3TD3A

Crystal structure of ompa-like domain from acinetobacter baumannii in complex with glycine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
120
structure length
120
Chain Sequence
MELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLNERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein omp38
publication title Mechanism of anchoring of OmpA protein to the cell wall peptidoglycan of the gram-negative bacterial outer membrane
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Membrane protein,peptide binding protein
total genus 39
structure length 120
sequence length 120
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3td3A00
4G88A 4PWTA 4ZHYB 2KGWA 3CYQA 4R40B 3S0HA 3WPWA 3TD3A 2ZOVA 3S03A 2LCAA 2ZVYA 3TD4A 3S0YA 2W8BC 4RHAA 1OAPA 3IMPA 4B5CA 3OONA 4ERHA 3S0WA 2AIZP 2K1SA 5EB1B 4G4YA 1R1MA 2ZF8A 3KHNA 2MQEA 3S02A 4G4WA 2N48A 4G4ZA 5EB0A 4B62A 2LBTA 4ZHWA 4ZHVA 4G4VA 3CYPB 4G4XA 3S06A 5EAZA 3WPXA 3TD5A 2HQSC 2L26A 2ZVZA 3LDTA
chains in the Genus database with same CATH superfamily
1XV2A 3CPQA 4PWTA 3Q8HA 3S0HA 4BW0B 2ZAUA 4YJ3A 1OFUA 1FNJA 3WGNA 4I4TA 3V3TA 1Q82H 4X1YA 1JY8A 1J7HA 3NK6A 2AIZP 3R0PA 3PLAC 5GANK 2K1SA 1U43A 3NMUC 1KC8H 2ZF8A 3CCSF 5KMGA 1CN7A 3MBMA 1GZ0A 1RLUA 3WGMA 4TUYA 3DC2A 3MCQA 3C9SA 2HQSC 2I6RA 4BT6A 1Q86H 1U3LA 3FFMA 5EIBD 2HS0A 3IKFA 3WJQA 3P4EA 5BMVB 1QU9A 3E1YA 2UYKA 3CCLF 2W8BC 5DCVA 1QD9A 2KTVA 2HS4A 2DYYA 3LYBA 3S0WA 3LWRC 3LFOA 3N4ZA 5IYZB 1YITF 3CCQF 2BO1A 4BVQA 3HKDB 3J80M 5EZYA 3RYIA 3N2GA 1TVKA 3RYHB 1U40A 3D01A 1Q8RA 3I7TA 5LYJA 3RYCA 4NWOB 1E7KA 2OTLF 4O4HA 1FFXB 1QAHA 4BVTA 1IV4A 5LOVB 4LNUA 3LWPC 3IKEA 4G4YA 4IIJA 4NUTA 3RA6A 5GONA 4ZK7A 2B33A 1W2BF 4WBNA 3VI6A 1QVGF 5LP6C 1CK2A 3JARB 3F0DA 3RE3A 4G4VA 4HNAA 1GO0A 5GINC 4X20B 1UI9A 4DXDA 4YJ2A 5EIBC 5LP6A 1YGYA 4B46A 3JVHA 3GHZA 2Z01A 3N4YA 1IV3A 3K12A 3FPIA 1K73H 3D00A 1JD1A 1XHOA 2UYNA 3C9TA 5EB1B 1R1MA 2Q1XA 4ZOLB 3HAXD 1SA0B 5J2UB 2YXZA 3OBWA 2BTQB 2Z1UA 3HJWC 3JAKA 4EB6B 2H8CA 4X1IA 3WXMB 4C82A 2CW4A 3FD5A 3CCMF 3CYQA 2JNBA 2BTUA 1TUBB 4DRXB 2OZBA 4TV9B 2CVLA 1OAPA 5LXTB 1RA4A 1M90H 3CG6A 3FD6A 4O4IB 1PXWA 3HKCB 3VOBA 2VXYA 1FSZA 5KX5B 3ELCA 5EO3A 2Z1EA 1YJ9F 2V9YA 3IEQA 3JAWB 3GYQA 4O2BA 5FLXM 5LA6B 2VAMA 1W55A 4BT4A 5IJ0B 4BT3A 1W581 3ZP7A 4ZHVA 3CCUF 3JALB 3T80A 3BYQA 1K9MH 3CCJF 1Z5VA 3RA5A 4U39A 5CB4B 4NQ3A 1CLIA 1DBFA 2VAPA 3M4SA 5ITZB 1NQ3A 3LMEA 3TD3A 3HTNA 2ALEA 4F6RB 4BT2A 3JASA 1RQ2A 2LCAA 3TD4A 2HVYD 1W57A 4RHAA 4O4LB 3OONA 3CCRF 2YYEA 3P10A 5AVMA 4O4JA 3JARA 1YQNA 3IEWA 4C8GA 3EORA 2HX0A 1VQVA 3ZOPA 3CCVF 5JQGB 3OBYA 1VHAA 4BVSA 5GAPK 4RQOA 1W59A 5EYPA 4LCKA 3QUWA 1H47A 3WGJA 4O2AB 3S02A 1M1KH 2CWJA 2KTUA 4IHJA 3I3FA 3QTYA 1COMA 2G9IA 1UFYA 4EB6A 4I50B 1VQOF 2I6DA 4TV8B 3LDTA 1JFFB 3N2KB 2PMPA 2ZOVA 5JH7B 3C8LA 5C8YB 5LXTA 5JVDA 2IQQA 3WGLA 5CA1B 3IMPA 3HKCA 4O4IA 4X1KB 5KX5A 2HRYA 1YJWF 2RHLA 5FNVB 3C9RA 3KJKA 4BT5A 3JATB 4I55B 1VQPF 5J2TB 3SIVA 3UT5B 2H8EA 3KE1A 2PHNA 5IJ0A 4ZI7B 2QTPA 2UYJA 2HP0B 3NVKE 3VTIC 3QHDA 4G4XA 5EAZA 3VOAA 3MQWA 1RLGA 5IJ9B 5ITZA 3J7AR 3FBAA 3HKEB 3LWQC 2P6YA 4FFBB 3U0OA 1VH8A 4C8IA 5HY0A 1Q81H 3IR9A 2OHWA 2R6R1 4BY9D 5MN6A 4X1YB 1VQLF 1NMUB 1SZQA 3E22B 4EI8A 2MQEA 5HXZA 3F0EA 3VYTC 3ESJA 1X7PA 4TUYB 3V4DA 1T0AA 3CB2A 4M8IA 3WGKA 3F0GA 5BMVA 2KGWA 1S72F 2ZVYA 3CMEF 1VQKF 3G4SF 4ZHQB 4U3JB 5HY1A 5IYZA 3PAFA 2CZWA 1N8RH 3HKDA 2GLZA 4G4WA 2EWCA 3RYHA 3E20B 5EZYB 3RYIB 2RHJA 5HY2A 5JCOC 3C9UA 3VYSC 1JN1A 4TV8A 3JCMM 3N2KA 2L26A 1RQ7A 4C81A 3VYUC 1VQ9F 1VQ6F 2HP3A 2F9ZC 1W5AA 4R40B 1H7MA 3WPWA 5JCOA 4E6EA 5LYJB 3RYCB 1FFXA 5LOVA 2FC3A 4O4HB 1JJ2F 1YHQF 3O85A 4LNUB 4ERHA 3JAMM 3MDOA 1ODEA 2VGMA 3AGKA 1ONIA 2OTMA 3UT5A 2QI2A 1VQ7F 5HP7A 1IV1A 2QEXF 2FGYA 1W3EX 3RYFB 5GIOC 1IPAA 3L7QA 4WBNB 4ZHWA 2RHHA 3VO8A 3CPWF 4HNAB 3HKEA 3V7QA 4X20A 4FFBA 3VMFB 1U3PA 3G6EF 3K14A 2KG4A 3D54A 1W41A 2VGNA 1VQ5F 5IT9M 4YJ2B 5LP6B 3KIZA 3J81M 3E22A 3GTZA 4B5CA 2GZLA 5HWEA 1VQNF 3MCAB 2LBXA 2UYNB 1Q7YH 4ZOLA 1SA0A 4EI9A 2NMUA 5EB0A 5J2UA 2LBTA 3NVIB 3B6NA 1X25A 2CHSA 3JAKB 3HKBB 1XRGA 4X1IB 5GIPC 4G88A 3CC7F 4ZHYB 3LWOC 3ERNA 3F0FA 2BTOA 1TUBA 3S03A 4DRXA 1VQ8F 5FJ4C 4TV9A 1NJIH 3ON1A 4ZHQA 4U3JA 5G4VC 1KNKA 2Z1TA 1W5BA 5A2QM 5CA0B 3JAWA 2RB9A 5LA6A 3DDNA 4O2BB 1FNKA 5B8FA 5MN4A 3G71F 3JALA 3WJPA 5HY4A 1W42A 2GVIA 1VK3A 4C4WC 2ZVZA 5CB4A 1YIJF 2DT4A 1ZWZA 2UYPA 3CXCF 1SDSA 3SIUA 2UZHA 4F6RA 3S0YA 2RHOA 3JASB 4BVRA 1K8AH 3CCEF 4O4LA 4YJ3B 1PF5A 4I4TB 1KNJA 3ZO8A 4BT7A 2Z1FA 4XCQA 3VIUA 5HXUA 1W5FA 3RYFA 4O4JB 3CC2F 1VQMF 5G4UC 5KMGB 3HWUA 2OTJF 1Z5WA 2ZODA 1X52A 1GX1A 2VAWA 5JQGA 1T0KB 3K2XA 4TZZA 4B45A 1XBIA 1W40A 1DT9A 5EWRA 5EYPB 3OW2F 1QVFF 2QA4F 1VQ4F 3CMAF 4X3LA 1GO1A 2WALA 3CC4F 1X7OA 3M1XA 2IAFA 1W5EA 4O2AA 4X3MA 3VCZA 5MN5A 3KHNA 2N48A 4B62A 3KJJA 2AMTA 3M84A 3NK7A 4IHJB 3LWVC 3N2GB 1TVKB 4I50A 2H6LA 2CHTA 2AIFA 2HRUA 3HKBA 3S06A 1JFFA 1H48A 3CD6F 5JH7A 1IV2A 5C8YA 1KD1H 5CA1A 5JVDB 2R751 4X1KA 4C8EA 2IG8A 2HS3A 1YJNF 5CA0A 1KQSF 5FNVA 3JATA 4I55A 5J2TA 3F6MA 4EI7A 4IIJB 3V7EA 5GONB 4ZI7A 1YI2F 4G4ZA 3I55F 3P0ZA 5HP8A 3K0TA 2HP0A 2CSLA 4KWEA 3ZP4A 2Q1YA 3CYPB 3I56F 3WPXA 2LBWA 3TD5A 5IJ9A 3WJRA
chains in the Genus database with same CATH topology
4G88A 4PWTA 4ZHYB 2KGWA 3CYQA 4R40B 3S0HA 3WPWA 3TD3A 2ZOVA 3S03A 2LCAA 2ZVYA 3TD4A 3S0YA 2W8BC 4RHAA 1OAPA 3IMPA 4B5CA 3OONA 4ERHA 3S0WA 2AIZP 2K1SA 5EB1B 4G4YA 1R1MA 2ZF8A 3KHNA 2MQEA 3S02A 4G4WA 2N48A 4G4ZA 5EB0A 4B62A 2LBTA 4ZHWA 4ZHVA 4G4VA 3CYPB 4G4XA 3S06A 5EAZA 3WPXA 3TD5A 2HQSC 2L26A 2ZVZA 3LDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G88 A;  4PWT A;  4ZHY B;  2KGW A;  3CYQ A;  4R40 B;  3S0H A;  3WPW A;  3TD3 A;  2ZOV A;  3S03 A;  2LCA A;  2ZVY A;  3TD4 A;  3S0Y A;  2W8B C;  4RHA A;  1OAP A;  3IMP A;  4B5C A;  3OON A;  4ERH A;  3S0W A;  2AIZ P;  2K1S A;  5EB1 B;  4G4Y A;  1R1M A;  2ZF8 A;  3KHN A;  2MQE A;  3S02 A;  4G4W A;  2N48 A;  4G4Z A;  5EB0 A;  4B62 A;  2LBT A;  4ZHW A;  4ZHV A;  4G4V A;  3CYP B;  4G4X A;  3S06 A;  5EAZ A;  3WPX A;  3TD5 A;  2HQS C;  2L26 A;  2ZVZ A;  3LDT A; 
#chains in the Genus database with same CATH topology
 1XV2 A;  3CPQ A;  4PWT A;  3Q8H A;  3S0H A;  4BW0 B;  2ZAU A;  4YJ3 A;  1OFU A;  1FNJ A;  3WGN A;  4I4T A;  3V3T A;  1Q82 H;  4X1Y A;  1JY8 A;  1J7H A;  3NK6 A;  2AIZ P;  3R0P A;  3PLA C;  5GAN K;  2K1S A;  1U43 A;  3NMU C;  1KC8 H;  2ZF8 A;  3CCS F;  5KMG A;  1CN7 A;  3MBM A;  1GZ0 A;  1RLU A;  3WGM A;  4TUY A;  3DC2 A;  3MCQ A;  3C9S A;  2HQS C;  2I6R A;  4BT6 A;  1Q86 H;  1U3L A;  3FFM A;  5EIB D;  2HS0 A;  3IKF A;  3WJQ A;  3P4E A;  5BMV B;  1QU9 A;  3E1Y A;  2UYK A;  3CCL F;  2W8B C;  5DCV A;  1QD9 A;  2KTV A;  2HS4 A;  2DYY A;  3LYB A;  3S0W A;  3LWR C;  3LFO A;  3N4Z A;  5IYZ B;  1YIT F;  3CCQ F;  2BO1 A;  4BVQ A;  3HKD B;  3J80 M;  5EZY A;  3RYI A;  3N2G A;  1TVK A;  3RYH B;  1U40 A;  3D01 A;  1Q8R A;  3I7T A;  5LYJ A;  3RYC A;  4NWO B;  1E7K A;  2OTL F;  4O4H A;  1FFX B;  1QAH A;  4BVT A;  1IV4 A;  5LOV B;  4LNU A;  3LWP C;  3IKE A;  4G4Y A;  4IIJ A;  4NUT A;  3RA6 A;  5GON A;  4ZK7 A;  2B33 A;  1W2B F;  4WBN A;  3VI6 A;  1QVG F;  5LP6 C;  1CK2 A;  3JAR B;  3F0D A;  3RE3 A;  4G4V A;  4HNA A;  1GO0 A;  5GIN C;  4X20 B;  1UI9 A;  4DXD A;  4YJ2 A;  5EIB C;  5LP6 A;  1YGY A;  4B46 A;  3JVH A;  3GHZ A;  2Z01 A;  3N4Y A;  1IV3 A;  3K12 A;  3FPI A;  1K73 H;  3D00 A;  1JD1 A;  1XHO A;  2UYN A;  3C9T A;  5EB1 B;  1R1M A;  2Q1X A;  4ZOL B;  3HAX D;  1SA0 B;  5J2U B;  2YXZ A;  3OBW A;  2BTQ B;  2Z1U A;  3HJW C;  3JAK A;  4EB6 B;  2H8C A;  4X1I A;  3WXM B;  4C82 A;  2CW4 A;  3FD5 A;  3CCM F;  3CYQ A;  2JNB A;  2BTU A;  1TUB B;  4DRX B;  2OZB A;  4TV9 B;  2CVL A;  1OAP A;  5LXT B;  1RA4 A;  1M90 H;  3CG6 A;  3FD6 A;  4O4I B;  1PXW A;  3HKC B;  3VOB A;  2VXY A;  1FSZ A;  5KX5 B;  3ELC A;  5EO3 A;  2Z1E A;  1YJ9 F;  2V9Y A;  3IEQ A;  3JAW B;  3GYQ A;  4O2B A;  5FLX M;  5LA6 B;  2VAM A;  1W55 A;  4BT4 A;  5IJ0 B;  4BT3 A;  1W58 1;  3ZP7 A;  4ZHV A;  3CCU F;  3JAL B;  3T80 A;  3BYQ A;  1K9M H;  3CCJ F;  1Z5V A;  3RA5 A;  4U39 A;  5CB4 B;  4NQ3 A;  1CLI A;  1DBF A;  2VAP A;  3M4S A;  5ITZ B;  1NQ3 A;  3LME A;  3TD3 A;  3HTN A;  2ALE A;  4F6R B;  4BT2 A;  3JAS A;  1RQ2 A;  2LCA A;  3TD4 A;  2HVY D;  1W57 A;  4RHA A;  4O4L B;  3OON A;  3CCR F;  2YYE A;  3P10 A;  5AVM A;  4O4J A;  3JAR A;  1YQN A;  3IEW A;  4C8G A;  3EOR A;  2HX0 A;  1VQV A;  3ZOP A;  3CCV F;  5JQG B;  3OBY A;  1VHA A;  4BVS A;  5GAP K;  4RQO A;  1W59 A;  5EYP A;  4LCK A;  3QUW A;  1H47 A;  3WGJ A;  4O2A B;  3S02 A;  1M1K H;  2CWJ A;  2KTU A;  4IHJ A;  3I3F A;  3QTY A;  1COM A;  2G9I A;  1UFY A;  4EB6 A;  4I50 B;  1VQO F;  2I6D A;  4TV8 B;  3LDT A;  1JFF B;  3N2K B;  2PMP A;  2ZOV A;  5JH7 B;  3C8L A;  5C8Y B;  5LXT A;  5JVD A;  2IQQ A;  3WGL A;  5CA1 B;  3IMP A;  3HKC A;  4O4I A;  4X1K B;  5KX5 A;  2HRY A;  1YJW F;  2RHL A;  5FNV B;  3C9R A;  3KJK A;  4BT5 A;  3JAT B;  4I55 B;  1VQP F;  5J2T B;  3SIV A;  3UT5 B;  2H8E A;  3KE1 A;  2PHN A;  5IJ0 A;  4ZI7 B;  2QTP A;  2UYJ A;  2HP0 B;  3NVK E;  3VTI C;  3QHD A;  4G4X A;  5EAZ A;  3VOA A;  3MQW A;  1RLG A;  5IJ9 B;  5ITZ A;  3J7A R;  3FBA A;  3HKE B;  3LWQ C;  2P6Y A;  4FFB B;  3U0O A;  1VH8 A;  4C8I A;  5HY0 A;  1Q81 H;  3IR9 A;  2OHW A;  2R6R 1;  4BY9 D;  5MN6 A;  4X1Y B;  1VQL F;  1NMU B;  1SZQ A;  3E22 B;  4EI8 A;  2MQE A;  5HXZ A;  3F0E A;  3VYT C;  3ESJ A;  1X7P A;  4TUY B;  3V4D A;  1T0A A;  3CB2 A;  4M8I A;  3WGK A;  3F0G A;  5BMV A;  2KGW A;  1S72 F;  2ZVY A;  3CME F;  1VQK F;  3G4S F;  4ZHQ B;  4U3J B;  5HY1 A;  5IYZ A;  3PAF A;  2CZW A;  1N8R H;  3HKD A;  2GLZ A;  4G4W A;  2EWC A;  3RYH A;  3E20 B;  5EZY B;  3RYI B;  2RHJ A;  5HY2 A;  5JCO C;  3C9U A;  3VYS C;  1JN1 A;  4TV8 A;  3JCM M;  3N2K A;  2L26 A;  1RQ7 A;  4C81 A;  3VYU C;  1VQ9 F;  1VQ6 F;  2HP3 A;  2F9Z C;  1W5A A;  4R40 B;  1H7M A;  3WPW A;  5JCO A;  4E6E A;  5LYJ B;  3RYC B;  1FFX A;  5LOV A;  2FC3 A;  4O4H B;  1JJ2 F;  1YHQ F;  3O85 A;  4LNU B;  4ERH A;  3JAM M;  3MDO A;  1ODE A;  2VGM A;  3AGK A;  1ONI A;  2OTM A;  3UT5 A;  2QI2 A;  1VQ7 F;  5HP7 A;  1IV1 A;  2QEX F;  2FGY A;  1W3E X;  3RYF B;  5GIO C;  1IPA A;  3L7Q A;  4WBN B;  4ZHW A;  2RHH A;  3VO8 A;  3CPW F;  4HNA B;  3HKE A;  3V7Q A;  4X20 A;  4FFB A;  3VMF B;  1U3P A;  3G6E F;  3K14 A;  2KG4 A;  3D54 A;  1W41 A;  2VGN A;  1VQ5 F;  5IT9 M;  4YJ2 B;  5LP6 B;  3KIZ A;  3J81 M;  3E22 A;  3GTZ A;  4B5C A;  2GZL A;  5HWE A;  1VQN F;  3MCA B;  2LBX A;  2UYN B;  1Q7Y H;  4ZOL A;  1SA0 A;  4EI9 A;  2NMU A;  5EB0 A;  5J2U A;  2LBT A;  3NVI B;  3B6N A;  1X25 A;  2CHS A;  3JAK B;  3HKB B;  1XRG A;  4X1I B;  5GIP C;  4G88 A;  3CC7 F;  4ZHY B;  3LWO C;  3ERN A;  3F0F A;  2BTO A;  1TUB A;  3S03 A;  4DRX A;  1VQ8 F;  5FJ4 C;  4TV9 A;  1NJI H;  3ON1 A;  4ZHQ A;  4U3J A;  5G4V C;  1KNK A;  2Z1T A;  1W5B A;  5A2Q M;  5CA0 B;  3JAW A;  2RB9 A;  5LA6 A;  3DDN A;  4O2B B;  1FNK A;  5B8F A;  5MN4 A;  3G71 F;  3JAL A;  3WJP A;  5HY4 A;  1W42 A;  2GVI A;  1VK3 A;  4C4W C;  2ZVZ A;  5CB4 A;  1YIJ F;  2DT4 A;  1ZWZ A;  2UYP A;  3CXC F;  1SDS A;  3SIU A;  2UZH A;  4F6R A;  3S0Y A;  2RHO A;  3JAS B;  4BVR A;  1K8A H;  3CCE F;  4O4L A;  4YJ3 B;  1PF5 A;  4I4T B;  1KNJ A;  3ZO8 A;  4BT7 A;  2Z1F A;  4XCQ A;  3VIU A;  5HXU A;  1W5F A;  3RYF A;  4O4J B;  3CC2 F;  1VQM F;  5G4U C;  5KMG B;  3HWU A;  2OTJ F;  1Z5W A;  2ZOD A;  1X52 A;  1GX1 A;  2VAW A;  5JQG A;  1T0K B;  3K2X A;  4TZZ A;  4B45 A;  1XBI A;  1W40 A;  1DT9 A;  5EWR A;  5EYP B;  3OW2 F;  1QVF F;  2QA4 F;  1VQ4 F;  3CMA F;  4X3L A;  1GO1 A;  2WAL A;  3CC4 F;  1X7O A;  3M1X A;  2IAF A;  1W5E A;  4O2A A;  4X3M A;  3VCZ A;  5MN5 A;  3KHN A;  2N48 A;  4B62 A;  3KJJ A;  2AMT A;  3M84 A;  3NK7 A;  4IHJ B;  3LWV C;  3N2G B;  1TVK B;  4I50 A;  2H6L A;  2CHT A;  2AIF A;  2HRU A;  3HKB A;  3S06 A;  1JFF A;  1H48 A;  3CD6 F;  5JH7 A;  1IV2 A;  5C8Y A;  1KD1 H;  5CA1 A;  5JVD B;  2R75 1;  4X1K A;  4C8E A;  2IG8 A;  2HS3 A;  1YJN F;  5CA0 A;  1KQS F;  5FNV A;  3JAT A;  4I55 A;  5J2T A;  3F6M A;  4EI7 A;  4IIJ B;  3V7E A;  5GON B;  4ZI7 A;  1YI2 F;  4G4Z A;  3I55 F;  3P0Z A;  5HP8 A;  3K0T A;  2HP0 A;  2CSL A;  4KWE A;  3ZP4 A;  2Q1Y A;  3CYP B;  3I56 F;  3WPX A;  2LBW A;  3TD5 A;  5IJ9 A;  3WJR A; 
#chains in the Genus database with same CATH homology
 4G88 A;  4PWT A;  4ZHY B;  2KGW A;  3CYQ A;  4R40 B;  3S0H A;  3WPW A;  3TD3 A;  2ZOV A;  3S03 A;  2LCA A;  2ZVY A;  3TD4 A;  3S0Y A;  2W8B C;  4RHA A;  1OAP A;  3IMP A;  4B5C A;  3OON A;  4ERH A;  3S0W A;  2AIZ P;  2K1S A;  5EB1 B;  4G4Y A;  1R1M A;  2ZF8 A;  3KHN A;  2MQE A;  3S02 A;  4G4W A;  2N48 A;  4G4Z A;  5EB0 A;  4B62 A;  2LBT A;  4ZHW A;  4ZHV A;  4G4V A;  3CYP B;  4G4X A;  3S06 A;  5EAZ A;  3WPX A;  3TD5 A;  2HQS C;  2L26 A;  2ZVZ A;  3LDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...