3TD3A

Crystal structure of ompa-like domain from acinetobacter baumannii in complex with glycine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
120
structure length
120
Chain Sequence
MELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLNERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of anchoring of OmpA protein to the cell wall peptidoglycan of the gram-negative bacterial outer membrane
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Membrane protein,peptide binding protein
molecule keywords Outer membrane protein omp38
total genus 39
structure length 120
sequence length 120
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3td3A00
2AIZP 3IMPA 1OAPA 2ZF8A 5EB1B 4G88A 4G4XA 4B62A 4ZHVA 2HQSC 3WPWA 4G4YA 3CYPB 4RHAA 4PWTA 2ZVZA 4ZHWA 4B5CA 2N48A 4ERHA 4ZHYB 2LBTA 3TD5A 3S02A 3CYQA 2ZVYA 2MQEA 2LCAA 4R40B 2KGWA 2ZOVA 3WPXA 3S0WA 1R1MA 2L26A 4G4ZA 4G4VA 3LDTA 3S06A 2K1SA 3KHNA 3S0HA 4G4WA 5EAZA 5EB0A 3S0YA 3TD4A 2W8BC 3OONA 3S03A 3TD3A
chains in the Genus database with same CATH superfamily
1OAPA 5JVDA 3K0TA 1H48A 3GYQA 5EB1B 5CA1B 5ITZB 4B62A 3E1YA 3E22B 3CCSF 5LYJA 1RA4A 1SA0A 3VTIC 1GO0A 4ERHA 3E20B 4NWOB 5LOVA 1U3LA 3FD5A 1SZQA 3C9UA 3OBWA 4G4ZA 1XV2A 1PXWA 3MQWA 3IKFA 3ZO8A 3C9TA 2HS3A 3CCUF 1RLUA 1KQSF 3N4ZA 2VAWA 3D54A 3VCZA 2R751 3IMPA 3IKEA 2EWCA 2VAMA 2R6R1 3F0DA 3F0EA 5ITZA 4PWTA 1SA0B 2H8EA 5FNVB 5LYJB 3S02A 2PHNA 4ZI7A 4O4LB 3FBAA 4BVSA 2IG8A 1VQNF 2KGWA 1XRGA 5GONA 1T0KB 5EIBD 2UZHA 3N4YA 1YJNF 1W41A 1NMUB 1VQOF 1YHQF 1M90H 4IIJB 1W40A 3RYIA 2AIZP 3K14A 1W57A 3PAFA 3CCEF 1JD1A 1Q8RA 1JY8A 4C8IA 1JFFA 3WJPA 1DBFA 4BT7A 1VQ7F 1X7PA 1Z5WA 4O2BB 1Q82H 1IV1A 1TUBB 2CSLA 3VO8A 4NUTA 5J2TB 5GAPK 1KD1H 4TV9A 4EI8A 1IV2A 2Z1FA 2UYPA 3OONA 2CZWA 1IV4A 3F6MA 4B45A 3IR9A 1UI9A 4IHJB 1YI2F 2HX0A 3P0ZA 4YJ3B 3HKEA 1YITF 3LMEA 3M84A 5IT9M 3KJKA 1W5AA 3SIVA 3FD6A 2QTPA 4F6RB 4G4VA 5JQGB 3CC7F 4U3JA 1FFXB 2H8CA 3N2KA 2YYEA 2FGYA 3C9SA 2Z01A 1T0AA 3N2GA 4WBNB 2HVYD 3LWOC 2HS0A 2V9YA 2RHJA 4U39A 4TUYB 5GANK 3JALB 3RYIB 1H7MA 3HKEB 2I6DA 2ZVYA 3VIUA 5J2UB 4E6EA 4BT6A 1U3PA 2CHTA 4BVRA 2QA4F 2H6LA 1YIJF 1ZWZA 4O4JA 3HKDB 5LXTA 1QD9A 1S72F 4RQOA 3WXMB 2FC3A 1M1KH 3S03A 3I55F 5HWEA 5JCOC 3LWRC 5EWRA 3VYUC 2OTJF 5JH7B 2WALA 3HWUA 3GTZA 4TV9B 4ZK7A 2HRYA 5HY1A 3CYPB 5FLXM 3RYCB 1VQ9F 5G4UC 2LBTA 4YJ2B 3LFOA 3JAWB 3WGJA 1X25A 5KX5A 5IJ9A 1ODEA 1GZ0A 2Z1EA 4I50B 1NQ3A 2L26A 3FPIA 3PLAC 2ZAUA 1FNKA 3I3FA 4X1KB 5LOVB 2CWJA 4O2AA 4ZHQA 3CC2F 3KHNA 4X20A 5HXUA 4BT4A 1KNJA 2GZLA 3VYTC 4WBNA 3K12A 1U40A 4G4XA 2HQSC 1W5EA 4RHAA 1JN1A 5JH7A 2QEXF 4ZHWA 2ALEA 5GIOC 1H47A 4ZHYB 5CB4B 3VYSC 3WJQA 1VQLF 3JASB 4HNAA 3VMFB 1GX1A 1Q81H 3P10A 2HP0B 3F0GA 1PF5A 1VQMF 4X1IA 1VQ4F 5EO3A 3JARB 3RE3A 1XBIA 3LWQC 1X7OA 5HY4A 3DDNA 3J7AR 1YQNA 1CK2A 5EZYB 1Q7YH 2ZODA 4TV8B 4HNAB 1VQVA 1JJ2F 3TD3A 1CN7A 3FFMA 1RQ7A 4I55B 3KE1A 4DRXA 1IPAA 3CCRF 5DCVA 5KMGB 3VOBA 3QTYA 1W42A 5EIBC 2KTVA 5HXZA 3D00A 1VQPF 2LCAA 3CCVF 5JQGA 5HP7A 1W5BA 5IYZA 5CA0B 4KWEA 4BT3A 4FFBB 2VGMA 3QUWA 5GINC 3P4EA 3BYQA 2CHSA 3JAWA 4ZOLB 3NVIB 1E7KA 1FNJA 4G88A 3O85A 1YJWF 5GIPC 5AVMA 1W2BF 3ZP4A 5EYPA 3T80A 5J2TA 5IJ0A 3HKDA 1U43A 2KG4A 2HS4A 3S06A 3ERNA 4O4JB 5LXTB 5FJ4C 5EB0A 3VOAA 2GLZA 3HKCB 3ESJA 3IEQA 4X1KA 3ZP7A 3RYFB 1NJIH 4ZOLA 5IJ0B 2OTLF 2RHHA 3CCQF 3AGKA 4IHJA 1FSZA 3LYBA 2ZVZA 3NMUC 2IAFA 3EORA 3CCJF 3TD5A 3CC4F 3C9RA 2JNBA 3JAMM 3NK7A 4IIJA 3G4SF 2AIFA 5KX5B 3S0WA 1R1MA 3CB2A 4EI7A 1W55A 3LWPC 2QI2A 3ZOPA 2AMTA 2YXZA 5FNVA 5LA6A 4C4WC 4O4IA 5EAZA 2RB9A 4X3LA 1K9MH 3CMAF 1DT9A 5MN6A 2Q1YA 2VGNA 3M1XA 3D01A 1W3EX 3B6NA 4G4YA 3JVHA 3L7QA 4X1YA 3UT5B 3RYHB 3M4SA 4LCKA 4BVQA 1KC8H 5LP6B 3CMEF 1W59A 4LNUB 3E22A 3G6EF 1VK3A 3KJJA 2K1SA 4YJ2A 1OFUA 3G71F 4BY9D 3MDOA 2F9ZC 2RHOA 3S0HA 3SIUA 4C82A 3R0PA 3N2GB 3VI6A 3J80M 3ELCA 1QU9A 3U0OA 5LP6C 1COMA 1W581 4X20B 1FFXA 1JFFB 1Z5VA 5G4VC 3HKBB 1SDSA 3NVKE 3JATB 2DYYA 1TVKA 2OTMA 5LP6A 4FFBA 4O2AB 4ZHQB 1IV3A 4G4WA 1K73H 4XCQA 2UYJA 1K8AH 2BTOA 5HP8A 4O4LA 3V3TA 5C8YA 3JATA 2ZF8A 3JCMM 4DXDA 2OHWA 2UYKA 3WGKA 5LA6B 3HAXD 4BVTA 2LBXA 3CYQA 4I4TB 4O2BA 4O4IB 4R40B 4C81A 1ONIA 4I55A 2DT4A 3WPXA 3CPWF 5EYPB 5B8FA 5KMGA 3ON1A 4LNUA 4F6RA 2B33A 4EI9A 3OW2F 5JCOA 3JALA 1QAHA 5EZYA 3NK6A 2G9IA 2W8BC 2UYNA 4TV8A 4C8EA 4O4HA 3RYHA 2BTUA 1QVGF 4M8IA 3V7EA 2BO1A 2I6RA 4TUYA 2OZBA 3JAKA 3I7TA 5CB4A 3CCMF 4B5CA 3K2XA 2HP0A 3JASA 2MQEA 3JARA 4ZI7B 1YJ9F 2Z1UA 3CG6A 3V4DA 2IQQA 5GONB 5MN4A 2GVIA 2Z1TA 2BTQB 2HRUA 3HTNA 3OBYA 3JAKB 1VH8A 3Q8HA 4NQ3A 1X52A 1YGYA 1VQ8F 1VQ6F 4YJ3A 5A2QM 5MN5A 4O4HB 3WGNA 3QHDA 2UYNB 4I50A 4TZZA 4DRXB 5C8YB 3J81M 1VQ5F 3CPQA 4BT2A 1VHAA 5HY2A 4ZHVA 2NMUA 1TVKB 4C8GA 4EB6B 3WGLA 3MBMA 1J7HA 1RQ2A 1XHOA 1Q86H 5HY0A 3MCAB 5IJ9B 3KIZA 3WGMA 5IYZB 5BMVA 3V7QA 3CXCF 1TUBA 3LDTA 5CA0A 3MCQA 3RYFA 1CLIA 3GHZA 2CVLA 2RHLA 2VAPA 4BW0B 3LWVC 3TD4A 3HKCA 4I4TA 3I56F 2VXYA 5CA1A 3RA5A 5BMVB 5JVDB 1KNKA 5J2UA 2HP3A 2CW4A 3WPWA 3RA6A 4EB6A 3HJWC 3WJRA 2N48A 4BT5A 3CD6F 2KTUA 3C8LA 3F0FA 1GO1A 2ZOVA 4B46A 1QVFF 1N8RH 4X1IB 2LBWA 1VQKF 2PMPA 3HKBA 4X1YB 2Q1XA 2P6YA 3N2KB 1UFYA 3UT5A 3IEWA 4U3JB 3S0YA 3RYCA 3CCLF 4X3MA 1W5FA 1RLGA 3DC2A
chains in the Genus database with same CATH topology
2AIZP 3IMPA 1OAPA 2ZF8A 5EB1B 4G88A 4G4XA 4B62A 4ZHVA 2HQSC 3WPWA 4G4YA 3CYPB 4RHAA 4PWTA 2ZVZA 4ZHWA 4B5CA 2N48A 4ERHA 4ZHYB 2LBTA 3TD5A 3S02A 3CYQA 2ZVYA 2MQEA 2LCAA 4R40B 2KGWA 2ZOVA 3WPXA 3S0WA 1R1MA 2L26A 4G4ZA 4G4VA 3LDTA 3S06A 2K1SA 3KHNA 3S0HA 4G4WA 5EAZA 5EB0A 3S0YA 3TD4A 2W8BC 3OONA 3S03A 3TD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AIZ P;  3IMP A;  1OAP A;  2ZF8 A;  5EB1 B;  4G88 A;  4G4X A;  4B62 A;  4ZHV A;  2HQS C;  3WPW A;  4G4Y A;  3CYP B;  4RHA A;  4PWT A;  2ZVZ A;  4ZHW A;  4B5C A;  2N48 A;  4ERH A;  4ZHY B;  2LBT A;  3TD5 A;  3S02 A;  3CYQ A;  2ZVY A;  2MQE A;  2LCA A;  4R40 B;  2KGW A;  2ZOV A;  3WPX A;  3S0W A;  1R1M A;  2L26 A;  4G4Z A;  4G4V A;  3LDT A;  3S06 A;  2K1S A;  3KHN A;  3S0H A;  4G4W A;  5EAZ A;  5EB0 A;  3S0Y A;  3TD4 A;  2W8B C;  3OON A;  3S03 A;  3TD3 A; 
#chains in the Genus database with same CATH topology
 1OAP A;  5JVD A;  3K0T A;  1H48 A;  3GYQ A;  5EB1 B;  5CA1 B;  5ITZ B;  4B62 A;  3E1Y A;  3E22 B;  3CCS F;  5LYJ A;  1RA4 A;  1SA0 A;  3VTI C;  1GO0 A;  4ERH A;  3E20 B;  4NWO B;  5LOV A;  1U3L A;  3FD5 A;  1SZQ A;  3C9U A;  3OBW A;  4G4Z A;  1XV2 A;  1PXW A;  3MQW A;  3IKF A;  3ZO8 A;  3C9T A;  2HS3 A;  3CCU F;  1RLU A;  1KQS F;  3N4Z A;  2VAW A;  3D54 A;  3VCZ A;  2R75 1;  3IMP A;  3IKE A;  2EWC A;  2VAM A;  2R6R 1;  3F0D A;  3F0E A;  5ITZ A;  4PWT A;  1SA0 B;  2H8E A;  5FNV B;  5LYJ B;  3S02 A;  2PHN A;  4ZI7 A;  4O4L B;  3FBA A;  4BVS A;  2IG8 A;  1VQN F;  2KGW A;  1XRG A;  5GON A;  1T0K B;  5EIB D;  2UZH A;  3N4Y A;  1YJN F;  1W41 A;  1NMU B;  1VQO F;  1YHQ F;  1M90 H;  4IIJ B;  1W40 A;  3RYI A;  2AIZ P;  3K14 A;  1W57 A;  3PAF A;  3CCE F;  1JD1 A;  1Q8R A;  1JY8 A;  4C8I A;  1JFF A;  3WJP A;  1DBF A;  4BT7 A;  1VQ7 F;  1X7P A;  1Z5W A;  4O2B B;  1Q82 H;  1IV1 A;  1TUB B;  2CSL A;  3VO8 A;  4NUT A;  5J2T B;  5GAP K;  1KD1 H;  4TV9 A;  4EI8 A;  1IV2 A;  2Z1F A;  2UYP A;  3OON A;  2CZW A;  1IV4 A;  3F6M A;  4B45 A;  3IR9 A;  1UI9 A;  4IHJ B;  1YI2 F;  2HX0 A;  3P0Z A;  4YJ3 B;  3HKE A;  1YIT F;  3LME A;  3M84 A;  5IT9 M;  3KJK A;  1W5A A;  3SIV A;  3FD6 A;  2QTP A;  4F6R B;  4G4V A;  5JQG B;  3CC7 F;  4U3J A;  1FFX B;  2H8C A;  3N2K A;  2YYE A;  2FGY A;  3C9S A;  2Z01 A;  1T0A A;  3N2G A;  4WBN B;  2HVY D;  3LWO C;  2HS0 A;  2V9Y A;  2RHJ A;  4U39 A;  4TUY B;  5GAN K;  3JAL B;  3RYI B;  1H7M A;  3HKE B;  2I6D A;  2ZVY A;  3VIU A;  5J2U B;  4E6E A;  4BT6 A;  1U3P A;  2CHT A;  4BVR A;  2QA4 F;  2H6L A;  1YIJ F;  1ZWZ A;  4O4J A;  3HKD B;  5LXT A;  1QD9 A;  1S72 F;  4RQO A;  3WXM B;  2FC3 A;  1M1K H;  3S03 A;  3I55 F;  5HWE A;  5JCO C;  3LWR C;  5EWR A;  3VYU C;  2OTJ F;  5JH7 B;  2WAL A;  3HWU A;  3GTZ A;  4TV9 B;  4ZK7 A;  2HRY A;  5HY1 A;  3CYP B;  5FLX M;  3RYC B;  1VQ9 F;  5G4U C;  2LBT A;  4YJ2 B;  3LFO A;  3JAW B;  3WGJ A;  1X25 A;  5KX5 A;  5IJ9 A;  1ODE A;  1GZ0 A;  2Z1E A;  4I50 B;  1NQ3 A;  2L26 A;  3FPI A;  3PLA C;  2ZAU A;  1FNK A;  3I3F A;  4X1K B;  5LOV B;  2CWJ A;  4O2A A;  4ZHQ A;  3CC2 F;  3KHN A;  4X20 A;  5HXU A;  4BT4 A;  1KNJ A;  2GZL A;  3VYT C;  4WBN A;  3K12 A;  1U40 A;  4G4X A;  2HQS C;  1W5E A;  4RHA A;  1JN1 A;  5JH7 A;  2QEX F;  4ZHW A;  2ALE A;  5GIO C;  1H47 A;  4ZHY B;  5CB4 B;  3VYS C;  3WJQ A;  1VQL F;  3JAS B;  4HNA A;  3VMF B;  1GX1 A;  1Q81 H;  3P10 A;  2HP0 B;  3F0G A;  1PF5 A;  1VQM F;  4X1I A;  1VQ4 F;  5EO3 A;  3JAR B;  3RE3 A;  1XBI A;  3LWQ C;  1X7O A;  5HY4 A;  3DDN A;  3J7A R;  1YQN A;  1CK2 A;  5EZY B;  1Q7Y H;  2ZOD A;  4TV8 B;  4HNA B;  1VQV A;  1JJ2 F;  3TD3 A;  1CN7 A;  3FFM A;  1RQ7 A;  4I55 B;  3KE1 A;  4DRX A;  1IPA A;  3CCR F;  5DCV A;  5KMG B;  3VOB A;  3QTY A;  1W42 A;  5EIB C;  2KTV A;  5HXZ A;  3D00 A;  1VQP F;  2LCA A;  3CCV F;  5JQG A;  5HP7 A;  1W5B A;  5IYZ A;  5CA0 B;  4KWE A;  4BT3 A;  4FFB B;  2VGM A;  3QUW A;  5GIN C;  3P4E A;  3BYQ A;  2CHS A;  3JAW A;  4ZOL B;  3NVI B;  1E7K A;  1FNJ A;  4G88 A;  3O85 A;  1YJW F;  5GIP C;  5AVM A;  1W2B F;  3ZP4 A;  5EYP A;  3T80 A;  5J2T A;  5IJ0 A;  3HKD A;  1U43 A;  2KG4 A;  2HS4 A;  3S06 A;  3ERN A;  4O4J B;  5LXT B;  5FJ4 C;  5EB0 A;  3VOA A;  2GLZ A;  3HKC B;  3ESJ A;  3IEQ A;  4X1K A;  3ZP7 A;  3RYF B;  1NJI H;  4ZOL A;  5IJ0 B;  2OTL F;  2RHH A;  3CCQ F;  3AGK A;  4IHJ A;  1FSZ A;  3LYB A;  2ZVZ A;  3NMU C;  2IAF A;  3EOR A;  3CCJ F;  3TD5 A;  3CC4 F;  3C9R A;  2JNB A;  3JAM M;  3NK7 A;  4IIJ A;  3G4S F;  2AIF A;  5KX5 B;  3S0W A;  1R1M A;  3CB2 A;  4EI7 A;  1W55 A;  3LWP C;  2QI2 A;  3ZOP A;  2AMT A;  2YXZ A;  5FNV A;  5LA6 A;  4C4W C;  4O4I A;  5EAZ A;  2RB9 A;  4X3L A;  1K9M H;  3CMA F;  1DT9 A;  5MN6 A;  2Q1Y A;  2VGN A;  3M1X A;  3D01 A;  1W3E X;  3B6N A;  4G4Y A;  3JVH A;  3L7Q A;  4X1Y A;  3UT5 B;  3RYH B;  3M4S A;  4LCK A;  4BVQ A;  1KC8 H;  5LP6 B;  3CME F;  1W59 A;  4LNU B;  3E22 A;  3G6E F;  1VK3 A;  3KJJ A;  2K1S A;  4YJ2 A;  1OFU A;  3G71 F;  4BY9 D;  3MDO A;  2F9Z C;  2RHO A;  3S0H A;  3SIU A;  4C82 A;  3R0P A;  3N2G B;  3VI6 A;  3J80 M;  3ELC A;  1QU9 A;  3U0O A;  5LP6 C;  1COM A;  1W58 1;  4X20 B;  1FFX A;  1JFF B;  1Z5V A;  5G4V C;  3HKB B;  1SDS A;  3NVK E;  3JAT B;  2DYY A;  1TVK A;  2OTM A;  5LP6 A;  4FFB A;  4O2A B;  4ZHQ B;  1IV3 A;  4G4W A;  1K73 H;  4XCQ A;  2UYJ A;  1K8A H;  2BTO A;  5HP8 A;  4O4L A;  3V3T A;  5C8Y A;  3JAT A;  2ZF8 A;  3JCM M;  4DXD A;  2OHW A;  2UYK A;  3WGK A;  5LA6 B;  3HAX D;  4BVT A;  2LBX A;  3CYQ A;  4I4T B;  4O2B A;  4O4I B;  4R40 B;  4C81 A;  1ONI A;  4I55 A;  2DT4 A;  3WPX A;  3CPW F;  5EYP B;  5B8F A;  5KMG A;  3ON1 A;  4LNU A;  4F6R A;  2B33 A;  4EI9 A;  3OW2 F;  5JCO A;  3JAL A;  1QAH A;  5EZY A;  3NK6 A;  2G9I A;  2W8B C;  2UYN A;  4TV8 A;  4C8E A;  4O4H A;  3RYH A;  2BTU A;  1QVG F;  4M8I A;  3V7E A;  2BO1 A;  2I6R A;  4TUY A;  2OZB A;  3JAK A;  3I7T A;  5CB4 A;  3CCM F;  4B5C A;  3K2X A;  2HP0 A;  3JAS A;  2MQE A;  3JAR A;  4ZI7 B;  1YJ9 F;  2Z1U A;  3CG6 A;  3V4D A;  2IQQ A;  5GON B;  5MN4 A;  2GVI A;  2Z1T A;  2BTQ B;  2HRU A;  3HTN A;  3OBY A;  3JAK B;  1VH8 A;  3Q8H A;  4NQ3 A;  1X52 A;  1YGY A;  1VQ8 F;  1VQ6 F;  4YJ3 A;  5A2Q M;  5MN5 A;  4O4H B;  3WGN A;  3QHD A;  2UYN B;  4I50 A;  4TZZ A;  4DRX B;  5C8Y B;  3J81 M;  1VQ5 F;  3CPQ A;  4BT2 A;  1VHA A;  5HY2 A;  4ZHV A;  2NMU A;  1TVK B;  4C8G A;  4EB6 B;  3WGL A;  3MBM A;  1J7H A;  1RQ2 A;  1XHO A;  1Q86 H;  5HY0 A;  3MCA B;  5IJ9 B;  3KIZ A;  3WGM A;  5IYZ B;  5BMV A;  3V7Q A;  3CXC F;  1TUB A;  3LDT A;  5CA0 A;  3MCQ A;  3RYF A;  1CLI A;  3GHZ A;  2CVL A;  2RHL A;  2VAP A;  4BW0 B;  3LWV C;  3TD4 A;  3HKC A;  4I4T A;  3I56 F;  2VXY A;  5CA1 A;  3RA5 A;  5BMV B;  5JVD B;  1KNK A;  5J2U A;  2HP3 A;  2CW4 A;  3WPW A;  3RA6 A;  4EB6 A;  3HJW C;  3WJR A;  2N48 A;  4BT5 A;  3CD6 F;  2KTU A;  3C8L A;  3F0F A;  1GO1 A;  2ZOV A;  4B46 A;  1QVF F;  1N8R H;  4X1I B;  2LBW A;  1VQK F;  2PMP A;  3HKB A;  4X1Y B;  2Q1X A;  2P6Y A;  3N2K B;  1UFY A;  3UT5 A;  3IEW A;  4U3J B;  3S0Y A;  3RYC A;  3CCL F;  4X3M A;  1W5F A;  1RLG A;  3DC2 A; 
#chains in the Genus database with same CATH homology
 2AIZ P;  3IMP A;  1OAP A;  2ZF8 A;  5EB1 B;  4G88 A;  4G4X A;  4B62 A;  4ZHV A;  2HQS C;  3WPW A;  4G4Y A;  3CYP B;  4RHA A;  4PWT A;  2ZVZ A;  4ZHW A;  4B5C A;  2N48 A;  4ERH A;  4ZHY B;  2LBT A;  3TD5 A;  3S02 A;  3CYQ A;  2ZVY A;  2MQE A;  2LCA A;  4R40 B;  2KGW A;  2ZOV A;  3WPX A;  3S0W A;  1R1M A;  2L26 A;  4G4Z A;  4G4V A;  3LDT A;  3S06 A;  2K1S A;  3KHN A;  3S0H A;  4G4W A;  5EAZ A;  5EB0 A;  3S0Y A;  3TD4 A;  2W8B C;  3OON A;  3S03 A;  3TD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...