3WGLA

Staphylococcus aureus ftsz t7 mutant substituted for gan bound with gdp, deltat7gan-gdp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
303
structure length
303
Chain Sequence
LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGANLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Structural change in FtsZ Induced by intermolecular interactions between bound GTP and the T7 loop
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
total genus 90
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3wglA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3wglA01
3HKEB 3ZIDA 5LXTA 1W5EA 3JAKB 1W5AA 5JQGB 4I50B 4EI8A 5CA1A 4X1KB 5MN4A 1RQ7A 4X1YB 3C8LA 4YJ2B 5LA6B 3RYFB 4EB6B 1TUBB 5IJ0B 4O4HA 4I55B 3HKDB 2GVIA 3VO9A 4U3JA 4IHJA 2R751 4LNUB 3VOBA 4I4TA 5C8YB 5J2TB 1Z5WA 4YJ3B 4O2BA 5LYJA 3RYHA 5ITZA 1W5FA 4EI9A 4EI7A 4HNAB 4O2AB 5LOVB 2BTQA 3HKCA 5EYPB 3ZBPA 4TV8A 4X20B 4FFBA 5KX5B 5CB4A 1FFXA 5EIBC 5GONB 2VAPA 3WGMA 4TUYA 5CA0A 4ZOLA 5LP6A 5BMVA 2RHJA 5KMGA 3JAWB 3N2KA 2VAMA 3JATA 4ZHQA 3HKBA 4DRXB 5CA1B 5MN5A 5J2UA 5JVDA 3RB8A 3UT5A 5EZYA 3N2GA 3RYCB 5FNVA 4F6RA 1SA0A 4B46A 4X1IA 5JCOA 1W581 3CB2A 4O4JA 5JH7A 4O4LB 1RQ2A 3HKEA 3E22B 3RYHB 2Q1XA 1TVKB 4WBNB 3JALB 2BTQB 4XCQA 4O4IB 4TV8B 3JAKA 4TV9B 4FFBB 3RYIB 4I50A 4M8IA 4X1KA 3VOAA 4X1YA 3RYFA 4IIJB 3JASB 5LA6A 4EB6A 5IJ9B 4YJ2A 5IYZB 1TUBA 5IJ0A 5CA0B 4I55A 3HKDA 3VPAA 2RHHA 1RLUA 3WGNA 5LXTB 1FSZA 3N2KB 3JARA 5C8YA 5J2TA 5MN6A 3JATB 4HNAA 4ZHQB 3HKBB 4O2AA 5LOVA 2RHOA 3ZBQA 4X20A 4ZI7A 1JFFA 4O4HB 5KX5A 4U3JB 4IHJB 1W5BA 3WGLA 4E6EA 4I4TB 5GONA 5M7EA 2R6R1 3WGKA 4O2BB 5ITZB 5JH7B 5LYJB 2XKAA 4B45A 5LP6C 3HKCB 3V3TA 3JAWA 5JQGA 5CB4B 1FFXB 4DRXA 4U39A 4TUYB 3M89A 2VAWA 3RYCA 4ZOLB 5LP6B 3M8KA 5BMVB 4LNUA 3WGJA 5KMGB 5JCOC 3R4VA 2BTOA 4YJ3A 4O4LA 3JARB 2Q1YA 5J2UB 3E22A 5EYPA 5JVDB 2XKBA 3UT5B 1TVKA 4WBNA 5EZYB 3JALA 3N2GB 2RHLA 5FNVB 1OFUA 4O4IA 4F6RB 4ZI7B 1Z5VA 1JFFB 1SA0B 4KWEA 4TV9A 3RYIA 4X1IB 2VXYA 4DXDA 4O4JB 5IJ9A 4IIJA 3JASA 5EIBD 1W59A 3VO8A 5IYZA
chains in the Genus database with same CATH superfamily
1G17A 2YYSA 3IQDB 3RU7A 2FW7A 3AQ4A 2QT1A 2PH7A 4IVPA 4Y1RA 2FOIA 5KNCH 1ZVKA 2HJSA 5SZKB 1T5TA 1MV5A 2PFGA 3W04A 5AM0A 2I3ZA 1ZZEA 3L49A 1VE3A 4JI3B 3S1AA 2IVZA 3ENKA 2QE6A 4XX0B 1U40A 3RCBA 1ZWKA 3UMBA 4C7MA 4CUJA 4EB8A 3J81A 3BQ9A 1JG1A 3Q3GE 4IF4A 1U2GC 1OXKB 3C6ZA 3DMDA 3C6YA 2AHRA 2RSLA 4G0YA 4KUEA 2H3EA 1WCIA 4MVJI 3AR3A 1Z4OA 3R4CA 1H2RS 2JRCA 1RPAA 2F48A 1MC8A 3KQNA 1QGZA 2IEIA 2UVPA 3NIWA 4P3NA 4B71A 3Q6IA 3C5WP 4EI2A 2GEFA 5D6NA 2EBUA 1CQWA 3EZNA 2W2OA 4DG8A 2RC5A 4X92A 5TPWA 3E5RA 4QU5A 1L3IA 3I9KA 1JSXA 3KTOA 1Q3HA 2HCJB 2IU4A 3VNUA 2HRUA 4PHCA 4S04A 2O8CA 2XE8A 1LPMA 2NYUA 2FPSA 4F4HA 4TTJA 1YKFA 3UV7A 4B32A 1V1MA 1XEWX 4YRFA 5A9SA 3F78A 4NJEB 4IIHA 2WV7A 4ZVLA 5AVOA 4RWZA 3A70A 2FN4A 1E2BA 3ANSA 1U63A 2FFRA 3IDAA 4JLKA 4TM8A 2HV9A 4P4TA 4BUZA 3R9IA 3K20A 5FL7A 4EZIA 3INTA 4YAFA 3WISA 1JMVA 2GSDA 3UIEA 3RWBA 3BE6A 4F4JA 2H9YA 3TUJC 4A3SA 5FXMA 4ND1A 3UFXA 2B7BA 1E69A 3CZCA 5ULLA 1JQ5A 4GZ6A 3QNMA 3R44A 5JXIA 2BEUA 3QE0A 2C2GA 4EITA 1V9CA 3TW8B 2GO7A 3WSVA 3SG0A 4DWWA 1W48A 2AN5A 2PUJA 1QVRA 2ZVDA 3PHCA 4QAJA 1OH6A 4BY9E 1IHUA 1QK4A 1WQ1R 1FYEA 4I50F 5BSGA 2C29D 2VJAA 2YWCA 3DO5A 3K2BA 1TYBE 1SB9A 5LMNB 4W9NA 4CODB 1GGKA 1B1AA 1HA3A 2RJNA 3GN2A 4HWRA 1NVGA 4XCVA 5ALKA 5IKEA 1ZLYA 4MQFB 4WY8A 4PC3A 2BCEA 1C9DB 5AP9A 1NF3A 1FYWA 4Y6QA 5TEVA 2MSEB 1F8YA 5G0WA 3S2ZA 1GT91 1TZJA 4ZVQA 3FCAA 5DWVA 3EF0A 3GP3A 3EVCA 2ZRCA 3P97A 4JHLA 4ITVA 4MW9A 5I7OA 1AZSC 1KERA 4N18A 2X14A 4EIWA 5BQXA 2WUDA 1EG2A 4LCBA 4E0BA 2A5GA 3K70C 3T54A 4TLBA 1IN4A 1OYOA 4CTNA 1S1CA 4V2UA 3ROPA 4C5CA 4GUAA 1XQ1A 1IB0A 1HYGA 3ZE0B 3QXJA 3TTWA 1DBIA 3TGWA 1GTSA 3VYTB 5KPDA 1HFEL 3QEJA 2AEEA 1RE0A 3DOIA 4TWRA 3KIPA 2FGKA 2QKYA 1CUIA 2J4FA 1Z0AA 2ODNA 4M54A 4DSZA 4UNRA 1QJCA 2OQRA 4J07A 5E95A 5DLEA 5EE1A 2CVQA 4PHHA 1UM9B 1C0EA 4FW8A 3LG2A 3MGKA 3DSRA 1VYTA 4AW9A 2AMLA 2F62A 3L4BA 4LXXA 2YIVX 4ISCA 3UK7A 2F43A 3BFKA 1CU1A 1J0XO 2E4XA 4A0FA 3C3DA 3TW4A 4HNQA 3IESA 2DZDA 4HH3C 3JU3A 2EQAA 3E9YA 5JAIA 2CLOB 2UAGA 4YR9A 3T5AA 4Z53A 1RMQA 2WJHA 2HBRA 1Y37A 1N75A 2NZUG 1GAJA 3D7KA 3FUCA 2ZI9A 4LJSA 3MCAB 3RM3A 2FPMA 1JILA 3OMWA 1VCMA 4P7JA 2REQA 3DMGA 4C6TA 3COZA 5BUSA 1RYZA 3ZHUA 1NUAA 2FWRA 4TL8A 2ZTUA 2GBIA 3ON5A 2W22A 4EJ2A 3D2AA 1OLUB 3AHDA 4AVYA 2C98A 4K28A 4NV1A 4DUZB 2PYDA 3QVGA 3NFYA 1R1DA 1YULA 5JPCA 5FV7A 2BM1A 3K9NA 3NP7A 4K2HA 5CHEA 1ZICA 4C05A 3KKPA 3WGHA 4JASB 3OW2F 2CJFA 3QLEA 4R0NA 2X0NA 3AR2A 2OZLB 1JVBA 1EX9A 2EG5A 3N76A 3D0OA 1E1DA 4W1QA 1O5OA 2QG9A 4EBFA 1OZHA 1U9CA 2O14A 5I9MA 1SIBE 2DFLA 4OHRA 1WPXA 5JE8A 4DIBA 3GDGA 4ZOLF 1HM5A 1ZIPA 1TD1A 4TL9A 3I62A 2J9FA 3CCCA 3W8RA 2YWHA 3DA8A 2AFIA 1XCBA 3RRFA 4H0FA 4AULA 4BT5A 2AG8A 8MHTA 3L77A 1ZWLA 4U7FA 4WBNB 2HGZA 4LVNA 2C5BA 2E55A 2ZYSA 1OXUA 2EIXA 4LQ4A 1PZMA 2PV7A 1PWZA 1ZRSA 4XD7A 3W0LB 2I2BA 1R8JA 1MH1A 5DULA 3U39A 1BMFA 4PLVA 4TQGA 1PQWA 3W3ZB 4CTOA 3BYQA 4YMIA 1F9AA 3O82A 5C7IO 3BVPA 3G2QA 2G08A 3IE2A 4UBLA 4F5WA 2ALJA 3UA3A 3MEQA 4J7AA 1OGJA 1LDBA 5CFRA 1K5PA 3BE8A 1WETA 1Z7WA 1R7RA 4IGIA 5CTJA 3CPQA 4X93A 4CCAA 1E98A 1FLVA 4HNSA 5GAJA 3FMVA 1O58A 3C3XA 1N8SA 2PGJA 1JB1A 4OH7A 3AVOA 3LPDA 3MG9A 3NI2A 4GNKA 4KPUA 4LDRA 4MS3B 4B43A 1RQGA 2V74B 3ZY2A 1IV4A 2WU0A 1UT8A 5JAHA 4LF9B 2EW1A 2H2DA 3DKRA 4P3KA 1JR3A 3WLKX 1WR8A 3UFBA 2J3HA 4MQEB 4PFSA 5F5NA 3AGPA 1H85A 2AR0A 2X8BA 1NX6A 3H2ZA 4PYQA 3IP9A 2VCEA 3BS4A 1AURA 3FZGA 3JR3A 3N8DA 4LYEA 4P53A 4TS4A 2ZSJA 5EHGA 5AQEA 4KR0A 1PNOA 3PLNA 3WJPA 3QRWA 2YIMA 5C7OO 1ZDMA 2BEVB 4PWZA 1EWVA 2IOFK 2XECA 2VYNA 3FPKA 4OSPA 3BWYA 3MB8A 4HWTA 4CLRA 3EWAA 3OE1A 1UWCA 1VQ5F 5DTIA 1SBQA 5M2QA 2PUDA 4MXDA 1OGYA 1VJTA 3BH6A 2HMYB 5B30A 1SXJA 1E1CA 1PTKA 2ZYGA 4KKVA 4EJSC 4FOOA 2WKQA 4WZAB 1NVTA 1SAYA 2B5OA 1WPQA 3L8FA 4Q4AB 3PDUA 1PGQA 1KQOA 3QUAA 1PE0A 1NNEA 4UHDA 1U8AA 2PVPA 2QUHA 2VFAA 3MC1A 3BCRA 4DLAA 5LM3A 2IS1A 3SBDA 1JHDA 4C4YA 4XD7D 3I7TA 1USVA 4PBRA 1N6IA 1BMFD 1SU7A 2CHTA 2PA3A 3ACBA 3L8DA 3I39X 4P54A 4LDZA 2FZLA 4C21A 3N0VA 3Q8XB 1OQAA 3DOOA 3VOTA 1Y6FA 3LXMA 4KVAA 5NULA 4E5PA 3OCVA 1TRKA 2CL5A 3PLRA 1HE5A 5JQGB 1OMOA 2ZAUA 1ZU4A 3W6UA 3KUCA 3ZW7A 1A7UA 1EMDA 3ULKA 2ZJ7A 2YXDA 2B4KA 5KYXB 621PA 1CLEA 3QHAA 1IZ0A 1DAPA 1KYTA 4AIRA 4FDUA 2VYQA 1Y0BA 2WU3A 3U3RA 4U2KA 1DC8A 1GO2A 1AGXA 4WNCA 3A9VA 2EFHB 4KXXA 1PJ8A 4W9RA 5HRUA 4HNAB 1F2TB 1FP4A 1R5NA 4XVUA 1QG0A 1I6WA 3WMRA 4TV8A 1KQPA 3ITNA 2QGNA 4TMFA 2V7UA 4QODA 3QF4B 4IHJF 2HC9A 4GLJA 1Q11A 2VSQA 2VYND 4V0RA 1PUJA 5AVTA 1NG9A 1CP3A 4P7KA 2GZAA 4YNBA 5JECA 2O19A 1A7JA 4MUBA 4HDQB 3SP1A 4U1RA 1SXJD 1MORA 4E09A 4ETIA 1VQOF 1P0QA 2G63A 1SZJG 4OQMA 1OXSC 3FHOA 4GZLA 2GD6A 3STHA 1HORA 4OIFA 3KSZO 4M1QA 4BJ5A 2V7PA 3H97A 4G1UC 4I9UA 3D1JA 1V48A 3N70A 5KYYA 4DCTA 1MJ5A 2V5AA 4QDKA 3JR7A 2C82A 1WDTA 1SOVA 2L18A 1OA0A 1LB1B 4TKUA 3KPJA 3K2XA 2CEKA 1GCGA 4EY4A 2JLYA 1F3LA 3AR5A 4JYPA 3RV4A 4QNMA 3BTOA 1CE8B 5IVIA 4DCVA 1S2LA 5LSAA 3U7FB 5D87A 1D5WA 1LU9A 5HMLA 2GCOB 2Q3LA 2G9ZA 4AT1A 4DQ0A 2G6BA 2XCQA 5EJ2A 1N0IA 1NXSA 1Y63A 2H1IA 1IC6A 1N2CB 4AU1A 2O8FB 2R1VA 1U8TA 4NS1A 3PFHA 3K1AA 5F12A 4COKA 3DP7A 3TG2A 2AW3A 4XYGA 1IFXA 1E8MA 2I3AA 2XEXA 4HS9A 5CFQA 1DG9A 1IG3A 1SUDA 2O6HA 3BL6A 3L1VA 5EXXA 3Q87B 5B36A 2GEDA 1VPLA 4NNJA 1QX4A 4ZC8A 1SXQA 3GBVA 2RKWA 3KHTA 5KNCA 3DG9A 1GVNB 2W8BC 4MUJA 3HVHA 5D01A 4C4TA 4IICA 5EE9A 1JAIA 1M1YB 2K7ZA 2OUKA 3AB3A 4U2DA 4C87A 1KZHA 5FB3A 3LMEA 4L16A 5AKJA 1PF7E 1P5FA 4OHBA 3JTEA 2YQZA 3ND9A 4KXFB 2DR0A 3AF0A 3BWVA 3GFRA 1QE0A 3WS7A 1FJXA 4GKVA 1HG0A 4UUMA 2XADA 2A9VA 4TLLB 1EFAA 1RMTA 3GGSA 1ULHA 1XTIA 5H9VA 2Y1FA 1EUDA 2ZBFA 4GGOA 4KO8A 4QDTA 3FFTA 3LUKA 5DBHX 2CJWA 3QX9A 4L02A 1XK6A 2JIZA 4PG8A 1X80B 3LGSA 1CQZA 1CETA 4XOIA 3T12A 3QJYA 1JE1A 3ZIUA 4DEYA 1QFZA 1PZEA 4UXHA 1LSSA 4JGGA 4L76A 4LZPA 3H04A 3ZHXA 3MJEA 3N2GB 1HTWA 4HWKA 3M1LA 3QOYA 5CLJA 1WEHA 3F4BA 4FFOA 1PK9A 4H7KA 4HNTA 3FI9A 2K4MA 2XWBF 2P4UA 1U31A 3EIHA 3QQ5A 4XVCA 1XEFA 4ZDJA 5EGNA 3HJNA 2YXEA 3F6SA 4BNUA 3C3MA 4DSOA 1IK4A 3ETHA 3ZHCA 4DNQA 1TM2A 4WZBE 2WU8A 3WYCA 4HO1X 4R5MA 3IBYA 4AQ7A 3SR0A 2TMYA 2PUWA 2QTBA 2VJPA 3EC1A 4RHCA 5EWJA 4OHMA 2CXNA 5FNZA 5KNCD 2NXJA 4WUVA 1URPA 2H7VA 2OCIA 2PZKA 2W37A 1WA5A 2WSIA 2HWKA 5EG5A 4LCKA 4RZ3A 2I4IA 2GNPA 3OEEA 2IGTA 3A31A 2A9FA 4P36A 2Q5CA 1V11B 2JIPA 4MB0A 1H23A 1OXBB 1XKTA 2RHCA 3B3QA 3K0BA 3R0PA 3M6UA 3MXOA 5L3SB 2YBDA 5DVZA 1FDVA 3TRDA 4MR7A 4YHHB 3A32A 1C4XA 2VYCA 3SX4A 3CLKA 4N65A 5KZMB 1YS4A 2EX4A 3USCS 1FQJA 2O2GA 4B6JA 1K0UA 3IPXA 2JIZD 1CERA 4BFVA 1NI4B 1FFHA 4F5EA 5JCPA 2V8OA 4DRYA 5IZCA 1LJ8A 1Q0UA 2WG2A 3HZZA 5P21A 1UJNA 3RB8A 3MJHA 1ES9A 1ORVA 1YZKA 1RXVA 2QZJA 3EBOA 3KQYA 3T15A 5JMTA 3EASA 3ZQUA 3LX4A 3MERA 4PINA 3REFA 3IAS6 5DPMA 1E3LA 2VHJA 3EFHA 1KZ7B 1OI7A 4O4JA 2MJLA 3OFSA 4PHGA 1H1TA 1CUGA 2Q21A 3V7EA 2CVPA 1E89A 1D8TA 1XTQA 4LJ8A 1Y6ZA 3NYIA 4Q6WA 1NV8A 2BTQB 2Y9MB 1U8EA 5LZ5A 3PQ6A 3BFVA 4URYR 1K7SN 4B3CA 3TGLA 2LUOA 3DEHA 2Z04A 1KO1A 4KBGA 3S0WA 4Q01A 1QQBA 2XUZA 3GGOA 4M9ZA 1AKNA 1T24A 1JIQA 1EK5A 2G1UA 1ZGCA 1IEWA 4WNYA 1L5OA 3PNSA 2VT3A 4TXHA 1I2AA 1OX5A 3WL3A 4R3WA 3RAJA 4D46A 4EG3A 5C1PA 3QM1A 2PTGA 3L4SO 3GUUA 3OEED 3QBVA 3DD5A 1LA2A 3ILVA 3PCRB 3DYBA 3ZGOA 3ZDAA 5F2NA 3RU2A 1JJAA 3ZHTA 2XOEA 3G9QA 5H68A 4X63A 4RORA 4U3JB 1P9WA 3VTFA 2DBZA 5ALXA 4YO7A 3M6WA 3TINA 2GXQA 4G41A 4RNCA 2JGAA 5ILGA 4Q7JB 4M1EA 1JF8A 3TUIC 4UREA 1II0A 1FDUA 5FBHA 3M4ZA 4G0MA 3VNSA 2WYOA 3HI6A 3H3XA 5IJAA 3KV1A 4IZIA 4MWBA 1L4MA 3NS7A 3H3FA 1I7NA 1LDNA 3CH7A 4GPBA 4F92B 4G07A 5HJ7A 4TYYA 2CMDA 1ULUA 4QTZA 3VYTC 4YECA 3WRXC 2R8YA 3FGOA 2GA9A 1PUIA 3MCQA 1KTIA 4BXOB 3PNBA 1WXHA 2IP1A 1JQDA 4PG6A 3CLRC 7ADHA 4MV7A 4FE4A 1ISSA 1BXRA 4AZ0B 1XL1A 1A9QA 1P18A 4UMDA 4K9DA 1JDZA 4G4SO 4YCLA 5CD1A 2WIBA 2WIDA 3E23A 4LY6A 5H4GA 3NZEA 4GMHA 4HX5A 4XQCA 4D3DA 2DFKB 5DNWA 3QEMA 5K0BA 2BKEA 3H11B 4O1IA 1ENOA 1R50A 1WAMA 1YQWA 3EVFA 4L9RA 4X6UA 5JXJA 2WR8A 3FDZA 4MDHA 1OI4A 1UEIA 2F64A 4Q6BA 3TZCA 4TRNA 4YFYA 1XWFA 1NJ2A 3I52A 2ZJ5A 9MHTA 1U8CB 2W6QA 3PPXA 3WX0A 2JFOA 1QRSA 3A2MA 1J2TA 4RF2A 3T9AA 1NW8A 3ISTA 4PZCA 4NG5A 1QCDA 1H9BA 3NNSA 5LYJA 1BX3A 4U5QA 3QSGA 1EXNA 1PR3A 3RJTA 4RTNA 2PUEA 2ZUCA 5KREA 2P3QA 2ZATA 4X41A 3KPUA 1MJFA 3UK6A 1KJWA 2JIDA 3MGAA 3OTIA 3PV0A 4B62A 3EWIA 1CBUA 1E58A 4REQB 3U3KA 2BZSA 5CFLA 3M70A 2IPNA 2XNCA 1RKVA 4HAYA 4HLQB 1A50B 3RGGA 5ALLA 1Z8DA 4MVJG 3GDOA 2I7DA 4LWOA 4P34A 1UBOS 1QGED 3AERA 1MXHA 3C24A 3AW8A 5DGTA 3K0TA 1Z4QA 4HUJA 4DT1A 3MJ4A 1G5PA 3D2LA 4HDMB 2C5LA 3WA6A 3RFVA 3E0XA 4BOYA 2XXJA 3B48A 3RANA 3P0HA 1AS2A 1R2QA 4UAGA 2XD4A 5BMVF 2FEAA 1CD5A 1G8FA 2COEA 2Q3JA 3H5OA 5CVVA 2NU9B 3TZLA 4A2PA 2CLEB 2EOAA 5FI1B 1N6LA 1AF7A 3T0GA 1BHJA 4HQ0A 4RY8A 1QHFA 5FR2A 1A95A 1ZCBA 4B9EA 2J9YB 3JAKA 3ILSA 3COJA 2ODEA 5TDHA 2RD2A 1C3XA 4RQBA 5F78A 1M6HA 3O2NA 1Y8QB 1RBMA 1XHLA 2AMFA 2WW8A 3BGDA 3MINA 3BMXA 4PAMA 3TLKA 4DAEA 4F8EA 2MWMA 3JATB 2H1RA 4FLFA 4RY0A 4NOMA 5G41A 3OBIA 2W2NA 3WMGA 3ZUGA 4BVEA 2PKCA 3FYUA 4MVXA 5BT9A 3W2TA 1WP4A 5ALQA 2AJTA 1DDGA 1RJEA 1Y5NA 2NZYA 2O2SA 3ROEA 5ICEA 4HD8A 5C1OA 3B9QA 4L50A 4HGQA 3A9WA 5TX7A 5FEUA 1RI3A 4A7PA 1DCFA 3VFDA 2HAEA 1FL9A 1FU8A 4QQ8A 2YY7A 2HZ7A 5ERXA 1NV9A 1JB9A 4G4XA 4C22A 1J33A 1WW2A 1B15A 2WE8A 3D8NA 1PKXA 4DJTA 2O4UX 2O8NA 2R87A 3BTUA 1S7CA 1RIIA 2R8RA 1L4NA 2PUHA 3I9FA 4EJ6A 3K5IA 3KC2A 2ZBVA 2RB4A 3O4HA 3NFRA 1UZMA 3PTAA 2R1UA 4PQYA 2VK4A 2OXFA 2Z43A 3FI0A 1Q0PA 4Y1GA 2P3LA 2QBYB 3QYAA 5REQB 2ZE7A 3RTEA 2PLNA 3NDIA 3PHJA 1WXFA 2JAUA 3SHVA 1D2EA 1SUIA 2WWIA 3DMPA 5COBA 1YL5A 1R6DA 5ED0A 2ZUUA 3K0SA 1JHAA 5KHOC 2WQZA 1NSYA 2XUOA 3BC1A 3G7UA 4ENRA 2NVUB 1YGYA 4QGSA 2IS4A 1YO6A 1Q0SA 3UA4A 5BT8A 3G0DA 1LDEA 1AHNA 1O5IA 2GESA 2CKDA 1TM1E 2ODPA 2OUIA 3G9UA 4D43A 2ZR7A 3NBQA 3M7IA 1L7MA 2CVFA 1NGSA 2WMYA 3GTZA 3WLMA 1CJBA 5B37A 1P1KA 2VG8A 4Q3CA 2D2FA 2AMYA 2QW8A 4LYJA 1G3RA 1XVIA 3Q4GA 3KLNA 4WBXC 4YJFB 5IYZF 1O94C 2I1LA 3D6JA 3RROA 1KDYA 3ZLUA 2E48A 3IT1A 1G8JA 3PC8C 1ODFA 4CM8A 5GZ3A 4A0SA 1G5IA 4MAFA 1UOPA 1T3HA 4HY3A 2PS1A 3T1YB 2KG4A 4IW3B 1H7MA 4RTSA 1E5XA 3V3KA 1XKXA 5CAEA 4GI7A 3OPQA 4JIGA 2XT9A 3ICCA 2NUTA 3E1KA 3FWNA 4YRBA 3K4PA 2H92A 4FT2A 1N3LA 5ICMA 3WAGA 4XWAA 5DM70 1F2DA 3ZO8A 3ONVA 3HCAA 3SN6A 2YJNA 4BMOB 2QN9A 1O7JA 3GLFA 5TF0A 3WHLA 2X5NA 4MSUA 1NT2A 2JANA 5CEEA 4DILA 1DRJA 2MTBA 4IX9A 2BFEA 4UUAA 3R7LA 1DKLA 1NSFA 3EPKA 3WDLA 3AG5A 3TBFA 2O3SA 3ANNA 5THQA 4YH1A 1HFKA 2YOHA 3FR7A 2VOJA 1NAHA 3CEPB 3ZWOA 4LXQA 4FBGA 1FBTA 3WNDA 3HR4A 3KU4A 4RDHA 1AQYA 5HHTA 1DJMA 2C83A 3FHCB 3K05A 2X23A 4UU1A 2NYAA 4L78A 3D4PA 5JMPA 5BN3B 1QVFF 2F9LA 3CYQA 4LY3A 3NX4A 3RFUA 2RBEA 1P0MA 1J7HA 2VF4X 4I50A 3V46A 4DLXA 2QRLA 3PYMA 3E1SA 5I3ZA 4KZPA 5SYNA 2YC2C 4UNPA 4ZAVA 2BSQA 2QTGA 4BNYA 2RAVA 3EVNA 4X44A 5J59A 1KR2A 3BRWA 5C46F 4MWZA 1QWOA 3AI3A 1U04A 3S68A 1AUPA 3AY7A 5P8WA 4BE7B 1EM6A 5EC8A 5HOQA 1MABA 1FNCA 2OC4A 2DX7A 1T10A 5B57C 2GD1O 2QR5A 3IVXA 4L8FA 1S3SA 4JR1A 4F2DA 4FDVA 4PTLA 1KYZA 1RRPA 4WXEA 3WLRA 3TXXA 1CUAA 3DH0A 4XCXA 1E63A 1UJ4A 4FYXA 4RF4A 3RSHA 5I4IA 1E2KA 2ARKA 2EVWX 2ZI5A 3OLZA 4R1LA 2JCXA 2JCGA 3ZQKA 5JSZB 4DLPA 2IXAA 1JG4A 3AF4A 3C1AA 5CEFA 4M8SA 1ZK4A 2Q5LA 2NO4A 1GG5A 1KS9A 1M67A 1NW5A 3E05A 3JVEA 1BS2A 1ZUD1 2Y68A 3WGTA 3ZYCA 1M2VB 2EFYA 3P10A 2OBNA 3JVIA 2SCUA 4RIEA 4YMSA 1ZITA 5BWCA 4G26A 3FCEA 1X8KA 4UHJA 5EUMA 4ARSA 4QWMA 1Y6RA 1Q20A 4W5QA 5G0UA 4UVDA 3O3MB 2P2DA 3AEQB 3D81A 4N39A 4LJ4A 5AI5A 4E6PA 1H6BA 4J1TC 1COWA 3REGA 1SVSA 2XVZA 4Z3DA 4AKIA 1G0OA 2I34A 2EL7A 2X1MA 3ZCPA 4X1IB 1O6GA 5J5CA 2Z57A 4CUKA 4UVIA 3JQAA 4FK8A 4O4LF 2OYRA 3PHBE 2X0KA 4U2EA 1P1BA 3JQBC 1EINA 3BRWD 4OXQA 3O9VA 5IBRA 3TEMA 1XFAA 3G13A 3VJKA 3ROMA 3MMSA 1DV1A 3NQ41 2BR5A 3LWRC 3K0EA 2ZOSA 4PCUA 5H16A 4DQVA 1NYQA 3LHDA 4GBJA 4U2BA 4F21A 3R0JA 4IM7A 2OQIA 3L0ZA 1ZGHA 3PIIA 1H2HA 4GKAA 1CR4A 1YB2A 4HLCA 3I01M 3IQEA 1TKBA 3MPOA 4N82A 2OVFA 4LJYA 3ZWBA 3GG9A 3HKDB 4B4DA 5HR5A 2DPGA 4RJ2A 1KFEB 5JHHB 2Z8YM 5MFZA 2O5EA 3ORYA 1R00A 4OGKA 5ALPA 4EEKA 3D2BA 1CWUA 2ZT6A 2IWRA 1SCJA 1WUTA 2NT3A 1GPUA 3EEIA 4UJ3A 4XR9A 1U1IA 2IHNA 3A28A 1RWXA 5FWNA 2HCRA 5BN5A 1JJVA 1Y8CA 2P9CA 3DDCA 4M7WA 1U9ZA 5F4ZA 3WWZA 2V7QA 1FFXA 4Q7KA 3MDOA 2CMKA 1DP4A 2BFFA 2I1WA 4I6JA 4MPPA 4A1OA 2HLNA 4B79A 4YDQA 1IYZA 1PYGA 2FG5A 4ZOLA 1YOVA 3PD1A 5A5EA 3ER9A 3M4NA 3L1KA 1MV8A 1LX7A 3E4DA 2BR4A 1HXHA 3H9JA 2CXSA 3L0BA 3VMMA 2OXEA 4R84A 2QW0X 3B6NA 1NMZA 4JY7A 1COWD 2C92A 8AT1A 3E70C 4E7PA 4KN6A 1U80A 4XYLA 3A9CA 4MIKA 1LD3A 1UKYA 2R8XA 4FNAA 4CKBB 4UNQA 1Y9JA 2CWDA 3CCQF 5A6SA 5JWRA 1Y8AA 4Y6SA 3JQAD 4G8DA 1WM1A 1WS6A 2IPLA 2PZJA 1S2GA 2ZT7A 3IB6A 1DAGA 3IBFA 1W4RA 3CFYA 4KHZA 4PO3X 4H3VA 4X8HA 4P35A 4WHMA 1LFAA 3SIXA 1Y81A 2OLKA 2X15A 4RVGA 3C8UA 2EFEB 2R84A 2QNRA 2P6UA 3G6KA 1UDCA 4M1YA 2QIOA 4J91A 4JT9A 3B2NA 5AQ1A 2EZUA 3RYFA 3F6BX 1V6SA 5FUMA 3PDWA 3Q3CA 2A0KA 3FZNA 4QT4A 3QPWA 3LZ6A 3IALA 4ALNA 1MX3A 1OAOC 3UMCA 2P2ZA 4D3XA 4KLAA 4EZEA 1FMFA 2GEVA 1M0SA 1BJRE 5B7NA 2BHRA 1H9CA 6AT1A 3ZTYA 3Q3EA 3FUTA 4TMWA 4YROA 3C7TA 3DMFA 1KJNA 1ZKMA 4FOTA 1H4VB 1SBNE 4D56A 3E3MA 3ABRB 3O92A 4OXKA 4MULA 1X38A 2V7QD 1OFHA 4QOGA 4WA7A 4XR4A 5F1KA 2D0DA 1IV3A 5D3KA 1NHGA 5CIQA 2QAGA 3MJSA 4TLDA 4GYYA 2P0EA 3U6BA 2ERXA 1C3OB 3I45A 1Z33A 2XQGA 4BRSA 2ATIA 4HJRA 5ALRA 3CUVA 5J1TB 4EA6A 2MINA 1QU9A 4MMZB 1WUJS 3OF3A 3ZI0A 5AVUA 3U4MA 2PR2A 4DM3A 3HDGA 2UUPA 3KEQA 4XZ3A 1MB2A 4IQGA 1Z73A 1MC4A 3LI2A 2Q62A 5LB2A 1J09A 4KVZA 4ARUA 5E7MA 4YAKA 5CFMA 3T0FA 3D7RA 3ZQ4A 1E0SA 1SUCA 1OAPA 3KWJA 1DQNA 4BNVA 3PQEA 3KUUA 4IFTA 2BI8A 3DB2A 2GCGA 5ALOA 5DXFA 1G16A 1QIJA 1RKXA 2IDZA 2ZAIA 4FKBA 4P5DA 4XQEA 2IZZA 5JYEA 4PSCA 1OGIA 1XTTA 4RKYA 5ECGC 4BP1A 2BM9A 1WRBA 2BMDA 1SVLA 3N5CA 2G06A 3ZU6A 4RVOA 3THWB 5JNWA 4W1PA 1O6ZA 2GK7A 1CLIA 4WOJA 5EHNA 1UBRS 3KD2A 4DXHA 1A2BA 1YS2X 2QG6A 1HFJA 2GN4A 4OMDA 2CFTA 4KO2S 2BZ0A 2ZYUX 4LMRA 1SQGA 3NTVA 3P4YA 1TM3E 1YJ8A 1TCBA 4OB8A 4RL6A 3H0KA 1GY8A 4IHJA 1I3KA 1IG0A 1R0ZA 1YR6A 2I8CA 2NAFA 4QRIA 2YOFA 4BN0A 1RI4A 2WVGA 1BDHA 2ZUSA 1USGA 2C61A 3H75A 2WD8A 1RBYA 3GWZA 3N6RA 1ZOPA 1I14A 2Y93A 3INYA 4R8SA 5AICA 5J5VA 3KYJB 5LP1A 3VKWA 4P9NA 2DRIA 1TJ3A 4MLCA 5TXGA 3VIUA 3JQ6A 4LY9A 2I4RA 2FMXA 4P6VF 3PNLA 1ODIA 1TU0A 4M3NA 1NUSA 1XRGA 4ER3A 2B5VA 5KMGA 5LKRA 5FUYA 4IWNA 1PJAA 2I8AA 1PR2A 4HDCA 2CJYA 2BMEA 4UUPA 1Q7BA 2V4UA 3F5DA 5AVJA 4AMBA 5FLXA 2QYOA 1UZNA 3OJ0A 3UPUA 2ZSDA 3IBSA 2VDPB 2HXGA 1E5DA 4BC1A 3CLVA 5E1DA 4YAWA 4RQOA 4J90A 1IL0A 4NYIQ 4HSEA 3RFCA 2RCNA 3PE3A 4JLUA 1C1XA 2ZBEA 1G7TA 3LK6A 3EPPA 3V7YA 2G71A 2NSJA 3C41J 1CUHA 3PL5A 1U1FA 3P71T 3PXXA 2H4ZA 1E4EB 4PTYA 3BMOB 3DTTA 3GNTA 2CLKB 4EPTA 2CLMB 1QHNA 2ZCVA 3GPDG 3NANA 3UJHA 1E3QA 4Q47A 4TV9B 2BAGA 4Q9IA 4KAJA 2Q3DA 3F98A 4PXSA 2JARA 4MK4A 4EUFA 5IHPA 3IPYA 1QVAA 3AVXA 2AR9A 3AK4A 2X8WA 3ZJUA 3L8CA 4LJ6A 4CQLA 4PZDA 5ICGA 1BN6A 1FNNA 5F3DA 1USIA 1OFTA 4UBMA 2K2WA 5G4VC 2G5GX 2YZ7A 5E6UA 2Q5HA 4AWAA 2IIPA 4RVUA 4WJZA 4LZOA 2AIZP 3K0CC 2J45A 1KMQA 4HP8A 3WXMA 3TH5A 1H2EA 2P1DA 2FZEA 2VATA 3QVWA 4ZQHA 1UAGA 2A92A 1MW9X 1MQ9A 4MYTA 4Q0MA 4R9NA 4AN1A 3AZOA 5AT1A 3D6FA 3FTEA 1XNGA 5SY9A 1G60A 5HE8A 4W6ZA 1QHSA 3CYPB 1U3PA 3IUMA 1ZJ4A 3GDFA 4NNOA 1HQKA 4IJKA 3IVGA 3D6TB 4KV9A 5AOCA 1WQ3A 1FRVA 3CWQA 4TVSA 4WXYB 4R1SA 5J4VA 5KNBH 2AQ8A 4NCNA 1PBNA 1ZGZA 3DLTA 3I34X 3KJJA 2EWCA 5JCOC 3RSCA 4TS3A 2DQKA 1VFPA 3KDAA 2J87A 4LDQA 2HQSC 2FXIA 4IS2A 5DNDA 1U2DA 2O8EA 2VWQA 1FTNA 4BTEA 2VNAA 4KYUA 5C31A 5JISA 2DM6A 1WBJB 3RIXA 2J3JA 4GI3A 3NEAA 3BWMA 3RSGA 4FFWA 4DR7B 3GFBA 4OX9B 3WDMA 3ANTA 1SQ0A 2Y2UA 2P79A 3NCHA 3FPEA 3NDJA 4U0KA 3HB9A 4YAEA 5K09A 3TTVA 2PS3A 3P8ZA 1YK1A 4EB3A 3ZHSA 1JDVA 1YR2A 3Q2IA 3QP9A 1GNLA 3HP4A 1XAIA 4EGQA 2GAJA 4B83A 2FWBA 2VH2A 3GRZA 5D00A 5CA1A 4FNOA 5C34B 2VOEA 1Y9DA 1CJVC 2QZPA 3K73O 4GG1A 3ZCSA 4ARVA 2FW8A 3LUBA 5K6RA 4B3GA 5IJ0B 1E94E 4Q4CA 1Z5GA 2H5LA 3KR9A 1NG1A 1LCIA 4V0ME 5F3WB 3SCZA 2H4HA 1UOOA 3VM6A 3Q88A 1MXFA 3DZDA 4OK6A 3AM3A 3PPIA 3W2GA 3CEAA 1UMDA 2GYWA 4U7GA 3EVEA 2VNSA 3OPYA 1H6CA 4YIKA 3WI7A 1PZHA 1J8VA 3HEMA 4U2GA 3NK6A 3Q10A 2I03A 2ZE6A 3UZUA 3OZCA 5CTAA 1T36A 3G5UA 5GGXA 4ZYVA 3ABZA 5CH5A 3PZRA 1R4NB 1WPRA 4UTZA 1THGA 3WP1B 1Z39A 3LVFO 2Q6KA 4DV1B 3TPCA 3D8RA 3W5JA 5HCNA 2ZUFA 1E6UA 1BAPA 2XEDA 1XEXB 4IGEA 2RGDA 3BULA 4ZP1A 3UC5A 4RLSA 1RRVA 2WJ3A 1I9GA 4GQIA 2IELA 2OO5A 1M5UA 2XUKA 4WGFA 4KR9A 3JWIA 3WIVA 4ZHQA 4Y2JA 2QA5A 4LYGA 4Q4JA 4LYAA 1WVIA 4F6LA 2VF5X 1NJGA 1H2AS 5SYMA 2NW6A 4IDNA 3C39A 4R8RA 3NAZA 2QLNA 4CMIB 4EGFA 2JD1A 3WIDA 1VQNF 2COUA 3H9GA 4NU6A 2JG3A 1Y7IA 4MQ5A 1GLNA 1E9BA 3PT5A 4HZUB 5HF8A 2ZXFA 2PGOA 3K5WA 1XNQB 4L15A 3N0XA 4D3SA 1CTQA 1QP7A 3O84A 4UBIA 1JFRA 2BF7A 2C4TA 2HWYA 3H5NA 5EGSA 4DG5A 4EO9A 4X1KA 1I51A 1VHDA 4H1UA 4LBYA 4NBLA 4OKSA 4P58A 3LV8A 4WFQA 5LKAA 4JB2A 1T5SA 4I2VA 2G0NA 1X6VA 1ST2A 4YRLA 1XCMA 1Z36A 2ABWA 2OAQ1 2HMTA 4UHCA 4C9BA 5BNTA 2HYDA 5AVRA 1QB8A 3D01A 4Q1BA 5KYUB 1N0VC 1INLA 3AI2A 5GVRA 2BELA 3ZEIA 3EOBI 3OPVA 3VBCA 2NQ2C 4BJ1A 3NJ8A 1D2RA 2HHLA 4E6EA 1U94A 1GQSA 3T94A 4DDWA 2AS0A 1Y6JA 3QLVA 4G84A 5JD3A 3A26A 2WPDA 3I9OA 3JWEA 4Q9NA 5JYCA 2F4VB 3PR1A 1IVYA 1DWOA 2GAIA 5KS2A 2ZULA 2F59A 1PVOA 4R69A 2GLUA 1KIAA 4TWAA 3HZOA 3TF5A 2AJCA 2Y27A 4KQGA 4S1TA 4LJRA 1D8AA 3GEEA 1F5NA 5E7JA 3HXMA 4CIVA 1GUAA 1XMXA 5ALTA 4IV0A 3HR8A 2RJOA 5JPDA 1XLTC 1CUZA 3OTGA 1EEXB 1SULA 1SXHA 3GJTA 3DBIA 2DWCA 3FFXA 1HDYA 1XA0A 2GEKA 2VKTA 1ETUA 2KBFA 3LK7A 2HDOA 4ZJZA 3P2YA 3PX7A 3OIFA 4N0QA 2JHAA 5LZ2A 3ECAA 4RLHA 5GMOA 2AUTA 3UW1A 4B34A 3HCDA 5ESXA 1J0AA 1GNQA 4PNHA 3HBJA 2YUTA 4O25A 3RVOA 1T1SA 2XTNA 4BW0B 4DBLE 4DR1B 1CYDA 3LL7A 2DSTA 3WWEA 1V8PA 2J08A 3KM0A 4BLUA 4DBZA 4PX9A 4ZKDA 5HKAA 3AUUA 4HI0E 1YR3A 3WQRA 3NMUC 3KALA 4K1LA 1SQ6A 1ESEA 2I7VA 1V26A 1N3IA 1DSSG 1VQKF 2PAFA 2QY6A 1PT9A 2XNJA 3HCWA 1NFQA 4DCGA 1GITA 1TUIA 1KSHA 2EFJA 4IIDA 1Y1PA 1HDRA 2G76A 1C0KA 1RAFA 3CH5A 3UF0A 4F2WA 3FJOA 4FR0A 1U7XA 4E94A 1QOZA 2WSLA 3FMIA 3PR2B 3P20A 2B6HA 4HWSA 2BEKA 3CJQA 4OM8A 2QVCA 2WPDD 3FG9A 4QHTA 5CYFA 3S99A 3WQQA 1CR0A 5KTKA 3IP7A 3BYZA 2Q99A 4LJ7A 5BW5A 5KKAA 2HVYD 3HEAA 4OBEA 1UPTA 1A82A 4QVKA 5DBOA 3UUGA 5JO0A 3T1HB 1RYMA 4R6WA 1CF4A 3NBZC 1JAYA 1G5QA 3PRYA 5UKDA 3ANXA 3QV1A 2WIJA 5BMVA 4DF3A 5KVSA 5FBQB 3F49S 6GPBA 5JXWA 2W42A 1JU4A 3BCSA 3NALA 1FVXA 1ND5A 4OSEA 1WHTB 4LVUA 1TJ5A 3NTLA 3HA2A 1GPWB 2F3RA 2VGNA 5LWQA 1U7UA 3IOBA 3LAWA 4DSTA 1YL7A 4O59O 3HXTA 3A06A 1Q7GA 4Z0PA 2Q7DA 3H84A 1KO4A 4QT0A 3GEMA 3TXYA 1FFCA 1MEOA 1NVFA 4MH0R 4K26A 1BFKA 1W6RA 2H18A 2P7HA 3ESRA 4NYMR 4DA9A 4ZAYA 1TA9A 1N34B 4A6XA 3LKBA 5DM2A 1A8HA 4QQKA 3PFCA 1MR3F 3E1YA 3RKUA 1PAUA 4B4WA 4IYJA 4F9EA 4KE6A 4JWKA 5AIAA 1FSFA 1QAQA 4BJ3A 1W1IA 1X15A 4QEDA 4H4EA 5DRYA 2NM0A 4HVTA 1CY0A 2WVHA 4CCWA 4M9SA 4RVNA 2ECFA 2GS9A 2MIIA 4FC6A 5TMEA 2GKSA 3H9EO 3K3PA 3MAJA 1GAEO 1QGAA 4ZAFA 3RLFA 1GQOA 2HT6A 3EUAA 4EECA 4EG7A 1J2UA 4FYHA 5DWQA 1LX6A 3KSDO 5ENZA 3R8CA 3OJCA 1MOSA 2Z2XA 4JBLA 2ENWA 4RMIA 3ZD9A 2FMFA 2PGAA 3AO0B 4D4LA 4QICA 2LCFA 1P74A 2PMWB 1N2GA 3CPJB 2AKAB 3TW0A 1NW4A 4RIGA 4XTRA 5DH9A 1DU4A 3T7AA 3LIPA 3RK4A 1N9KA 4QM7A 1I0LA 1H2BA 3RS4A 1SJ9A 1CULC 4MMYB 4DCPA 5IF3A 3M9XA 4C30A 3B1WA 1DC4A 1MBZA 3OBBA 4IFEA 5DBFA 1ZD1A 3JQQA 5CB0A 5A71A 3NHMA 3EX7C 4ZICA 4IIUA 3BM5A 2QD2A 4KJZA 1M8JA 2A57A 4ZTBA 1P29A 2XMZA 3AP3A 3VVBA 1Q7RA 4WQMA 3WB9A 3D54A 2ZB3A 1UKBA 2H0QA 4MKRA 3TG8A 3A0UA 4L5CA 3HVUA 1A98A 2AFHE 2PGDA 2Y0EA 3K4QA 5JS2A 2JFVA 5IYZA 2UZ3A 1GUZA 1BS9A 2Q7XA 2IXTA 1Q50A 4KDRA 4L1KA 5CHYA 3TCXB 3UANA 3CPWF 4WCFC 1J9GA 3UCEA 5GINE 1EVKA 1MVNA 2XMGA 1J4AA 5CDGA 4QUDA 1L4GA 1ZI6A 3KEFA 4DTIA 4QDJA 4NBUA 4PPGA 4G4VA 1CIVA 2VL7A 5ER6A 2WZCA 5FBZA 1J7JA 1I7PA 3BOSA 1TTTA 3W5BA 3FKSA 3CQ9A 5CXQA 2ZYHA 3HJUA 1CK4A 3TMAA 1PSZA 4LX0A 1E2EA 2I91A 2JEYA 3IP5A 2WP8J 2QTVA 1O2DA 3MAGA 5K3DA 3T34A 1XZDA 3L6RA 2HYIC 1UMBA 2QTZA 4CLHA 3J7AC 7MHTA 5JJ5A 5I9SA 5ISMA 1VB3A 1NAIA 3IHLA 1VPDA 3ZV6A 4UE2A 3VZPA 4CG0A 2CL0X 1J2JA 2YWXA 1LF0A 1JKIA 2ASVA 5JI2E 2A7QA 1VL2A 3UJ3X 3RE3A 2AD1A 4LJ5A 2HJWA 4OHVA 1B2LA 1BDMA 3BK1A 3MM4A 1JH9A 5BSHA 1OLSB 3D54D 2QSUA 1AV7A 1O0SA 3P9XA 1I4LD 3N58A 5CMLA 4GP6A 1AUOA 3WRYC 1MRSA 1EVQA 5H83A 2KJQA 4HQOA 3THOA 3H6HA 1Y4ZA 3MUEA 3O8QA 3T3EA 1E20A 1UP4A 1KI6A 4MNTA 1T2UA 3TB4A 3GZNA 3CCUF 1FVOA 1Z26A 4ZXFA 2YVQA 3JALB 4FI3F 2UVPB 2FZWA 4BRUA 3KFLA 5IT9A 4RXTA 3R5JA 1X1RA 4NU8X 1A9RA 3ROFA 4GM0A 5HOEA 2ZUWA 4DUYB 1MQSA 3CLUC 2BKXA 3F6RA 2Z6QA 5LJLA 4YRZA 1U2PA 1FSGA 3FKSD 3ZLVA 3NV9A 3O2QB 1C9JA 4F4IA 2DTEA 3JWPA 2J59A 3BIXA 2WLTA 1N78A 5KOJA 4BIIA 2YZGA 3VSCA 2YMLA 3ZY5A 1U5BB 2P6NA 5A5GA 1K86A 4ES6A 1QCZA 3LRXA 4WERA 4BVRA 2OGSA 4HB3A 2V7XA 2O1WA 5CPBA 4NY1A 5L7TA 1IXYA 3CZMA 2GXAA 4KDEA 1JSLA 2IXBA 4I9HA 4C4RA 1TNDA 2BKLA 4A0QA 2C3UA 1S02A 1BKSB 1UT6A 2L42A 3LPAA 4ICIA 1XNRB 2OAGA 5J63A 1RWMA 4ZT6A 1GOTA 4FKZA 3BGSA 4JP5A 3VZDA 1UZAA 4GLOA 3KJHA 4LHWA 2Q5IA 5GJWC 3LXUX 3KLMX 4HPXB 3RJZA 3UFXB 2VEOA 3IEPA 2Y4NA 3VR4H 2EP7A 3PHLA 1AKWA 5HUQA 4KMOA 2PHZA 4N7JA 2PY6A 4URVR 2NYVA 4OEHA 2ZRAA 1DKQA 2PQMA 4O4LA 1YVEI 5A9RA 3AVUA 2XBUA 4FWTA 1LPOA 2AFVA 4PRZA 3WIUA 4F60A 2WQ7A 1CEEA 4LGVA 1FQKA 2JLRA 4PNZA 4NBSA 4F6RB 1BXZA 1YJXA 2C9OA 3CX3A 3RYIA 2VUIB 1YB7A 3G2IA 4ND3A 4NNPA 1KK2A 1IXKA 3NVMB 4RPHA 2NP6A 3I9V1 1ECCA 1NPTO 3V2HA 2CLLB 1SD5A 1PJQA 2AF4C 4FWBA 4MEJA 1QZUA 1WHSA 1RW4A 2Z9BA 3ECCA 3FWYA 4O8ZA 3JQFC 1TT7A 3MT8A 3RC1A 4IDDA 1GEEA 4XGRA 1F14A 5EXSA 1CPYA 3JCMM 1NW7A 1WVMA 3VU9B 4LHSA 1R16A 2YV2A 3VR6D 5HQ3B 3WNQA 3I09A 9GPBA 4CZ2A 3ZVKA 4N0PA 3C8LA 1UMKA 3G2KA 1CZHA 4MI9A 2EKLA 1Q7TA 1BYUA 1KQ3A 2JLBA 4RD6A 5EMNA 4D96A 1P3DA 3KZ1E 5EMJA 4KR2A 2IEBA 1K3UB 2W6MA 2ZYAA 1NYTA 2D1YA 2Q4BA 3UB2A 4CL8A 5JR3A 1A9ZA 2ZJBA 1N9GA 2O2EA 2XWJI 3FDJA 2CYBA 3OPMA 3SM3A 3WLJA 1E66A 4NCAA 4PR0A 4FCCA 2Q3MA 4X95A 5J1SB 1E3IA 4Q21A 2HBYA 2FK7A 5KU1A 2J4CA 1XMOB 4IIFA 3NHUA 3A0RB 4GEGA 1CUDA 3LDGA 4TTIA 1CJUC 4DJEC 4HNUA 5JZBA 1E1NA 3KQKA 1JHUA 3VMFB 1B14A 1ZNYA 3OZXA 5A03A 2C2YA 4MCIA 2X0FA 3L46A 1P81A 2Q50A 1M8GA 2V9ZA 5J4LA 1GCIA 4K8RB 4MI6A 5FULA 3U9SA 3QXHA 1PJTA 1NF8A 2FE4A 3OCWA 4EKGA 2ZK7A 3B70A 2Q5QA 4I2NA 4TZKA 2YJ3A 4Y8VA 3TTXA 1C8BA 3BMNA 1VP9A 1AIPA 4XJTA 4A10A 1ZVVA 1S3GA 4IG4A 1VE1A 4ENWA 4CLOA 2IV3A 4BNJA 1Z2NX 4OXIA 1G2PA 4PPQA 1GRCA 3W6NA 4OHXA 2A0WA 5C8VA 2OCGA 4I9NA 1JUDA 4FQ8A 4KGVA 4BB5A 1NVBA 1E6WA 3CRNA 1JIVA 4IQ0A 4PE5B 1W2GA 2FW1A 3F5FA 5YASA 4AN4A 4R68A 5EL0A 1V3UA 2R5WA 5AR1A 3GRKA 3GLRA 1JAHA 2IOQA 2I6GA 1RVDA 4HDSB 3PTZA 4H16A 2TMKA 1YITF 2GRUA 1BHSA 4FZ3A 1L5HA 1W85B 2VJLA 3ONNA 1CUFA 1QU3A 4NF2A 1YFJA 3WL4A 4DB2A 2J6BA 5EERA 3D6UA 8ATCA 3B9RA 4I4IA 1A5TA 1ORIA 4CT5A 3OVMA 4C0KA 2EGUA 2PXHA 5JD4A 1J2EA 4AJIA 4H4DA 2WI8A 1E0JA 4DIMA 3WGLA 3ZGNA 1WNFA 2E0IA 4GOND 2QLBA 4QLOA 4L0DA 1JWLA 3OQ1A 4LOAA 1KDPA 4HB0A 1YASA 1G6HA 1CQIB 4JP3A 2X7HA 3SZRA 1EKXA 4DV0B 4HXGA 5J58A 3NBKA 1YZVA 4HYTA 2OMEA 4NMXB 1J0CA 2EW2A 4MUMA 2F3QA 4UAVA 4ND6A 4DREA 3M89A 5JLJA 1LQUA 1NIJA 3WWDA 3GPCA 3Q1LA 3C3WA 2CY0A 3L8ZA 3BH0A 4BHTA 3EGXA 3PF9A 1E9SA 2BUCA 5JVDB 4BLQA 4POOA 2ZG6A 3L8MA 4NDNE 2PLAA 1NZFA 5AVQA 4KV7A 4RM3A 3W78A 4ENQA 3YASA 2ISCA 3O8DA 3WAKA 4DS3A 1DEAA 3VYRB 4AIIA 1ECBA 4MARA 3RUFA 1GGNA 1XRNA 1R8QA 3BX1A 5EXDA 5F52A 4M60A 1L5KA 4ZCIA 2O8DB 2A9JA 1Q0ZA 3LDHA 3OT1B 4G1CA 2VPTA 3PUZA 2JI8A 4B7XA 2V7VA 4LOIA 1EK1A 3KAQA 1NLFA 4G36A 2C1XA 2XNDA 1O97D 1MEJA 4E3ZA 4Y98A 1GLGA 2FQWA 1IPHA 5LNK1 2BE9A 1UDRA 4BFYA 5JZ9A 3TKAA 5I51A 1Z4JA 2PMPA 3EGIA 1W96A 3ESQA 3K6SB 2YFHA 1U3TA 3U6KA 1S1MA 1A9XB 4CL3A 3KK0A 4GSKA 5HBRA 3TQTA 4LFBB 1ZJWA 2O5VA 2QUKA 4MS4A 5A0FA 4DXAA 3U81A 5FYQA 4FIDA 4EHJA 4EYQA 3E9CA 1RZVA 4W82A 4Z4HA 3WB0A 5C1BA 4BDTA 4LYYA 1YR1A 3KKNA 4J16C 1VJ0A 4KP7A 2Y66A 1RC8A 3VC1A 1YFKA 3MCVA 4MW2A 1G19A 3PGKA 3P2EA 4UOQA 1I1NA 5EMMA 1WDKA 4E14A 3HN7A 1TW3A 4AY5A 5ECDA 2BGRA 3TWOA 5TVKA 4RCYA 5DM60 3FLBA 3A9RA 2CCJA 1M1UA 2XQKA 2O8BB 3LUJA 1I2DA 3SKXA 4ZMRA 2KS6A 3FR8A 5U4XA 3P9ZA 721PA 5K0FA 2IZ5A 2ZUVA 5IANA 3QBJA 3SOZA 1XYGA 3DMNA 2YFQA 5E4YA 4HAWA 3WHKA 3R9KA 5JZMA 3FPHA 2XE7A 4GDMA 3SLGA 2UYNA 4J6EA 1E8DA 2PMCA 4Z0TA 2B6NA 2JH3A 3KOZA 4GC5A 4L3WA 4PGFA 5E2IA 4CEHA 5CLGA 3H2BA 1XV2A 4BB0A 2J3DA 5JALA 4AAYA 2YHUA 4TV8B 4I1UA 4QPNA 4F85A 1GTZA 1VBNA 1HBJA 1LLUA 2FPPA 3CZRA 3AR7A 1R0WA 1N8TA 1QH8B 3DONA 1ZC3A 3KB2A 3LL4A 3Q85A 4KDCA 4ZCQA 5IAOA 3AKYA 5KPJA 1YZGA 3GLIA 1T8WA 2FP4A 2XNDD 5H82A 4EY5A 4OGWA 4XRGA 1F4LA 2FPUA 3S0YA 2GEUA 2ZBGA 3K96A 2PJRA 2Q4EA 3GMSA 5AH0A 4ZGBA 1Y1SA 1PW5A 1RRCA 1ZMOA 4K6OA 3IA7A 2P4EA 3Q7TA 4M0MA 5CFZA 4ZFNA 5GY7A 1E3WA 4NCJA 4YMLA 1J2RA 2A2ZA 3QQPA 1QP4A 3DV0B 4YB8A 1ZSVA 1JHXA 1YR7A 3MA0A 4EPWA 4F12A 4KE7A 3ND7A 4CL2A 1RABA 1Z8FA 1ZD4A 3VYWA 3EZXA 1W30A 4AJEA 1VLLA 1NUTA 2O2CA 4TKUB 4UCFA 2PA0A 4C0AC 1T0KB 1R6XA 4MS1A 3JAWA 1Q2UA 1R0BA 1X3SA 2DT5A 2IYPA 1YU9A 2VT2A 3GEPA 2V9CA 3GRFA 5C0OE 4BWFB 1K8ZB 4DFDA 1PGJA 3MRTA 4F3YA 2UZHA 4ERHA 4H7IA 1VHJA 1QQ5A 3NHPA 1QPZA 1XTSA 1T0PA 5JJKA 1I3LA 4FBMA 4UZFA 4OD0A 1G4UR 3OQMA 1W2WB 3K1AB 3B12A 2II6A 2DKOA 3HXLA 4G5RA 1CHDA 4IXNA 4D9FA 1QYRA 4ESOA 3LY9A 1NNLA 1ZBDA 1B8NA 1JJBA 1MP0A 1M6NA 1YAJA 1XP5A 2VJMB 4FYJA 1HX7A 4LECA 1PS0A 4KSBA 2HP0B 5LBIA 5ALDA 2MSNA 4M1WA 3PEFA 2KX7A 1VKZA 2IQQA 2QD1A 1WUHS 5E38A 5CG2A 3OF5A 2WWVD 3Q5GA 1OT5A 4BX8A 4DBLC 4JL5A 1V16A 2BBWA 3KQQA 2ZWAA 3K2EA 1T9DA 4WBNF 2RGEA 3C3KA 3MS2A 3UPTA 3CB4A 4BVQA 1SHUX 3DMHA 4ML3A 2Q27A 3CX4A 2H29A 3WGUA 4DA6A 4KW7A 4FHZA 2G40A 1IZ9A 3GJSA 5B2EA 2QORA 3K35A 3PXUA 4EUSA 4YRPA 3T3HA 1HZZC 4JP2A 4MLPA 2BP7A 2O1SA 3VVCA 4RDXA 4YT2A 4FE7A 4NMHA 2OHFA 2WFZA 4JROA 4ZXPA 3TO5A 3DZJA 3MHPA 1O6CA 3O93A 2HLHA 2OO3A 1VJGA 2ZSUA 1R5OA 2IYTA 4HEQA 4QBTA 4RZIA 2QVYX 4ASUA 4DCUA 2Z9DA 3EIOA 1PEYA 4HXYA 4EW2A 1W7AA 3ACCA 3EOZA 3TNDA 2HCFA 5EWLA 3DE7X 3WSWA 2QUZA 4ZIRB 1U3WA 3A6JA 2IX3A 3UH0A 3UXMA 2FF7A 2H65A 3PNKA 1Z28A 1V4VA 2GAAA 1IM2A 1XZQA 4H0NA 3JTMA 2VWGA 3P2IA 1K6EA 1UXHA 2BE7A 3KJKA 2XAUA 3LU1A 1YDFA 3QFSA 1TZ2A 2DQYA 1N0UA 4PEVA 2PD4A 5EWJB 1K9VF 3D5EA 3OZVA 1TVMA 4CCYA 1XMPA 2R47A 2V9PA 2ZSAA 3I37X 5DT2A 4DUPA 2N3ZA 3FPJA 5IMBA 3FM9A 2JS7A 3HSYA 4YRGA 1PJZA 3PGXA 1QIGA 2IXEA 4LRTB 1ZSYA 2C03A 3H5RA 2BGMA 3LX8A 3FCOA 1I2MA 4WE3A 2JCSA 3DUFB 4K6FA 1DIAA 5BVHA 4PAQA 3QPBA 3Q7QA 3CSDA 4Z9AA 2YS7A 3LUHA 3UW3A 2IFTA 4YI3A 5JSFA 4HDKA 1Z0KA 2RGXA 4D81A 5I7WA 1KEEA 4M88A 2YVKA 4PFJA 3M82A 3INGA 2QN1A 4LDNA 5HGXA 4FOLA 3QE2A 2VDJA 5FI5A 3P52A 3T5PA 1TUGA 4R2HA 1AXRA 1E7MA 1YBHA 3SSMA 5BV2P 1US8A 4PX5A 1XD9A 1H5UA 3QLJA 4MV3A 3QWFA 3NH9A 4RYLA 1H0SA 1TMKA 1ZD2P 4G8JA 4JENA 3R7AA 3U7IA 3IEQA 2YJGA 4JR0A 1TPYA 5BUQA 3LPCA 3A04A 4KGDA 1T5IA 3GV0A 3OCCA 4BO5A 1YJWF 2Q0XA 4ASUD 5A2GA 2EBWA 2HI0A 4L51A 5IC4A 4NFHA 4F1WA 1CUSA 3DZIA 3LPLA 1U2GA 1E6MA 3C7DB 3L8EA 4KWTA 3BF8A 4E03A 1DRVA 4EA9A 2XGJA 1QRRA 4TVOA 4H60A 2C2OA 2EG9A 1U0RA 2M98A 3MVEA 1J25A 3T3PB 1UQTA 3ONDA 2LBWA 4X65B 2LDBA 4CCSA 3GLGE 3N86A 2JAQA 5TARA 5FP0A 1G20A 4ZYXA 2HMVA 3MFYA 3SLKA 4NSNA 4UQOA 1X7WB 3AUFA 3U4GA 3V6MA 1C50A 5AJZA 4TUYB 1WZEA 4GNRA 3AYXB 1OBVA 2IEYA 4AXBA 5F5LA 3KZXA 2OZKA 4MW4A 2BMJA 3H83A 4AUMA 2JFHA 1HQDA 3KJZA 4D0NA 3ML1A 1H0HA 4QDOA 1XV5A 4N3AA 3GFOA 3U49A 4E70A 4DLUA 4RHTA 2WG1A 4M89A 2AZ4A 3IIMA 1G5HA 2A5DA 2FWNA 4ZRMA 3W7VA 1Z35A 4KWEA 3DBVO 3GUZA 1JT9A 1WXQA 4TXLA 3FTCA 3T80A 3HCBA 5GAPK 3EDRA 5LFAA 3A1DA 4CF3A 1MU0A 1NMEA 3C14C 3R3YA 4Y67A 2FRXA 3GGGA 5T3UA 1UOEA 2C3OA 3GQBB 2OBMA 5GINC 3LGAA 1TF7A 5BSKA 1N6NA 4PICA 1ESDA 5KC9A 2LV8A 3AFNA 1ZD5A 4URZR 3HDQA 5EWRA 3IA2A 1GPBA 3LF2A 3USES 2HA6A 3H2IA 1Z5PA 3ENWA 4BLWA 1ZH0A 1L4KA 2FX5A 2PU5A 2ZS7A 3AJ8A 1CQPA 3PK0A 4ZJUA 1KNJA 4HQRA 3TSOA 4WDQA 1KAEA 1Z0IA 2PKYX 2AC4A 2GGSA 3H0EA 3I2JA 3OMXA 4QSHA 1IBKB 3BD6A 4JBHA 4V0QA 1M5RA 4ZZIA 4CBVA 2WRZA 3FOEC 5GQSA 2O2HA 1ZA2A 4IDFA 5KX5B 1M90H 2MMCA 2IHTA 3AHCA 3BJEA 5G0TA 3EC2A 3QEMB 1X42A 3KUKA 5CT4A 3T52A 4ND2A 3K14A 4DV4B 3CVWA 1N4DA 1EE2A 3W6OA 1J6UA 3G5AA 3LA8A 2B25A 3NGXA 4G0QA 1T0HB 5D6OA 3C48A 5G53C 3TZQA 1T8YA 4HLUC 3OUZA 4N8EA 4ECEA 3V4FA 1MLDA 2C88A 4U6QA 4ZANA 3RC3A 3RYTC 3WB2A 3PB3A 4E12A 2FX3A 2R5FA 5MN5A 3WWPA 4B81A 1B1CA 2XUDA 3AI7A 3ZCTA 3OHPA 3ZD6A 2HDNB 2F9ZC 2OXRA 2WIAA 3A4TA 4HDOB 4RTKA 1I32A 3FD5A 1NBME 4MINA 3KVNA 3UJNA 1SXIA 5D86A 3LXXA 2D13A 3E22B 1UJ2A 1Y98A 2PL3A 4OQXA 3HS3A 1LK7A 3ICWA 3IJRA 4CGYA 1MCZA 4QQRA 4EJ0A 3OPYI 5TVGA 1LDGA 4FLMA 2H6LA 2LBXA 1I4TD 1Z7BA 2ZJOA 3G2OA 4OATA 2VSYA 1ML3A 3OONA 3SIPA 2P27A 3JQGB 1V6AA 1SOWA 5T8KC 1ODJA 1K8QA 5G0VA 4MJ7A 1BX1A 4ODIA 4RJIA 4G4ZA 1QYVA 2C4KA 1QKJA 2K5UA 3DHEA 1PZNA 3KT6A 3WLHA 1T5BA 1XXHE 4U7PB 5DU2A 4A8PA 5HXUA 3ZG6A 1EDBA 3ZE1B 2QZSA 3IT0A 3C3CA 4NULA 4YCSA 3RRBA 2CHFA 4R41A 3A6HA 4IHAA 1YB1A 4DA0A 2WFMA 1PQYA 4Y6PA 4P81A 2FF5A 3T3MB 3TMKA 4BZZA 5DCYA 2Y1LA 4BB6A 5JD5A 3HZRA 5KQGA 2W58A 5EKDA 3GT4A 3DQPA 2I6UA 1OJLA 4L6CA 4EB0A 1XTJA 3S2UA 3MSCA 2BLLA 3S5JA 4KE8A 3TECE 2N0SA 4US2R 3IHWA 1YDEA 3TZEA 1N3YA 1RAHA 2WD7A 3BD7A 3IP8A 5FTMA 1IVNA 2BGLA 3KOUA 4PBTA 3KJIA 3HCCA 3EBLA 1SIOA 3KETA 3MINB 3GA7A 3MJFA 1YL6A 3KZCA 3L40A 5F3RA 1W8IA 4V0OA 4F11A 2R2GA 3HNRA 3CCFA 3ZDRA 4OQ4A 3F0FA 3SMQA 2A0UA 5L3RA 2CDNA 3O75A 5DEOA 2X6QA 2O52A 3FYUB 5GIPE 2C84A 1RHJA 1R4ZA 2RHWA 1N8NA 3TQSA 4FP9A 5HTOA 1Z06A 2DWUA 1PBTA 5EIBD 3N0TA 3QKRA 1YB6A 3LQ1A 2Q9BA 1PJSA 3FBWA 2CUTA 2Q29A 4AICA 1AZTA 4X54A 4C7VA 4TZTA 4YQFA 2R7NA 3H1GA 4DZZA 3ZWNA 4EI8A 5IBCA 3S7TA 1HSZA 4ZQFA 3CX6A 2PHNA 2ZREA 4IGFA 3RLIA 1DXHA 5K4GA 4QATA 3PRHA 4DMGA 1N7IA 4WASA 4JGBA 2IZOA 5BVGB 2XCTB 4EI7A 4HNGA 1T9BA 2GI4A 3KP1A 4MUEA 3D7MA 1LGYA 2XA9A 3NHKA 5D5QA 1PV4A 1EXDA 1P8JA 4BGIA 2I6DA 1JA0A 4FFBA 3HCEA 3I1IA 3PFFA 1FBNA 1OWLA 5FBVB 4FYMA 4HTFA 2B4TO 2M6RA 3MPUA 5K4AA 3MT0A 2F9FA 3GIWA 1SC9A 2ES4A 2H7CA 3A6GA 3EIWA 3JWHA 4KE9A 3SVLA 5KHLB 2IHVA 1DNPA 1MAUA 3EXIA 3JD1A 4D57A 2Q1WA 2J7PA 1GZUA 3BTSA 3KXPA 3H42B 4EARA 3OICA 3GEGA 5M3BA 3UYLA 2A1UB 3W1WA 5JJLA 2IE0A 2G07A 1PCXA 1PL0A 4RJKA 5CJPA 5EKUA 2UYJA 2GM4A 3RSZA 3IR7A 1Y3BE 4L2IA 5H81A 3EZFA 4G1FA 2TECE 1L5MA 2NXCA 2PKRA 2XYVA 4N3GA 2OFFA 4BNWA 3TAXA 3UICA 4QG3A 4HPWA 5K99A 4CM8B 5FYDA 3HP1A 4QXPA 5KC8A 5FUWA 1BE6A 3LWDA 3QA3E 5HY2A 4PC1A 4XVHA 3NEYA 2NU8B 4DE5A 4Z4QA 4WKGA 3WO1A 3BHJA 1JTEA 4RLQA 3ZXIA 2NUTB 4N7RA 3PLAE 3ANMA 2PJDA 3NONA 2HCBA 4JAVC 4LCEA 4URFA 5EP4A 3SE7A 4OOFA 1TYEB 4ZO8A 1NDHA 3IKJA 2O7QA 4H7DA 2QIPA 2RI6A 5AJXA 1NHWA 4ZVVA 4JI4B 3AETA 3DF7A 2DTXA 4WKNA 2P9TA 5JXHA 3EXHB 4GM1A 3RDPA 5ILQA 4OQEA 2NU7B 1W73A 3R7BA 2QX9A 2ALEA 1E59A 1E9DA 2Z9CA 4GOMD 4RTLA 4PY2A 2DWOA 1DBRA 4FCVA 4FN5A 4X9XA 2GDJA 1Q22A 2Z1DA 2FEPA 3MQFA 1HSOA 2JZNA 1HPLA 2YRXA 3OIUA 4LQLA 3DTNA 1UMCA 5DNCA 2J7PD 2JK1A 1OH7A 3GCZA 2ZVJA 4NKRA 4EKNB 3TN7A 4NHEA 2WJYA 3SMVA 2HA2A 5BURA 1ZZGA 2J3MA 5BOSB 3CF4A 4UUBA 3COPA 1M7HA 5JRJA 2CKMA 5G1NA 1U0NA 4RO0A 4TPKA 4UNNA 3EPLA 1OU0A 4BBPA 3TFQA 4PVDA 1SCIA 5EYPA 4V38A 4KODA 4CMGA 1I4DD 4NONA 4W4TA 5KSYA 2YV1A 4POAA 4C0XA 3B9PA 4UTRA 4HNVA 3AC0A 1QIKA 4K8OA 4AQDA 5CP8A 3HYSA 1UKEA 2I7XA 2YIJA 2PZMA 4L7VA 3THXB 1PUXA 3CVYA 5A0TA 4R7TA 2Q07A 3ET4A 3C3JA 5DT9A 1N2EA 1N7HA 3DVQX 2A58A 1VE5A 1E60A 1R4MA 1AXEA 2C0QA 4KC0A 5ICCA 4GWGA 1KP9A 1NR1A 4X8OA 1FX0A 2YJ5A 4O0LA 3CUTA 1DI0A 1TEHA 3HQ4O 1DL5A 2PFSA 4HEA6 4DDHA 1XCPA 4W9MC 2Y1KA 4URUR 5KNLA 2P9JA 1S8OA 4HGZA 1QIMA 4RS3A 3IV9A 4EHBA 2DPYA 1KOGA 1SPXA 1F48A 4LGYA 2CNWA 4NESA 1K5GA 4I9FA 3QPUA 1XUOA 2WWTA 3DT9A 3GROA 2W8BA 1DARA 1EFPA 4NOJA 4DCOA 5JARA 3B5IA 3FCXA 1NP6A 4IIYA 1S5PA 3DFMA 1PVDA 3DBHA 4XB2A 4EF6A 1QG2A 3ROGA 3UJCA 2POCA 3IT3A 1ZU5A 2ODAA 2PSEA 4GYJA 4LJLA 4RXMA 3TDKA 4GOLD 1SBCA 2P8JA 3E9RA 3N0RA 4L5IA 1DEHA 2XQJA 4LHXA 3AHFA 4QUJA 5JG7A 2AZTA 5LU8A 2WHQA 4HQ6A 4X3CA 2YY6A 2OHWA 3WJRA 3BERA 1P7WA 3N8NA 3OQIB 2FEWB 5CGZA 2E37A 1CS0A 3GEIA 3E53A 3V00A 3ZV7A 2VNIA 2C2XA 3MJDA 3LCMA 2QQ5A 3FF4A 1DCMA 1TKAA 5CYPA 2DLDA 5C3UA 1GCAA 2DUWA 5MDHA 1C30B 3UQYS 2EKBA 2BFDA 1VMIA 3ZQ6A 3ZDYB 1L8AA 3UAXA 5AJVB 3VDMA 3IJPA 2KLBA 4HC4A 1YJQA 1DX4A 1TLTA 4HUQB 3LT2A 4OBBA 5DGCA 5E0OA 1MRZA 2WTXA 4P4GA 3MBMA 1ISRA 1VHLA 1W4LA 4CEIB 3DVLA 2P9GA 3RW9A 4F91B 1E2PA 2OAP1 4MUYA 4XX0A 4BMXA 2R4UA 4F0JA 2I4TA 5H3LA 1YOVB 2ORIA 4JCCA 4OF4A 4QYIB 2G25A 2CXUA 3O73A 2P6RA 1Z56C 2HDHA 2GMWA 4K9LA 3AY0A 5EMHA 4CMCA 1LNQA 2CNWD 2HP3A 4RIHA 4NLLA 3HVRA 4FHCA 3W4IA 3W4JA 1XA4A 1UANA 2K2QB 2PBLA 3DFZA 1QO9A 4H1TA 1E7SA 2JGDB 3WL7A 2BKVA 3SAJA 5A1JA 3QIVA 4WKCA 1K9MH 3IKFA 4JWTA 3G0CA 4O63O 1MTZA 2AIRA 1KJJA 3HNPA 5FWXA 1Y82A 4MR8B 2FJUA 3HUUA 4BX2A 5CJJA 4EY3A 4N40A 1I6LA 2XE4A 4UM5A 4C14A 4NJEA 3IMKA 3DEJA 1ZXLA 3C15C 3PYLA 4OK3A 1P3Y1 3HYCA 1XZJA 4FUQA 1K66A 3INRA 5IABA 3OPXA 2FLKA 3RNLA 4C3UA 5E4TA 4XSVA 1ISFA 3WHIA 1NNUA 5J4HA 4RV4A 2W4QA 3V8VA 4EFKA 2I54A 3NVAA 2P0YA 4KSYA 1LY1A 1ZW1A 2WAAA 5F98A 1XR3A 2HTFA 3IV7A 5EZYB 1KZYC 3ZGYA 4V3CA 1X9HA 3IPLA 4PBSA 2J6IA 4Y2UA 3D4LA 4U8HA 3H1EA 4ZVMA 3RRYA 4D42A 5ICSA 1MIHA 1ZEMA 2P30A 5ENVA 4RZ2A 2B20A 3BA1A 1XHEA 1EIWA 2GTIA 4W5HA 3TW8A 3DCNA 3RG8A 3IQIX 3M6FA 3TAHA 2G88A 5E3IA 3CA8A 3GHYA 3BGOS 4L75A 4BEWA 1YJ9F 4V39A 2ZPAA 1G8PA 5FOXA 3O7WA 2J0UA 1BXGB 2H2HA 4A0HA 1PJLA 2BZ1A 2I2CA 2HFKA 3N7TA 3HMQA 4LOJA 4TYMA 4I55B 1P19A 4CMAA 7GPBA 3EPJA 3FWPA 4IOJA 2YWRA 3DMRA 4UEWA 2YWDA 4MQFA 3NPAA 1AXGA 1BCSA 1CF2O 4N01A 2FQYA 2AX4A 4BX3A 5F77A 4FNMA 3WPXA 2Q6TA 5ETJA 4RKFA 2JLXA 3BAZA 2ATXA 2V6FA 2VAPA 2D5AA 4YRMA 1QAMA 3VPFA 1KGSA 3DBRB 1MW8X 2HPVA 1U4OA 2V7BA 4LC1A 3ISVA 4TRMA 3BCHA 4NWOB 2JA2A 3VTKA 4KXVA 1GTMA 2B1IA 1SURA 3BUSA 3FBGA 4ILEA 4ED9A 3UMMA 2RJ3A 4JJAA 5GJVC 3QTTA 2Q9CA 4JJ7A 4ZRNA 3QU2A 3F96A 5EJGA 3WRXA 3FSRA 4GLLA 2OK7A 2FN7A 5T41A 5FIUA 3T5DA 3U1BA 1U43A 3RABA 1DDIA 3IXMA 4ZOQI 3UMRA 1KY3A 1UM9A 3JQCA 4JQYA 1MFZA 1XVLA 1WZ2A 2GFQA 5JCXA 2R4TA 2ZYDA 3ZXSA 2ZYRA 1VIMA 1PL7A 2SKCA 1EX1A 2P9FA 2BI7A 3GLKA 3S4YA 4ZEMA 2X7JA 3E2PA 1VQ9F 1B6GA 3DNMA 2QYTA 3VCZA 3F0EA 1G0NA 1O96B 2BBTA 3T5BA 4M36A 2Z5GA 2HMWA 3F73A 4YAOA 3CISA 3CCVF 4OO3A 4BO4A 1E7YA 3B13B 1NULA 1A5BB 4LPSA 4LXIA 2PIDA 2A94A 1USUA 3A1UA 2C4MA 3BQNB 3MCAA 2PEZA 1HNZB 1IWPB 2VQ6A 1BIFA 2CXQA 5CLLA 1KKLA 4CT0A 1GU0A 2Y1CA 2ZDQA 2OSBA 3MOIA 3QOFA 3TLYA 2Y99A 4EG8A 1OLUA 1XNHA 3ASUA 3DWGA 4RYDA 3X1ZA 3GLQA 3UJPA 1J9ZA 1C1XB 5CBPB 2I33A 2E3JA 3SR4A 1UDWA 1XDBA 4C8GA 2ZWIA 3EAFA 4U5XA 5D7NA 4CM3A 3KCQA 1NNI1 1ZSNA 4REOA 5EESA 3ZHVA 3QEKA 5BNZA 4PCVA 5EKXA 5TEWA 4BO8A 1Z29A 2OZLA 2Q45A 1X1SA 4S1PA 1Y7TA 2ZZMA 3VHXA 2QZ9A 3NORA 5F7XA 1F5SA 2CCKA 3WO0A 2ZRHA 1XD2B 3ZWCA 4BVAA 3L7BA 5B6IA 5ADWA 1RXWA 2O0LA 4YRQA 2JA1A 5FPKA 3RQIA 1X7GA 5JSKA 2ROQA 1GGJA 2P1ZA 2A3NA 3CLRD 4QGHA 1HNNA 2WIKA 1F7UA 4CF5A 5AOBA 4S3MA 3K8YA 4L7QA 2BI4A 4WBNA 2ZT5A 3MMPA 1G5FA 2NNWB 1ZCFA 2Q2VA 4OQLA 1BO6A 2O50A 1ZJ6A 3O38A 2OZEA 1XK7A 1RXCA 4KXWA 1L0BA 1JJFA 3JYNA 5BW4A 4MWOA 1KF0A 1JWBB 4B40A 1VFNA 4ENTA 1I5EA 3QUBA 3SJBA 5KNBA 4MVJH 4US0R 2VZEA 3IEMA 3ZDBA 1T5OA 3E7XA 5CT8A 1T29A 4BO6A 3NBMA 4ZALA 1OAAA 2PPLA 2Z3VA 2C04A 2VHCA 4GKKB 1CUXA 5IAGA 4DY6A 2C96A 3KYDA 2GK4A 3IT2A 4R05A 1NI5A 2AG0A 4MS3A 3TQRA 4ALIA 5IVHA 2VDRB 5AWFC 4BJ6A 3GNLA 1M2JA 1U6JA 2QTLA 3AB8A 4RSRA 5CDTA 1K9SA 3CCLF 2AN1A 4GR4A 2CBXA 1TU4A 2XMSA 1XLVA 4IRMA 4MQEA 1UDAA 5HJ2A 1SDSA 1KZ6A 2H7XA 4XIYA 3NU1A 1AGNA 4INJA 2FK8A 2BGKA 2OYCA 4AB1A 2ZIWB 3OE7A 4O29A 5KSOA 3FOCA 2V98A 1P1IA 1T2AA 3UHJA 2YYEA 2IPXA 1XTZA 1P2UA 5EA2A 4ZVTA 5KUTA 3FYSA 5K9ZA 2VP0A 2I3BA 3O5AA 4ZHYB 1NBIA 5DP1A 3VPBA 2VDQB 4TTVA 4F3NA 2VHZA 7ABPA 2IEDA 4BVTA 1OPRA 1D1SA 1MVLA 1Q92A 1N2XA 1TCUA 2GD0A 1A27A 4Q4AA 5CA1B 4BNFA 9ATCA 5LU9A 3HYTA 1N5RA 3HGQA 2EQ5A 4RFVA 3OHSX 2QRZA 1T6NA 4C4OA 3GZ4A 2BMWA 2W6IA 1W0JA 3WGVA 3H1FA 2VDNB 2ZRLA 3QNWA 1IUNA 2G3YA 3RUIA 5ALSA 3FX2A 3D0RA 4YALA 1GPDG 5KAPA 2PN1A 2WM8A 2C97A 2ZTLA 2H4FA 3DWEX 3EXHC 3PUWA 4M8IA 4LRXA 1LZLA 4CM4B 2IE8A 4DLNA 4IIJB 1U9IA 4J0QA 2UYGA 2JCVA 3CNNA 3F3MA 4Y30A 5AHOA 5KYXA 3SYRA 4DIUA 3AM5A 3F0DA 4J2HA 3KV3O 3ZCXA 4C7KA 4GD3Q 1XIVA 4BY9D 4FFPA 2JJ2A 3IEUA 5DGDA 4HNAA 2X3FA 2FJ0A 4ZHQB 3EY9A 2NO1A 4Q4JB 3F0TA 3HBMA 2B1RA 1I6MA 2G28A 2WA2A 1C3LA 2G1KA 1O94A 3CPSA 3OE7D 1MN6A 4KDFA 2P1RA 4RGQA 3E8XA 1NIPA 3UWDA 1U5AA 4I3GA 3GLHE 1NDQA 4M37A 4MIOA 5AHXA 4NEHB 5ALMA 4ESHA 5C35A 1R74A 1DELA 1N5JA 1ZM4A 3SBEA 2Q41A 2TYSB 5JDIC 2ANBA 3C87A 1E61A 4KR6A 2EHDA 3H7IA 3U7QB 4AJ9A 3ADBA 1LH0A 1M2OB 1P62B 3OM9A 2G04A 5FJ4C 3H65A 2SKEA 2EEPA 2QNBA 2QTMA 3SYLA 4B3DA 3ZWAA 2SBTA 2C0PA 3EXAA 4PZEA 1M2FA 3WWOA 2RB5A 2WSYB 4D97A 1W0JD 5BSFA 3O4GA 1JDJA 3F1KA 5J5AA 2JGJA 2J9RA 2WP0A 3UWMA 4Q24A 3L2OB 2V96A 5KU7A 3OO1A 1CIJA 2GCOA 2NUPB 3QWHA 4FBLA 4OQQA 3K30A 1N2CA 2O8FA 1BVUA 1Z4LA 4INZA 2PNFA 3IP3A 1F8XA 2W0SA 3O85A 3AIMA 2MSDB 1IQRA 3S02A 1SKBA 2B2CA 2X2PA 4J7CA 3QWBA 4BQIA 1WBBA 4LAFA 1NVWQ 4JNCA 4TV9F 2NSHA 2JJ2D 3GT7A 4C8EA 1DINA 2AJ8A 1LQ2A 3K15A 3SYTA 2JJ8A 2PD3A 10MHA 5LQMA 4E88A 5FTLA 1M1YA 1V7ZA 3K1JA 3NYQA 1O94D 1SKYE 4WRRA 3U56A 2TMDA 1FZTA 5LD2C 3O31A 4OYRA 4Y2XA 2CVHA 4AJLA 2PZAA 2VXBA 2WC1A 1IUKA 4CMJA 4KQ9A 5BWMA 1LK5A 2VDLB 1VQ6F 3SK0A 4ZI2A 2H31A 3PTLA 1AKTA 5CIWA 3QE9Y 4BQEA 3J7TA 2IBTA 3GCWA 1IY8A 3EISA 1GSOA 3PPVA 4KI7A 3DLHA 2R11A 1NC1A 3SXPA 5K05A 4KLZA 3VSBA 4ER0A 1RJDA 3EQ9A 3LYBA 5AHRA 4R7GA 5FWDA 4BV2A 1HF3A 3IURA 2O20A 2WT4A 1HG1A 3OO0A 1TEXA 2ZAGA 4J6FA 1X80A 4KAFA 4L4XA 4TRRA 1AB5A 3V7UA 5DI3B 3WLOA 1QB7A 2CLCX 5CDSA 3MTEA 4DYHA 3STUA 1ZP6A 3TEFA 3VJMA 2TMGA 4AKTA 2PO5A 3EK2A 3EZ6A 2EF1A 2QV0A 3N2GA 4X97A 4ZAXA 3W5IA 4EHLA 4Q16A 2A1TS 3RSQA 1X0XA 4EVIA 1DMRA 1M75A 1PJRA 1B8PA 3PSAA 3NW9A 2YFKA 4NZ9A 3GVHA 3M4XA 3NUQA 5AK4A 5DXJA 1MJGM 4ZCLA 1I30A 3GFQA 4J1TA 4Z54A 5B4VA 5LDDC 4C2UA 1N5KA 3FNGA 5JEEA 1S3IA 3OF2A 2DFDA 1UC8A 4FGZA 1MPXA 4BEBA 3G7NA 3PLAC 1KEUA 4PYMA 1NTOA 4AZWA 1U99A 4CG3A 5BYAA 1WV0A 4LE0A 2CUNA 2X86A 1A1SA 2ACWA 2WNSA 4E4TA 3T3NA 3JQBA 3H7AA 4MKGA 3M3PA 4JODA 1YAHA 1QJ4A 1VCHA 5TGTA 4MWGA 1LJUA 3DO8A 4PPYA 3W5VA 2E7ZA 3NHWA 4K2AA 3LBIA 3AFIA 3DE0X 4BWGA 3ZD7A 3KXDA 1T43A 4LYHA 2AG1A 1GX1A 2IXGA 5CDFE 5IHXA 1NFRA 4NS4A 3UWKA 3U3JA 3LUDA 2Q6LA 5EPEA 4HRYA 5L3SA 3Q3JB 2PX8A 3KQOA 1QP0A 3BT7A 4Z1MA 5ALGA 3MF4A 4LJ9A 2Z09A 4KACA 4Y2RA 1F9EA 4E2WA 4I8XA 3VTZA 5WRFA 3O95A 1CY2A 4OK5A 4JI7B 1FX1A 2XCSB 1JR6A 1H2ZA 1NXTA 3EXFB 2DPLA 2DUJA 1NI4A 1QUEA 2HL6A 2JFXA 1Y8ZA 2R65A 2VQEB 3ZVLA 1EFVA 4AZ3A 1SZPA 2H48A 2JLSA 2IS6A 4F71A 1ONBA 1SHZA 1P77A 1T35A 1FB5A 4GP9A 4DSNA 4L9WA 4AX4A 4QNNA 3ZDCA 1ODKA 1JLSA 4JH0A 4H1WA 4IZ6A 2AOTA 3C5CA 3EGVA 3PXDA 2PS9A 1GRRA 2FN9A 4IL5A 4N5DA 4XOUA 3RVNA 4DGQA 3SVTA 4FXPA 3TCNA 5JRDS 1JL3A 1HETA 3QY0A 4KZKA 5BWNA 1QYIA 1FC0A 4P0QB 1B16A 3I5XA 3FSGA 1YS1X 1UFYA 3FKQA 5DO9A 4RULA 4NU5A 4YUAA 1JFVA 2H3HA 2VKQA 3NIFB 4BT7A 3KQLA 3LVQE 1IPFA 3CH4B 4YJ2B 5E7QA 3CJTA 3V2UA 4P7BA 2Y1WA 3OTHA 4DEVA 3EMDA 5TIIA 1M