3TD3A

Crystal structure of ompa-like domain from acinetobacter baumannii in complex with glycine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
120
structure length
120
Chain Sequence
MELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLNERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein omp38
publication title Mechanism of anchoring of OmpA protein to the cell wall peptidoglycan of the gram-negative bacterial outer membrane
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Membrane protein,peptide binding protein
total genus 39
structure length 120
sequence length 120
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3td3A00
3WPXA 2LBTA 2LCAA 5EAZA 3S02A 4G4YA 3CYQA 4B5CA 2K1SA 2ZF8A 4ZHVA 4B62A 3S0YA 3S06A 4ZHWA 4G4XA 1OAPA 2ZVZA 2MQEA 4ZHYB 3TD4A 3OONA 4G4ZA 4G4WA 2KGWA 1R1MA 5EB0A 5EB1B 2ZVYA 2HQSC 3KHNA 3S0WA 4PWTA 2N48A 3S0HA 4G4VA 3TD5A 3S03A 2AIZP 4R40B 3CYPB 3IMPA 3LDTA 3WPWA 2L26A 4G88A 3TD3A 2ZOVA 4RHAA 2W8BC 4ERHA
chains in the Genus database with same CATH superfamily
1SA0A 3F0FA 1W55A 2ZODA 3IEWA 5J2TB 3CB2A 3I7TA 1OFUA 4B62A 3E20B 1FFXA 3O85A 3N4ZA 5IYZA 2GZLA 1K73H 3CCRF 3S0WA 3HKBB 1YJWF 3ELCA 1VQ8F 4DXDA 3FFMA 5HY4A 5MN4A 1H48A 2L26A 1YIJF 1VQKF 5J2UB 1U3PA 3HKDA 3V3TA 3CPWF 5JVDA 3RYHB 1YHQF 3JALB 4U3JB 5GONB 2VAWA 4KWEA 3CCQF 3C9TA 2HS0A 2Q1YA 4BT7A 1W581 4X3MA 1NMUB 1R1MA 3D54A 2LBWA 4O2BB 1VQNF 3ZP4A 2YYEA 1YITF 3J80M 3OBWA 3WXMB 3M1XA 3ZP7A 2Z1UA 4NQ3A 5CA1B 3L7QA 4X3LA 1NJIH 2QTPA 2H8EA 2HX0A 1DBFA 3CYQA 4RQOA 2RHHA 3VYSC 2MQEA 3MBMA 4O4IB 1KNJA 3HTNA 4O4JA 2OHWA 4I4TA 2NMUA 5EIBC 5GANK 1H7MA 4NUTA 3N2GB 1SA0B 1IPAA 5HY1A 5GIOC 2CWJA 4HNAB 4NWOB 3G4SF 1PXWA 4RHAA 5CB4B 3J7AR 4DRXA 2OTJF 2VXYA 3CCLF 1W5AA 2H6LA 4U39A 5IYZB 2OTLF 1RLUA 5HXUA 5KMGA 2FC3A 3DDNA 1ONIA 2EWCA 2CSLA 3V7QA 4X1YA 2WALA 5LXTA 3OONA 2CZWA 5BMVA 5CA0B 3I55F 4BVRA 4BT3A 4F6RA 1JN1A 3R0PA 4BT2A 3CXCF 3PLAC 3RA5A 3MCAB 4ERHA 2QI2A 3MQWA 2CVLA 1E7KA 2G9IA 3CCUF 1N8RH 2H8CA 1ZWZA 3JARA 3VOAA 2HRYA 4I55A 2HP3A 2ZVYA 2CHTA 1W40A 4C81A 5JQGA 3N2KA 3T80A 2DT4A 1W42A 4TV8A 2Z1EA 3WGNA 1KQSF 1JY8A 5ITZB 1X7OA 3WGKA 3VYUC 3KE1A 1TUBA 2F9ZC 1DT9A 5KX5A 3RYCA 2JNBA 5FLXM 3K2XA 1RQ2A 4O4JB 1W5BA 3WGLA 4I4TB 3VO8A 2ZF8A 3D00A 2VAMA 2IAFA 1U40A 3Q8HA 5HXZA 4FFBA 1SZQA 3JAWB 5IJ0A 1KNKA 3JATB 4BT4A 1CN7A 4EB6A 4DRXB 4M8IA 3WGJA 4ZI7A 1FNJA 5LP6C 2RHLA 4ZOLA 3RYIA 4WBNA 1ODEA 4YJ2A 5KMGB 4BVQA 4EI7A 3D01A 4O4HB 1M1KH 4X1YB 5LXTB 1SDSA 3QHDA 3VTIC 5BMVB 3M4SA 5EAZA 5MN6A 3NK7A 3VOBA 3S02A 4G4YA 4F6RB 3DC2A 3B6NA 1Q7YH 4G4ZA 1VQ9F 5IJ9A 5EWRA 5HWEA 1W59A 4BVSA 3N4YA 2PHNA 2DYYA 2ZAUA 2VGMA 5GIPC 1QD9A 3G6EF 4IHJA 2ALEA 1VQ7F 1VQ6F 4I55B 4BVTA 3FD6A 4TUYA 1RLGA 1W5FA 3LWRC 5JQGB 3N2KB 1W5EA 4ZHQA 4IIJA 4ZHWA 1OAPA 5EZYB 3IKFA 2UYJA 5LP6A 3OBYA 4B45A 2UYPA 3RYCB 3KJKA 1CLIA 1K8AH 1QVGF 3F6MA 5JCOC 3ERNA 5EO3A 2W8BC 1J7HA 3VI6A 5IT9M 1FFXB 1VQLF 1Z5VA 2HP0A 4EI9A 3LWVC 3JASA 5IJ0B 2HS4A 5G4UC 1X7PA 4EB6B 5EB1B 3BYQA 4ZI7B 3CCVF 4ZOLB 4WBNB 5J2TA 3V4DA 4YJ2B 4G4VA 3CCSF 3HKDB 1YJNF 2AIFA 3CG6A 5JVDB 3ZO8A 1U3LA 3WPWA 3SIUA 5MN5A 1CK2A 1Q86H 5LOVA 1S72F 5JH7A 4B46A 5GAPK 4X20A 5IJ9B 3FPIA 5HY2A 3VYTC 3MCQA 1Z5WA 4LCKA 5LYJA 3ESJA 1YI2F 2UZHA 3CCEF 4X1KA 1XRGA 1RQ7A 4BY9D 3J81M 3ZOPA 3WJQA 5JCOA 3CCMF 3S0HA 3I56F 5HP8A 3QUWA 1QVFF 3VIUA 3CYPB 4TUYB 4C8GA 3TD3A 5FJ4C 3NVIB 2IG8A 2ZOVA 4O2BA 3F0EA 4ZHQB 4E6EA 3CMEF 3HKCA 4EI8A 4I50A 1KC8H 5LP6B 3WPXA 2LBXA 2LBTA 2HS3A 1T0AA 2PMPA 2HVYD 2FGYA 2K1SA 5C8YA 3S06A 1JD1A 3HKEA 1T0KB 2BTOA 2YXZA 3TD4A 4C82A 2HRUA 3U0OA 1FNKA 2GLZA 4PWTA 4YJ3A 3F0DA 1VQVA 3C8LA 1Q81H 2AMTA 2AIZP 4O4IA 3IMPA 2Z1FA 3C9SA 4G88A 4XCQA 3C9UA 2HP0B 2BTUA 4O4LA 4X1IA 2OZBA 3JASB 3RA6A 1UI9A 3ON1A 1YQNA 3N2GA 3GHZA 4HNAA 1GO0A 3V7EA 3P0ZA 2UYKA 5CB4A 2BTQB 1GX1A 4C8IA 3C9RA 2KGWA 3KJJA 1IV3A 2N48A 1VHAA 3VCZA 5LA6A 5LOVB 5JH7B 2KG4A 2QEXF 5CA0A 4X20B 1JJ2F 3WGMA 3QTYA 3K14A 1U43A 1VQ5F 2UYNA 5LYJB 4BW0B 3RYFA 3IR9A 1GZ0A 2Q1XA 4X1KB 2R751 3JARB 4LNUA 1H47A 3E22A 3LWPC 5HY0A 1JFFA 3CMAF 1UFYA 4B5CA 3JVHA 3LMEA 1QU9A 3VMFB 3S0YA 1COMA 1GO1A 3OW2F 4ZHYB 3LYBA 4TV8B 5B8FA 3NMUC 1TVKA 3KHNA 5HP7A 3RE3A 1VK3A 2CW4A 4TV9A 3CC2F 3HKCB 1TUBB 3UT5A 3LDTA 1K9MH 5KX5B 4I50B 1X25A 1M90H 3I3FA 5EYPA 3AGKA 5FNVA 2Z1TA 5C8YB 5ITZA 1IV1A 2OTMA 3HKEB 3JAKA 1IV4A 1W3EX 2RHOA 2LCAA 1XHOA 2RHJA 3M84A 1NQ3A 1KD1H 3CD6F 4YJ3B 3CCJF 4FFBB 4BT5A 1W2BF 1IV2A 4O2AA 2ZVZA 4O4LB 4X1IB 3HAXD 3RYIB 1YJ9F 2VGNA 3TD5A 3CPQA 1W57A 3JAWA 4C8EA 3HKBA 1FSZA 3P10A 3JATA 3CC4F 3LWOC 3K12A 3KIZA 3E1YA 2B33A 5J2UA 3GTZA 4BT6A 5EIBD 4O4HA 5LA6B 2KTVA 3RYHA 4TZZA 3JALA 4U3JA 5EB0A 5AVMA 4G4WA 2V9YA 5GONA 1X52A 2R6R1 2HQSC 3P4EA 3MDOA 4ZK7A 2I6RA 2I6DA 2UYNB 5DCVA 3RYFB 1VQPF 1YGYA 3S03A 4IHJB 3GYQA 4R40B 4LNUB 5G4VC 3FD5A 2IQQA 1VH8A 3E22B 4C4WC 1JFFB 3NVKE 3WJPA 3FBAA 2GVIA 3LFOA 3WJRA 3PAFA 3HJWC 4IIJB 1Q82H 2P6YA 2VAPA 1TVKB 5A2QM 1VQ4F 3CC7F 3EORA 4TV9B 5CA1A 4ZHVA 1Q8RA 2CHSA 4G4XA 3LWQC 3IKEA 3UT5B 3JAMM 3JCMM 3K0TA 3G71F 2QA4F 1VQMF 1PF5A 2KTUA 1XV2A 5EYPB 5EZYA 5FNVB 1XBIA 1W41A 3HWUA 3SIVA 3JAKB 2Z01A 1VQOF 3IEQA 5GINC 1RA4A 1QAHA 2RB9A 3F0GA 4O2AB 2BO1A 3NK6A
chains in the Genus database with same CATH topology
3WPXA 2LBTA 2LCAA 5EAZA 3S02A 4G4YA 3CYQA 4B5CA 2K1SA 2ZF8A 4ZHVA 4B62A 3S0YA 3S06A 4ZHWA 4G4XA 1OAPA 2ZVZA 2MQEA 4ZHYB 3TD4A 3OONA 4G4ZA 4G4WA 2KGWA 1R1MA 5EB0A 5EB1B 2ZVYA 2HQSC 3KHNA 3S0WA 4PWTA 2N48A 3S0HA 4G4VA 3TD5A 3S03A 2AIZP 4R40B 3CYPB 3IMPA 3LDTA 3WPWA 2L26A 4G88A 3TD3A 2ZOVA 4RHAA 2W8BC 4ERHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WPX A;  2LBT A;  2LCA A;  5EAZ A;  3S02 A;  4G4Y A;  3CYQ A;  4B5C A;  2K1S A;  2ZF8 A;  4ZHV A;  4B62 A;  3S0Y A;  3S06 A;  4ZHW A;  4G4X A;  1OAP A;  2ZVZ A;  2MQE A;  4ZHY B;  3TD4 A;  3OON A;  4G4Z A;  4G4W A;  2KGW A;  1R1M A;  5EB0 A;  5EB1 B;  2ZVY A;  2HQS C;  3KHN A;  3S0W A;  4PWT A;  2N48 A;  3S0H A;  4G4V A;  3TD5 A;  3S03 A;  2AIZ P;  4R40 B;  3CYP B;  3IMP A;  3LDT A;  3WPW A;  2L26 A;  4G88 A;  3TD3 A;  2ZOV A;  4RHA A;  2W8B C;  4ERH A; 
#chains in the Genus database with same CATH topology
 1SA0 A;  3F0F A;  1W55 A;  2ZOD A;  3IEW A;  5J2T B;  3CB2 A;  3I7T A;  1OFU A;  4B62 A;  3E20 B;  1FFX A;  3O85 A;  3N4Z A;  5IYZ A;  2GZL A;  1K73 H;  3CCR F;  3S0W A;  3HKB B;  1YJW F;  3ELC A;  1VQ8 F;  4DXD A;  3FFM A;  5HY4 A;  5MN4 A;  1H48 A;  2L26 A;  1YIJ F;  1VQK F;  5J2U B;  1U3P A;  3HKD A;  3V3T A;  3CPW F;  5JVD A;  3RYH B;  1YHQ F;  3JAL B;  4U3J B;  5GON B;  2VAW A;  4KWE A;  3CCQ F;  3C9T A;  2HS0 A;  2Q1Y A;  4BT7 A;  1W58 1;  4X3M A;  1NMU B;  1R1M A;  3D54 A;  2LBW A;  4O2B B;  1VQN F;  3ZP4 A;  2YYE A;  1YIT F;  3J80 M;  3OBW A;  3WXM B;  3M1X A;  3ZP7 A;  2Z1U A;  4NQ3 A;  5CA1 B;  3L7Q A;  4X3L A;  1NJI H;  2QTP A;  2H8E A;  2HX0 A;  1DBF A;  3CYQ A;  4RQO A;  2RHH A;  3VYS C;  2MQE A;  3MBM A;  4O4I B;  1KNJ A;  3HTN A;  4O4J A;  2OHW A;  4I4T A;  2NMU A;  5EIB C;  5GAN K;  1H7M A;  4NUT A;  3N2G B;  1SA0 B;  1IPA A;  5HY1 A;  5GIO C;  2CWJ A;  4HNA B;  4NWO B;  3G4S F;  1PXW A;  4RHA A;  5CB4 B;  3J7A R;  4DRX A;  2OTJ F;  2VXY A;  3CCL F;  1W5A A;  2H6L A;  4U39 A;  5IYZ B;  2OTL F;  1RLU A;  5HXU A;  5KMG A;  2FC3 A;  3DDN A;  1ONI A;  2EWC A;  2CSL A;  3V7Q A;  4X1Y A;  2WAL A;  5LXT A;  3OON A;  2CZW A;  5BMV A;  5CA0 B;  3I55 F;  4BVR A;  4BT3 A;  4F6R A;  1JN1 A;  3R0P A;  4BT2 A;  3CXC F;  3PLA C;  3RA5 A;  3MCA B;  4ERH A;  2QI2 A;  3MQW A;  2CVL A;  1E7K A;  2G9I A;  3CCU F;  1N8R H;  2H8C A;  1ZWZ A;  3JAR A;  3VOA A;  2HRY A;  4I55 A;  2HP3 A;  2ZVY A;  2CHT A;  1W40 A;  4C81 A;  5JQG A;  3N2K A;  3T80 A;  2DT4 A;  1W42 A;  4TV8 A;  2Z1E A;  3WGN A;  1KQS F;  1JY8 A;  5ITZ B;  1X7O A;  3WGK A;  3VYU C;  3KE1 A;  1TUB A;  2F9Z C;  1DT9 A;  5KX5 A;  3RYC A;  2JNB A;  5FLX M;  3K2X A;  1RQ2 A;  4O4J B;  1W5B A;  3WGL A;  4I4T B;  3VO8 A;  2ZF8 A;  3D00 A;  2VAM A;  2IAF A;  1U40 A;  3Q8H A;  5HXZ A;  4FFB A;  1SZQ A;  3JAW B;  5IJ0 A;  1KNK A;  3JAT B;  4BT4 A;  1CN7 A;  4EB6 A;  4DRX B;  4M8I A;  3WGJ A;  4ZI7 A;  1FNJ A;  5LP6 C;  2RHL A;  4ZOL A;  3RYI A;  4WBN A;  1ODE A;  4YJ2 A;  5KMG B;  4BVQ A;  4EI7 A;  3D01 A;  4O4H B;  1M1K H;  4X1Y B;  5LXT B;  1SDS A;  3QHD A;  3VTI C;  5BMV B;  3M4S A;  5EAZ A;  5MN6 A;  3NK7 A;  3VOB A;  3S02 A;  4G4Y A;  4F6R B;  3DC2 A;  3B6N A;  1Q7Y H;  4G4Z A;  1VQ9 F;  5IJ9 A;  5EWR A;  5HWE A;  1W59 A;  4BVS A;  3N4Y A;  2PHN A;  2DYY A;  2ZAU A;  2VGM A;  5GIP C;  1QD9 A;  3G6E F;  4IHJ A;  2ALE A;  1VQ7 F;  1VQ6 F;  4I55 B;  4BVT A;  3FD6 A;  4TUY A;  1RLG A;  1W5F A;  3LWR C;  5JQG B;  3N2K B;  1W5E A;  4ZHQ A;  4IIJ A;  4ZHW A;  1OAP A;  5EZY B;  3IKF A;  2UYJ A;  5LP6 A;  3OBY A;  4B45 A;  2UYP A;  3RYC B;  3KJK A;  1CLI A;  1K8A H;  1QVG F;  3F6M A;  5JCO C;  3ERN A;  5EO3 A;  2W8B C;  1J7H A;  3VI6 A;  5IT9 M;  1FFX B;  1VQL F;  1Z5V A;  2HP0 A;  4EI9 A;  3LWV C;  3JAS A;  5IJ0 B;  2HS4 A;  5G4U C;  1X7P A;  4EB6 B;  5EB1 B;  3BYQ A;  4ZI7 B;  3CCV F;  4ZOL B;  4WBN B;  5J2T A;  3V4D A;  4YJ2 B;  4G4V A;  3CCS F;  3HKD B;  1YJN F;  2AIF A;  3CG6 A;  5JVD B;  3ZO8 A;  1U3L A;  3WPW A;  3SIU A;  5MN5 A;  1CK2 A;  1Q86 H;  5LOV A;  1S72 F;  5JH7 A;  4B46 A;  5GAP K;  4X20 A;  5IJ9 B;  3FPI A;  5HY2 A;  3VYT C;  3MCQ A;  1Z5W A;  4LCK A;  5LYJ A;  3ESJ A;  1YI2 F;  2UZH A;  3CCE F;  4X1K A;  1XRG A;  1RQ7 A;  4BY9 D;  3J81 M;  3ZOP A;  3WJQ A;  5JCO A;  3CCM F;  3S0H A;  3I56 F;  5HP8 A;  3QUW A;  1QVF F;  3VIU A;  3CYP B;  4TUY B;  4C8G A;  3TD3 A;  5FJ4 C;  3NVI B;  2IG8 A;  2ZOV A;  4O2B A;  3F0E A;  4ZHQ B;  4E6E A;  3CME F;  3HKC A;  4EI8 A;  4I50 A;  1KC8 H;  5LP6 B;  3WPX A;  2LBX A;  2LBT A;  2HS3 A;  1T0A A;  2PMP A;  2HVY D;  2FGY A;  2K1S A;  5C8Y A;  3S06 A;  1JD1 A;  3HKE A;  1T0K B;  2BTO A;  2YXZ A;  3TD4 A;  4C82 A;  2HRU A;  3U0O A;  1FNK A;  2GLZ A;  4PWT A;  4YJ3 A;  3F0D A;  1VQV A;  3C8L A;  1Q81 H;  2AMT A;  2AIZ P;  4O4I A;  3IMP A;  2Z1F A;  3C9S A;  4G88 A;  4XCQ A;  3C9U A;  2HP0 B;  2BTU A;  4O4L A;  4X1I A;  2OZB A;  3JAS B;  3RA6 A;  1UI9 A;  3ON1 A;  1YQN A;  3N2G A;  3GHZ A;  4HNA A;  1GO0 A;  3V7E A;  3P0Z A;  2UYK A;  5CB4 A;  2BTQ B;  1GX1 A;  4C8I A;  3C9R A;  2KGW A;  3KJJ A;  1IV3 A;  2N48 A;  1VHA A;  3VCZ A;  5LA6 A;  5LOV B;  5JH7 B;  2KG4 A;  2QEX F;  5CA0 A;  4X20 B;  1JJ2 F;  3WGM A;  3QTY A;  3K14 A;  1U43 A;  1VQ5 F;  2UYN A;  5LYJ B;  4BW0 B;  3RYF A;  3IR9 A;  1GZ0 A;  2Q1X A;  4X1K B;  2R75 1;  3JAR B;  4LNU A;  1H47 A;  3E22 A;  3LWP C;  5HY0 A;  1JFF A;  3CMA F;  1UFY A;  4B5C A;  3JVH A;  3LME A;  1QU9 A;  3VMF B;  3S0Y A;  1COM A;  1GO1 A;  3OW2 F;  4ZHY B;  3LYB A;  4TV8 B;  5B8F A;  3NMU C;  1TVK A;  3KHN A;  5HP7 A;  3RE3 A;  1VK3 A;  2CW4 A;  4TV9 A;  3CC2 F;  3HKC B;  1TUB B;  3UT5 A;  3LDT A;  1K9M H;  5KX5 B;  4I50 B;  1X25 A;  1M90 H;  3I3F A;  5EYP A;  3AGK A;  5FNV A;  2Z1T A;  5C8Y B;  5ITZ A;  1IV1 A;  2OTM A;  3HKE B;  3JAK A;  1IV4 A;  1W3E X;  2RHO A;  2LCA A;  1XHO A;  2RHJ A;  3M84 A;  1NQ3 A;  1KD1 H;  3CD6 F;  4YJ3 B;  3CCJ F;  4FFB B;  4BT5 A;  1W2B F;  1IV2 A;  4O2A A;  2ZVZ A;  4O4L B;  4X1I B;  3HAX D;  3RYI B;  1YJ9 F;  2VGN A;  3TD5 A;  3CPQ A;  1W57 A;  3JAW A;  4C8E A;  3HKB A;  1FSZ A;  3P10 A;  3JAT A;  3CC4 F;  3LWO C;  3K12 A;  3KIZ A;  3E1Y A;  2B33 A;  5J2U A;  3GTZ A;  4BT6 A;  5EIB D;  4O4H A;  5LA6 B;  2KTV A;  3RYH A;  4TZZ A;  3JAL A;  4U3J A;  5EB0 A;  5AVM A;  4G4W A;  2V9Y A;  5GON A;  1X52 A;  2R6R 1;  2HQS C;  3P4E A;  3MDO A;  4ZK7 A;  2I6R A;  2I6D A;  2UYN B;  5DCV A;  3RYF B;  1VQP F;  1YGY A;  3S03 A;  4IHJ B;  3GYQ A;  4R40 B;  4LNU B;  5G4V C;  3FD5 A;  2IQQ A;  1VH8 A;  3E22 B;  4C4W C;  1JFF B;  3NVK E;  3WJP A;  3FBA A;  2GVI A;  3LFO A;  3WJR A;  3PAF A;  3HJW C;  4IIJ B;  1Q82 H;  2P6Y A;  2VAP A;  1TVK B;  5A2Q M;  1VQ4 F;  3CC7 F;  3EOR A;  4TV9 B;  5CA1 A;  4ZHV A;  1Q8R A;  2CHS A;  4G4X A;  3LWQ C;  3IKE A;  3UT5 B;  3JAM M;  3JCM M;  3K0T A;  3G71 F;  2QA4 F;  1VQM F;  1PF5 A;  2KTU A;  1XV2 A;  5EYP B;  5EZY A;  5FNV B;  1XBI A;  1W41 A;  3HWU A;  3SIV A;  3JAK B;  2Z01 A;  1VQO F;  3IEQ A;  5GIN C;  1RA4 A;  1QAH A;  2RB9 A;  3F0G A;  4O2A B;  2BO1 A;  3NK6 A; 
#chains in the Genus database with same CATH homology
 3WPX A;  2LBT A;  2LCA A;  5EAZ A;  3S02 A;  4G4Y A;  3CYQ A;  4B5C A;  2K1S A;  2ZF8 A;  4ZHV A;  4B62 A;  3S0Y A;  3S06 A;  4ZHW A;  4G4X A;  1OAP A;  2ZVZ A;  2MQE A;  4ZHY B;  3TD4 A;  3OON A;  4G4Z A;  4G4W A;  2KGW A;  1R1M A;  5EB0 A;  5EB1 B;  2ZVY A;  2HQS C;  3KHN A;  3S0W A;  4PWT A;  2N48 A;  3S0H A;  4G4V A;  3TD5 A;  3S03 A;  2AIZ P;  4R40 B;  3CYP B;  3IMP A;  3LDT A;  3WPW A;  2L26 A;  4G88 A;  3TD3 A;  2ZOV A;  4RHA A;  2W8B C;  4ERH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...