3WGLA

Staphylococcus aureus ftsz t7 mutant substituted for gan bound with gdp, deltat7gan-gdp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
303
structure length
303
Chain Sequence
LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGANLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Structural change in FtsZ Induced by intermolecular interactions between bound GTP and the T7 loop
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
total genus 90
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3wglA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3wglA01
4X1YB 5JQGB 4U39A 5IYZB 3R4VA 1FFXA 2RHJA 4I50A 5JH7A 2Q1YA 5IJ0A 1TUBB 5LXTA 4O2BA 5J2TA 1FFXB 2RHHA 1RQ2A 4WBNA 4U3JA 4E6EA 1W5EA 4I50B 5JH7B 5IJ0B 4HNAA 4O4IA 5LYJA 3RYHA 5LXTB 4O2BB 5ITZA 5J2TB 3RYIB 5LA6A 5JVDA 4WBNB 5KMGA 4TUYA 4U3JB 1JFFA 4HNAB 4O4IB 5LYJB 4O2AA 5GONA 3RYFA 2XKBA 2R751 5JVDB 5LA6B 2GVIA 5EIBC 5KMGB 4TUYB 1JFFB 3N2GA 1TVKA 4O2AB 5GONB 3RYFB 1RQ7A 3VOAA 5CB4A 4X20A 5C8YA 3N2GB 4B45A 4XCQA 2Q1XA 1TVKB 1TUBA 4IHJA 2RHOA 5CB4B 4TV8A 4F6RA 5MN4A 4X20B 4X1IA 5C8YB 4O4LA 4EB6B 4IHJB 4TV8B 4F6RB 3RYIA 1Z5WA 2BTOA 2XKAA 4X1IB 4ZOLA 3JATA 1Z5VA 4O4LB 3ZBPA 5CA1A 4B46A 3ZIDA 4I4TA 4ZOLB 5MN6A 3JATB 2VXYA 1W5FA 3M8KA 5CA1B 4DRXB 4I4TB 1W5BA 3ZBQA 3WGLA 3HKEA 5LP6A 5KX5B 4DXDA 3JARA 4IIJA 5LP6C 4ZI7A 1W581 3WGMA 4EI8A 5EZYA 3HKEB 5LP6B 4EB6A 3V3TA 3M89A 2VAPA 3JARB 4IIJB 5CA0A 3UT5A 4ZI7B 3RYCA 5EIBD 5EZYB 2VAWA 1FSZA 3UT5B 5CA0B 4KWEA 2R6R1 3RYCB 3RB8A 4ZHQA 4YJ3A 3VOBA 2VAMA 4EI9A 5FNVA 4LNUA 4M8IA 5IJ9A 4DRXA 4TV9A 3WGJA 4O4HA 5JCOA 4ZHQB 4YJ3B 3HKBA 3HKCA 3JALA 5JCOC 5FNVB 4LNUB 5EYPA 3JAKA 5IJ9B 5KX5A 4TV9B 4O4HB 3N2KB 3HKBB 3HKCB 3JALB 3VPAA 3E22B 5EYPB 3JAKB 3JAWA 4EI7A 3CB2A 5MN5A 3WGKA 1OFUA 4YJ2A 4X1KA 3JAWB 4O4JA 5J2UA 5LOVA 4FFBA 4YJ2B 4X1KB 4O4JB 5J2UB 3VO8A 3C8LA 1SA0A 3HKDA 5LOVB 4FFBB 1W5AA 3VO9A 3WGNA 3RYHB 5M7EA 4I55A 5ITZB 5BMVA 3JASA 1SA0B 3HKDB 2BTQA 1W59A 3N2KA 4X1YA 5JQGA 4I55B 5IYZA 3E22A 5BMVB 1RLUA 2RHLA 3JASB 2BTQB
chains in the Genus database with same CATH superfamily
2A5FA 3WGZA 2JBAB 4RKYA 2RMKA 1S72F 2EZTA 4I2NA 5BPFA 4JJ8A 3VJRA 1BE1A 5KDDA 2O2JA 2AD5A 4J3JA 5DI3A 4DGSA 3ABRB 1GPJA 1L4HA 4GYKA 5L3VA 1W5EA 1ZD1A 3RS8A 1R88A 2PIAA 1QHHA 1SD2A 5DI3B 4GSKA 5SY9A 5I7RA 2D7DA 1SOMA 4JYPA 5FJ4C 3LPCA 3E48A 2AWOA 2YBDA 4WGFA 3WHIA 4YCMA 1QHHB 3WR5A 1SCNE 2G67A 1AS0A 2R1TA 4H3HB 1SC3A 3RVBA 3ZV7A 4JUIA 1T9KA 1RYHA 3DQQA 2WE7A 3MMPA 2YIVX 4HWTA 5IARA 2IYAA 3C3MA 3WQSB 2R1TB 4FYMA 4RNCA 3B7PA 3IUYA 1ACMA 5JYCA 2V45A 4N0MA 4UM9D 3STYA 5KKCA 4AWBA 3OONA 5DT9A 1M7BA 5K05A 4DLWA 1M1NA 5FORA 4ND4A 3O92A 5CT6A 1GZ5A 1MXHA 1T9GR 4L8FA 5IN5A 3RYIA 1R0SA 3UB2A 3MYYA 2P67A 1VHWA 3AP1A 2W58A 1M1NB 1VL0A 2VDOB 1LBIA 3L0CA 1G98A 3N8HA 4GWLA 1X1SA 1XO1A 4S2EA 4B46A 3AO0B 3ORYA 2R6ZA 2PSDA 1U7UA 3MAAC 3QGMA 4ZAZA 5MN6A 4YUAA 4ZK6A 5ALOA 4IICA 3BJZA 4UKDA 1ZCBA 1YBFA 5AW1A 5CJ2A 1F9EA 3E18A 3IBFA 1F5NA 5F64A 2VWHA 2WPNA 2DHRA 2OM2A 1CSEE 4BUJA 2WM2A 2PKEA 1L3IA 2ZRLA 2EL7A 3EVAA 3J7AR 1CVLA 2HNAA 4LRWA 1GUAA 2Q46A 4JI7B 3PRJA 4JWTA 4RV9A 4EHAA 1FTGA 2HO5A 3QUBA 2H5IA 3KYIB 3EEFA 4Q1CA 4UXHA 2CDAA 5FD8A 2YMPA 4X8LA 1ZUWA 4MV1A 2G1PA 2OC4A 1P9WA 4KAJA 4PFQA 1M0EA 2C9ZA 4UFNA 2REBA 1SU8A 4HPXB 4LX0A 5LLDA 3R5XA 4UPVA 1HNWB 1K5HA 2JCBA 3D7RA 2MSNA 3D4OA 1XC7A 5BSGA 2HY7A 5TXGA 5K2OA 3CYPB 1NVMB 2W2OA 3NO4A 4QSMA 5SY4A 3VVBA 4BRSA 4PNHA 4CMKA 1PX0A 5DULA 2V54A 4U6QA 5TR9A 1FFAA 2DECA 4AL4A 2VEOA 2ORYA 2POCA 2GN6A 3T99A 1E89A 1DCMA 1JECA 4NYJQ 1RQLA 3FPHA 3RADC 2BFCB 1CFJA 1JJFA 1NE7A 3PYMA 4N40A 2XOXA 1ZONA 3DZCA 5ARBA 4R31A 1CY6A 4YMLA 4FFBA 1MXFA 1T9GS 5DU2A 1KMQA 3E3MA 2WPDA 1AMNA 1Q0ZA 5JAQA 3ROMA 3DMDA 3QU7A 4PG7A 3ITNA 3W5IA 4FFBB 3QHDA 1HF3A 4XWWA 2OXRA 2HA2A 4CQJA 1X19A 5FCDA 4HQ0A 2EFHB 4CLXA 1XCPA 2RH9B 2YJ3A 4E4RA 2LBWA 4PYOA 3RKSA 4J6FA 2XUGA 3N8KA 4EVSA 5AJWA 1RXCA 2GO1A 1JFLA 1U94A 1R5OA 2VZ0A 3TUIC 5KIAA 1KDTA 5KVAA 3ELWA 4ZQGA 3KOXA 2BM8A 4E5UA 2MU1A 4QG7A 3DULA 2ZTHA 3QJYA 3QMMA 2VXBA 5K0SA 4AP6A 3FPEA 1GX1A 2OEPA 2VUHB 1X1TA 2Z57A 3SMQA 1A2BA 1F8UA 1MQ9A 2AJDA 2Q4BA 2XSZD 3ED5A 3QKUA 3GAFA 3H5WA 4Q3DA 3FZNA 3D4LA 3LHDA 2KLHA 1JWLA 1W25A 1I51A 3VYTC 2FWNA 1Z4IA 2V0GA 4FMCF 1GSOA 4NU8X 4ENUA 4B09A 4H4EA 2I2BA 5CT4A 1P5RA 4QKQA 2GLUA 1JALA 3ECAA 4D9HA 1MAAA 1AK2A 1VQ1A 1I4LD 3JYHA 3PGA1 1OF1A 1KETA 2W37A 3HB4X 3STXA 3DBVO 2GEUA 2XMRA 3B52X 2C5HA 2YINC 3ZS8A 1F4PA 1CLEA 1IOVA 1OV6A 4X00A 1HL3A 2EBUA 4LY3A 4NCHA 1XMJA 5CAEA 1KXZA 3BWMA 4G5XA 2PGXA 2PSJA 4HF7A 3CUYA 4IOMA 4BVGA 3V4OA 1UBTS 4HSEA 4PBTA 5CAEB 5F2OA 3IEIA 3RKUA 5BMOA 1S3IA 2YWJA 2H2WA 3K1AA 2O2ZA 2XITA 1G8KA 3B9PA 5A9SA 2V9ZA 1GNTA 2FSIA 2QI9F 3D1VA 3TE7A 1CUAA 2PYIA 1BKYA 5JMPA 3K1AB 2VCHA 1W2BF 5A9SB 2XZTA 1XQ1A 4BVRA 2BJHA 2PD4A 4U5QA 3QW4B 5EP1A 5JATA 3KJQA 1UDRA 3PK0A 4RK4A 5IAJA 3DLHA 3NEJA 1D9XA 3LPMA 2HCBA 4IDAA 4V0ME 5DEIA 1UOEA 1MEEA 5B3LA 2ZRDA 1WKCA 2M98A 1N57A 1EK6A 1EUQA 4RMNA 5FJJA 4YYZA 3FLAA 3IHLA 3N75A 1NSYA 2FSFA 2DJIA 1PGNA 2O8BA 4DV0B 3EH1A 2AMJA 2R8RA 4G3XA 3CT6A 4G5FA 4LVOA 3A37A 5A4MS 2O8BB 2I1QA 1DELA 1GGHA 2B25A 1MF7A 3BGWA 3IUJA 4EX6A 3P32A 2OGZA 2XQVA 4RHEA 1AK1A 1UMKA 3ESAA 4C01A 5JXWA 1E9BA 4ZAYA 2BCEA 4EPXA 3C6BA 3RIHA 3DCIA 2Q3DA 4KI0A 1UFYA 1OT5A 4L50A 3WBJA 5FT9A 3ZDFA 6AT1A 2LBXA 1ZD9A 3SI7A 1USKA 5JD5A 4B0PA 4QPJC 5KTKA 4OREX 2J9XB 3F4BA 5BV2P 1TAQA 4U0KA 1GITA 2RBKA 3UW1A 2HIAA 3WL6A 2XUJA 3AEQA 3ILHA 3E82A 4FYPA 2KX7A 4PW0A 4XZ3A 4YAWA 3MTJA 3WL4A 5B57C 5KTRA 1C7FA 2QIPA 1O2DA 3OZSA 3PWSA 4JVNA 3AEQB 5K3OA 1WMBA 3LLVA 4H6XA 3FVQA 1DCKA 4IH4A 4M36A 5F73A 4ZJUA 2FDCA 1YCHA 3M83A 2PUJA 1RKUA 5AI0A 4BLWA 1H8HA 4LGVA 1GTG1 1NX9A 2UZAA 2QLTA 4UC0A 5I3CA 3ZJVA 4RV5A 2JFWA 2V59A 3LQ1A 4COKA 5KNBH 5KYWA 2G36A 4BUCA 1L7NA 2QUZA 1NHGA 5FR1A 3UGTA 3NHZA 4Y9RA 3C3CA 3I6YA 4MW9A 2UYCA 5KYWB 5CEFA 5FO0A 2VK1A 4CG2A 5HF5A 3G68A 4ZJZA 3AZOA 3WKEA 2WHEA 3I45A 3PG5A 4EPRA 4XCVA 5K0FA 4XJSA 4YCNA 2IDMA 1NN3A 4FOPA 4NJEA 3B5IA 4OM8A 1U2SA 3TS1A 4L5BA 4GVPA 2J45A 3W5UA 2FWRA 2M1ZA 1PEYA 1Z33A 1YL5A 3GWZA 5EMMA 4CUJA 4NJEB 2P1DA 4MZXA 3CEMA 4DILA 4GUAA 2DFKB 3PHHA 1GZHB 3ENNA 1U2PA 2IPAB 1R5NA 1Y3FE 3A2MA 3A3PA 3HP4A 3KZCA 4GMGA 4O5AA 2IYTA 4BVKA 1BDHA 3DP7A 4FNMA 4ALNA 2OLEA 2R4TA 1U0JA 1ZI8A 5K45A 2X22A 5HF8A 1ULZA 4DOMA 1PD0A 4MIKA 1ZSVA 5BNWA 2PS3A 3KD3A 3OBWA 1XBIA 5HJ2A 4L9RA 2HBYA 3PGKA 2ZKLA 4CT5A 1C2TA 5HVNA 2QR5A 3BCUA 3FCEA 4IO0A 2N46A 3CF6R 4GLFA 3ZGVA 4GX5A 3WJAA 5IDQA 2QE7A 1A4XA 1U1CA 2QTGA 3RR2A 3SICE 4ES6A 4IWYA 2NVOA 1P7VA 2WTMA 2X2PA 2X6QA 1QOPB 1T6ZA 3T3DA 1JEOA 1TLFA 5FI0B 1TJ5A 3EVNA 2P9HA 5KTPA 1ZOOA 3GJ3A 1SQGA 2Y1EA 3QXCA 4JOCA 1WCIA 2JHFA 5H3LA 4D9GA 5BN4A 5CB8A 5KUTA 3Q5GA 5FWDA 5KU1A 4TL9A 5IASA 3GNQA 2PKXA 4N18A 1Y8AA 2H16A 2H57A 1A9QA 1WCIB 1HPLA 3R0ZA 5TY0A 3NHJA 5I51A 3LA8A 4BVHA 3J7AC 1B14A 2H8EA 3QPWA 5ENDA 1BVYF 4BV3A 4OFZA 1Q2XA 3OUTA 1LDMA 3EVEA 5AOBA 3AIMA 5IAKA 1BXRA 2BIFA 2RCNA 4Y1GA 5F2KA 3AG6A 1UBUS 3EUFA 3KU4A 4MUKA 3CVWA 4F8EA 3AF0A 4PCUA 3L46A 5LZ7A 1BXRB 2WJPA 2QRKA 3AIKA 5TIIA 1JQ5A 2IUFA 1OFIA 1ZJJA 4EGSA 4FUTA 1KBQA 1XFAA 3DFKA 3MJRA 5CXSA 4BLUA 2P27A 4W1SA 4PYJA 2A58A 1PDOA 1A88A 1LVUA 4FE4A 3TD6A 4YT5A 1EA5A 5AVWA 2V6FA 3RFFA 1GDDA 4J0CA 2L0XA 3LKBA 4BO0A 3KHTA 3VSCA 4A5SA 1NMUB 3DE6X 3HB7A 1PLKA 1H85A 2XNSA 5D85A 4PO3X 5T3UA 4DARA 4XVHA 1ZIDA 1R0RE 3MGCA 4ZI5A 3HK2A 1MZVA 4M7RA 4MP3A 3NFYA 1XDGA 3R0XA 2DQ4A 2WD9A 1C1HA 1EMDA 2HKIA 4G0MA 2XB6A 2HWYA 1SCQA 3PKIA 1CBUA 2IV7A 3EHDA 1JB1A 4K9DA 4C4YA 1XTTA 1Q7EA 3A14A 1MOSA 3GCZA 4LHEA 4HH3C 1MHPA 2WWTA 2MMGA 6GPBA 1T9AA 4Z9XA 5AI4A 1MGPA 3FSEA 1YT5A 2PUCA 2A0FA 4QQNA 4BECA 5GIOC 2WIDA 3SNHA 3NR2A 1O94C 5F3DA 3MQFA 5G02A 1X7GA 2HS0A 4BVQA 3MPOA 4BFLA 221PA 3OOSA 3PNMA 5B7GA 2F9FA 4IXNA 2HTEA 3WLTA 2HSJA 2O2HA 5JSQA 5LDDC 4MRNA 4LJLA 3ADOA 1E66A 1KAQA 3GLFE 2XYHA 1KSJA 1EBUA 3CLTC 4R0VA 2VSFA 3P2JA 2QYTA 5AQ1A 1UFOA 2ZR7A 1ONOA 3TVYA 4U63A 5K01A 2CXRA 1I7PA 3MWKA 1BXGA 3PP8A 5LXTA 1G3UA 4Q1EA 2LBTA 1FA9A 1U02A 4E15A 3U4QA 1R3DA 1VCOA 3W9BA 2JFZA 2Y71A 4JBHA 1NVGA 1Z2EA 2F4NA 1BXGB 4DR1B 5LXTB 2ZS9A 2YXEA 1YBHA 3O3MB 3V7NA 1YJ8A 1ZGHA 4PPYA 1S4QA 5GV7A 3VVCA 4M6WA 4OPMA 1R74A 1HSOA 2BE9A 2HF2A 1ESDA 1KMNA 5DM0A 3AV0B 4WKNA 1QMPA 5L40A 4GQIA 4M6WB 3QWAA 4MJ3A 1C9JA 2I78A 3KB6A 4CETA 3QEAZ 1G4UR 1L9XA 4UARA 1KIAA 2XTNA 3P2OA 4RADA 4ATNA 4D9KA 4F9TA 1TPZA 2WSSD 5JLJA 1D4OA 2PZMA 5HK8A 1KWGA 4NAUA 2XNHA 1G3IA 4CKXA 3VH4A 4EB8A 5COQA 4AYTA 3H4IA 1JTEA 1L2TA 3FIUA 2Q07A 3A4MA 2CDBA 4V03A 4L2IA 3PFGA 4CQNA 4H17A 3TSCA 1OX6A 1Z6QA 2ZITA 1NFFA 3N2NA 3Q5EA 4Q03A 4OLHA 5EKSA 4L2IB 2SNIE 3KZNA 2Z0MA 4N3NA 4W7HA 3G71F 4PGHA 4YXWA 4BTEA 1O97C 1UAAA 4CGZA 1LBTA 1YR1A 1CS4C 2WDPA 3ZHYA 1DC7A 2HJ9A 5T4HA 3GA7A 1AS2A 3KQPA 3FAKA 2CXHA 2V55B 2QMHA 3LRXA 3KSMA 3RBZA 1KYVA 3OLCX 1KGSA 3PQ6A 2Z4TA 3Q3EA 3WZMA 1N5KA 4BU1A 3DA8A 2IHZA 3M89A 1LQTA 4MCJA 5DVZA 4YREA 1T43A 3STTA 3STWA 4C4AA 2KI5A 1MV8A 3MPUA 4Z0NA 1E6LA 4QBIA 2C4UA 2X0JA 3BPSA 4A10A 1A9XA 1IBKB 3K0AB 1U3CA 3VZSA 4E32A 2B7BA 2GS9A 3BDAA 1W47A 3AVXA 4XM2A 3NAGA 5L45A 1EJ0A 1A9XB 3GRAA 1LWOA 3OCVA 4L85A 4LKRA 4W1QA 2FA9A 4WADA 4J9UE 3SWWA 4CIVA 5KNCA 1Y80A 3G8CA 3LYHA 3L8EA 1YQGA 5CLLA 3PXUA 3V6MA 3N2KB 1B6TA 3GROA 4LYYA 4KQGA 5C8DA 1OXBB 2PM8A 2F1IA 4RSGA 2BGKA 1SUPA 3KEOA 2LUOA 5EE9A 1D7OA 1R1MA 2PGNA 2XTZA 1J2UA 1DQSA 1GQRA 2C9MA 3DE2X 4IOKA 4AMGA 3RHZA 3ADCA 1YB4A 4IJUA 4FWTA 4JASB 3LHKA 3RG8A 2ZU0C 1GTJ1 5B1EA 2PGOA 4QECA 2JJ2A 2HA4A 4HZGA 1LSJA 2IXTA 4Y9DA 5CH8A 4Z2YA 1Z2PX 4QBHA 2D0IA 5HBRA 1X1QA 2IA5A 3K15A 1XHEA 5A4JA 5B5SA 5B7QA 3AINA 2BI4A 1SM4A 2FGYA 2GVZC 3ZIAD 2VAVA 5KQRA 1H9CA 2PUDA 1J7HA 3FHOA 1U80A 5KQSA 3D3NA 4NAHA 1BGVA 4ZVRA 3WLLA 1VOTA 3E22A 4L75A 5ESWA 1QHFA 4HVTA 1KZ1A 1Y4ZA 3F6BX 3SDZA 1L4FA 1ZMRA 3NPMA 5EEHA 3RK0A 5JDCA 2ZRKA 2PH5A 3SDSA 2EX4A 3LXMA 4G86A 1ODJA 1CRZA 1UBCA 3BC1A 1FVOA 4RTOA 1XEAA 4RK6A 2XR1A 2EAUA 1FDRA 4WLOA 3UUEA 1SHUX 4WBNA 2JLSA 3L0YA 1XLUA 1WIWA 3AZPA 4LYGA 1FDOA 5P21A 3T7TA 2ZVYA 1SN7A 1Y1KE 2QTNA 3ZHSA 3WL7A 5LNK1 5LZ9A 2XA2A 4WBNB 2XB4A 4JC5A 4PS0A 4TRMA 3CN7A 1KDVA 4J2OA 2C7VA 3AL0C 3I62A 4MI9A 3EMBA 1SEPA 1Z8HA 2YZ2A 3FSGA 1UPFA 2WBLC 5JQGF 1FLVA 2TMKA 5C5EA 2GPTA 1U2GC 3S70A 1K8QA 1XTUA 4KQKA 1Y8CA 2Y1FA 2NXCA 3FUUA 4JJFA 5FUWA 1DGQA 3HSKA 2PT7A 3IUSA 1KH1A 4TT3A 1UI9A 3ZGXA 2XDWA 5FAXA 5JTUA 5FA5A 3QVLA 5EWMA 1T8SA 3N8IA 4DM4A 3BFXA 4UEOA 2NZYA 1U2QA 3DH0A 3P0EA 3H8JA 4L74A 1TRHA 1KBZA 1BHSA 4HEA1 2C7PA 1HG1A 1W40A 1XN4A 2QL6A 1VPEA 2R7AA 3KD2A 5EWMB 2W90A 3JATA 3WAKA 4BB6A 4EP1A 4BCCA 3B6IA 1AV6A 1ISIA 4YRMA 4EQZA 2E48A 4KMRA 4WXHA 1VQOF 1T5DX 3JATB 1EHIA 2QRVA 5JHGB 1WXGA 2OQIA 3K7EA 3OTWA 3RS3A 5IWAB 1YF3A 1DUSA 3AVOA 4X95A 4AMYA 4M8LA 1V45E 1QSGA 3REOA 2AC4A 1U2TA 4BFVA 1OFUX 2QRVB 1WSAA 4P31A 2BM1A 2A9FA 4BQEA 1B41A 4AP5A 3ZWAA 5ALLA 3WIUA 1A8PA 1P4AA 2NNWB 2WFLA 5AJUA 3X0DA 2F8MA 1IM2A 4EI8A 1I6WA 4ARIA 1OHHD 3S0YA 5HFAA 4RK7A 4Y1FA 1W0KA 3LOUA 2WFLB 4J4HA 5HWEA 4CL3A 3MLBA 3IMKA 4MWGA 3LPNA 5BSVA 3GIDA 1QG0A 2J31A 1FSZA 1YJNF 3O0DA 5CFMA 1R4AA 1MQSA 4MW7A 3QFCA 2OD9A 1XN1A 1BU5A 2C3YA 3O2JA 5K4HA 1G55A 3S5UA 1QPZA 1AM4D 3FHTA 4DRXA 2V4UA 3WRWA 3IE0A 1S96A 1JVSA 1AQLA 3SYNA 1KI2A 3SXUA 3IURA 4W5RA 2GILA 1NN1A 2J9YB 3FGOA 3SX2A 2CLMB 3P9IA 4JBNA 4ARUA 1XQYA 4MTLA 1NIJA 5FFNA 3Q8XB 2A0WA 5JO0A 5IKXA 3D9QX 5A7GA 3SXUB 1U1FA 1UPTA 4RZHA 4Y0AA 2NZXA 3I1JA 3U7GA 1XRNA 4HBZA 1VP9A 1WUHS 2IHYA 2FWIA 3OZ7A 3BXXA 4P98A 3GLUA 2JLWA 4BNZA 2ZIVB 4OHYA 5F2EA 1Q0QA 1ORVA 1X7ZA 2ATXA 2EFDB 2YIJA 3AP3A 4L72A 4YJ2A 4Y2XA 1SXJA 5JS8A 1U8XX 3GGGA 4KH1A 1NLFA 2BGNA 1CHDA 1LBSA 1U3VA 1X7ZB 4NMWA 1R6DA 4RVCA 4B6GA 4YJ2B 4L16A 1SXJB 3I9OA 4ASUD 2ZI7A 3RTAA 2B5WA 3OEHA 1TZCA 4MV3A 3FNBA 3GVHA 4CBVA 2FSVC 3DCYA 4J1TC 3R09A 1E2LA 2RGXA 2A78A 4IZ6A 4Q3BA 5AI9A 5FTWA 5CD1A 4YROA 2E2WA 1PUIA 4XYBA 4B7AA 2JJMA 1VLVA 1DBSA 1CPYA 1W19A 3GN1A 5KNDH 4WACA 4Q1BA 3QWFA 1I4DD 1I6KA 2HA0A 4KN9S 3I72A 4Y30A 2IWHA 4AO8A 4N47A 3VZDA 3C98A 3C45A 4YIHA 3FDZA 1ZZEA 3EEYA 4N49A 4TXHA 5TMPA 2JGIA 3EK2A 4LJYA 5DZSA 1P8AA 3OOEA 3FDZB 5KOYA 2O0MA 1ODKA 1QVWA 1QQ7A 2OZPA 4HNAA 4YUYA 1UBGA 1RM5A 3LBNA 1I7SB 5BQ5A 4KK3A 3RDPA 3ZJUA 4PGMA 4HNAB 1BFUA 3IFSA 1Y9EA 4HQRA 1GAEO 1PK8A 3PNLA 1XD8A 2VO1A 3UGQA 3SM3A 2JFVA 3HYNA 2X41A 2ZRAA 3ST7A 3CVYA 1PQPA 2A3RA 4YRDA 1PZXA 1P6QA 4AQDA 1NW6A 5COBA 3PFIA 4ENSA 1N7IA 3HGTA 4GZ6A 3CLSD 2H17A 2LWIA 3LXRA 5JH7F 1XZ8A 3Q3GE 2DFVA 3HWX1 5F9MA 1M76A 3OEWA 3U44A 4C4PA 5ICMA 1K5DA 2EJCA 5KAPA 2X3YA 1U5CA 3TLEA 1XNRB 2OKCA 4K3VA 2NO0A 1FMJA 1ZN9A 1W4RA 1ZH2A 3CZRA 2YJ6A 3KQHA 3U44B 2H1LA 5AM2A 1LWNA 3L7YA 1U1IA 1M67A 2OV4A 5TPZD 4IXDA 3JVVA 3OQIA 3CZ4A 3PI7A 3PS9A 3AFOA 3ZYZA 3BORA 2WC1A 3OQIB 4J0FA 5DM2A 1WDMA 4FR0A 1J2TA 2ZRQA 1EGQA 3DAFA 3KZXA 4ZHYB 3K2EA 1T5BA 3IESA 3T3HA 3TZQA 1EFCA 1KP2A 1N3IA 4NBLA 2VAPA 4NZ9A 3ZZNA 4CM9A 2PX6A 3H4TA 4K1XA 3E7WA 4Y98A 5BO5A 1U1EA 2CKMA 2AZ4A 3B85A 1WF6A 1JYEA 1PL7A 4CTNA 1N3YA 1K6EA 3SXPA 2VUTA 3QOFA 2ZROA 3H7IA 3M5WA 4M46A 4U2CA 1FYWA 2IPMA 1JDUA 1Q5PA 4I4NA 4DLBA 4GR9A 4YRPA 4CQMA 1UK8A 1CD5A 1LB1B 1EGHA 4AUKA 4LK2A 2J7PA 4XRGA 1YITF 4HWOA 4MUAA 2OA0A 4DLYA 1S5PA 1KVRA 1CERA 4PG5A 4CQMB 4A92A 2INGX 4DYVA 2ISQA 5HKKA 4NKRA 1V4NA 3RVPA 4FZRA 1EP9A 4BMPB 5JYBA 3A6GA 4DDWA 1NG9A 2Y9MB 2ENWA 4PAGA 1HE4A 3M6LA 5CIQA 3C8ZA 2OFWA 4INOA 4YYEA 1D4AA 3GRPA 3Q87B 1GFZA 2WWXA 1F8GA 4NMMA 1MO3A 3PHCA 2EDCA 2ZUTA 1NURA 1AG9A 2O8DA 4HX5A 4URVR 1ZICA 4MGKR 4B4VA 4YFYA 3ZU3A 1O0CA 2DH5A 1XLVA 4H1TA 4RVOA 4CMIA 4AC9A 2VUUA 3RK4A 3H9EO 2O8DB 1WD7A 2PKYX 3DZFA 4R4JA 3A4IA 1NZFA 2V9PA 1R66A 2WTNA 3B3AA 4JT4A 2HVYD 6Q21A 1PR6A 3MD0A 2PWBA 4CMIB 1NNEA 1JXQA 4XUGB 3IP3A 4NCIA 4RZIA 4RTQA 5C1DA 4V24A 1SPXA 3LCRA 4JK3A 5I4KA 2OENG 1O4WA 3HXLA 3L8ZA 5DV9A 2H63A 2HU5A 1HG0A 1LLUA 2Q2WA 3H3JA 2FG5A 4M76B 4OFWA 4BYMA 4AY2A 3IJEB 2P30A 4H1VA 3ILVA 2CSUA 2WILA 3WE7A 2OFOA 5E0KB 1XOIA 1X9IA 3BBPA 4QLAA 1YZHA 2CLIB 2RE8A 4PAMA 2V7UA 4DC1A 3AP2A 3TTVA 4HNRA 4L5IA 1X1DA 5KMGA 1VGRA 2A35A 4F1KA 3GYQA 3VV2A 5DTQA 3VYTB 4Q5IA 1Q7YH 3WL3A 1KO4A 2QYOA 2ZUSA 4NG5A 3VSBA 4A15A 4OP2A 2B4QA 2C04A 5EIBC 5KMGB 1IK4A 2G88A 3ET4A 3DL4A 5JSYA 5EIFA 3L7QA 1JLMA 1FRNA 2ODQA 2WA1A 3C5EA 4JD5A 3WMRA 1NV9A 4MARA 1SUCA 2ADFA 2OHWA 3N3BC 4QARA 5CW2A 3KL2A 3PD7A 4L22A 1L5GB 2NZUG 3P2EA 4D92A 2VF4X 5AXAA 2OVFA 3CH5A 3RE1A 2B99A 4REQA 2FUNB 4ER6A 2K4MA 4D0RA 2CE7A 2W2KA 1DG9A 4QUBA 1IBCA 3KR1A 3OJEA 4REQB 3D0KA 3W3AH 2BISA 4Z0TA 1XRJA 4ZYUA 2W2KB 3ISVA 1HEIA 3S2FA 1QBGA 1XTPA 3NYWA 1PQ4A 3BA6A 3ZXUB 1ZDMA 5BUQA 1WNTA 3IQIX 2FN4A 4K6GA 4FKZA 2M32A 5C1IA 4Y1EA 1FOEB 1J23A 3A3YA 1JN1A 1NBOA 2H0AA 1QVAA 3T5MA 3AI3A 5JYDA 2Z6QA 1V5IA 2CK3A 1K75A 1RPNA 3WLFA 1K7SN 3PZRA 4DBLE 1QG4A 4DV5B 3RVNA 1D4ZA 3FROA 1E3JA 4H35A 2IEYA 5CIYA 3F8TA 2PSSA 3EEIA 4R69A 3OM1A 1I24A 1GTSA 4RH1A 4K8RB 1SHLA 2J3LA 1QIDA 4PCVA 4S05A 4ZT6A 4MYDA 1N1EA 5EAIA 4QJ3A 3ZU2A 1NE2A 5ELXA 1I5OA 3LLMA 4RY0A 1W2WB 4IJKA 1C1DA 1E60A 4XIFA 5HW0A 1X9GA 3D3EA 3BL6A 4BNMA 4YVFA 5BSWA 2IX3A 1DDGA 2QTHA 4QASA 1I7LA 1ZOSA 3NMUF 2IU3A 3H5OA 3ICVA 4K9SA 3SOZA 2VZ8A 1C1DB 3A2LA 3OLQA 1QO7A 4OQLA 4C0AC 4C4XA 1CTQA 3A1FA 1QX3A 1WCYA 3C3DA 5JZVA 3C97A 4CM5A 4ZYLA 2H1OA 1YQXA 4EG7A 5EB0A 3EIUA 5DYWA 2YWCA 4A6DA 4Y67A 3N7UA 3M1XA 2DZDA 4HQNA 1DLIA 1I7DA 2Q6VA 2X4IA 2G6BA 4DR2B 2TMYA 1PI3A 1DNPA 1U7XA 4MINA 5A2QM 3SZOA 4TYNA 3QX3A 1Q86H 2FPIA 2GCIA 3E15A 4F72A 2XCIA 4OHUA 4QU0A 5CURA 4ZEXA 3ZWQA 2YR0A 1MOPA 1CRWG 1P0QA 2G0TA 3DZGA 1CQPA 2FPIB 1T6YA 3LWBA 2GTIA 2H6LA 2H65A 3LCCA 1YIOA 2ZI3A 1K63A 1XU4A 3V8EA 1G8MA 5GM2A 1ZHFA 2CNLA 1C0KA 3CRW1 1XKLA 2UYPA 1X1AA 4NCXA 1YI1A 1NV8A 1ZNYA 2BKVA 2V8OA 2VTBB 5LQKA 4NC9A 3U7EB 1YH3A 4H7EA 3GJ7A 1QS0A 2YW9A 5GZ3A 5IK2D 1K5PA 1ONNA 1SKYB 3P4UA 1HGXA 2ETVA 1NF3A 4X71A 4DVGA 3V8NA 4F4JA 3ZKWA 4HS9A 1QS0B 1R0ZA 2I67A 2QU7A 2JGKA 1PU2A 3H7AA 3NTQA 3EDYA 4IV8A 3WMXA 1WZNA 2IC5A 1WB9A 1J2JA 5MHTA 3W8EA 4NBTA 4Y2SA 5JRDS 3Q41A 3CCJF 3DMRA 2G5GX 1I14A 1KY4A 2YHBA 3LECA 4MHSA 4Q48A 4RNDB 2WAOA 2XUQA 3GEMA 5G4VC 2CL7X 4CF4A 5A0TA 2FMIA 1DWQA 2QNBA 1DX9A 1MRNA 3T3PB 3UAWA 3INNA 2X6RA 1K7EB 5E3HA 4EB3A 4F12A 3JAMM 4L6AA 2FNAA 1YUBA 4TV8A 3DE7X 4BZWA 4JJAA 2NADA 2UXCB 4EMTA 5HKBA 4EG5A 1KHTA 2V7QD 2F43A 4TV8B 4KACA 2QKYA 1RAFA 1EK0A 5CVEA 2IKSA 2R00C 4F6CA 1DTWA 2F43B 2H1RA 5EJFA 2H0QA 2HWUA 3DXFA 1T1IA 2Q4RA 3SQMA 5K8JB 3JQFC 1DTWB 4GE0A 1VKHA 3AR9A 2FVYA 3RVRA 3NHRA 1FVHA 1VJCA 5C8VA 3GDWA 3GFTA 3O8QA 3HCNA 3IE2A 3QYJA 3PKJA 3VKHA 3AETA 1FW8A 4X3MA 1G5PA 1HYHA 2C2MA 3SMVA 3A1NA 2XKJE 2QUJA 3O8QB 5KKNB 4KG7A 1NUAA 2ZXUA 2QWXA 2VP3A 4BNNA 4YRKA 3ZVNA 5DEOA 2DWPA 3AETB 4RWEA 1M2WA 4LZWA 1KVQA 4AURA 4PZCA 3TJZA 3GJ4A 5HP8A 1WM1A 2F90A 4B7CA 5DLYA 4XJTA 1E2FA 3IVAA 4TL6A 3R76A 1PR3A 3C3KA 3ICOA 1C3JA 3LVRE 1SQSA 3KFXA 4CQLA 3B1WA 3IAHA 1RXUA 1XVLA 4Q3CA 4D4KA 5CYGA 5AVRA 5I45A 4MDYA 2Q3JA 4BPBA 1E3TA 2YHSA 3GJTA 1ZXLA 2O7VA 3JVEA 4GX2A 4CQLB 4CT4B 3GGJA 2G25A 3K9BA 1N8NA 4I9UA 1RHRA 1UBKS 1RRCA 3A7EA 1XMVA 4LY6A 1D2RA 4H31A 3ANMA 1OJLA 3ROKA 1TZBA 3WLRA 2O5VA 2QD2A 1C1XA 4CYMA 1ETUA 3RE3A 5MN5A 1A4RA 1LPBB 3LF1A 2W2NA 2OSBA 1DOHA 3BD7A 2WWVD 3ZDCA 4NBKA 4NABA 3ZJ4A 5K6RA 1NF9A 1MB2A 2GAIA 2OXCA 3F6EX 4W6ZA 4LOJA 1QYIA 3I4LA 3RUFA 5HRCA 3C8LA 2GLXA 2VDRB 2C5AA 5EHXA 5DTMA 4ABTA 1U9YA 1O94A 2HK7A 1U0NA 4JUDX 4BX8A 3BCRA 1FRZA 3K4HA 1GNPA 1T1SA 3T0FA 1SIBE 4E22A 3WICA 3L1KA 2FXVA 4HGPA 5BYJA 2G5PA 4G4IA 1K2VN 3OLWA 3Q7QA 5AYVA 2WZDA 5GOZA 2OGTA 1HE2A 2FZCA 4BRWA 4GD3Q 5ENVA 2J3IA 1QFXA 1WPXA 1R16A 2CYAA 3GPCA 4OQDA 3EFOA 4P4SB 4KUGA 4RE5A 4Y0NA 1TZJA 3WGQA 3KOMA 2GZSA 2XOKA 2H7VA 3KPJA 3TBKA 4H1WA 1CULC 2X5OA 4YJGB 1FDTA 4BMYA 3K16A 3LL7A 3TSWA 2PHZA 1AO0A 3TSAA 2YXPX 1HZJA 1NVXQ 1IZZA 3GG9A 5D5HA 2DETA 4QYSA 5BSTA 3X3HA 5AD1A 3WGOA 1CE8B 2AMYA 5IHXA 4MW4A 1IZYA 2EHJA 4MUBA 3DBOB 3RABA 1XZLA 3PQ8A 3TMKA 4BKPA 4DL9A 2Z2YA 4J0GA 4G5SA 1PNQA 2GHRA 4QQ8A 1YS9A 1J0DA 2AT1A 4DCTA 3SQWA 4RANA 3LBFA 2GN4A 1XTIA 3B6KA 3DEJA 3N0XA 4WDQA 3IV9A 1OVMA 5EXEA 5HMMA 4DB2A 1YHNA 2X7HA 3CURA 1H2BA 3D54D 4BY9D 3N7TA 2DPHA 3LCJA 3RC7A 4B2IA 2IS4A 3T94A 4DAEA 5L4NA 3WTBA 3TTYA 2CHQA 2C4WA 2X58A 4YALA 3WWOA 3UFBA 4RD3A 5EOVA 4QBGB 1OW3B 4DSAA 1DUVG 2C83A 2KLBA 4ARAA 1NLZA 1YAJA 1M7HA 4I5EA 3PNVA 4KIJA 2AKAB 7REQA 4QL3A 1WXHA 4B2YA 1P0FA 2H52A 2FPLA 2E1PA 1PIWA 4XQ9A 5KCZA 2WAAA 5C5DA 3L07A 3P4YA 5AHRA 3QE3A 3DLTA 3OA2A 4TN1A 4BCDA 5JJ5A 1DAMA 2PX3A 3L84A 4X1OA 5IH3A 3A4VA 1A9YA 3QG5A 4ZQIA 4CCSA 1QGOA 4QOFA 4TWBA 5BRJA 4WXYB 3V4PB 1ZISA 3A26A 2WFZA 1QRSA 4YV7A 4ZVQA 4EB6A 5L51A 1EDZA 9MHTA 1DT9A 3QUSA 4R8RA 1Y1LA 1F51E 1UK9A 2XGOA 3J81k 4MAMA 1BE8A 2BMAA 1T3HA 1XJWA 2C2OA 2D3WA 3LSTA 2NXNA 3LRTA 1NUQA 2AMFA 3RVOA 2XCOA 2V8BA 3Q11A 2HT1A 1XEFA 2MSCB 3EC7A 2D5CA 4JP2A 4AQ7A 4MS4A 3PEUA 3CVOA 3KOWA 5I7FA 1BJKA 3JQCA 2WMDA 2ZQ5A 3AHCA 2R8XA 4MS4B 3P26A 4NU6A 5BV7A 5CDSA 5C9ZA 4JT2A 1FS6A 4KQWA 3ANYB 3DO6A 3KPYA 2BHSA 4HADA 4FN4A 4B74A 1GD1O 1NN5A 1XEXA 1HUQA 1RWKA 1BMQA 2O07A 3P10A 1DFIA 4PFSA 3E3LA 1AKVA 4PAWA 3UEOA 2OZLA 1ZESA 1JAIA 1UDCA 4EG8A 1XEXB 4ZYTA 4NK4A 1WRBA 3BOSA 3WK4A 4F3CA 1DB3A 1DAEA 2X0IA 4OQ4A 3TBHA 4QYMA 1Z6AA 3O8DA 4N8EA 4ONEA 4YA6A 3GLIB 3H9QA 4AX4A 4LZPA 2JFOA 4QRIA 5DRYA 3VR0A 4I55A 2X4GA 3FNQA 3R4CA 4UHDA 5NULA 4CPDA 5HP4A 3M3PA 2EGHA 4XASA 5FUVA 4PV7A 2FRXA 2AMVA 5F4BA 4I55B 2CYBA 4FFPA 4GI7A 4RY9A 4F7WA 1C41A 1XP8A 5FLXA 3WKDA 3RLIA 1VKNA 3MMNA 1TO1E 5ADWA 2GUGA 2YWFA 2VOEA 1HM5A 5CX1A 2P0AA 1T1JA 3X1KA 4AYXA 5A6VA 5C34B 4UEJA 3CG4A 5CX1B 5DGDA 4XQCA 2GJ4A 2AXNA 1OV4A 2I6UA 4RUKA 1H6BA 2QM8A 2GA8A 3KE9A 5AVYA 3EJWA 1G291 1Z5OA 1YS4A 3W6PA 5DYTA 1X2EA 2VHEA 4FYJA 3FI0A 4MWEA 2ZS7A 3J7TA 4O8CA 4OI2A 3TF5A 1UXGA 1NU6A 4HDOB 5IRCD 4DJJA 4TYYA 1V16A 3BJRA 4IQ4A 1X42A 3HR4A 1GTVA 1P62B 4YK7A 2AXPA 2VDKB 1U2GA 2C8LA 1TF2A 2NZWA 3EA0A 3G8DA 3HEAA 1F06A 1G21E 2WVAA 3RRJA 1IY9A 3GZTB 1V16B 2WVJA 3P19A 5FB3A 4JI8B 1AXEA 1PTKA 3PENA 5BUCA 4B5CA 1GZ6A 3SY8A 3V8BA 1R0WA 1GYRA 1WB4A 3F98A 2YV3A 3HGMA 2WW8A 3PUVA 1BW9A 1SHZA 3TTTA 4F9GA 4F6RA 1XAIA 4AJHA 2V3CC 4YRBA 3UWPA 2J6IA 1HZZC 4QOHA 2H8CA 2B0JA 2DKOA 5LXTF 1M8GA 5A4DA 3BUSA 1VI5A 3S27A 1BW9B 3C1OA 3NM5A 4F6RB 3OBYA 1V1RA 4BBJA 4NEHB 4BKUA 2O4CA 3L8MA 3OA0A 2HPHA 3AF3A 4HAYA 1V1RB 3V4FA 1T34A 1WDKA 5EY5B 2FUEA 2OFFA 3W7AA 5TJHA 3WA7A 1Y9JA 5B8FA 2RI0A 2EYUA 1AUQA 2HRYA 1NYRA 4LXYA 4BAGA 5JWHA 3LOQA 1E98A 4DVJA 2NZJA 4E2XA 3UN1A 1Z16A 3PXEA 3HKEA 1PGJA 4UVGA 1I4TD 4ZT5A 3HN2A 4B3DA 3DMTC 2QL9A 3E7XA 4NIMA 3D1JA 1D2CA 1DPFA 3OPVA 2GDJA 4FOOA 1IV3A 4AJJA 1RZRD 3HKEB 1OWMA 4B4DA 1NVEA 1CJKC 4RF4A 4YRFA 3IEXA 4HB4A 3O4IA 2ZSAA 1PEAA 4EHLA 3WMFA 5I7SA 2ZR0A 4DEXA 4ITVA 2XUDA 3U37A 2GBPA 2XMZA 3VOBA 1TM2A 4OUDA 4F38A 4GL2A 1GN8A 4DC0A 4M8IA 1CQWA 1BS2A 1JXAA 2CLDX 5JDIC 1ESNA 1GLVA 4DLLA 3BREA 1U3TA 1ZFNA 4LQDA 4OUDB 5FWAA 5JAHA 2VPQA 4KUHA 4E5SA 1BDBA 3KYDA 3LMKA 2O57A 4MULA 3U1VA 1WBJB 1N2JA 1VL1A 1WBBA 4DDUA 1GP2A 4XWOA 1ZA1A 2W00A 4CF6A 1I3OA 5E6SA 3KYDB 3A3OA 3O31A 4RDIA 3ZCRA 2ZJ2A 1G1MA 4RQTA 3GH3A 1DQNA 4ECEA 7GPBA 4PRZA 1LBEA 2RH5A 4PWZA 2BFEA 5E6SB 3KJZA 3VZPA 1CY0A 4QPPA 5IEJA 4AVYA 3THYA 1XV5A 3OZWA 3CC8A 2COEA 2HYDA 3EYWA 2GDZA 3PSAA 1Q81H 2BFEB 3HUEA 3UOGA 4CKEA 4Q7QA 5J3JA 5HOQA 1B6GA 2FSVA 4KQXA 2OWDA 4J1TA 3TL2A 1MT3A 3THYB 4ZDWA 4K26A 4CKEB 1BHO1 4QXPA 5JAUA 1RM0A 3CRZA 1ABEA 2O1XA 4Q02A 1E1RD 2VUIB 4YAGA 1R4NA 5LZ8A 1PT7A 4YCBA 4AULA 1DLJA 3F8WA 3BD9A 2BCJQ 1NBHA 3U49A 1BH6A 2VR1A 4BTLA 3PD0A 4GPD1 4YMTA 4YQFA 4ZI2A 4JI0B 3E05A 4MIEA 2XA9A 3I9LA 4UHCA 1F48A 3N1UA 1ISJA 2G6TA 2IHVA 3WO1A 4LY0A 2CC2A 5KKAA 2Z01A 1PBNA 5LZ2A 2AOUA 3HU3A 3VO2A 1EDOA 2FUG1 2H9IA 2PKCA 4OIMA 5FEUA 1ISRA 3E20B 4N5LA 4D43A 2ZRIA 4OAQA 1IJFA 1LJUA 1SIUA 2AOUB 5BNTA 1RYFA 4M88A 1LUAA 4KVGA 1RXEA 1CUBA 4WK0B 3OQNA 1NLYA 3B20A 1JFFA 4G1MB 2A86A 3MXTA 2PU7A 1EVYA 1ZGZA 2PV0A 2E4WA 3E81A 3I58A 1XZQA 1NLUA 1CEXA 2OZEA 3M5DA 5F76A 1TVCA 1JFFB 3K31A 3O91A 5DHRA 4IQGA 3MTQA 1I0ZA 2D5LA 3HL4A 1FRFS 5AVZA 4RK1A 4NY1A 4JXJA 1S8OA 4XCQA 2FLWA 4HNHA 4LPSA 4XVCA 5AVQA 3IP6A 1PJBA 2VS1A 5JE8A 3RC3A 3VSEA 1FBNA 3GG2A 4JB3A 3ZHUA 1Q1NA 4R0NA 4R5HA 4EUSA 1T6NA 3C14C 2PSEA 4OG2A 4WXPA 5CDTA 4WBNF 2Z1TA 1P3Y1 2VHTA 2BPOA 2R4QA 3AF1A 3EULA 4YLYA 5AFSA 1QFZA 1V39A 3UJ8A 4RTKA 2JHAA 1F2TA 3GEHA 4Q39A 5F7JA 1JXOA 4CM4A 4MW5A 2W48A 1B0ZA 4JY7A 4LBWA 1Y89A 1DEAA 4IV0A 3FUCA 3Q8LA 3WDMA 1F2TB 5ICEA 1KAEA 1VFNA 4CM4B 1FY2A 3KKEA 1XMQB 2GNPA 1CQXA 3H65A 1KERA 2R9VA 5DYYA 1YVDA 4BQQA 2EW8A 2I7XA 3OLXA 3AXTA 4X94A 1CEYA 1U98A 2GF0A 3BQMB 2VSNA 3HFJA 3WJRA 2FQYA 3A8TA 1A77A 1O54A 1ONBA 2F1KA 13PKA 2QTFA 3ZEAA 4OXQA 2OHGA 3FPJA 3LWZA 2WICA 1B4DA 2WV7A 1LJ8A 2OAP1 4LXIA 4UAGA 4E3WA 1E9DA 3ZD7A 2AKEA 3MF4A 1Y3CE 5D3MA 2QTTA 2YN2A 3GARA 3OE7D 2OE2A 3DOEA 4AIRA 4RIIA 5T64A 2OQRA 4ZYZA 2QZSA 5D3MB 4RVHA 1CUZA 3WGJA 3LFTA 1KO1A 3PNQA 4L3OA 4DMMA 1IIBA 2QM0A 1MC1A 2PUHA 5DWVA 1JKMA 1IYZA 3EAGA 2HEIA 5CK4A 4D4IA 1V5WA 4RH0A 4Z4IA 3WGTA 1NW5A 2CUKA 1D2AA 5EVCA 1QK5A 1EFRA 2V6BA 5JZ9A 3QHQA 4EFNA 1MJFA 1GTRA 3HBNA 2XWQA 1GARA 4FGLA 4UHEA 5JG7A 4HEHA 2VDJA 2VP6A 4DQKA 1C4WA 1LI5A 1G1AA 2XVXA 3RTGA 1YC2A 2Y99A 2HCJB 3QLEA 2RGAA 3EN0A 3X44A 5KYXA 4DJEC 2VQDA 3PHJA 5JNVA 3I32A 2GKGA 1ZCZA 4KXWA 2OMEA 5EIHA 3RYHB 1KYIA 1E32A 5M3BA 3WBKA 3UAOA 4Y2JA 3FOZA 1TMOA 2EKPA 4Q6WA 3DNFA 4F2GA 3EGEA 1TA4A 2QMOA 4IEEA 1O6GA 1R15A 3HBFA 1P44A 3PQFA 2PU5A 1Z73A 3S2UA 5J1SB 5B37A 3WHLA 1POXA 2PO5A 1U0SY 1ZGJA 3TI7A 1K3UB 1QDLB 3WOHA 4EEZA 3NDJA 1SOVA 3CSUA 1SUSA 2I2WA 4YJ2F 2WD8A 3FNEA 5DLEA 4A6PA 1TIBA 1U04A 2HV8A 1NPYA 4PLGA 3T9BA 5K3BA 1Q7GA 4GF5A 3T9FA 1E96A 1Q3TA 1RU3A 1KFBB 1MORA 4QATA 3RFUA 4R8KA 2MYUA 2W11A 5ES4B 3TZ6A 4E1VA 1IY8A 1H4VB 5FPQA 3HLTA 3V97A 2XT6A 4WXMA 2P3LA 1VL8A 2ZBRA 1RT9A 3AKZA 3L4BC 2BF7A 3O73A 4MB6A 3B9QA 4C78A 2E5LB 3OMXA 4GMDA 2Z5GA 2GEFA 3NNNA 3I28A 4RPLA 1KC3A 4HYEA 3E4DA 5C1OA 1KXJA 1AK9A 2X4DA 3OE5A 5DHSA 2PO7A 4G23A 4U9IS 5I3ZA 3IUNA 4ZO8A 3HN7A 2L42A 1T9HA 4C7OA 4MO2A 4E5VA 5IJAA 5B36A 3OZGA 2FEXA 1E61A 2NSYA 1U0FA 2IYSA 3QBDA 1N2IA 5DYGA 5FL7D 4C7OB 1BX0A 1Y3IA 4IVPA 3IQFA 4NPHA 1J4AA 4HH1A 1FX1A 4KFUA 2BGRA 3ZWWA 3LQQA 4Z53A 5K0CA 5EHNA 2IZ6A 4JBGA 1W5TA 4DUYB 2FU5C 1VG0B 3IO3A 4GZ3A 4DJFC 2A84A 1NJGA 4ZVKA 1X38A 4J7XA 4AG6A 4BP3A 1JR4A 4TT8A 5A02A 3F6RA 5GVRA 4E5NA 1I1NA 1OLUA 1J09A 1JR3D 4O1IA 1K8XB 4XOIA 2DQZA 5LM3A 4N6NA 3AOEC 3KHNA 2IXBA 1OLUB 3G6KA 2FW1A 2NSJA 5REQA 1SXHA 1YQEA 4XGIA 3DZJA 1USWA 1E2GA 2F48A 4Y2VA 2I1LA 5DBGA 4Z0PA 4Q9KA 3QKWA 2XQGA 4YECA 2F8SA 5REQB 2CNOA 2XGSA 1JHPA 2J33A 4RESA 3FVRA 4NUTA 4UAVA 3TNFA 2C31A 3PRYA 1FDIA 3BEDA 2NUPA 2RGNC 2X9VA 4YPFA 3GFPA 4Y2PA 4WA8A 4MYUA 1V9SA 2C2BA 3GA0A 4NULA 2VTKA 3F7OA 3LCMA 4P33A 2W98A 3C6KA 3SE7A 2NUPB 1SU6A 3OCCA 3VDQA 3FCUB 2R2GA 4MNTA 1ZWLA 5DHTA 5A71A 4XEHA 1NBEA 3A9UA 3LG2A 1A2OA 3FRIA 4G81A 2WUEA 5BURA 3IDSA 1OFUA 3UWKA 2CCGA 1JFSA 2XJ9A 1HC7A 1T4MA 3RS4A 3PPVA 4P36A 2JA1A 4LECA 3QBTA 3PUKA 1GKYA 5FF9A 3VR6A 4NV0A 3GEEA 3C7TA 3G9XA 1VYHA 3K32A 4ZT7A 4JHLA 5ICGA 1WMAA 1RBMA 2ID8A 3OJCA 1DRKA 1VMIA 1LV8A 2IJGX 2QN8A 3CN9A 3HPQA 1THZA 3P71T 5TMDA 3JASA 3PKZA 3ZWMA 4FB4A 1Y4UA 2IYNA 2PZBA 3IIEA 2MJLA 3CH4B 1UDBA 3JASB 3E9RA 4XXHA 5F1OA 1YRLA 1JT9A 3CB4A 2FWPA 2Z5VA 1LCIA 3B2NA 4LRQA 4XFDA 5CVVA 4OF4A 4DMKA 1RI1A 4GRAA 5FTNA 4LV6A 1O95D 4U8GA 5A9RA 4TWJA 4CWAA 1LK5A 5JNTA 4FM9A 4JVOA 3OAAD 4YQZA 2O8NA 2LCAA 4YDSA 2VH5R 2PMEA 1QU2A 4TXJA 4Q24A 1K27A 2YRWA 3H9JA 5GINE 1QG6A 3E0XA 1GA1A 2GPAA 2RGGA 3L01A 3KVNA 4YLGA 2AFHA 4UZFA 3GVXA 3IJ5A 1WNFA 4IV5A 2GVIA 1PRYA 2AFHB 2XMPA 1IHPA 4MUYA 2WIGA 3BK2A 3IBSA 2YVKA 4POOA 3GLHB 1EIWA 3NGXA 3WQHA 4ESVA 2PLAA 3A1DA 3R5KA 1HKHA 4D79A 1L5ZA 3CZ5A 2XMSA 3N0VA 4JL6A 4AD8A 3UBTA 2XMDA 2A3NA 3PE6A 1E58A 3TJRA 2C3UA 4UULA 4DLUA 3Q1KA 3FTQA 2XE8A 3MM4A 2R8BA 5LQRA 2PYDA 4Z9BA 2W2TA 3OFJA 4X44A 5H9WA 2WALA 3VCZA 4RPJA 1VPWA 3GI1A 3MGAA 3TUZC 1RM4A 1L1RA 1S2DA 1FQWA 3K6KA 3VPGA 4U6NA 4Q3OA 4EKIA 2R00A 1V48A 2RI6A 1E6KA 2CVZA 3KS9A 5CJPA 1I3KA 2VI5A 3F8SA 3M0EA 2KBEA 1RADA 2WKSA 4HUJA 4C07A 3HUFA 3JQFA 4IKOA 3U16A 3U26A 3AVWA 3OZRA 1MGOA 1KZ7B 2RG1A 3ZE9A 2OV1A 2JAXA 1R6VA 1XA3A 1XF9A 1VIYA 3DLBA 1CXZA 1E4OA 2WIBA 4GW3A 4Z9AA 4US0R 3W8DA 4YP9A 1CYDA 3SVZA 1EGAA 1HNXB 3IULA 1I7QB 2YHIA 2V74B 4KXUA 1ZBQA 4IYRA 3L6CA 1ORWA 3DV9A 2YYEA 1SU7A 2F8LA 1NRJB 4H0NA 4QXQA 2BRUC 4Z1OA 2VHUA 2YHIB 1GVNB 3FX2A 3GX1A 5AKHA 4C7XA 3ZQ4A 4MQLA 4H7PA 1YU6A 3Q3CA 1W6UA 4PAQA 2V03A 1AHIA 5F33A 4M9CA 2VYVD 2I7TA 1XGKA 4XIYA 3GGSA 1C4KA 1DIRA 1FL9A 1SD5A 4JVSB 4AF7A 3KR2A 1M54A 1FVFA 3KQSA 4BKRA 1DI0A 1T24A 2IE0A 5AM5A 3IUEA 1VSVA 2Y1KA 4GOJA 1NMQA 4ZKEA 3LL4A 3SKXA 1J0CA 1FP7A 1NAIA 4Z7JA 4RVNA 2VZ9A 4R2XA 3GZJA 2L17A 3A58B 3SSMA 2D1TA 4D4LA 1H47A 5AW8A 4Y7DA 1RE0A 2GASA 3AG5A 1A5AB 2QRJA 1PWXA 3ESQA 4B32A 3F78A 2B2CA 1O6FA 3GJQA 5ALNA 4A8HA 3WKAA 3NTVA 4LQLA 2DTEA 3O1HB 1ABBA 4W9RA 4LC0A 2F64A 2O2XA 1C50A 2IYFA 5B1IA 4AF8A 4G0XA 3PB3A 4P5DA 1PW5A 5FUYA 3Q15C 4UEWA 3SIPA 1Z6XA 2MR5A 1EJBA 2CFSA 2O0HA 3CSDA 3HCBA 4MUIA 4PGFA 1RIFA 4AZ0A 3C9RA 3KKZA 5BWCA 3CD6F 2D1YA 3IC5A 2C29D 2SECE 1GT6A 2JB9A 1S89A 1TCVA 2PX2A 1EPUA 3B70A 3H8SA 4X61A 5AHXA 4ZODA 3HABA 1V8PA 4AZ0B 4ZCIA 1CK2A 4Q3EA 1QUEA 2WQZA 5BOVA 1ZCJA 2IQ5A 3V1TC 8ATCA 2W0MA 1KS9A 1PJSA 2H2FA 1I9GA 3ZHRA 1OGIA 1XWWA 3CCMF 1ODTC 1R12A 1SIWA 3B82A 3THOA 4OOFA 1ZVKA 2FZ4A 1SBIA 3E7DA 4ROSA 2A5LA 4MJ7A 4EJSC 5KQMA 4BXOB 3W5JA 1WUKS 2Z95A 4KREA 1Z6TA 2BUBA 2WG0A 3PXDA 5IG2A 2DBQA 3SQOA 2Z2IA 3SPXA 1NRWA 1Q74A 3C5WP 3I2IA 3QELA 3AF4A 5TQ2A 3TG8A 3PNYA 1I1OA 3AC0A 3ISJA 3WNCA 1STOA 1J1IA 4GECA 1QH0A 3SFVA 3S8YA 3FVVA 1JHDA 1LLCA 4FC6A 3OTGA 5TQ2B 3TLYA 3N76A 1P18A 4MPDA 3TE6A 1X87A 2OM6A 3DVLA 1PSZA 2F3QA 4BFWA 2RHOA 4FCWA 4OSOA 3CUWA 4X1IA 5AHOA 3B6NA 4P82A 3ZVMA 1RQPA 2H5LA 5LWQA 5M2QA 4OQMA 3G0HA 1L7PA 1W0CA 1PK9A 4K81B 4QELA 4X1IB 1CUUA 5BUSA 1CZUA 3GLGA 2RAPA 1D7AA 3AKCA 3M4NA 5HY1A 3CX7A 4P8RA 4Q19A 1YRYE 4JLMA 4R1SA 4Y6QA 3IBGA 1SUDA 4RELA 3D59A 3S2ZA 4E1BA 4ENVA 3GLGB 8MHTA 2A59A 2LDBA 1MCZA 3GRUA 3TX6A 4XJXA 4DV6B 2IITA 2ST1A 1BJRE 1VKRA 4I4IA 5EXPA 5H70A 3T80A 1C4OA 1OI7A 1TTTA 1RAAA 4R54A 1KH3A 4KHPB 3NG1A 4QUDA 2A67A 4DIBA 2ZVZA 4TM7A 4ZGWA 2UZ3A 3IHTA 2JEOA 4UNSA 1NHWA 5EKDA 4TV8F 1I80A 1A7AA 3DHNA 1GA6A 1V9LA 1T8PA 4XGQA 1V3UA 3EG5A 4RHCA 1K9VF 2QTBA 3R2JA 1AIPA 2NQ2C 1PD1A 3S2YA 2J0EA 1K92A 3KUKA 5DNUA 821PA 2HMSA 3DOUA 1BGXT 1LDYA 2C9BA 3QIVA 5U9CA 1YZ3A 1SXGA 3QEKA 4DR4B 3TVTA 4YAUA 2BM0A 2JIPA 4BCBA 4P3YA 1S3FA 1X1RA 1UKCA 1ZM2A 2W70A 1OC2A 1CX9B 1E7KA 2XIJA 2ZRHA 4H60A 3GLQA 4C2TA 3H2GA 1FSFA 4YTEA 4BFCA 5FH9A 2JFXA 4NH4A 3WLHA 3UH1A 1II0A 1XG5A 2V97A 2YYYA 4K9RA 3KYJB 1DXHA 3A70A 1KGDA 4PC2A 2LCIA 4M1MA 4QUIA 4XDYA 3HG7A 2NTNA 3BYQA 3M6AA 4HDCA 1Z35A 1GUDA 1XUOA 2X15A 4UHFA 4F4CA 2HQOA 3C7AA 4GPIB 3CX8A 3SHVA 4V0NA 2HSGA 2HXGA 3QOXA 5JY1A 4N0DA 1AHPA 4G6ZA 1W87A 5DBOA 4HTAA 2G09A 3SHQA 2X5KO 2ZSHA 1D0VA 1NW7A 3G7UA 4KZPA 2GGSA 1GNSA 1KJ9A 4MYHA 4XD7A 3PQ3A 1CV2A 5B1YA 2HREA 1ADJA 2VK8A 2QXUA 1NXVA 5B6JA 3ZHOA 3UJDA 2GQ0A 5TMEA 4LF7B 3IAS1 4JV5B 1XJ0A 3W1WA 4DZRA 4C05A 4ND5A 2IW3A 3KPUA 5HRAA 4Q3LA 3FBGA 2PGLA 5KNLA 4JQCA 1I2BA 2HC9A 3V8RA 3A31A 4DS3A 1O0BA 2YKGA 3IKVA 4KQHA 4BAZA 3BULA 4O2BA 3GCDA 2Y77A 3MUFA 4HLNA 4K3UA 2OBMA 4YFVA 5BRNA 3VQTA 2AN4A 3GDGA 3CO5A 1GGVA 5EWJA 4ISCA 2W2LA 4O2BB 1XTZA 2I6SA 1VXOA 2NOAA 3GT4A 4G9EA 3I8XA 4JDPA 5BW4A 1QXSA 3O8RA 5EWJB 2ZSBA 4OQFA 1BDJA 4D1YA 4NDAA 3TCNA 3VHQA 3E1KA 3DNPA 4YONB 3P27A 3NKLA 3QVGA 1U31A 3OWHA 1SC1A 3VDMA 1GPKA 1SVSA 2VBCA 4UU1A 2C8VA 4QBKA 16PKA 2O6HA 3QVGB 2WB4A 4MQFA 2JL1A 4NR0A 2R1VA 2E7ZA 4GVLA 4PTYA 4YJDA 1HZZA 2W71A 5KHAA 3INRA 1Y1PA 1DAIA 2BFDA 4QPDA 1K88A 4MQFB 2R1VB 1R3UA 2DU8A 2PH1A 4ZAFA 3GN2A 1V1MA 2WJ3A 3ED1A 2BFDB 4DNPA 1Z2CA 4DLAA 1U8TA 1UJ4A 2QLNA 2QXTA 1Y6JA 3VU1A 4CJXA 1BAPA 4NEQA 1KYYA 1NUPA 2G70A 4R5MA 3RCBA 1RBZA 2D7CA 1V1MB 1XJQA 2QG9A 2WMYA 3NX4A 1T2VA 4ZOEA 1W1IA 2JGLA 3EZ2A 2C92A 3I2JA 4O59O 3CJTA 5FEMA 4EYEA 1P4HA 3GFRA 2KS6A 1QF7A 3ZU4A 4AZWA 1E1MA 1V8DA 4XA8A 4ERHA 3LI2A 6ABPA 5J23A 2XX3A 4LYEA 1WQ4A 5E9QA 2GCEA 4IIJA 1AE1A 1W29A 3JYNA 2AYXA 3E1SA 3EMDA 3K0EA 2AXQA 4FFOA 1KI8A 4HGQA 4U9UA 4LJ9A 4EECA 2H4ZA 1RXSA 2P4EA 4X7RA 1F0YA 4IIJB 4EPVA 2KYRA 2VNIA 5BV0A 1MO2A 3OJOA 2GK7A 4UAJA 3GMTA 5I8PA 5K8CA 3CCUF 1O0SA 2FX2A 3G3EA 4EO4A 4C4WC 1KJQA 1S2NA 2RB9A 4BQNA 3V9PA 5T41A 1WPGA 4JC0A 4TMYA 3DE4X 2CD7A 3UH0A 3N59A 2XMQA 4BP1A 5JDIA 5IJ9A 2Q5HA 3V3KA 1YHYA 3DAGA 5DSZA 2BVNA 4DN6A 4C4ZA 4B8YA 5IJZA 1T5SA 5AM3A 2AN3A 4NATA 5IJ9B 4YMHA 1KD1H 1Z7BA 2JJYA 3BILA 4WOCA 5E4FA 4JI3B 3VDRA 1LRKA 4OJKA 3DGEC 4GR5A 3T34A 3ZCTA 1W7AA 5KBYA 2I0FA 3N5KA 2VUSA 2P4QA 2DT5A 4FS3A 1Y6RA 3GFSA 3QU5A 5J2UA 2GYUA 1V2GA 2CUTA 3ESRA 5K8UA 3AV3A 2YNMC 2V7PA 3P9YA 3REQA 1KAHA 2B4YA 4R9SA 3GYGA 4HGOA 3SU8A 1YRWA 5J2UB 2JH9A 4PSKA 2D7JA 3QK7A 1DXOA 3ENWA 3REQB 2GTHA 4FYWA 4A36A 4JSRA 4MLCA 5IDYA 2JGNA 1UIMA 3TCXB 1IUOA 4XFKA 3PHIA 1GGMA 3FCCA 4J4BA 4ML3A 3PQCA 3HJWC 3C3JA 5IT9M 1P1RA 1S0UA 4HL6A 4M8NE 5DX0A 5HE8A 4G5YA 2XQFA 2DHQA 2CXQA 3GJYA 1X2BA 2OC9A 4RHTA 3ROXA 4E5YA 4BY9E 4GRIA 1PFQA 2LCFA 1OX5A 2LIVA 4YUXA 2WABA 4NHOA 3MNFA 1X7XA 4J29A 4RE6A 4WZBE 4E0BA 4U2KA 4KGZA 1C7JA 1NWCA 3SN6A 1ZWKA 1CG6A 3FHLA 3N5CA 1XTSA 5H1YA 2ORIA 3HJCA 1X7XB 3TQCA 1OLOA 3CUKA 4KJZA 1HA3A 3I05A 1P1BA 4GLLA 3THWA 3G02A 3J81M 3N70A 4OGKA 3S1LA 4CIBA 2ZWOA 2UZ0A 4I55F 3NLLA 1AA9A 3DL7A 2AN9A 2VKTA 3THWB 1EX7A 1UFKA 4MO9A 2XDAA 2Y1WA 4BEJA 1L5HA 2P11A 2BONA 4KGDA 4CW7A 2Q3FA 4C5CA 3EAFA 1Z9BA 2Q2QA 4S3MA 4WY2A 1FMCA 4NYJR 1L5HB 1G0OA 1GOTA 4OXYA 2LDXA 2OZVA 2GHTA 3LPLA 4NHEA 3GP8A 1JDBC 1H8HD 1I2AA 1ZK4A 3RU9A 4GC9A 3DL2A 3MRSA 3D00A 1TVMA 2CJYA 1W35A 1DC5A 2II6A 2RB4A 3GDHA 4FINA 4X63A 1BQ3A 3S44A 1TMGE 3NI2A 1C7RA 3HEBA 5GAJA 2ZSFA 3W4JA 3BD8A 4ZCTA 3R9XB 1T91A 4BJ6A 1XXHA 1JLRA 4C03A 1THMA 5D6NA 3F0GA 3E03A 3EA5A 3M5CA 1XXHB 3MHPA 2CW5A 2ILTA 3MXOA 2M9MA 3MYRA 4G1VA 3R7WA 3L1UA 1JZSA 1V4BA 3F97A 2FMKA 2KMLA 4LDAA 3BL8A 2ZI4A 3JARA 1T8WA 2ODPA 1DHTA 3L0OA 4ITUA 4R41A 3C48A 3OECA 3UJ3X 2BI8A 2BUCA 3ZDAA 1UZLA 3JARB 1GHTA 1OWPA 3MJVA 1X6VA 3AFMA 5DK6A 4MAAA 3ZVRA 3K2QA 2QZ4A 3GT7A 3KSZO 2UYJA 3GUHA 5CLQA 3M9WA 4Z7QB 2O2YA 1M83A 3VTFA 1W49A 2RC5A 1H8EA 2FWMX 5LQNA 2O3JA 1N9GA 3RV3A 4E03A 3F4KA 3EPHA 1CRLA 4OJNA 1AO3A 2YH2A 3UZUA 5IS2A 1OWLA 4IXTA 4LVNA 4WPGA 1N9GB 3K9FC 1ECFA 2P9CA 3AT1A 4QUKA 1JSXA 1RI2A 1TM3E 1UQUA 5JUWA 3ANLA 1ZLYA 2P75A 3TNLA 2Z09A 2VP9A 4FGUA 4P81A 1VLZA 4LCJA 5B3AA 4Q15A 1F0PA 4D6PA 3UMGA 5CMLA 4UOEA 3FZGA 5C3MA 2BMJA 3JQ6A 1FSSA 3JYLA 3Q98A 1RLMA 4KITB 1BN6A 4GXTA 1UP4A 2EX0A 3N86A 4IAOA 1JIQA 2PHNA 3OY7A 4BQOA 4G5HA 4W5WA 5IBPA 3FPAA 4BMSA 2LZ0A 1LBHA 2HLHA 2ZBPA 3ZGLA 3H05A 4AMUA 2HJWA 4RX1A 4KGXA 2WJVA 4R1MA 1GAJA 1TZMA 5P8WA 4M86A 1A5BB 1Q11A 5DGCA 2AEFA 5DE3A 4DMLA 1OB2A 1MRZA 1AD2A 2GPJA 1TAGA 1V37A 3DD5A 2FE4A 4Q9JA 3IIIA 4CDGA 1L9KA 1O8CA 2NO9A 4W7SA 3GLRA 5ER9A 1G7CA 2DBYA 4X3OA 4XTRA 2ZDQA 2X2FA 1SQ5A 3BIOA 3COSA 1EXWA 4DR7B 3UAVA 4HWSA 2B9EA 3FMPB 4N8DA 4A23A 1NP7A 1E9RA 4GI5A 2GM3A 1X9HA 4QFDA 2LCQA 4KP7A 1ACJA 2I65A 4OHBA 2DT8A 2DYKA 3KJFA 4X24A 4ZO4A 2JFQA 4I08A 1FZTA 3IVGA 3KXDA 1GAQA 2QTWB 3MC1A 3N05A 1C3EA 1OBCA 2FGJA 4YIKA 4AN1A 3GLVA 3H2KA 3RAGA 1IHYA 1T9BA 5I7WA 4RO0A 1D2GA 4PSAA 2NQ8A 1P81A 2BHLA 1UXJA 3JXEA 3FYUC 3L4BA 4JIGA 4PQEA 5AOAA 3ZDQA 5A4FS 5JROA 3L82B 4MGEA 5DN6A 4CUKA 2Y0CA 3G5UA 1P7WA 3P9ZA 2V5AA 3Q10A 4IJVA 3TQHA 4G67A 3RU3A 5LR6A 2AMTA 4WKPA 4V0KA 2G8NA 2HLPA 3GGCA 2I2CA 3ZU5A 4K9QA 2Q6TA 2X1HA 4H3VA 5AVUA 3OQOA 2QMQA 1A72A 1QCCA 1TU3A 2X8AA 2WEKA 3EQ2A 3ZQ6A 5FUMA 1OZGA 2C5EA 2JD0A 5CFOA 2NGRA 4ZHSA 1O77A 1RYDA 1AQUA 1YONA 2PPVA 3UXYA 1UZUA 4PPQA 4AMZA 4DCJA 4EUFA 4JR2A 1ZNWA 4LMBA 4WRRA 3PTLA 3ROEA 4ALIA 3ZH2A 3NB0A 4CR6A 4P22A 5DNAA 2W6CX 2B7CA 1BRTA 1MAUA 3OETA 4IILA 4Q1DA 4DKJA 5K0GA 1UF9A 3H0KA 4C4TA 5A7FA 4G0UA 1Y7TA 5KI6A 1EI9A 5CFRA 4NU0A 1QV7A 1V5FA 4MQ6A 4K46A 4LC9A 3N4ZA 1R8JA 3ZE7A 4L8GA 5EJ5A 1NF8A 3I9V1 1JDZA 3A1CA 3D7SA 2EWVA 1W5BA 3HYLA 2OBBA 2B6HA 1D04A 2MSDB 4Z3KA 5DNCA 2GEKA 4IDGA 2C2YA 1MJNA 3JU3A 3M4JA 2DBRA 3GEIA 3H0EA 1QHSA 4RJKA 2X5JO 1PV4A 3H8VA 2ZYDA 2PWPA 1RXVA 3ZXYA 5HS4A 4OO3A 4N01A 3AOEA 4FDMA 3CBGA 1YK0A 2GH1A 4V3CA 4WKCA 3V1YA 3N6XA 4G0PA 4IOLA 2YXNA 1QP0A 5D86A 3L6BA 2ZYGA 3V4DA 2EFYA 4QFBA 3TCKA 3VIUA 2J9FA 5JISA 1L4UA 1VHJA 4X0EA 2AC2A 3H5RA 2DFLA 1KKMA 4BNFA 2IOHA 2J9FB 4TMFA 4I1OA 2CHSA 5B4VA 2FI1A 2XXBA 4O3MA 2RGNA 4E88A 1JU3A 2OGWA 4XSGA 2VSOA 3IGFA 2VYFA 3AF5A 4AW9A 5HM8A 4I5DA 2V7TA 5K3FA 5KS2A 1M0WA 1GDHA 3WNQA 1UIRA 5CNMA 2B1GA 1QV9A 2ACWA 1Z88A 2O48X 3JAWA 1Q91A 4PRKA 1VHDA 2H31A 5K3FB 3TG2A 2BZ0A 4P6VF 3SKYA 1GQOA 3DJFA 3HCRA 4F7DA 2WVHA 4XLZA 2GPBA 2IY7A 3AHDA 1VB5A 3JAWB 3KUCA 4HUQB 4JBWA 2FDXA 4U02A 1L7RA 3QA3E 3VU3A 5JTTA 1X0XA 2OD7A 5K8TA 2XGMA 3K72B 3IAM1 1F6DA 1NJ1A 4BGUA 4CKYA 1QHGA 3QF4A 3HBMA 4KC0A 4HYYA 1QP7A 3NZEA 1L5FA 4Y3UA 5FDFA 4E6PA 2CFCA 1JIXA 3QF4B 3P0RA 4HDAA 3THXB 2H2DA 4CZ2A 5T5QA 3PQEA 1SCIA 1YJCA 1G7SA 3H42B 4YRLA 1HQYE 4P35A 1QTNA 2E82A 3G0CA 5BSUA 3TLXA 4NBUA 1JF8A 1T9CA 2PRYA 3DHYA 5G3ZA 2ATEA 4CLHA 4M54A 5DNDA 4AJLA 3MDOA 1WA5A 2B69A 1Z39A 3DYVA 2D3TA 1ZINA 2FX5A 4MHOA 2GZHA 2JIQA 2A94A 5KNCD 2REQA 2Z43A 2HHHB 5HCUA 3OT5A 2ZE8A 1G42A 4AKEA 5IH7A 2GCOA 1RWBA 2REQB 3AUAA 4WH0A 1Q1QA 3OQJA 3G0IA 1JFVA 1K89A 1YJ9F 1OSNA 2PK3A 3CWQA 4BZZA 2VF8A 2GCOB 3NJRA 2CL0X 1GKIA 3KOUA 3LK7A 4BFSA 2XCLA 3SXJA 1Q82H 1OTXA 3LWVC 2CXNA 1H42A 2ISSD 4MWCA 3TL3A 5D1NA 4LYJA 2Q6LA 3TGPA 3CONA 2JJ2D 3BFKA 2ZLBA 5DN9A 2ATIA 3JD0A 5IPFA 3OCZA 2FR8C 1DIHA 3JZFA 1ECCA 2XTAA 3LGSA 1H23A 1E9VA 3KM0A 3TOVA 4ZJPA 5C4IA 1E0DA 1ESCA 2P1ZA 1RKBA 3RVJA 1KRXA 4A8PA 1FJGB 3AONB 1UQTA 3DKRA 3T7CA 3ZV3A 1VPDA 1WY7A 4P5EA 4EJFA 3ICPA 2YRFA 4GPBA 3W2IA 5HPYB 5L53A 1HLPA 1MEJA 1ONIA 1VGQA 4KIWA 1YJXA 2FY8A 3DTVA 4B9AA 1I4OA 4UDNA 3N0RA 2FRDA 3DAHA 4XQ0A 1N6LA 2JGAA 3V6LA 4MRMA 5IVHA 1QFJA 2FW9A 2Z1FA 3DTVB 4AN0A 2O3QA 1IOWA 3ABQB 4UZEA 2P9FA 4NESA 3G2HA 4MRMB 1KEPA 1PJZA 3G2MA 3ZLJA 4JBIA 5TMBA 3UT5A 3FYTA 2IXFA 3DV0A 4BGIA 5KZMB 2FPGA 1GRNA 3E7FA 2GZRA 3FSGD 3IHWA 4YAOA 2QLFA 4JC4A 4JB2A 4KWCA 3UT5B 4KRGA 4MV0A 4V0OA 5KTOA 1B42A 2YC2C 3LWRC 1AGNA 2FPGB 3HRIA 5I47A 1I7NA 1OXSC 4N9QA 4TPKA 3AU9A 1M75A 1XCLA 2I4RA 3HNOA 4TT3D 4G8JA 5FIUA 1K08A 4EHDA 4M38A 4CMJA 2JLVA 2X76A 3G2KA 2DRIA 3DKIA 3NFRA 1T6XA 2EF0A 1BD4A 2PIDA 4FDLA 5HMLA 3UJAA 5FOTA 1TAHA 4CLOA 3EEOA 5EJ7A 4JXZA 2Z8YA 2H07A 5F5XA 2V6GA 3F0EA 2YOHA 3BTOA 1XZNA 3LX6A 3KPVA 1TA9A 3RRYA 3TO5A 1B93A 4CLOB 4JA2A 4UM8B 4EY6A 3GQBA 3DDHA 1QHEA 3O4GA 2KE5A 2EGGA 2H1CA 2QQGA 3TZKA 4DG8A 1RQRA 3OEYA 4KE6A 4A0QA 4DV1B 4PTLA 3T6KA 2VLIA 4HWGA 1A82A 3GQBB 3JRWA 2EDAA 1SC4A 2HLNA 3ONEA 4PS1A 1QYCA 5AOCA 1SA0A 4BZXA 1VBMA 4HMQA 1C7EA 1VCMA 1RP7A 4EABA 1A8HA 3H5AA 4R2LA 1SA0B 4B3IA 2EEPA 2ZYIA 1W0KD 2WOJA 1J20A 3A11A 3P9PA 3AEXA 1DIOB 5EJGA 4EZBA 1KQGA 3PX2A 1Y6FA 1Z4KA 2V4ZA 4Q93A 3IVCA 1T3GA 4MXDA 3U48A 3S81A 4EW3A 1FFDA 3C3YA 3IX7A 3R40A 4WV3A 3QYPA 4HATA 4H7HA 1CVIA 3JD3A 4EG4A 4P7BA 3NT4A 4TKUA 1ZK0A 4EJSA 4CXMA 3RI3A 4MYTA 1R0CA 1O6CA 1IDN1 3QOYA 1SJ9A 3ESDA 2YUIA 1XROA 4JHXA 4QUEA 4R1TA 3SKVA 4TKUB 5CDFE 1ZI6A 3AH8A 3BXEA 4BX9A 4EJSB 2JAWA 4EJ2A 1Z25A 4E4TA 4DPKA 4M49A 1Z7EA 2HCFA 2J30A 2C58A 3HJAA 4TKVA 1SC6A 3IKFA 1YDFA 3MINA 4UMEA 1X8JA 1SXJD 5EJIA 3K8OE 4TKVB 3MTBA 1C7IA 1K1EA 2I3GA 5DHAA 3MINB 1RFGE 3EMVA 1TJYA 3I2GA 4XX0A 2XWJI 2X13A 5DCVA 1YZKA 2G5TA 2QXYA 2LKCA 2RK3A 1E2KA 2DQKA 3OEHD 4HTFA 1N6PA 4RVUA 4ZALA 4G0NA 4YRJA 3ONFA 4HNVA 4LVUA 4XX0B 2PN1A 3EZXA 2IU0A 5C8XA 1GGJA 2RAFA 1VPTA 4KXYA 1XZHA 1N5JA 4YGXB 5J59A 3MCWA 4ILEA 3D6NB 3RUHA 1EP3B 2BDTA 1IN7A 2OHJA 4J90A 4IQ0A 1RRGA 1NL3A 4L5JA 4CIAA 1IN8A 5CNJA 1YZVA 4OIFA 1LXCA 1SU4A 4V0RA 3GY0A 5LB4A 2PZAA 3FFAA 4B82A 3PCRB 2JGJA 5AI6A 4D8WA 2QR3A 3OEEA 2H48A 3K0CC 1BX3A 2Y1LA 3AKYA 3Q6NA 4LMRA 4QGHA 1DWUA 1TI7A 2G82A 4PHGA 1O7JA 4FCCA 4P7JA 1EHCA 1FYVA 1G6OA 1OJ7A 2YIDA 3RH0A 5JPCA 5JU6A 4R3NA 5DTEA 2O20A 1ID8A 4IDHA 1QRAA 3CNNA 2WVGA 4HDSB 4KAAA 1NR1A 4L5CA 3W34A 1D3AA 2ZP1A 4CI9A 4BWFB 1PNTA 3A3KA 2AR9A 3RVKA 2PJDA 3ROFA 4AF6A 2QSYA 1H5QA 4D80A 4H2DA 1OLSB 2WRZA 2YICA 3HYSA 2O6LA 2Z1DA 1P9RA 4P3PA 5E1OA 3WYFA 2EQAA 2UYNB 4LSZA 4V0MA 1R6AA 4E08A 3TLZA 2W6JA 3OPYI 3SLKA 3EEQA 1I6MA 1JWAB 4G85A 5ES3A 1A7KA 4DBLC 3SHTA 4BATA 3PHGA 2CV1A 5K0JA 3LBYA 1W85A 4MVJH 3MN1A 5CTJA 3KFVA 4J6EA 3H84A 3BFJA 4JZKA 4YS6A 3KPWA 4G4XA 3S03A 1RJ9A 3HJRA 3G6EF 1KOFA 2G06A 4MVJG 2DBVO 4C08A 1L4MA 1YACA 1NW9B 1HDRA 1UXKA 1I2ZA 2Z3WA 2OD2A 1ZEMA 3CPEA 1RJ9B 3IJPA 4TS3A 2WJ6A 1KH2A 3GJ0A 3C1UA 1CFZA 1VBFA 1HE8B 5DIFA 4CHTA 1RI4A 1JSZA 1JJIA 1P5FA 3SJ7A 1CHNA 3MZ0A 4RGQA 4Y9TA 4ZO7A 3CT4A 2VWPA 4PLZA 5F35A 1GSIA 3I64A 1IXYA 4RHYA 3OZAA 4RPGA 3HJHA 4CM9D 4J0HA 1J97A 1OA1A 2W2PA 1XZFA 4A9AA 3WA6A 1A5ZA 1OIWA 3PGVA 4WOKA 2PWYA 4BMXA 1OPXA 2JCSA 3I3OA 1E6MA 4X97A 4ESEA 4QT4A 2A9JA 1KC8H 2JIZD 4WJKB 1B1CA 3ADDA 1P7ZA 1EFPA 4J49A 5GPBA 4CIYA 5K5EA 2VBIA 1EK2A 3V7QA 5IN4A 1MG0A 4CQMD 3PL5A 4Q3AA 3DOCA 4I81A 3VISA 3SLGA 1EFPB 2FETA 4EAQA 2OT3B 1AQNA 1LY1A 1N3BA 3TEFA 2JAUA 4IIGA 1YE3A 2WK1A 1B8PA 4JBXA 4PVDA 4C0LA 5CFZA 2ANCA 3TIVA 5HKKD 5FPKA 1OR8A 1Z2NX 3UAXA 4M98A 3NVIB 5BT8A 3V4SA 2F3UA 3L5KA 3WDKA 3W2EA 2IV2X 4HG2A 3ELBA 4LQCA 4F3YA 2SCUA 5B1DA 5HDQA 3PFCA 3AJ8A 4ZJYA 3JTEA 1GPMA 3CISA 1MT0A 2QGNA 4GGPA 1TYEB 2SCUB 3FOAA 5JD3A 1TQ2A 1QLWA 2BLLA 3K0HA 4DMFA 4ETNA 2FQQA 5DISB 4V2IA 3IL2A 1OFHA 2ZXFA 4LV5B 2OILA 2WG1A 4OQYA 4BW0B 1N6OA 1X14A 4MKXA 4UJ3A 4WW0A 1KDZA 1ZOIA 2FCRA 3DOJA 1VFPA 4DUPA 5LKRA 2NT3A 2XKAA 4M37A 4WFQA 3ZE8A 2G7ZA 3AW9A 1QX4A 2EKBA 3T4EA 1Z63A 1FXSA 1G9SA 1CUXA 9ATCA 1GU1A 1NXSA 3G2LA 1LDGA 1NZDA 3OKFA 4GT1A 2P3QA 4KW7A 2IXGA 5EZ6B 4YCJA 2WUDA 3TKYA 1G5QA 3WFJA 2C0QA 3FWYA 2BP7A 3PLAE 4DNFA 2R62A 5THQA 3DG9A 4GI2A 4KXNA 1JLLB 1VG8A 1YQNA 3BMCA 4UE3S 5AKXA 2BP7B 5FP0A 3G1TA 2DY1A 1IXKA 3DBHA 3IQWA 5SV2A 4IF6A 4X8OA 3F5QA 3CPJB 2CLHB 2B37A 4MDFA 2AQHA 3BMCB 2ID9A 1Z2OX 3G5LA 4UUMA 3UVEA 1CJMA 1T9DA 3K2XA 3ER6A 4CTKA 3RYCA 1SQ6A 1PR2A 5EC8A 2GSDA 3TSZA 3HV2A 2WIFA 1WPQA 1GFIA 1LW7A 3EY9A 1HV8A 3VPCA 2UZIR 4D0NA 3RYCB 1MOZA 2EG5A 1UXHA 4JU8A 3LTEA 1WXQA 1SZPA 3NBFA 1M2NA 1YOVA 3FUTA 2A0KA 2OK8A 4RMJA 4DLVA 1KKUA 1XD9A 3HCWA 1PQUA 1F14A 2NAPA 2PX8A 3NWPA 1NR7A 4LJ4A 3HU1A 1YOVB 2WU3A 2ZE6A 2ZJOA 3PPXA 1MNQA 1J8FA 1FTQA 2H7YA 2VPWA 3AI7A 3KTFA 2P4UA 1VH8A 3T4XA 4NYIQ 1QAHA 4URYR 2WMNB 3OPMA 4ARCA 4FT4A 4O25A 3OW2F 1H1TA 3UMBA 4NPCA 3KWFA 1OA0A 4IG4A 3LDGA 1TLTA 3FYHA 4JJ4A 2YNMA 3RBAA 3HE3A 3LYAA 4OI4A 4G5RA 3F5SA 4IQFA 4RKWA 3H75A 3M82A 1IK6A 1PCXA 2J3EA 1NQWA 2N9UA 4MVJE 4RVFA 1SBHA 4A2WA 1K0UA 2MR6A 2GRJA 2XZPA 3AM3A 4BQIA 1LPSA 1WQ1R 4PNPA 2C