3TD3A

Crystal structure of ompa-like domain from acinetobacter baumannii in complex with glycine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
120
structure length
120
Chain Sequence
MELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLNERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein,peptide binding protein
molecule keywords Outer membrane protein omp38
publication title Mechanism of anchoring of OmpA protein to the cell wall peptidoglycan of the gram-negative bacterial outer membrane
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 39
structure length 120
sequence length 120
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3td3A00
3IMPA 3CYQA 4G4VA 2ZF8A 4G88A 4ERHA 4G4YA 4R40B 3LDTA 2HQSC 3S02A 3TD3A 2AIZP 5EB0A 3TD4A 4G4XA 4G4WA 2LCAA 4B5CA 4ZHYB 3CYPB 2L26A 2ZVYA 2ZOVA 4B62A 2MQEA 3OONA 5EAZA 2W8BC 2LBTA 3S06A 4PWTA 3S0WA 3S0YA 4ZHWA 2ZVZA 2N48A 3TD5A 2KGWA 1R1MA 4RHAA 5EB1B 3WPXA 3WPWA 4G4ZA 3S03A 4ZHVA 3KHNA 3S0HA 2K1SA 1OAPA
chains in the Genus database with same CATH superfamily
5LP6A 2P6YA 5IT9M 3IKFA 3VYTC 2I6DA 2PMPA 2VAMA 3C9SA 5GONB 3LFOA 2QEXF 2RHHA 3VOBA 1RLGA 3LWVC 1JFFA 5C8YA 3CCSF 1VQLF 3IEWA 3OBYA 1X25A 2Z01A 3C8LA 1JY8A 1RQ2A 1YHQF 3SIUA 2LBWA 5ITZB 4IHJB 4X1IA 1GZ0A 1K73H 3P10A 1SZQA 4U39A 5MN6A 3G6EF 1W5BA 3MDOA 5JH7B 1T0AA 4B46A 1W5EA 3C9RA 2ZAUA 1Q81H 4BT3A 3F0EA 4DRXA 5LP6B 3G4SF 2FC3A 1Q8RA 4O4IA 1VQKF 4C8EA 1CK2A 4IIJA 2OTLF 2CHSA 5CA0A 1KNJA 2L26A 3J80M 3RYHA 2NMUA 1JFFB 5HY0A 5C8YB 3CCEF 2QA4F 5EIBD 5LP6C 1W3EX 3LYBA 5IYZA 2YXZA 3JAKA 2KGWA 3J81M 3WPXA 1SDSA 1KQSF 3WJRA 3F0FA 2Z1EA 3HKEA 3P0ZA 3WGJA 1JJ2F 2G9IA 3V4DA 1K9MH 2EWCA 3VYUC 4G88A 3K0TA 5FLXM 4DRXB 4B45A 1YIJF 4G4XA 1W40A 4O4IB 1IV4A 5IJ9A 1VHAA 3ZO8A 4IIJB 3N2GA 1FNJA 3WGKA 3R0PA 3Q8HA 3RYHB 3JARA 2Q1XA 3O85A 3WGMA 5BMVA 2QTPA 5IYZB 4TZZA 2FGYA 5JQGA 3JALA 3JAMM 4F6RB 2ZF8A 1J7HA 2H8EA 3UT5A 3HKCB 3HKEB 3IEQA 4EB6A 1YQNA 4TUYA 4ZOLA 1H47A 3FBAA 1X52A 3OONA 4BW0B 4BT7A 3HJWC 4O2BA 5HY4A 4O2AB 1KD1H 5HY2A 1ONIA 4YJ2A 3LWQC 3JARB 2K1SA 3S03A 2HP3A 3MBMA 2OTMA 5BMVB 4O4LB 2HS3A 4BT6A 3CXCF 1CLIA 3RA6A 3WGLA 3BYQA 3JALB 4G4YA 4TV8A 1ODEA 1U3PA 2KTUA 4EB6B 4TV9A 4TUYB 3DDNA 4B62A 5EAZA 1U43A 5ITZA 3OW2F 3VOAA 2AIFA 3S0WA 3KJJA 1S72F 4BY9D 4O2BB 3K12A 4BT5A 3TD5A 3CC7F 2H6LA 1R1MA 4RHAA 2IG8A 3CPWF 2AMTA 2CW4A 1FNKA 5KMGA 3LWRC 3S0HA 3VMFB 4EI9A 1W41A 3JVHA 3CB2A 2H8CA 5IJ0A 3E1YA 4U3JA 5GAPK 3NVKE 3HKDA 3VCZA 4X3MA 3CC2F 2IAFA 3CMEF 4TV8B 3D00A 4G4WA 4NWOB 5FNVB 5G4UC 3ERNA 2HRYA 3DC2A 4YJ3A 3KIZA 2ZODA 3JCMM 4TV9B 2OZBA 4KWEA 3EORA 4X3LA 1K8AH 3CCVF 3CPQA 2HS0A 5LOVB 2UYNA 1JD1A 1IV2A 1W42A 1VQPF 5KMGB 2IQQA 3CD6F 5LXTA 3ELCA 4R40B 5IJ0B 4U3JB 4BT4A 3CMAF 2BTOA 3HKDB 3LMEA 4DXDA 3CCUF 3M4SA 1RA4A 3PLAC 2W8BC 1U3LA 2VGMA 1PF5A 4YJ3B 4LNUB 3MQWA 2BO1A 1VQ9F 4I50A 5B8FA 1VQ4F 3I55F 5EZYB 4ZHVA 4C4WC 2V9YA 3G71F 3CCQF 4F6RA 5JCOA 3CYQA 3HKCA 2UYNB 3QUWA 1H7MA 3F0GA 4ERHA 5MN4A 2RHOA 1TUBA 3S02A 1Z5WA 4O4HB 5EB0A 5LXTB 3HAXD 4NUTA 1KNKA 1XHOA 3FD6A 1Q86H 3MCAB 4O4JB 2MQEA 4EI7A 1VQVA 4ZK7A 1E7KA 4O2AA 3C9UA 4X1KA 4C81A 1DBFA 5AVMA 3IKEA 2VAWA 2KTVA 3GHZA 5EWRA 3LWPC 2ZVZA 2Z1TA 2KG4A 3WPWA 5LYJB 3VIUA 1W59A 4O4LA 3RYCB 4HNAB 4I50B 1QVGF 4ZHQA 2GVIA 5JVDA 2R6R1 4I55A 1YJNF 2JNBA 3GYQA 1TUBB 5MN5A 2BTUA 3NMUC 3NK7A 3E22B 2QI2A 5HXUA 1UI9A 2RB9A 3J7AR 5JCOC 3S0YA 3RE3A 1RQ7A 3JAWA 3V7QA 1QAHA 4X1KB 1XRGA 5EB1B 3WXMB 1GO1A 2UYPA 5J2UA 2CWJA 3ON1A 4ZI7A 2Q1YA 5CA1A 3VYSC 1YGYA 4ZHQB 3PAFA 3K2XA 1VH8A 5JVDB 2HP0A 5FNVA 5G4VC 3CCMF 2LCAA 3HKBB 5HWEA 2LBXA 2B33A 3FD5A 3M1XA 4I55B 1VQ5F 4WBNB 3RYIB 1X7OA 3SIVA 3NK6A 1CN7A 2N48A 1W5AA 2HX0A 3JAWB 3KE1A 4G4ZA 5LOVA 1FSZA 4C8GA 2HS4A 5LA6A 3IMPA 3JASB 5J2UB 2DT4A 3RYFB 4ZI7B 1TVKB 4C82A 5CA1B 1VQMF 4M8IA 1XBIA 2UYJA 1T0KB 4X20B 2OTJF 3KJKA 5HXZA 3CCLF 2HP0B 2UYKA 2CZWA 1VQ7F 1KC8H 2VAPA 4LNUA 3V3TA 4RQOA 4XCQA 1NMUB 2F9ZC 3I3FA 1NJIH 5EZYA 5EIBC 5EO3A 1YI2F 1QU9A 5CB4A 3GTZA 1U40A 3JATA 1Z5VA 1OFUA 5GINC 5DCVA 5GIOC 3QHDA 5LA6B 1VQ6F 3CG6A 5GIPC 3OBWA 1SA0A 3E20B 3LDTA 4O4HA 2Z1UA 4O4JA 3VO8A 2ZOVA 4FFBA 1PXWA 3AGKA 3D54A 2LBTA 3S06A 4BVRA 3C9TA 3N2KB 3WJQA 5LYJA 3WGNA 3K14A 3RYCA 1GO0A 4HNAA 5J2TB 2YYEA 3KHNA 2CSLA 1OAPA 1W5FA 5HP7A 1Q82H 3N4YA 5CB4B 2PHNA 1RLUA 3ZP4A 1XV2A 3JATB 1FFXA 3V7EA 2GLZA 1SA0B 3FPIA 3M84A 3TD4A 3FFMA 3LWOC 3E22A 5HY1A 3ESJA 1H48A 3HTNA 1NQ3A 1GX1A 2OHWA 3B6NA 2ALEA 1W2BF 4PWTA 4FFBB 4C8IA 4ZHWA 5KX5A 3CCRF 4BVTA 1VQOF 5GANK 4X1IB 2RHLA 4I4TA 3QTYA 3N4ZA 1W581 3HWUA 3L7QA 1YJ9F 1QD9A 2Z1FA 4BVQA 5HP8A 3HKBA 2VXYA 2AIZP 3CCJF 1QVFF 1VQNF 1FFXB 1M90H 3VTIC 3CC4F 2GZLA 5EYPA 1COMA 4WBNA 5CA0B 2CHTA 1IV1A 3RYIA 1JN1A 3ZOPA 2RHJA 3RA5A 5A2QM 1N8RH 3I56F 3JAKB 5KX5B 2I6RA 3JASA 2DYYA 3RYFA 1TVKA 2HVYD 2CVLA 4I4TB 1IPAA 4X1YA 4G4VA 3NVIB 2BTQB 4EI8A 4X20A 1IV3A 4E6EA 3U0OA 3TD3A 3F6MA 5FJ4C 4BT2A 4ZHYB 2R751 3CYPB 2ZVYA 5IJ9B 1YJWF 5EYPB 3N2GB 1YITF 2HRUA 1VK3A 3I7TA 1X7PA 4BVSA 2WALA 3T80A 2VGNA 3WJPA 5GONA 1UFYA 3IR9A 4LCKA 5JQGB 4NQ3A 4X1YB 3ZP7A 3UT5B 1ZWZA 4B5CA 1Q7YH 4ZOLB 1W55A 1W57A 3F0DA 4IHJA 3N2KA 3MCQA 1M1KH 5J2TA 5JH7A 1VQ8F 3D01A 1DT9A 3P4EA 4YJ2B 2HQSC 2UZHA 3VI6A
chains in the Genus database with same CATH topology
3IMPA 3CYQA 4G4VA 2ZF8A 4G88A 4ERHA 4G4YA 4R40B 3LDTA 2HQSC 3S02A 3TD3A 2AIZP 5EB0A 3TD4A 4G4XA 4G4WA 2LCAA 4B5CA 4ZHYB 3CYPB 2L26A 2ZVYA 2ZOVA 4B62A 2MQEA 3OONA 5EAZA 2W8BC 2LBTA 3S06A 4PWTA 3S0WA 3S0YA 4ZHWA 2ZVZA 2N48A 3TD5A 2KGWA 1R1MA 4RHAA 5EB1B 3WPXA 3WPWA 4G4ZA 3S03A 4ZHVA 3KHNA 3S0HA 2K1SA 1OAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IMP A;  3CYQ A;  4G4V A;  2ZF8 A;  4G88 A;  4ERH A;  4G4Y A;  4R40 B;  3LDT A;  2HQS C;  3S02 A;  3TD3 A;  2AIZ P;  5EB0 A;  3TD4 A;  4G4X A;  4G4W A;  2LCA A;  4B5C A;  4ZHY B;  3CYP B;  2L26 A;  2ZVY A;  2ZOV A;  4B62 A;  2MQE A;  3OON A;  5EAZ A;  2W8B C;  2LBT A;  3S06 A;  4PWT A;  3S0W A;  3S0Y A;  4ZHW A;  2ZVZ A;  2N48 A;  3TD5 A;  2KGW A;  1R1M A;  4RHA A;  5EB1 B;  3WPX A;  3WPW A;  4G4Z A;  3S03 A;  4ZHV A;  3KHN A;  3S0H A;  2K1S A;  1OAP A; 
#chains in the Genus database with same CATH topology
 5LP6 A;  2P6Y A;  5IT9 M;  3IKF A;  3VYT C;  2I6D A;  2PMP A;  2VAM A;  3C9S A;  5GON B;  3LFO A;  2QEX F;  2RHH A;  3VOB A;  1RLG A;  3LWV C;  1JFF A;  5C8Y A;  3CCS F;  1VQL F;  3IEW A;  3OBY A;  1X25 A;  2Z01 A;  3C8L A;  1JY8 A;  1RQ2 A;  1YHQ F;  3SIU A;  2LBW A;  5ITZ B;  4IHJ B;  4X1I A;  1GZ0 A;  1K73 H;  3P10 A;  1SZQ A;  4U39 A;  5MN6 A;  3G6E F;  1W5B A;  3MDO A;  5JH7 B;  1T0A A;  4B46 A;  1W5E A;  3C9R A;  2ZAU A;  1Q81 H;  4BT3 A;  3F0E A;  4DRX A;  5LP6 B;  3G4S F;  2FC3 A;  1Q8R A;  4O4I A;  1VQK F;  4C8E A;  1CK2 A;  4IIJ A;  2OTL F;  2CHS A;  5CA0 A;  1KNJ A;  2L26 A;  3J80 M;  3RYH A;  2NMU A;  1JFF B;  5HY0 A;  5C8Y B;  3CCE F;  2QA4 F;  5EIB D;  5LP6 C;  1W3E X;  3LYB A;  5IYZ A;  2YXZ A;  3JAK A;  2KGW A;  3J81 M;  3WPX A;  1SDS A;  1KQS F;  3WJR A;  3F0F A;  2Z1E A;  3HKE A;  3P0Z A;  3WGJ A;  1JJ2 F;  2G9I A;  3V4D A;  1K9M H;  2EWC A;  3VYU C;  4G88 A;  3K0T A;  5FLX M;  4DRX B;  4B45 A;  1YIJ F;  4G4X A;  1W40 A;  4O4I B;  1IV4 A;  5IJ9 A;  1VHA A;  3ZO8 A;  4IIJ B;  3N2G A;  1FNJ A;  3WGK A;  3R0P A;  3Q8H A;  3RYH B;  3JAR A;  2Q1X A;  3O85 A;  3WGM A;  5BMV A;  2QTP A;  5IYZ B;  4TZZ A;  2FGY A;  5JQG A;  3JAL A;  3JAM M;  4F6R B;  2ZF8 A;  1J7H A;  2H8E A;  3UT5 A;  3HKC B;  3HKE B;  3IEQ A;  4EB6 A;  1YQN A;  4TUY A;  4ZOL A;  1H47 A;  3FBA A;  1X52 A;  3OON A;  4BW0 B;  4BT7 A;  3HJW C;  4O2B A;  5HY4 A;  4O2A B;  1KD1 H;  5HY2 A;  1ONI A;  4YJ2 A;  3LWQ C;  3JAR B;  2K1S A;  3S03 A;  2HP3 A;  3MBM A;  2OTM A;  5BMV B;  4O4L B;  2HS3 A;  4BT6 A;  3CXC F;  1CLI A;  3RA6 A;  3WGL A;  3BYQ A;  3JAL B;  4G4Y A;  4TV8 A;  1ODE A;  1U3P A;  2KTU A;  4EB6 B;  4TV9 A;  4TUY B;  3DDN A;  4B62 A;  5EAZ A;  1U43 A;  5ITZ A;  3OW2 F;  3VOA A;  2AIF A;  3S0W A;  3KJJ A;  1S72 F;  4BY9 D;  4O2B B;  3K12 A;  4BT5 A;  3TD5 A;  3CC7 F;  2H6L A;  1R1M A;  4RHA A;  2IG8 A;  3CPW F;  2AMT A;  2CW4 A;  1FNK A;  5KMG A;  3LWR C;  3S0H A;  3VMF B;  4EI9 A;  1W41 A;  3JVH A;  3CB2 A;  2H8C A;  5IJ0 A;  3E1Y A;  4U3J A;  5GAP K;  3NVK E;  3HKD A;  3VCZ A;  4X3M A;  3CC2 F;  2IAF A;  3CME F;  4TV8 B;  3D00 A;  4G4W A;  4NWO B;  5FNV B;  5G4U C;  3ERN A;  2HRY A;  3DC2 A;  4YJ3 A;  3KIZ A;  2ZOD A;  3JCM M;  4TV9 B;  2OZB A;  4KWE A;  3EOR A;  4X3L A;  1K8A H;  3CCV F;  3CPQ A;  2HS0 A;  5LOV B;  2UYN A;  1JD1 A;  1IV2 A;  1W42 A;  1VQP F;  5KMG B;  2IQQ A;  3CD6 F;  5LXT A;  3ELC A;  4R40 B;  5IJ0 B;  4U3J B;  4BT4 A;  3CMA F;  2BTO A;  3HKD B;  3LME A;  4DXD A;  3CCU F;  3M4S A;  1RA4 A;  3PLA C;  2W8B C;  1U3L A;  2VGM A;  1PF5 A;  4YJ3 B;  4LNU B;  3MQW A;  2BO1 A;  1VQ9 F;  4I50 A;  5B8F A;  1VQ4 F;  3I55 F;  5EZY B;  4ZHV A;  4C4W C;  2V9Y A;  3G71 F;  3CCQ F;  4F6R A;  5JCO A;  3CYQ A;  3HKC A;  2UYN B;  3QUW A;  1H7M A;  3F0G A;  4ERH A;  5MN4 A;  2RHO A;  1TUB A;  3S02 A;  1Z5W A;  4O4H B;  5EB0 A;  5LXT B;  3HAX D;  4NUT A;  1KNK A;  1XHO A;  3FD6 A;  1Q86 H;  3MCA B;  4O4J B;  2MQE A;  4EI7 A;  1VQV A;  4ZK7 A;  1E7K A;  4O2A A;  3C9U A;  4X1K A;  4C81 A;  1DBF A;  5AVM A;  3IKE A;  2VAW A;  2KTV A;  3GHZ A;  5EWR A;  3LWP C;  2ZVZ A;  2Z1T A;  2KG4 A;  3WPW A;  5LYJ B;  3VIU A;  1W59 A;  4O4L A;  3RYC B;  4HNA B;  4I50 B;  1QVG F;  4ZHQ A;  2GVI A;  5JVD A;  2R6R 1;  4I55 A;  1YJN F;  2JNB A;  3GYQ A;  1TUB B;  5MN5 A;  2BTU A;  3NMU C;  3NK7 A;  3E22 B;  2QI2 A;  5HXU A;  1UI9 A;  2RB9 A;  3J7A R;  5JCO C;  3S0Y A;  3RE3 A;  1RQ7 A;  3JAW A;  3V7Q A;  1QAH A;  4X1K B;  1XRG A;  5EB1 B;  3WXM B;  1GO1 A;  2UYP A;  5J2U A;  2CWJ A;  3ON1 A;  4ZI7 A;  2Q1Y A;  5CA1 A;  3VYS C;  1YGY A;  4ZHQ B;  3PAF A;  3K2X A;  1VH8 A;  5JVD B;  2HP0 A;  5FNV A;  5G4V C;  3CCM F;  2LCA A;  3HKB B;  5HWE A;  2LBX A;  2B33 A;  3FD5 A;  3M1X A;  4I55 B;  1VQ5 F;  4WBN B;  3RYI B;  1X7O A;  3SIV A;  3NK6 A;  1CN7 A;  2N48 A;  1W5A A;  2HX0 A;  3JAW B;  3KE1 A;  4G4Z A;  5LOV A;  1FSZ A;  4C8G A;  2HS4 A;  5LA6 A;  3IMP A;  3JAS B;  5J2U B;  2DT4 A;  3RYF B;  4ZI7 B;  1TVK B;  4C82 A;  5CA1 B;  1VQM F;  4M8I A;  1XBI A;  2UYJ A;  1T0K B;  4X20 B;  2OTJ F;  3KJK A;  5HXZ A;  3CCL F;  2HP0 B;  2UYK A;  2CZW A;  1VQ7 F;  1KC8 H;  2VAP A;  4LNU A;  3V3T A;  4RQO A;  4XCQ A;  1NMU B;  2F9Z C;  3I3F A;  1NJI H;  5EZY A;  5EIB C;  5EO3 A;  1YI2 F;  1QU9 A;  5CB4 A;  3GTZ A;  1U40 A;  3JAT A;  1Z5V A;  1OFU A;  5GIN C;  5DCV A;  5GIO C;  3QHD A;  5LA6 B;  1VQ6 F;  3CG6 A;  5GIP C;  3OBW A;  1SA0 A;  3E20 B;  3LDT A;  4O4H A;  2Z1U A;  4O4J A;  3VO8 A;  2ZOV A;  4FFB A;  1PXW A;  3AGK A;  3D54 A;  2LBT A;  3S06 A;  4BVR A;  3C9T A;  3N2K B;  3WJQ A;  5LYJ A;  3WGN A;  3K14 A;  3RYC A;  1GO0 A;  4HNA A;  5J2T B;  2YYE A;  3KHN A;  2CSL A;  1OAP A;  1W5F A;  5HP7 A;  1Q82 H;  3N4Y A;  5CB4 B;  2PHN A;  1RLU A;  3ZP4 A;  1XV2 A;  3JAT B;  1FFX A;  3V7E A;  2GLZ A;  1SA0 B;  3FPI A;  3M84 A;  3TD4 A;  3FFM A;  3LWO C;  3E22 A;  5HY1 A;  3ESJ A;  1H48 A;  3HTN A;  1NQ3 A;  1GX1 A;  2OHW A;  3B6N A;  2ALE A;  1W2B F;  4PWT A;  4FFB B;  4C8I A;  4ZHW A;  5KX5 A;  3CCR F;  4BVT A;  1VQO F;  5GAN K;  4X1I B;  2RHL A;  4I4T A;  3QTY A;  3N4Z A;  1W58 1;  3HWU A;  3L7Q A;  1YJ9 F;  1QD9 A;  2Z1F A;  4BVQ A;  5HP8 A;  3HKB A;  2VXY A;  2AIZ P;  3CCJ F;  1QVF F;  1VQN F;  1FFX B;  1M90 H;  3VTI C;  3CC4 F;  2GZL A;  5EYP A;  1COM A;  4WBN A;  5CA0 B;  2CHT A;  1IV1 A;  3RYI A;  1JN1 A;  3ZOP A;  2RHJ A;  3RA5 A;  5A2Q M;  1N8R H;  3I56 F;  3JAK B;  5KX5 B;  2I6R A;  3JAS A;  2DYY A;  3RYF A;  1TVK A;  2HVY D;  2CVL A;  4I4T B;  1IPA A;  4X1Y A;  4G4V A;  3NVI B;  2BTQ B;  4EI8 A;  4X20 A;  1IV3 A;  4E6E A;  3U0O A;  3TD3 A;  3F6M A;  5FJ4 C;  4BT2 A;  4ZHY B;  2R75 1;  3CYP B;  2ZVY A;  5IJ9 B;  1YJW F;  5EYP B;  3N2G B;  1YIT F;  2HRU A;  1VK3 A;  3I7T A;  1X7P A;  4BVS A;  2WAL A;  3T80 A;  2VGN A;  3WJP A;  5GON A;  1UFY A;  3IR9 A;  4LCK A;  5JQG B;  4NQ3 A;  4X1Y B;  3ZP7 A;  3UT5 B;  1ZWZ A;  4B5C A;  1Q7Y H;  4ZOL B;  1W55 A;  1W57 A;  3F0D A;  4IHJ A;  3N2K A;  3MCQ A;  1M1K H;  5J2T A;  5JH7 A;  1VQ8 F;  3D01 A;  1DT9 A;  3P4E A;  4YJ2 B;  2HQS C;  2UZH A;  3VI6 A; 
#chains in the Genus database with same CATH homology
 3IMP A;  3CYQ A;  4G4V A;  2ZF8 A;  4G88 A;  4ERH A;  4G4Y A;  4R40 B;  3LDT A;  2HQS C;  3S02 A;  3TD3 A;  2AIZ P;  5EB0 A;  3TD4 A;  4G4X A;  4G4W A;  2LCA A;  4B5C A;  4ZHY B;  3CYP B;  2L26 A;  2ZVY A;  2ZOV A;  4B62 A;  2MQE A;  3OON A;  5EAZ A;  2W8B C;  2LBT A;  3S06 A;  4PWT A;  3S0W A;  3S0Y A;  4ZHW A;  2ZVZ A;  2N48 A;  3TD5 A;  2KGW A;  1R1M A;  4RHA A;  5EB1 B;  3WPX A;  3WPW A;  4G4Z A;  3S03 A;  4ZHV A;  3KHN A;  3S0H A;  2K1S A;  1OAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...