;  3CYP B;  5EB0 A;  3WPW A;  4RHA A;  1R1M A;  3LDT A;  3S06 A;  5EAZ A;  2LCA A;  3KHN A;  3OON A;  2LBT A;  4PWT A;  4G4Z A;  4ZHY B;  3S0Y A;  2W8B C;  4G4X A;  3TD3 A;  4B5C A;  4G4Y A;  2N48 A;  2ZVZ A;  3S0H A;  3WPX A;  4B62 A;  2ZVY A;  1OAP A;  3S02 A;  2MQE A;  3S03 A;  2ZF8 A;  2KGW A;  2HQS C;  2K1S A;  2L26 A;  5EB1 B;  4ERH A;  4R40 B;  2AIZ P;  3IMP A;  4G4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...