3TD3A

Crystal structure of ompa-like domain from acinetobacter baumannii in complex with glycine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
120
structure length
120
Chain Sequence
b'MELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLNERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein omp38
publication title Mechanism of anchoring of OmpA protein to the cell wall peptidoglycan of the gram-negative bacterial outer membrane
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Membrane protein,peptide binding protein
total genus 39
structure length 120
sequence length 120
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3td3A00
4ZHWA 3LDTA 4G4VA 4ZHYB 3S02A 2KGWA 2HQSC 3TD5A 4ERHA 5EAZA 2LCAA 3TD3A 3WPXA 2ZVZA 3CYQA 2ZOVA 4G4YA 3S0HA 2L26A 4ZHVA 3OONA 3KHNA 4G4WA 4PWTA 3S0YA 5EB0A 3CYPB 4RHAA 2N48A 2ZVYA 2MQEA 1OAPA 4G4ZA 4B5CA 3TD4A 4G4XA 2AIZP 2ZF8A 3IMPA 3S03A 2K1SA 5EB1B 2LBTA 1R1MA 3S06A 4R40B 3S0WA 3WPWA 2W8BC 4G88A 4B62A
chains in the Genus database with same CATH superfamily
1VQ6F 2HP0A 1W55A 5HXUA 5JVDA 2L26A 2CHTA 3LFOA 5EYPA 1H7MA 3S0YA 4X1KA 1XHOA 3LMEA 1IV3A 2OTJF 1GZ0A 4O4HA 5GONA 2IQQA 3CD6F 4HNAA 5J2TB 4I55B 3NVKE 5LXTA 3RE3A 2H8CA 3O85A 1Q82H 4M8IA 3JAKA 3QTYA 5G4VC 3N2GB 1TVKB 1R1MA 3R0PA 3JATB 3OBWA 3RYFA 5MN4A 1U3PA 2DT4A 3I7TA 3VI6A 5C8YB 5CB4A 5HXZA 3KJKA 2HP3A 1PF5A 2VGNA 3VYTC 5B8FA 1U43A 1QU9A 2KG4A 1RQ2A 3RA6A 3TD3A 2Z1FA 3BYQA 4YJ2B 4G4WA 5MN6A 1NMUB 5CA0A 4TUYA 5HP8A 2HRYA 2UYNB 2GVIA 1VQNF 2VXYA 3JAWB 5EIBC 2UYKA 4EB6A 2IG8A 4BT3A 3JALA 3I55F 5GANK 3JASB 1YJWF 3PAFA 3CPQA 1OFUA 4ZHWA 3JVHA 2HQSC 1IV2A 2UYNA 1VQ9F 1W41A 4BT5A 4X3MA 3D01A 3JAWA 2BTUA 4X1IB 5LOVA 1NQ3A 3E20B 4ZK7A 4XCQA 2ALEA 1ODEA 4WBNA 1UI9A 3D00A 1U40A 5KX5B 5LP6A 3CCLF 5JCOA 3J81M 5JH7B 2K1SA 3S06A 5EO3A 1M90H 5HY2A 4U3JA 3LWVC 2H6LA 4BT7A 2VAMA 2VGMA 1X7OA 3FD5A 3JARB 4G4YA 4O2BB 3HKBA 3K0TA 3RYIB 2VAWA 3C9RA 2CSLA 2HS3A 4RHAA 1Q81H 2N48A 3IKFA 1VQVA 3HAXD 5HY0A 2ZF8A 2PHNA 3CCVF 5EB1B 3IR9A 1W5EA 2LBTA 1RA4A 5HY4A 3E22A 4BT6A 3P4EA 4B46A 2JNBA 5BMVB 3VYSC 1IPAA 3RYIA 2NMUA 1YJ9F 3KJJA 4O4LA 2BTOA 3MCAB 3CYQA 2RHHA 3P10A 3S0HA 1VQ4F 2CWJA 2R6R1 3CCEF 1TUBA 4O2AA 4PWTA 3CCMF 2WALA 5JVDB 3WXMB 3CYPB 1YQNA 2BO1A 2YYEA 5ITZA 2HS0A 3C9UA 4O4IA 2Z01A 1W5BA 4X1KB 3F0GA 2QEXF 3VTIC 3F0FA 4HNAB 2QA4F 1VQ8F 2AMTA 5LXTB 1Z5WA 2QI2A 1UFYA 2Z1UA 3JAKB 4BVRA 3IKEA 3RYFB 3WGNA 3WJRA 1W59A 5CB4B 4X1YA 5FJ4C 3KHNA 3F0DA 1NJIH 5HWEA 1N8RH 3CCJF 1QD9A 2ZVYA 1X25A 2UYJA 3VO8A 5CA0B 4TUYB 3CPWF 3UT5A 1J7HA 4R40B 5KMGA 4G88A 4EB6B 4LCKA 3F6MA 3GHZA 4ZHYB 1XV2A 2KTVA 3JALB 1VQ5F 1KNJA 2RB9A 1DBFA 3FD6A 4YJ3A 5J2UA 1K8AH 1X52A 4X20B 2G9IA 1KNKA 5LYJA 3I56F 3VCZA 4ZHVA 4BVTA 2GLZA 3CC7F 3C9SA 4DRXB 3WGJA 1QVGF 1RLUA 2OHWA 3LWOC 3DC2A 4IIJB 2ZAUA 5LOVB 1FNJA 5GINC 3IMPA 1Q86H 1W57A 2AIFA 5JQGA 1QVFF 4I4TA 3V3TA 4WBNB 3S0WA 4X20A 5LP6B 4B62A 5CA1A 4B45A 2HVYD 1IV4A 1ZWZA 3TD5A 3LWQC 4DRXA 1Q8RA 4TV8A 3N2KA 2LCAA 3WPXA 5A2QM 2HS4A 1Q7YH 3MQWA 3QHDA 4U3JB 2GZLA 3L7QA 4BT4A 1VQ7F 5DCVA 4IIJA 3CC2F 2OTLF 3LWRC 3T80A 5IJ9B 4BVSA 4ZI7B 1JFFA 4U39A 2MQEA 4BW0B 5FNVA 3HKBB 2Q1XA 1JN1A 2UYPA 3N4YA 1KC8H 3CCSF 1E7KA 3LYBA 3S02A 3CMEF 2KTUA 3B6NA 3F0EA 3ESJA 4RQOA 3ZP4A 1W42A 5IJ9A 3CCUF 4ZI7A 3E22B 5GAPK 3FBAA 1H47A 2Z1EA 1JD1A 4O4LB 3GTZA 2HX0A 3TD4A 1TUBB 3HWUA 4O2AB 3J7AR 3WGLA 3HKEA 2VAPA 1T0KB 2QTPA 3QUWA 5ITZB 2CHSA 3HKDB 4NQ3A 4O4IB 3LDTA 3MDOA 3WGKA 3GYQA 3G71F 4ZHQB 5EIBD 1H48A 1FFXB 3VYUC 3WGMA 4EI9A 4I50A 3DDNA 4F6RA 4C8IA 4X1YB 1K9MH 3HKDA 5EZYB 4KWEA 3PLAC 5G4UC 2YXZA 5JCOC 3K14A 4ZHQA 2DYYA 2IAFA 2V9YA 1FFXA 1VQOF 5LA6A 3NK7A 2FGYA 4C82A 4C4WC 1VQKF 3UT5B 5EAZA 3HKCA 1ONIA 3C9TA 1U3LA 2UZHA 5KMGB 5HY1A 1Z5VA 4C81A 3JAMM 1RQ7A 1SA0A 3Q8HA 5EZYA 3P0ZA 4TV9A 4YJ3B 5J2UB 3CCRF 2LBXA 3K12A 1FNKA 5LYJB 4B5CA 3CC4F 2AIZP 1FSZA 3VOAA 5IJ0A 3RYCB 3WJPA 5GIOC 3WPWA 3U0OA 3ZP7A 1VQLF 4FFBA 2KGWA 4ERHA 1VH8A 1M1KH 3FPIA 3M4SA 5JQGB 1W2BF 4I4TB 1S72F 5CA1B 5IYZA 1KQSF 3VIUA 2OTMA 1GX1A 1W581 3VOBA 4TV8B 3N2KB 3RYCA 3ON1A 3RYHB 2Q1YA 1CK2A 1YHQF 4TZZA 3WJQA 3C8LA 1GO0A 2OZBA 1DT9A 1VQPF 1JFFB 2B33A 2W8BC 3ELCA 5FNVB 2RHLA 3CB2A 5J2TA 1COMA 1YGYA 4I55A 2R751 3RYHA 3CMAF 4BT2A 1IV1A 3I3FA 3M84A 3N2GA 1TVKA 2HRUA 3N4ZA 3ZOPA 3SIUA 3JATA 5FLXM 1OAPA 5C8YA 1YIJF 3LWPC 4LNUB 3NK6A 1W5FA 4C8GA 3RA5A 4NWOB 4YJ2A 3V4DA 2CW4A 3MCQA 1W3EX 2I6DA 3HKEB 1VQMF 3KE1A 5MN5A 3OONA 3V7EA 4X3LA 5EB0A 1W40A 1X7PA 4LNUA 3NMUC 3JASA 2CVLA 3VMFB 4G4ZA 4I50B 1RLGA 1VHAA 3IEWA 3FFMA 1K73H 3CG6A 1CLIA 3MBMA 1XRGA 5GIPC 3CXCF 3OBYA 4F6RB 3OW2F 3IEQA 4X1IA 3KIZA 2ZODA 2LBWA 3D54A 3HJWC 2ZVZA 3V7QA 2RHJA 5LA6B 3J80M 1VK3A 5KX5A 3G4SF 2Z1TA 5EWRA 2PMPA 3CCQF 3ZO8A 5JH7A 3NVIB 3HKCB 2FC3A 2F9ZC 4O4JB 1SA0B 4G4XA 1XBIA 2I6RA 5LP6C 4TV9B 1PXWA 1YITF 1YI2F 1T0AA 2H8EA 1SDSA 4ZOLB 3JARA 1YJNF 3M1XA 3G6EF 4O2BA 4EI8A 4G4VA 4IHJB 1JY8A 3AGKA 4EI7A 5IJ0B 1GO1A 1CN7A 1SZQA 3JCMM 2ZOVA 3EORA 4C8EA 4NUTA 2HP0B 4FFBB 5HP7A 4O4JA 2CZWA 1W5AA 4DXDA 5AVMA 2RHOA 4BVQA 2BTQB 1QAHA 2P6YA 4ZOLA 3SIVA 3HTNA 5EYPB 5BMVA 5IT9M 5IYZB 3S03A 4BY9D 4O4HB 5GONB 4IHJA 1JJ2F 3E1YA 1KD1H 4E6EA 2EWCA 3K2XA 3ERNA
chains in the Genus database with same CATH topology
4ZHWA 3LDTA 4G4VA 4ZHYB 3S02A 2KGWA 2HQSC 3TD5A 4ERHA 5EAZA 2LCAA 3TD3A 3WPXA 2ZVZA 3CYQA 2ZOVA 4G4YA 3S0HA 2L26A 4ZHVA 3OONA 3KHNA 4G4WA 4PWTA 3S0YA 5EB0A 3CYPB 4RHAA 2N48A 2ZVYA 2MQEA 1OAPA 4G4ZA 4B5CA 3TD4A 4G4XA 2AIZP 2ZF8A 3IMPA 3S03A 2K1SA 5EB1B 2LBTA 1R1MA 3S06A 4R40B 3S0WA 3WPWA 2W8BC 4G88A 4B62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHW A;  3LDT A;  4G4V A;  4ZHY B;  3S02 A;  2KGW A;  2HQS C;  3TD5 A;  4ERH A;  5EAZ A;  2LCA A;  3TD3 A;  3WPX A;  2ZVZ A;  3CYQ A;  2ZOV A;  4G4Y A;  3S0H A;  2L26 A;  4ZHV A;  3OON A;  3KHN A;  4G4W A;  4PWT A;  3S0Y A;  5EB0 A;  3CYP B;  4RHA A;  2N48 A;  2ZVY A;  2MQE A;  1OAP A;  4G4Z A;  4B5C A;  3TD4 A;  4G4X A;  2AIZ P;  2ZF8 A;  3IMP A;  3S03 A;  2K1S A;  5EB1 B;  2LBT A;  1R1M A;  3S06 A;  4R40 B;  3S0W A;  3WPW A;  2W8B C;  4G88 A;  4B62 A; 
#chains in the Genus database with same CATH topology
 1VQ6 F;  2HP0 A;  1W55 A;  5HXU A;  5JVD A;  2L26 A;  2CHT A;  3LFO A;  5EYP A;  1H7M A;  3S0Y A;  4X1K A;  1XHO A;  3LME A;  1IV3 A;  2OTJ F;  1GZ0 A;  4O4H A;  5GON A;  2IQQ A;  3CD6 F;  4HNA A;  5J2T B;  4I55 B;  3NVK E;  5LXT A;  3RE3 A;  2H8C A;  3O85 A;  1Q82 H;  4M8I A;  3JAK A;  3QTY A;  5G4V C;  3N2G B;  1TVK B;  1R1M A;  3R0P A;  3JAT B;  3OBW A;  3RYF A;  5MN4 A;  1U3P A;  2DT4 A;  3I7T A;  3VI6 A;  5C8Y B;  5CB4 A;  5HXZ A;  3KJK A;  2HP3 A;  1PF5 A;  2VGN A;  3VYT C;  5B8F A;  1U43 A;  1QU9 A;  2KG4 A;  1RQ2 A;  3RA6 A;  3TD3 A;  2Z1F A;  3BYQ A;  4YJ2 B;  4G4W A;  5MN6 A;  1NMU B;  5CA0 A;  4TUY A;  5HP8 A;  2HRY A;  2UYN B;  2GVI A;  1VQN F;  2VXY A;  3JAW B;  5EIB C;  2UYK A;  4EB6 A;  2IG8 A;  4BT3 A;  3JAL A;  3I55 F;  5GAN K;  3JAS B;  1YJW F;  3PAF A;  3CPQ A;  1OFU A;  4ZHW A;  3JVH A;  2HQS C;  1IV2 A;  2UYN A;  1VQ9 F;  1W41 A;  4BT5 A;  4X3M A;  3D01 A;  3JAW A;  2BTU A;  4X1I B;  5LOV A;  1NQ3 A;  3E20 B;  4ZK7 A;  4XCQ A;  2ALE A;  1ODE A;  4WBN A;  1UI9 A;  3D00 A;  1U40 A;  5KX5 B;  5LP6 A;  3CCL F;  5JCO A;  3J81 M;  5JH7 B;  2K1S A;  3S06 A;  5EO3 A;  1M90 H;  5HY2 A;  4U3J A;  3LWV C;  2H6L A;  4BT7 A;  2VAM A;  2VGM A;  1X7O A;  3FD5 A;  3JAR B;  4G4Y A;  4O2B B;  3HKB A;  3K0T A;  3RYI B;  2VAW A;  3C9R A;  2CSL A;  2HS3 A;  4RHA A;  1Q81 H;  2N48 A;  3IKF A;  1VQV A;  3HAX D;  5HY0 A;  2ZF8 A;  2PHN A;  3CCV F;  5EB1 B;  3IR9 A;  1W5E A;  2LBT A;  1RA4 A;  5HY4 A;  3E22 A;  4BT6 A;  3P4E A;  4B46 A;  2JNB A;  5BMV B;  3VYS C;  1IPA A;  3RYI A;  2NMU A;  1YJ9 F;  3KJJ A;  4O4L A;  2BTO A;  3MCA B;  3CYQ A;  2RHH A;  3P10 A;  3S0H A;  1VQ4 F;  2CWJ A;  2R6R 1;  3CCE F;  1TUB A;  4O2A A;  4PWT A;  3CCM F;  2WAL A;  5JVD B;  3WXM B;  3CYP B;  1YQN A;  2BO1 A;  2YYE A;  5ITZ A;  2HS0 A;  3C9U A;  4O4I A;  2Z01 A;  1W5B A;  4X1K B;  3F0G A;  2QEX F;  3VTI C;  3F0F A;  4HNA B;  2QA4 F;  1VQ8 F;  2AMT A;  5LXT B;  1Z5W A;  2QI2 A;  1UFY A;  2Z1U A;  3JAK B;  4BVR A;  3IKE A;  3RYF B;  3WGN A;  3WJR A;  1W59 A;  5CB4 B;  4X1Y A;  5FJ4 C;  3KHN A;  3F0D A;  1NJI H;  5HWE A;  1N8R H;  3CCJ F;  1QD9 A;  2ZVY A;  1X25 A;  2UYJ A;  3VO8 A;  5CA0 B;  4TUY B;  3CPW F;  3UT5 A;  1J7H A;  4R40 B;  5KMG A;  4G88 A;  4EB6 B;  4LCK A;  3F6M A;  3GHZ A;  4ZHY B;  1XV2 A;  2KTV A;  3JAL B;  1VQ5 F;  1KNJ A;  2RB9 A;  1DBF A;  3FD6 A;  4YJ3 A;  5J2U A;  1K8A H;  1X52 A;  4X20 B;  2G9I A;  1KNK A;  5LYJ A;  3I56 F;  3VCZ A;  4ZHV A;  4BVT A;  2GLZ A;  3CC7 F;  3C9S A;  4DRX B;  3WGJ A;  1QVG F;  1RLU A;  2OHW A;  3LWO C;  3DC2 A;  4IIJ B;  2ZAU A;  5LOV B;  1FNJ A;  5GIN C;  3IMP A;  1Q86 H;  1W57 A;  2AIF A;  5JQG A;  1QVF F;  4I4T A;  3V3T A;  4WBN B;  3S0W A;  4X20 A;  5LP6 B;  4B62 A;  5CA1 A;  4B45 A;  2HVY D;  1IV4 A;  1ZWZ A;  3TD5 A;  3LWQ C;  4DRX A;  1Q8R A;  4TV8 A;  3N2K A;  2LCA A;  3WPX A;  5A2Q M;  2HS4 A;  1Q7Y H;  3MQW A;  3QHD A;  4U3J B;  2GZL A;  3L7Q A;  4BT4 A;  1VQ7 F;  5DCV A;  4IIJ A;  3CC2 F;  2OTL F;  3LWR C;  3T80 A;  5IJ9 B;  4BVS A;  4ZI7 B;  1JFF A;  4U39 A;  2MQE A;  4BW0 B;  5FNV A;  3HKB B;  2Q1X A;  1JN1 A;  2UYP A;  3N4Y A;  1KC8 H;  3CCS F;  1E7K A;  3LYB A;  3S02 A;  3CME F;  2KTU A;  3B6N A;  3F0E A;  3ESJ A;  4RQO A;  3ZP4 A;  1W42 A;  5IJ9 A;  3CCU F;  4ZI7 A;  3E22 B;  5GAP K;  3FBA A;  1H47 A;  2Z1E A;  1JD1 A;  4O4L B;  3GTZ A;  2HX0 A;  3TD4 A;  1TUB B;  3HWU A;  4O2A B;  3J7A R;  3WGL A;  3HKE A;  2VAP A;  1T0K B;  2QTP A;  3QUW A;  5ITZ B;  2CHS A;  3HKD B;  4NQ3 A;  4O4I B;  3LDT A;  3MDO A;  3WGK A;  3GYQ A;  3G71 F;  4ZHQ B;  5EIB D;  1H48 A;  1FFX B;  3VYU C;  3WGM A;  4EI9 A;  4I50 A;  3DDN A;  4F6R A;  4C8I A;  4X1Y B;  1K9M H;  3HKD A;  5EZY B;  4KWE A;  3PLA C;  5G4U C;  2YXZ A;  5JCO C;  3K14 A;  4ZHQ A;  2DYY A;  2IAF A;  2V9Y A;  1FFX A;  1VQO F;  5LA6 A;  3NK7 A;  2FGY A;  4C82 A;  4C4W C;  1VQK F;  3UT5 B;  5EAZ A;  3HKC A;  1ONI A;  3C9T A;  1U3L A;  2UZH A;  5KMG B;  5HY1 A;  1Z5V A;  4C81 A;  3JAM M;  1RQ7 A;  1SA0 A;  3Q8H A;  5EZY A;  3P0Z A;  4TV9 A;  4YJ3 B;  5J2U B;  3CCR F;  2LBX A;  3K12 A;  1FNK A;  5LYJ B;  4B5C A;  3CC4 F;  2AIZ P;  1FSZ A;  3VOA A;  5IJ0 A;  3RYC B;  3WJP A;  5GIO C;  3WPW A;  3U0O A;  3ZP7 A;  1VQL F;  4FFB A;  2KGW A;  4ERH A;  1VH8 A;  1M1K H;  3FPI A;  3M4S A;  5JQG B;  1W2B F;  4I4T B;  1S72 F;  5CA1 B;  5IYZ A;  1KQS F;  3VIU A;  2OTM A;  1GX1 A;  1W58 1;  3VOB A;  4TV8 B;  3N2K B;  3RYC A;  3ON1 A;  3RYH B;  2Q1Y A;  1CK2 A;  1YHQ F;  4TZZ A;  3WJQ A;  3C8L A;  1GO0 A;  2OZB A;  1DT9 A;  1VQP F;  1JFF B;  2B33 A;  2W8B C;  3ELC A;  5FNV B;  2RHL A;  3CB2 A;  5J2T A;  1COM A;  1YGY A;  4I55 A;  2R75 1;  3RYH A;  3CMA F;  4BT2 A;  1IV1 A;  3I3F A;  3M84 A;  3N2G A;  1TVK A;  2HRU A;  3N4Z A;  3ZOP A;  3SIU A;  3JAT A;  5FLX M;  1OAP A;  5C8Y A;  1YIJ F;  3LWP C;  4LNU B;  3NK6 A;  1W5F A;  4C8G A;  3RA5 A;  4NWO B;  4YJ2 A;  3V4D A;  2CW4 A;  3MCQ A;  1W3E X;  2I6D A;  3HKE B;  1VQM F;  3KE1 A;  5MN5 A;  3OON A;  3V7E A;  4X3L A;  5EB0 A;  1W40 A;  1X7P A;  4LNU A;  3NMU C;  3JAS A;  2CVL A;  3VMF B;  4G4Z A;  4I50 B;  1RLG A;  1VHA A;  3IEW A;  3FFM A;  1K73 H;  3CG6 A;  1CLI A;  3MBM A;  1XRG A;  5GIP C;  3CXC F;  3OBY A;  4F6R B;  3OW2 F;  3IEQ A;  4X1I A;  3KIZ A;  2ZOD A;  2LBW A;  3D54 A;  3HJW C;  2ZVZ A;  3V7Q A;  2RHJ A;  5LA6 B;  3J80 M;  1VK3 A;  5KX5 A;  3G4S F;  2Z1T A;  5EWR A;  2PMP A;  3CCQ F;  3ZO8 A;  5JH7 A;  3NVI B;  3HKC B;  2FC3 A;  2F9Z C;  4O4J B;  1SA0 B;  4G4X A;  1XBI A;  2I6R A;  5LP6 C;  4TV9 B;  1PXW A;  1YIT F;  1YI2 F;  1T0A A;  2H8E A;  1SDS A;  4ZOL B;  3JAR A;  1YJN F;  3M1X A;  3G6E F;  4O2B A;  4EI8 A;  4G4V A;  4IHJ B;  1JY8 A;  3AGK A;  4EI7 A;  5IJ0 B;  1GO1 A;  1CN7 A;  1SZQ A;  3JCM M;  2ZOV A;  3EOR A;  4C8E A;  4NUT A;  2HP0 B;  4FFB B;  5HP7 A;  4O4J A;  2CZW A;  1W5A A;  4DXD A;  5AVM A;  2RHO A;  4BVQ A;  2BTQ B;  1QAH A;  2P6Y A;  4ZOL A;  3SIV A;  3HTN A;  5EYP B;  5BMV A;  5IT9 M;  5IYZ B;  3S03 A;  4BY9 D;  4O4H B;  5GON B;  4IHJ A;  1JJ2 F;  3E1Y A;  1KD1 H;  4E6E A;  2EWC A;  3K2X A;  3ERN A; 
#chains in the Genus database with same CATH homology
 4ZHW A;  3LDT A;  4G4V A;  4ZHY B;  3S02 A;  2KGW A;  2HQS C;  3TD5 A;  4ERH A;  5EAZ A;  2LCA A;  3TD3 A;  3WPX A;  2ZVZ A;  3CYQ A;  2ZOV A;  4G4Y A;  3S0H A;  2L26 A;  4ZHV A;  3OON A;  3KHN A;  4G4W A;  4PWT A;  3S0Y A;  5EB0 A;  3CYP B;  4RHA A;  2N48 A;  2ZVY A;  2MQE A;  1OAP A;  4G4Z A;  4B5C A;  3TD4 A;  4G4X A;  2AIZ P;  2ZF8 A;  3IMP A;  3S03 A;  2K1S A;  5EB1 B;  2LBT A;  1R1M A;  3S06 A;  4R40 B;  3S0W A;  3WPW A;  2W8B C;  4G88 A;  4B62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...