3WGLA

Staphylococcus aureus ftsz t7 mutant substituted for gan bound with gdp, deltat7gan-gdp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
303
structure length
303
Chain Sequence
LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGANLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Cell division protein FtsZ
publication title Structural change in FtsZ Induced by intermolecular interactions between bound GTP and the T7 loop
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 90
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3wglA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3wglA01
5J2UB 1W581 3JAKA 1W5EA 3JAWA 4IIJA 5CA1B 4XCQA 4IHJA 2BTQA 1SA0A 3VO9A 3JALA 5MN6A 2Q1XA 3VOAA 2RHLA 3UT5A 3VOBA 4DRXA 4F6RA 5LOVA 5LP6A 5CB4B 5JH7B 3RB8A 4O4IB 4O4LA 4X1IB 3WGLA 3HKBB 3RYIB 5IYZB 5KMGA 3HKDB 1FFXB 4U3JA 5J2UA 5CA1A 4YJ2B 5LOVB 5BMVB 4TV8B 2VAMA 3HKCB 5C8YA 4EI8A 5EYPB 2VXYA 4KWEA 4ZHQB 5FNVB 5CB4A 5JH7A 4ZOLB 4X1IA 4YJ3B 2GVIA 2RHJA 3C8LA 4O4JB 1W5FA 3HKBA 3RYIA 3RYFB 5CA0B 5IYZA 3E22B 1RQ7A 1FFXA 3HKDA 4DXDA 3RYCA 5C8YB 2BTOA 3WGJA 4TV9B 5EZYB 4YJ2A 3WGMA 5BMVA 1TVKB 4TV8A 3HKCA 1W59A 4X1KA 4O2BB 3VPAA 4I50B 5EYPA 3RYHB 3WGKA 4O4HB 4ZHQA 5FNVA 4X20B 4ZOLA 4YJ3A 3RYCB 4O4JA 3N2GB 1OFUA 1RLUA 5CA0A 3RYFA 5EIBD 1RQ2A 3E22A 4X1KB 4TV9A 4X1YB 5EZYA 2Q1YA 2RHOA 5IJ9B 3R4VA 2XKAA 1TVKA 4M8IA 4O2BA 2R751 3JARB 4EB6B 4I50A 4E6EA 4U3JB 3RYHA 4I4TB 4O4HA 4X20A 5LYJA 4B45A 4EI9A 1TUBA 3HKEB 3N2GA 5JCOC 4I55B 5IJ0B 2RHHA 4B46A 4WBNB 2R6R1 5JVDB 3M89A 5GONB 4X1YA 5KX5A 5JCOA 5IJ9A 5J2TB 3ZIDA 4FFBB 5ITZA 5LXTB 3JATB 3JARA 4EB6A 1TUBB 4ZI7B 1W5BA 5LYJB 5MN4A 4I4TA 3V3TA 5LA6B 3HKEA 4I55A 5M7EA 5KX5B 3JASB 5LP6C 5IJ0A 4WBNA 4TUYB 5JVDA 5JQGB 5GONA 5ITZB 3ZBPA 4EI7A 4HNAB 3VO8A 5J2TA 3M8KA 4FFBA 4LNUB 5LXTA 3JATA 4ZI7A 3N2KB 2VAPA 5LA6A 4O2AB 1JFFB 1Z5VA 3JAKB 3JAWB 4IIJB 2BTQB 4IHJB 3ZBQA 2XKBA 1SA0B 2VAWA 5EIBC 3JALB 3JASA 4TUYA 3UT5B 4DRXB 4F6RB 5JQGA 5LP6B 4O4LB 1FSZA 4HNAA 3WGNA 4LNUA 1W5AA 3N2KA 3CB2A 1Z5WA 4O4IA 5KMGB 5MN5A 4O2AA 1JFFA 4U39A
chains in the Genus database with same CATH superfamily
2W8ZA 4IIJA 1Y7PA 2IKQA 4KAXA 4DMRA 4EW6A 2QTRA 4QRDA 2WF6A 3W3AD 2GDJA 4C3UA 1T5TA 3WGYA 3OO1A 3NHRA 3Q9UA 4X3OA 3W8RA 2BI4A 3H6GA 4WCFC 2W6ID 5JH7B 1GADO 3BL8A 3O31A 4RLQA 4CQMB 4OX9B 2P91A 5CXQA 3A4IA 1D8TA 4WK0B 3L8MA 3SG0A 1GGJA 3QYAA 3FM9A 1NP6A 3TLAA 4RU1A 4BMCA 3L6BA 2R8OA 2H5EA 5TS3A 4BWFB 5CDFA 1EFVA 2CHQA 2CN1A 1XZLA 3C3MA 3FSGA 1RQXA 1YUNA 3K9CA 4FE3A 4FSDA 1W36C 5LFAA 1YR9A 2ZS9A 3HBAA 3MTEA 5JWHA 2FZCA 1XCGB 3LBIA 3NKVA 4IXTA 3E05A 1L7BA 2GEFA 2I65A 3EOAI 3AB3A 1PJBA 4Z9XA 4IYRA 1G8SA 1X7OA 4Z6KA 3DAGA 5GONF 5GP1A 5MDHA 1PR2A 1RI3A 2JZOA 2YHBA 2D4HA 3NHFA 4IXWA 2VDQB 3ZR4B 4C0XA 8LDHA 3K2BA 2EGGA 4JLMA 2QL7A 2QGZA 2F3PA 3BTOA 1SN7A 3CRVA 1V95A 3TDMA 3VHLB 4B1FA 4HWSA 4ZO7A 3F98A 2CUTA 1LBSA 3R09A 2Z5VA 3T5GA 1GZHB 4CIYA 5KWJA 2PMDA 4B3TB 1SU7A 4NBKA 1J0BA 1X70A 1USUA 4P7KA 4DAEA 2PJZA 4ZCPA 4N41A 1AKMA 2PX8A 4QQRA 4Y6PA 2JH9A 3TFQA 1ADGA 1JI3A 4JCCA 2PUHA 4QLAA 4X1KB 2LD4A 2ZYRA 3A3OA 4AZ3A 4ZZ0A 3BXFA 1ABBA 3GEEA 3PI6A 2B8EA 4I5GA 4IDFA 1JI0A 2CW5A 4IAOA 4PLYA 3WC4A 3QX7A 1XPUA 4ZU3A 4AJJA 4Y0AA 3MBIA 3BRCA 2VF5X 1NBME 1F2TA 2XWSA 4MVJA 3S1AA 2CVLA 1MZPA 3OMLA 3WDKA 3CUSA 4ZT7A 2DPYA 1ZJZA 3M4XA 2FZGA 3L7JA 2HEGA 1K7XB 2VF4X 4WBNB 1JR2A 2BHLA 4Y2SA 5U1PA 2FDCA 1PKXA 2J3MA 3T1HB 2J07A 4WXMA 3FKQA 4G0XA 5LJLA 2AN9A 2CVFA 2G5CA 3V4RA 2VKQA 3IEQA 2WPNA 2O2GA 5HWEA 4BNNA 5DCYA 4JV5B 3ZWQA 2OXTA 3EEOA 4JD5A 1Y6FA 4Y6GB 2DCUA 4KQMA 5CHYA 3LZ6A 5FHRA 2E6UX 3U3DA 4Z7OB 1CJBA 4J7CA 2D0DA 1Y3CE 2DULA 1RABA 2YW9A 3EMKA 4J07A 3TNLA 2REBA 1P17A 3NUZA 1ZW1A 4EELA 3OOEA 3EH2A 4H35A 4ZI7A 2I2XB 3DOIA 5TE9A 1ILEA 4HQ6A 3KYCA 3SHTA 1KNXA 2PTGA 2ZWPA 2V58A 3KQQA 1Y80A 3FRJA 4XDHA 1W8DA 2H1IA 4DE5A 1J70A 4EAAA 5CEJA 3A6KA 5KTMA 1LSOA 1LFDB 1KQ3A 2C04A 3JQPA 1SMKA 1WETA 3LBAA 1U0JA 3L6EA 4WKOA 1ULAA 2CD7A 1BEUB 3WK6A 5EB0A 4BV2A 5C1DA 2R62A 1VE5A 5CA1B 3JAWA 1QK4A 4I5EA 4J0GA 5ALMA 1JB1A 4LZNA 4YMTA 5JSZA 2ONJA 4IWXA 5EJ5A 1O9HA 3IKLA 3WKBA 5COQA 4CKCB 2ZCJA 2QX9A 1U80A 3MIZA 3BRWA 1VLJA 4B9EA 3NHYA 1OTXA 1E8DA 1FFSA 1QB7A 1OH6A 1WAMA 5AKZA 2AZDA 2WIGA 3FI0A 5CVUA 1N25A 5JJIA 5K0JA 1KRWA 1T8UA 1HZJA 1NUTA 1FTWA 3AO0B 4AK9A 1P2DA 3A9WA 3UJAA 5ISMA 4HI0E 1I4DD 2OAGA 1Q1BA 3DNFA 4ALLA 3VOSA 1UKVY 3EUEA 1WJGA 4QLBA 4N1AA 5JADA 1PG2A 3S2SA 1DKQA 2MSCB 5DXFA 1CIJA 2Y9MB 3GJ3A 4X45A 5B2ZA 1F48A 1NC1A 2YXDA 1KZYC 5F98A 1XOIA 2A88A 2UZ0A 3L7LA 3TEFA 1UFQA 3QUAA 3UVEA 1JKJB 3IESA 4I6GA 6ABPA 1XMXA 3N5KA 4BQPA 3MYYA 3ONDA 4FNAA 3UWSA 5HJ7A 2GKOA 3EH1A 4HNVA 1U9IC 5D3MB 3DHWC 4F5DA 3O9MA 1RLIA 1E3JA 2V8BA 3HHEA 4K9DA 1WDKA 4UXIA 3ZHSA 3HJHA 2G1KA 1K6IA 4HAIA 3BKXA 1OZAA 1WHSB 4JYCA 2Z2YA 3W1EA 5FH9A 5JC8A 1NTOA 2D1RA 3I34X 1GTL1 4RSMA 3AKCA 3D31A 4XLZA 2PUJA 3KTFA 1J0AA 3FTCA 2FE1A 4WLFA 2HRQA 1WXFA 2JBAB 1KNKA 2PGIA 3E53A 3LDHA 3RTBA 3GQBA 1XVIA 1F8UA 4Q47A 3HRHA 4L6IA 4J03A 1GLVA 3LGSA 3CJQA 2KTUA 1DJPA 2J4CA 4BJ6A 2GD0A 5AICA 3UWKA 5JS2A 5AQ1A 3BWYA 3V33A 1RAGA 2IPNA 2J9FA 4YMLA 3W2FA 5JCXA 4OQNA 2I6XA 2VNHA 1GHTA 2MTBA 2G9VA 3GARA 3WGGA 3TTUA 1GOTA 1H2AS 3EC2A 1OZGA 1TEVA 1T5LA 3VRHA 1AKRA 2XUZA 4PQFA 5GM1A 3FVVA 1DQNA 3GEHA 3V9AA 1R15A 3OURA 4OHVA 4R0NA 1AQIA 3CWZA 1NXTA 1FSFA 3FF4A 1YJ8A 4D4GA 2B4KA 5B4TA 4QWMA 4I14A 4FFBB 5TPWA 2PRZA 1HR0B 1T9GS 1JEEA 2EJWA 3O21A 2WQ6A 3T12A 5IBRA 3M9XA 1LK0A 4V0MA 4PZCA 1Y7IA 1VA4A 3C6BA 4NR0A 1O9BA 2R7MA 4ZZ3A 1FUYB 4QELA 4RF4A 3EBPA 4U9UA 1ISFA 1JU3A 2RGGA 3K1YA 1S4QA 4R40A 2PMFA 5CAEA 2AMJA 2IYXA 3RGGA 1DIAA 4Q3BA 4ZJZA 1MAVA 2QENA 4YJHB 3SNHA 3VJKA 4AMUA 1T6YA 3PXBA 4C78A 2JI6A 1JEYA 1TAGA 4G67A 4L2IB 4WECA 2DPMA 4X84A 1G4HA 3KEMA 3LMKA 3TINA 2DUUA 4HX9A 2QRUA 3V7EA 3EFHA 3EXEA 3FCXA 2V3VA 4FR5A 1SBCA 4LOLA 4LTDA 2I4TA 2QAGA 3C3WA 3DTVB 4LYGA 4X85A 3OU6A 5FWDA 3FFMA 3I9OA 5TT0A 1KSGA 3T7RA 4ZT2A 1R0LA 5H81A 5FOXA 1DBFA 3FYDA 4URWR 1NXOA 1JMKC 1IN5A 3RR2A 4HVCA 3KQLA 1CQJA 1RRCA 2WHRA 1QZ3A 1JDTA 4J91A 2RHDA 5DN9A 2ZVDA 1JF8A 2UYJA 2NZJA 5JZBA 2PMPA 3WE7A 1NN5A 1GPMA 1Q0PA 2JCVA 3OLXA 1XZDA 2YRXA 2P2DA 3OQ6A 3VTFA 3AX6A 3G23A 4TOIA 1G66A 2NU9B 3RVOA 1TMYA 2FNAA 2OGSA 4UTRA 1I51A 4YRZA 1FFXB 1V3UA 1OIVA 4BMVA 1V16B 5F1PA 2QZ4A 2R6HA 1PL6A 1FDRA 4ZKEA 4JVNA 1K3FA 3SS8A 3UUFA 3WXBA 1DOZA 2F1HA 1UAAA 5AW4A 4JFRA 3FOEC 1OTHA 2C7VA 1G3QA 1RI5A 2FV8A 4Y1FA 4PNPA 5B7PA 1I4WA 4TZKA 1VK3A 2CDAA 2F3UA 2GCEA 2P9EA 2NXWA 2WB4A 2Q7DA 4X1IA 4H6VA 1K92A 3PR1A 3GCZA 4ZOBA 4KGZA 1LZLA 3HVJA 2AHRA 4LE1A 3B6JA 3I52A 1HYQA 3B2EA 4YJFB 5BUQA 1E2QA 2O8EA 2J3IA 4HTFB 2FRDC 3RRZA 4A4DA 4Y9DA 1JPJA 2HQBA 4D42A 2IS6A 1UPUA 4IXMA 4X1KA 3FX2A 3B20A 3VYTC 4G4YA 1VE7A 4QVIA 3MGBA 3PQ7A 1DIRA 1KPIA 4M38A 2XEDA 3QTYA 1EDDA 1GSOA 1MQ8B 1WO8A 2B98A 2E3JA 4RMIA 2Q3BA 3GDGA 2OAP1 3ZD9A 4D82A 3UJ3X 1GQRA 2FOXA 5ALEA 4Q9JA 3FUCA 4QDXA 5F3RA 4Q01A 3WK4A 1PQWA 3R3JA 4TXJA 2ZCUA 5AJUA 5KSZA 3F7NA 2FLVA 4Y1RB 1XDGA 3IELA 4TV9A 3GR6A 3DVRX 3HYCA 2XPCA 4WINA 3VV3A 3KQMA 2OZLA 4ZARA 1W48A 5K8JB 3JD1A 4FPXA 1I0ZA 1RCUA 1A9QA 1KHTA 2JLAA 1ZR2A 4C5CA 2FUNB 3AR6A 3DXZA 2H5LA 2WAYA 1IRXA 4KQJA 4TVBA 3UFBA 4E32A 2B6NA 2WBLC 3HKEB 2V7UA 4GOJA 2IX3A 4TMZA 5E8JA 1A5AB 1IQRA 1QYVA 1V35A 2VQSA 3FKJA 3QVWA 3HFGA 4JLPA 5GONB 4MQFB 3WRXC 1B8NA 4YUAA 1ZD1A 5LQAA 2XBUA 3BSWA 1ZA2A 1IQUA 1NDUA 1N5DA 1TFUA 2BP7B 2JIOA 2QP9X 4P33A 4CDGA 5K8CA 4UVEA 5CDUA 2VOJA 1VDMA 2WU1A 4DV5B 4BFUA 1G98A 2X3YA 5D3KA 3ZYZA 4MW7A 4PYNA 1V25A 3O9VA 1KETA 4RXTA 1M83A 2J6CA 1MX1A 2BGKA 2IH4A 3L0PA 4HNHA 4S1OA 1L4BA 4GRDA 1PI3A 3LLCA 3P2MA 3KM0A 2O07A 2NT3A 2A8YA 2FN4A 2PKQO 2QTZA 1Y9JA 3B9QA 1YHNA 3L5KA 4J4TA 1LRKA 3LF2A 4N9WA 4MQ5A 1QU2A 4C9BA 5DO9A 2GBLA 4ZODA 3TLMA 2IHBA 3K73O 4EGFA 4FE4A 5K05A 2IHNA 1KDPA 1Z5VA 1ZAKA 3HLYA 1YGYA 2VDWB 4IDDA 3HCWA 2EHDA 5I7HA 1CUUA 2E49A 2IHZA 3JASA 3ETEA 3OQBA 4V39A 1XSEA 4WCVA 3S5JA 2CE7A 4MKZA 1GCOA 1NMEA 1OCEA 1UMDB 1V8ZA 3H5WA 4FTWA 1UXOA 4ZVOA 3AZOA 4BGUA 5BV8A 3KSAC 3EGEA 5CG1A 2XXJA 3RUIA 2PBLA 5KVVA 4PLVA 1AN9A 3RIXA 4IBOA 4MVJH 3RBAA 5JU6A 1E9FA 2V74B 3C3KA 4DFDA 2M32A 2P6MA 5I9TA 1L8LA 3GAAA 4OVKA 4WPGA 1RU3A 1AOXA 4HK4A 4MUJA 5KJ1A 1J5EB 3TNYA 2R6ZA 1JWLA 2BMVA 4EA8A 1WD5A 1OFUX 1W1WA 2LGJA 2WD9A 2RDMA 4QBFA 1DC3A 4HDMB 5A7HA 3UQZA 4DJFC 3ETNA 4DQ0A 4BJ5A 3P7MA 3E7DA 3P1JA 5AESA 1ZI6A 4B34A 3QWAA 2AVNA 2O57A 2HNAA 1Y48E 4AICA 5KMGA 2I1LA 2PZKA 3G1TA 4QGFA 4EPTA 1A96A 1WZNA 2KPOA 3BSYA 3ZHZA 1KGDA 3N8GA 4L4SA 3RJZA 3U2QA 4D4JA 1UUFA 2CHFA 4JLUA 1FTYA 1ORTA 1P0FA 2IFTA 5B30A 1B43A 1ZKDA 5AVKA 5LU8A 2AMYA 4EGSA 1FP7A 1D6SA 1EFDN 4O2AF 3QELA 1Z8FA 1ATZA 3N8DA 3DVQX 5EVJA 4EWLA 4OMCA 4B4DA 1BDIA 2R1TA 4DUZB 3K0FB 2QW0X 5I01A 3QNUA 1YCDA 1MAWA 3JZMA 1NTRA 3N74A 2ZROA 4U7TB 3FAZA 2A5JA 3SHWA 3V1TC 5JD5A 4G8CA 4G9BA 5F76A 5BN4B 3M6IA 2FKAA 1I2BA 3AW8A 2P9HA 3NEPX 3K1ZA 5AKYA 3HMQA 5LLSA 2P0AA 1G42A 4IOKA 3UBMA 5CDHA 5KJCA 3M1LA 3H8WA 1XAHA 3BHNA 3NV7A 1AQLA 3HDTA 2JI9A 3M82A 1FMTA 2FWBA 3M6LA 4C4YA 4HQKA 5ALZA 4KACA 2DEUA 2IZ5A 3U44B 5HCUA 1U11A 3L06A 3V2UA 3TD4A 1QB8A 2GAOA 4YRRA 1A82A 3UMFA 2IYUA 3IKFA 1OHHA 2G08A 2GBFA 3C8MA 5EHZA 5KAPA 5IT4A 2AFVA 2AJLI 2YICA 1FU4A 1U0RA 1GUZA 1YKFA 4AC9A 5HVNA 4NFLA 1B6GA 3PC7A 4OSPA 3BSFA 5CCXA 1AJEA 5GANK 2R68A 3KOOA 4DQVA 2BMAA 1AKYA 5HQ3B 2HF2A 2N47A 2SICE 3VI3B 4BNDA 2PS1A 2HMUA 4KMSA 4TWAA 5AJYA 4RTKA 3MSCA 1ICIA 2EKBA 2IIVA 3RUCA 1QHGA 4YJHA 4FU0A 4RORA 5F3WB 2R25B 1QIJA 1DP4A 2MU1A 2VR1A 3ECSA 4J3FA 4JEHA 2WYVA 2HRYA 3LDTA 1PDVA 4RGBA 5DT9A 4C2UA 2AXNA 1EFKA 2C1ZA 4EJ2A 5KC8A 1NRXA 3SZ3A 5CDFE 2PBFA 1WZEA 2BSAA 1OI3A 2Y1XA 4JBYA 5KOJA 5KTKA 1U7TA 4TWZA 1H5UA 4E3ZA 3MQ4A 2R87A 5BUSA 4CIWA 1UODA 1G2PA 4BLVA 2QIOA 2C96A 2OA0A 1XQVA 1FJHA 1GAQA 4DKJA 3L8GA 3JQBA 5BMVF 4N8SA 3OAAD 1PYDA 1T0JB 3ONWA 4TV8F 2WB2A 1VMIA 3FTPA 4GKBA 3VNBA 4OKIA 4JI4B 4M1KA 2F1OA 1QLWA 1PK9A 1M2OB 3I53A 4TT8A 1N7IA 1TTTA 4NRDA 2GTHA 5GV7A 4BEVA 2FQWA 1P7VA 2HJGA 4JL5A 4LFCB 3K12A 1BEEA 2P9CA 3GEPA 2WZCA 4ZHSA 2SECE 1G5RA 4L4ZA 4NNPA 3KFLA 5BYBA 2OHFA 1UXJA 4F4JA 2DBVO 5FTJA 4XM2A 1ISJA 1PJZA 3D00A 1MJ5A 3QUQA 1HYEA 2IU4A 1Z8HA 2A0WA 2RGNA 1W34A 3FRHA 3JQGA 4Q3OA 1NT4A 4F9TA 4UOZA 4IJKA 4GYWA 4GPBA 1I30A 3DZDA 2F8MA 4YHHB 4MVJE 5KX5F 2JIDA 4QXPA 2Q3MA 1LNQA 4Q4HA 1PK8A 3GEBA 3AJ8A 5CH3A 1BEZA 1YBFA 2XX3A 4QFBA 1U8XX 1XI2A 3O8NA 2R8ZA 4FEEA 2AXEA 3CC4F 3AETA 4L9AA 3U7EB 1IOWA 2RGBA 3PEYA 1FQKA 1BE6A 5I8WA 4TN5A 3TB4A 1ECGA 5FTKA 4OAQA 1TECE 1ZIDA 4PZDA 1XVTA 2G9UA 2AOVA 2FN8A 2NGRA 2C5HA 1H9CA 3I04M 4LA4A 2A1IA 3ZGXA 2BTOA 3SZUA 1H1LA 4YP0A 2CMHA 2JAOA 1DUSA 2ZRJA 4JP3A 4MP8A 1IV2A 2H8GA 2ZRHA 3A10A 3N59A 1I6WA 4GNRA 4IDHA 1BA3A 1OW3B 2IGTA 4HQLA 3UC5A 1C8KA 1P45A 3I05A 1KFKB 4XFKA 4D8UA 5E2IA 4G0VA 3ICPA 2NZVG 3U60B 3ISVA 2H1OA 1NJIH 2XB6A 1YBMA 1ZKMA 2DFPA 2X6QA 3E27A 3M2TA 2C83A 1MQ9A 1WZUA 1Y1SA 2HT6A 1JHMA 3B7PA 4XVRA 1K97A 1WCV1 4MUKA 3ZHRA 1DT9A 2HADA 2OFFA 5GVSA 1YSCA 4GMKA 2Y2VA 1P29A 2BJHA 1W2HA 5GZ3A 1LDGA 5CFRA 4J0DA 1DDGA 2YXEA 5B37A 3R7BA 3T1OA 3WLKX 4ARSA 5IT9A 3UN1A 2VWQA 2H85A 1DFHA 1G1MA 2Q9AA 5LR6A 2BFOA 3FMGA 4FOOA 1E6LA 4OB6A 5TNXA 4CZ2A 4B46A 5JD4A 3VYUC 3R7LA 4AUNA 2EBUA 3O8DA 1XNRB 5C52B 4C7KA 2HQ1A 1QF9A 3F6SA 2QRNA 3QFSA 3UKOA 3LX5A 4NFYA 1THGA 1QX3A 4X24A 2BFFA 2CB9A 1YB5A 2ATXA 3O4FA 2BMDA 2AZXA 3GFBA 3QW2A 1I4EB 2VHYA 3GAFA 4WJLA 2VDOB 4UHFA 5SY4A 3B82A 5B8FA 4LKRA 1IV3A 1DUIA 3G1UA 4G25A 2FSVA 5BQOA 1NSTA 3U17A 3FY4A 5JVDA 1YJ5A 4JLAA 1NQAO 2PKRA 2H2WA 2ZAGA 4HDNB 4ARBA 4ZCMA 2VA9A 4WRRA 1NQ3A 5F3DA 3ELCA 2IEYA 5T6BA 4TWIA 3BCUA 1FP2A 4UE6A 2ZQ5A 4IHAA 1V41E 3DKVA 1QP8A 3B8HA 5EHQA 3WYFA 1LPAB 5FO1A 1EH5A 1K3UB 3GJXC 1NFRA 3GMTA 4ITUA 2PR7A 3T5AA 2QMZA 2MYPA 4MVXA 1VLZA 3EFOB 2BBTA 1M0WA 1X1TA 2OWDA 2VTDA 2I7TA 4LJ4A 2I8AA 4WOJA 5G4KB 3REQB 3T5PA 4CR7A 1C0KA 4HNAA 4BY9D 1UL1X 4FJ2A 2X6TA 4FN4A 2J9GA 2X8AA 5LUBA 2VBGA 4E2WA 5IXYA 2FMIA 1B0PA 3BA6A 3RUEA 2H4ZA 3ZCQA 3SZOA 3ROZA 3QOFA 4B7AA 3HP4A 5IABA 3JVHA 4NV0A 4MVJG 5BR7A 2RK3A 4G0QA 3PRYA 2I9PA 2RBGA 4GQAA 4NJEB 3TJRA 4CLOB 4AU1A 2IODA 3TQFA 1MV5A 4D4LA 1LY1A 3NANA 3KKLA 5JISA 3V8BA 1MA0A 3CLKA 2PMEA 4JI7B 1B8VA 1CUDA 2FSUA 2DLDA 3TD5A 4TLEA 2ZTUA 1TQ2A 1DC8A 4I9UA 5IARA 1KK0A 3WYNA 4Z4EA 1DELA 1T3TA 5KJ6A 5JCZA 2Y2UA 3PYMA 2YQ5A 4M7WA 4S1WA 5B53A 4UTNA 5AOCA 5AKEA 3I0ZA 3TIFA 5EE9A 2V54A 4GM1A 2NTJA 2NZXA 3R7WA 1K7SN 4WFIA 3HS3A 5IWAB 4W7HA 4KVFA 4KEAA 4D0RA 5F4ZA 2P9ZA 3FUUA 3HAXD 1M2HA 1EB9A 1XRQA 3CEJA 3F71A 4M4SA 1IPEA 2P5TB 1H3NA 4YAEA 4J6FA 2X19A 1YB2A 2OV6A 1YZUA 1KA9H 2PRJA 1E6WA 2N1MA 2WMNB 4NJOA 4DLNA 5B58C 3WGJA 4V0ME 1E8NA 4ZVMA 3VYRB 3O90A 3F9CA 4G89A 4B33A 4BX2A 2YQZA 3DDUA 2JLZA 3U7FB 4P5DA 5TQ0B 1RR6A 3UEOA 4G1CA 2HXGA 1MH9A 3HRKA 2EJVA 3JS5A 4ZD6A 3DE7X 3SYTA 3TUJC 1L7VC 1H3EA 3JQQA 3V32A 1KI7A 1TJYA 3H2HA 3SX0A 3X3HA 4K81B 4CLRA 4KYIB 3LA6A 1UMKA 3ZY4A 1RQ2A 4PYOA 1X39A 2YN0A 3ZXXA 1XMPA 2Q4OA 3JQFA 4A0FA 3F2IA 2GYWA 4BAUA 4C3VA 3Q10A 4KITB 5D3QA 3HRIA 1JPUA 2RHOA 1G64A 1WKCA 2WLTA 3CNLA 4L15A 3GA5A 1AKUA 4Q34A 1VCIA 1S2IA 3FFWA 5MF6A 2C0CA 2VK4A 3EXG1 2F9MA 4IJUA 4XX0B 1J7JA 1VG9B 2YIMA 4QJ3A 4HEHA 3ICEA 4Q39A 3NOOA 3TEMA 1DWQA 1LF5A 3ZWNA 2XJ4A 1UJ4A 2Q50A 1OKKA 4FZRA 4REMA 4PYRA 1DAPA 2WMDA 4KQXA 3BYZA 4RA6A 1SHZA 5EKTA 3VPXA 3CNNA 2AVDA 4XGIA 1SULA 5CD1A 2Q7OE 1QIGA 1DSSG 1HL3A 4C14A 2BEVA 1ZGBA 4B80A 1YZLA 5J9FA 2Z2IA 2F48A 1WV0A 3HUDA 1WUHS 4BEJA 2Y0EA 1KAHA 1E66A 4QQ8A 3PF8A 4KE9A 1FYDA 2DFKB 2UZ1A 221PA 1OD6A 1ZCZA 1BCSB 1QE3A 1NVGA 5AHRA 1DXQA 1WIWA 4DG5A 3T3GA 1U40A 4ECEA 1D7AA 1SC6A 4DXAA 1QX4A 4XIFA 2YYAA 4RVHA 3W8DA 3FVTA 1KOGA 4XR9A 1DJQA 4FQ5A 4H4DA 2FEWB 2XV1A 1WVIA 5CX1B 3RNOA 3S2EA 4Q3KA 4DM3A 3LHSA 4M7PA 4EK9A 5EPUA 3JVDA 3NBMA 2FHPA 4BZQA 5MFPA 4Y2TA 2YN2A 2YS6A 2BLNA 1E89A 2WJVA 4LHVA 1BGVA 4P22A 2YVAA 1CEXA 3TJMA 2QN6A 3I5AA 3JQ8B 2O0MA 4YCBA 3RKRA 4YUYA 2FEKA 4L8YA 1UC5B 3AFIA 4Y1EA 1X19A 4E5PA 3UM9A 2WZQA 1ZK0A 2CC2A 4J16C 3PPIA 4N40A 2KHZA 2EJUA 2H52A 3QXHA 4U7JA 2BTQA 3AKZA 1EXDA 3SF8B 3DOHA 4J1NA 4CU2A 3BQMB 4Z7JA 1SEPA 2H06A 3P2OA 2HWXA 5EIXA 4QOFA 1SVIA 3T9BA 2CDRA 3F78A 4INPA 2G9IA 4OKSA 5IHPA 4Z4CA 3G1WA 1U2QA 1QWSA 1Z4MA 4R1SA 5JJLA 2DZDA 2XCQA 3H3FA 3E3LA 2BD0A 3KFVA 2VDKB 1FXUA 3OT1B 4M86A 1R10A 3NS7A 4NH0A 2D2XA 5GAJA 1E1LA 1D8AA 2CJPA 3LY7A 3N0RA 1HY3A 5BMVB 1K89A 3M4JA 3PQ5A 4P7GA 5DYIA 4TV8B 3U48A 4AYWA 4EO4A 3TUIC 4L0QA 4LDNA 1C1XA 1WD7A 1OI2A 1ODFA 4QBGB 2Y68A 3DPSA 3A0UA 3M83A 5B4UA 1QUEA 5E4JA 3BGDA 2H31A 1JUDA 1Y8CA 1UIRA 2VUSA 4YXFA 3QVXA 3ZHYA 2R85A 4KGXA 1UEJA 2HSDA 2PX0A 3IHLA 4TKLA 2HUPA 4D0GA 5IN4A 5LZ4A 3T7DA 2CFOA 3OPMA 5ER9A 3KQWA 3LW8A 3QYJA 1NVMB 4YAKA 2IAFA 1Z36A 4Q6BA 3OCYA 4B6JA 4EG0A 1TA0A 2XMPA 3J80M 1KYTA 2QN9A 2OD9A 4EO7A 2ZANA 3OPXA 4M1SA 4I08A 1Y3IA 5I9BA 1SKAA 2QMHA 5JNVA 2QSJA 5C3UA 1ULUA 2DF8A 3Q41A 4V24A 2YV4A 3N8HA 2A5LA 3FLEA 4Q3CA 3IR5A 7GPBA 5KNBH 3WSWA 4IMJB 5I8PA 2B36A 3A27A 3HJBA 1OBHA 4GR5A 2GNPA 4FI3F 1YQ9A 1VQVA 2A7XA 3SQOA 2VFAA 2ZRIA 3IP6A 3LDFA 4Q7MB 1EA7A 4QARA 3VDXA 1DO8A 4X6LA 1XEXA 3NHAA 1KI9A 4DBLE 4ZEOA 3CRZA 5GJCA 5H3LA 1OX5A 1CUJA 1WDLA 4FLFA 4UHDA 5DBEX 1N9KA 5AM2A 5I5EA 3RFCA 4FFOA 4K6KA 1KMMA 2PRIA 4LOIA 1N5LA 2WWVD 3ZLJA 2IYYA 3DXYA 2PK3A 1GZUA 4BJ1A 3DYVA 3Q3CA 3CC8A 5A6SB 1X1DA 2CFSA 4RPHA 3AR8A 1Z07A 3VPGA 3LWRC 1ZH0A 5FPTA 2YZ2A 3IIIA 1F2UA 5FL7A 1BXZA 3CCMF 3EWAA 3SKVA 3X43A 4LXUA 3I12A 5DKFA 2Z1NA 3ZZ1A 1QYWA 2I03A 4JC0A 1KNJA 2GAJA 3ABSB 1J6UA 1JHUA 1G6KA 4F72A 2YCBA 3GLQA 3ZX5A 4ITVA 4HAWA 5AM4A 3IX7A 4RYLA 4M8KA 4BVJA 5HXAA 1GD1O 5FAKA 4NE9A 1VQ7F 3T9DA 3I3SR 1A9ZA 3OONA 5FWXB 1S3FA 1BTOA 3REQA 1ZR4A 3LY9A 3DMDA 2BFDB 1HDRA 1QAOA 1W2WB 3C8DA 4EUHA 2WSMA 421PA 1M75A 1SD1A 1Z5OA 2OXFA 3O7WA 3GX1A 4JB2A 4IVNA 4JR2A 4NAUA 4R81A 2UYCA 4GL2A 1BRMA 3G5UA 4Q3NA 1IB6A 3AESB 1D4OA 2GK3A 1HT1E 2Q0SA 3HVRA 2GCGA 4RPGA 4IZHA 4MAAA 3OQNA 5EPEA 3LC0A 4JQYA 1JIVA 3ZWOA 4HWOA 2XQKA 3UWDA 2GHIA 1V3TA 3A25A 1QMGA 5LMUB 1QS0A 1XTSA 5A4IS 2P2GA 4HQFA 2VTEA 2AWNA 1E9EA 1G6HA 2XTZA 2P2YA 3HUUA 3NYIA 2VRCD 4A03A 2BMWA 2ZVQX 1GGKA 3PFBA 4LJRA 4O4LA 2H1CA 3ZZMA 2QPAA 4HAVA 3MS7A 1LI5A 1O57A 3OZGA 4W5QA 3H2ZA 1V8BA 4QDUA 5J2UA 4W7IA 2OD7A 1TO1E 1D9ZA 1VB5A 3VZQA 1NBHA 3ZWXA 1PZGA 4MHTA 2V6MA 4HWKA 1U2PA 2O0LA 5KSWB 2GMWA 3MW8A 4RJIA 1EGQA 4LZJA 1CIPA 2QG9A 2YUTA 5DW3A 1Y98A 3BIOA 4CT5A 5DTMA 2ZSEA 1OMOA 1M54A 2OVFA 1A72A 2X4IA 1TKCA 1FPQA 2CZCA 1LCIA 1V2GA 3L9WA 3PUWA 5JNTA 1ODKA 2ZIEA 4GXTA 5TC4A 2VWHA 4Q9DA 1HSZA 4RADA 3G8AA 3D6NB 3DTNA 4EZEA 1AKNA 1Q12A 1L5KA 5A02A 3NTLA 4QPDA 4EECA 5KNLA 4P0PB 4PGAA 5JO9A 2L26A 1OU0A 1WCWA 2VP6A 2XW6A 3AI3A 1I1OA 2I6GA 1ZOLA 3QVSA 1K88A 1WE2A 4DWVA 5J2UF 3DMGA 1VQ8F 1SQ0A 3AF5A 2E4VA 2N1BA 4ARVA 1UPFA 4TWBA 3U9SA 4BXOA 2P9YA 4B6EA 2B5OA 4MIKA 2CJWB 3ADDA 4X90A 3FTFA 5JNUA 4HMPA 5FPYA 3D2AA 3OCVA 1JIJA 2W2LA 5IDYA 2RI1A 2IP4A 2JAPA 2HI0A 3QU5A 1H1TA 1GUAA 1RCFA 5IP5A 3RWOA 5ADVA 2FTKE 2ZRQA 5G1NA 3AERB 2PT7A 4E5DA 1EJ0A 2C5EA 3W5UA 4BLOA 3A9VA 2PYIA 1OBVA 3FFBA 4UHHA 5DISB 4YMHA 4QPZA 2PU7A 3M3PA 3O74A 4K05A 3U81A 5A4AA 1GCUA 3QXGA 3ROFA 1P1KA 3JQCA 5C8ZA 2P2NA 3V8MA 1CX9B 3N0XA 2Q1WA 3R6WA 2VO1A 4NWIA 3RCBA 4DT1B 4RTJA 4TTPA 2OT3B 4EUFA 4ZI3A 5FPKA 5I6DA 1KQPA 1BCSA 1E1CA 1OJ7A 1Q1AA 2FPKA 3BFKA 4IKEA 1VOTA 2YN4A 4YJ3F 4Q24A 2HSGA 1PO7A 4EL0A 3OF2A 2X0EA 1WW2A 3WV4A 1TT7A 2TS1A 1M1KH 1OBOA 2I2FA 4K86A 4Y2RA 4D45A 4UCQA 4WFKA 3H2KA 1DEKA 2ZJ3A 5IKPA 4EVSA 1EG2A 1RC0A 2OKCA 5JCPA 3PHLA 4B3RB 1LSSA 1OROA 1E63A 2G1JA 4F6CA 2B82A 5EWJB 1E4VA 1U7PA 3HUTA 4I6EA 3ZHVA 3BERA 4PC1A 1M9NA 2C2OA 3F46A 4RD0A 2HUNA 3BDIA 3D0RA 2AIRA 2ACWA 3OICA 4JOBA 5KC9A 1XQXA 4HH1A 1PJ2A 4ZPJA 1ODJA 2NO1A 1SIBE 3U80A 1CUAA 1ZUIA 1Z5UA 3B1XA 4HFMA 3BGIA 4F38A 1DBRA 1CY1A 2ODEA 1GV1A 1HL7A 4QDOA 3IP3A 4UUAA 3QW4B 2HRZA 1VHWA 2HS0A 1Y9EA 3PFNA 3R2JA 5HR5A 2UYNA 2V3CC 4NXNB 1IY9A 1TPYA 1UMBB 3RREA 5AYVA 3NIDB 3A3PA 2W6NA 4KL8S 2V7TA 4N8DA 5CLLA 3BHMA 5T8KC 3T3DA 4EF6A 3ZJTA 3MRXA 2VUUA 4PZLA 3UB4A 1K5PA 1TRHA 2JGJA 1INLA 2WIDA 3BKWA 3PUKA 4MUXA 2CLCX 5LBTA 4IOLA 4XCVA 4OGGA 1GQFA 5HYVA 2W6JA 4LWQA 2H6EA 5AXBA 1OXMA 2QSYA 3DSRA 3DLHA 3HKBB 1Q21A 1F06A 2IHJA 3W5JA 3C24A 4E6PA 2QMOA 1Z7BA 1K73H 2D7CA 2OORA 4WKCA 2D0PB 3RLFA 3QE4A 3RSGA 2VJYA 1TU3A 4UNSA 1PGOA 3BF8A 4D3ZA 2XBMA 1UJ6A 3I9V6 3EHDA 1E0KA 2E7ZA 1YOVB 3HJRA 4RHEA 2P69A 3GFPA 4MVJP 1NY6A 1G6OA 4EYGA 1FNBA 1R0BA 2C5AA 3GLGA 4NYJQ 1MC4A 3VR3A 2PX3A 4F85A 2O7QA 2RB9A 1YVDA 3GUUA 3QMPA 4OAOA 5T41A 1UOEA 1KDVA 2CZWA 1C7JA 2FG5A 3A9CA 1MOPA 4JUFA 2HFJA 4XW2A 1XQ6A 1MXHA 4XVUA 2PY6A 3A9RA 3FMIA 2PUVA 2RH5A 5BN1A 3K70C 2DPLA 4RD2A 1WQ3A 3VNUA 1G8KA 2DUJA 1RWMA 3TR6A 4MUAA 2JJ2D 1XPOA 3EPLA 1GEGA 1HQYE 3M70A 4HDOB 1ZQ9A 3BH6A 4DIBA 3R0IA 3Q8LA 3QU9A 4H7HA 2UZIR 1BX0A 2JF0A 3PDIA 5J23A 1R00A 3G02A 4X95A 3EIFA 3SHOA 3E48A 1W30A 2DOKA 2AFHA 2PSDA 4LYEA 2XVYA 4UUPA 3ERNA 3C7AA 1GN9A 1PJQA 4KJXA 3P9CA 4BLUA 3OU2A 5K0SA 1EWYA 3VC3A 2A3RA 4MGHA 4UAJA 3UPTA 2A35A 2OVBA 4JN6B 1U1GA 3CCFA 4D9BA 1QO9A 1X1SA 1XNHA 4Q4CA 2NXEA 4LNAA 4EVIA 3W78A 2C4NA 2JZNA 1L9KA 3GUZA 4HB2A 3TVDA 2QAGC 4H1VA 3RV3A 4MQ4A 5M2QA 4HH0A 4GEGA 1MD9A 4Z4QA 1M8KA 2ZBVA 2PJRA 4RVDA 3H9QA 5T7BA 1RZRD 1FFHA 4I2VA 3ZH2A 4D3FA 5BOSB 4R7TA 1E2GA 2FPGB 1OB2A 6CHYA 3L0DA 1K8YB 4NC9A 5DB4A 2QTAA 1IY0A 2BSQA 4KMOA 3CTMA 2ZZMA 3G4SF 3JVUA 3W5VA 4PLPA 3KELA 4FQ7A 4W5RA 1B0ZA 5FBZA 5U4QA 3QF7A 1M1YB 2QI9F 3AR9A 5DLDA 5LKAA 2GWHA 5H9WA 3LXUX 2EJTA 2FG6C 1VDZA 2JGFA 2QYOA 2I99A 1FW8A 2XSZD 4US2R 1JLLA 2B3DA 3EARA 2XOEA 1VL5A 2QTMA 3SD7A 2JGRA 2GH1A 4XFDA 2A5DA 3GBPA 3LT2A 4NQRA 2IWRA 3BOSA 5HTOA 4M9CA 1LJLA 3PITA 1T4CB 3DPIA 3VNVA 1O8CA 3G59A 1U3GA 1JHRA 3IEWA 3ITNA 5ILQA 2UXBB 1WBDA 3O2SB 1P62B 4Q4JA 1PP4A 2C20A 5IT0A 4RAQA 2QT1A 3SHQA 1P5RA 4X7BA 5BSMA 2OTMA 4GRAA 3JSXA 1RMQA 1BSVA 2J85A 2ZBFA 2ZULA 2WJWA 4WLVA 2A92A 4QLOA 4WUVA 4X91A 5ESXA 2XH8A 3UTDA 3QFCA 1Y8RA 4KTTE 5EFOA 1KOLA 3PTLA 1JHZA 3U4IA 1ACMA 4B9AA 1RQPA 3ROEA 1NOJA 4LXGA 2QRJA 2C9ZA 2O8VA 2Q1XA 1T1JA 1SKQA 1Y8QB 2WJZB 2CWJA 2R6AA 2FSHA 1F9EA 3C16C 4P86A 4S1NA 4ZQBA 1WPXA 2Q5HA 3DCYA 3K5HA 4C4OA 2WJYA 4IOJA 2DU8A 3OIYA 4Q82A 4GLOA 4PZ9A 1EYZA 4J75A 3IT2A 2CB0A 2QX8A 1S3GA 4QYIA 2D59A 1G8YA 2GAIA 2MMGA 3RVNA 2XCUA 2I0FA 4GEKA 5DM0A 5AVJA 1AHIA 2C5FA 4EBBA 3OIDA 5DLQC 1XRPA 1U7UA 1R6XA 3W5IA 4JXXA 2C4TA 3KBOA 3ENQA 4HXFB 4TTIA 4WL0A 3W06A 1LDNA 2E87A 4AQDA 4Q7JB 2P62A 3HE3A 3DF7A 1KOJA 1PQYA 3QVGB 3ABQB 3DFUA 1XYYA 4QOSA 4CWAA 4F5EA 3GLFA 2KGWA 1T3LA 4DA4A 2CKMA 3KAKA 3W6NA 5JYCA 5JSQA 1AUPA 3NW9A 5ALGA 2ZXUA 4H7PA 2XAAA 3O3MB 4OXYA 1RPZA 4DC9A 1DTSA 4B8WA 3IDSA 3OTQA 1CE8A 3HM2A 5GINC 1AQ6A 1EMDA 3QPDA 1DIHA 2V97A 1T2EA 3R8FA 3L7BA 1SIOA 4KV7A 4BUJA 5BSGA 1E3TA 3DZHA 2D3TA 3AERA 1SVMA 4FONA 3WG9A 3FPSA 1L7EA 3TL6A 1S8FA 2OBYA 3LK7A 4ER7A 1GFZA 2VK1A 3GRFA 3L1UA 1FJGB 2JFNA 2Q1YA 2VYCA 3G13A 5DEOA 3U5TA 2GBLC 3SQWA 5FCDA 3T0IA 2P3QA 4C2AA 4R5HA 4O2BA 3II6X 3RVDA 1KQFA 3GNLA 4CE6A 1J23A 2WI8A 3HV0A 3GV0A 2WM8A 5GAPK 1CY6A 4E30A 3GCGA 4IXDA 1ULSA 3JV7A 4RDIA 1JHXA 4N9QA 3HY6A 5EQJB 5AVOA 5HIJA 4EENA 1SM4A 5L4SA 4ACBA 1BMFD 1GYQA 3PNVA 1UZUA 1XN4A 3BWVA 3IOBA 4UVHA 3M49A 1PLKA 3TMYA 3ZE6A 3INNA 3QG1A 4R84A 4RTOA 2W2NA 2G9QA 3ESRA 2B8JA 1WLSA 3KKKA 4H59A 3D3KA 3ESDA 1APBA 2WJAA 2VSXA 1M90H 4FOPA 4L07A 3K9WA 1LB1B 4JQZA 3QZUA 3AR4A 2XVMA 2YS7A 2R2GA 4IDAA 2NVUA 1CUFA 1ECPA 2ZJ1A 4IX9A 2OYRA 1Q2UA 3PDWA 1HYBA 5C7LO 5JATA 1PT7A 3HXTA 2P3LA 1CZRA 1L4FA 3G8BA 1F4VA 4C8EA 1KO7A 2IXDA 3QX3A 1OFTA 1E3IA 1Y8AA 4BWGA 1R0RE 3OTIA 3PENA 2XA9A 4HN4B 4LQDA 4FDLA 5BSTA 5BY2A 3GNQA 4MDYA 2XD4A 4YLYA 1NV9A 2I54A 2OECA 1UMBA 3WQSB 4K6GA 1VL8A 5CXSA 1TQHA 5I4CA 3OCXA 1EM6A 4MP6A 2C5LA 1SU8A 2PLFA 1Z56C 5B5SA 2H8CA 3WL5A 5J58A 2D8MA 3ZOKA 4WK2B 5ALHA 3NHZA 2O54A 5F12A 1W581 4LXTA 1E94E 3D6TB 1R5BA 3FNRA 4CL0A 2F8TA 3D3QA 3SEQA 1KNQA 3KKPA 1KEEB 1E59A 2GKSA 2GF0A 5EKXA 3UJHA 4B3BA 1LS1A 2VPPA 3C5WP 3GJ8A 3KZXA 3PR3A 4PICA 4DYVA 4POOA 1CZHA 2FF7A 4MRSA 4QHTA 3E20B 3AYXB 4C08A 3N05A 4KYUA 4YPOA 4CM8B 1CNEA 1GVNB 5HZHA 1OAOA 3A3YA 2HPZA 2D62A 3HPQA 1CD5A 3R3XA 3UWOA 3GLIA 3ZXUB 1IZZA 1Z7WA 1RWWA 2COKA 4GPAA 1J56A 1QD9A 1TQ4A 3QLUA 3NTVA 4FW8A 1VCHA 3FPBA 5CH5A 3BXEA 2NPFA 3TTWA 3UXYA 4C0JA 1W0KD 2CVQA 3E8XA 2J7KA 3F4LA 5AK4A 1OH8A 4FKMA 2QM7A 1UKEA 3TL3A 5A03A 4PSKA 5CNIA 4YFYA 3NIGB 1C4KA 2EJBA 3PGXA 1NLFA 1LQUA 5TLSA 4BX9A 3SKXA 3OG9A 3V4ZA 4HS4A 1W1IA 4CI9A 4AUEA 3LKZA 2YWCA 4YREA 5JXJA 5KU1A 1W5SA 4ZGBA 4UBNA 1DBSA 3VVCA 1JG6A 4IDPA 5JZSA 1DU4A 1W1UA 2FKNA 2QMEA 4INJA 4NDZA 1AK1A 2WT4A 3GRPA 2NSDA 3R40A 1M10A 3CLHA 1P0IA 3K0SA 3SPXA 2WE8A 1G20B 5ESDA 4AJEA 4CF3A 3NNSA 1D2MA 3FZNA 3UJ8A 2C1XA 1LW7A 2BMJA 2PQMA 3OCUA 2BCEA 4KK4A 4NQZA 3TW8A 1DC5A 2BGTA 2FZWA 1I01A 2WHYA 5K0ZA 3JWEA 5F7ZA 3GAZA 2B34A 2XUFA 1HK7A 4MWDA 2POCA 2QRVB 2CV0A 3HNOA 3PQ3A 1RVV1 4OI2A 3RTCA 1OXBB 2DAPA 1SCUA 3D7LA 1TVKA 1V6AA 1J33A 2CXTA 4OHFA 2WZDA 3KB6A 3HCAA 4PU0A 3W7AA 4B0PA 3ORRA 4UPEA 1WMBA 2FG7C 3ZK9A 3MCVA 2ZUDA 3BG5A 5D5HA 3JQBC 4YR9A 3D81A 4UKDA 2IS2A 3COSA 3GJ6A 1JLRA 1I2CA 4BO7A 4AQ7A 2NSHA 1E9VA 2R86A 3M1XA 2EXXA 3BZWA 5DNDA 3OIVA 1EAMA 1TAHA 1DT3A 1PWYE 3WGQA 4R71A 1EVQA 3B5JA 4WA7A 1RMTA 2VJMA 1L8QA 2OE2A 1IZ9A 2GZRA 1VYUA 4A0HA 4BT7A 3NOQA 1GZVA 1M1YA 1XCJA 2BGIA 3AMVA 3O93A 4MR7B 3LQQA 1Z2EA 4Q4DA 1VSBA 2EKPA 1BYUA 3RIGA 3OQIA 4DJTA 4DVGA 1UBNA 3PPYA 1VKOA 9MHTA 1EA5A 2YZ7A 2WTEA 3H84A 2VYND 1K5GA 2RGNC 1T4CA 1DAKA 4CIVA 5JEDA 5CDYA 4CEHB 2O19A 2EWCA 1U3DA 2BKAA 3G17A 1EE9A 4D9CA 2YOFA 3T3PB 821PA 4PC2A 4LFAB 3F3YA 5A9RA 5I3CA 1Y1TA 3DBIA 5IT5A 2CLKB 3A1NA 2VF2A 3OEHD 4FC7A 3FBTA 1NVBA 2P5SA 1O6FA 1QV7A 2VHXA 4OQLA 5ALNA 4P32A 2B0CA 1FYVA 3EPRA 3GU3A 4A16A 2XOKD 1USWA 1Z0JA 2GYYA 1ZWZA 4FFPA 3GCXA 1SOWA 3VGPA 2JG3A 4URUR 3FR8A 2A9JA 4MI3A 5CD9A 3R7AA 4Q5IA 4Z9AA 2VH1A 3BD7A 2C07A 3MTDA 1H6DA 1MG5A 3RW9A 1YQNA 1Q1GA 1AQUA 3QWBA 4KPGA 5LQCA 3DFZA 3LCJA 3PSAA 2Z57A 4LXXA 3D1VA 1T0AA 1Q7GA 1HT2E 2IVFA 5E7MA 3RUFA 3EHEA 3ETLA 2HNBA 2WW8A 5IUKC 5J2TF 3E0XA 3T7JA 2BF7A 3S28A 5LWHA 3WMRA 3D7NA 3DVAA 3WSTA 3RU2A 2A59A 1TCUA 2Q3DA 4EFMA 4CEIB 3WZMA 1TPZA 1X7WB 1OE0A 4INZA 2MMCA 4XB1A 2VCEA 3T94A 1ZN8A 1RHQA 1J8MF 3CC2F 2C94A 3OBWA 2FN3A 3Q8XB 5FWYA 1X7XB 4X6YA 4COOA 3KJGA 3TB6A 1BFKA 5EYPB 5C2JB 1CJKC 1EQUA 4W63A 3ZKWB 3UF0A 1E18A 2HO5A 4HRXA 4L4YA 2OHOA 1F7VA 5TEWA 3BDAA 1PFQA 4TT3D 1PLLA 1QGED 3HFJA 2CSLA 1F60A 1G5QA 3HSSA 4Q1CA 5AHXA 2DLNA 2JIMA 3I92A 4Y9UA 2QYHA 3BH7A 4D43A 1U6KA 1YK1A 3CVWA 1FUEA 4FVTA 3ZJUA 4U2BA 2HWKA 4LY0A 1EWVA 2ZT6A 1PJ8A 1T2NA 3IXMA 3U4QA 2Y66A 3A37A 3KOUA 3AHHA 5FNVA 1C30A 3FOWA 3QE2A 3W9BA 2RB4A 5DGCA 2FSVC 2I1WA 2AQKA 5CA0A 2C2KA 3DL7A 2Z1UA 2Q2WA 2W7TA 4UM5A 3ERCA 1EXMA 1UOQA 5C18A 1OXVA 2NZ8A 4CKBB 3TKAA 3LQRA 3GVHA 5KNCA 3NH6A 4M83A 4ZC1A 1M72A 4GGPA 4KN8A 1P72A 4N39A 1XMIA 3FI9A 1N2EA 2Y67A 3H5TA 2W2TA 1TFRA 2XECA 2UYKA 3LL4A 2WUGA 4RTRA 1T9HA 3SSOA 4F06A 4AXBA 1N2CA 3QSYA 2ZBGA 3HJGA 3BMQB 3PQDA 3PIRA 4R9SA 1Y4SA 4E88A 5HKKD 1C9DB 5LQNA 1EM8B 1B6TA 4OB8A 2FPPA 1GTSA 1L7NA 1JZQA 1XTBA 1XHLA 1JSRA 1GQYA 2QPLA 4LG1A 4XGRA 1JILA 4DLXA 2IE0A 3IQWA 4JASB 1SUIA 3P0IA 1U3VA 1W5TA 4Y9TA 1ZUD1 3CPSA 4R3UC 5F33A 4EHJA 4JHXA 1RM3A 2DY1A 5H80A 3HLKA 3SLGA 4UTXA 2P77A 3MWEB 4R51A 1VRWA 2JK0A 3AVYA 3OZIA 2FC3A 3QVJA 4R3WA 4DSUA 4FWIB 1XJ5A 2OFPA 1DE0A 1U02A 4KRFA 2VSNA 4DM4A 1GM5A 3DE0X 3NNDA 1NU6A 5KQRA 3GLHB 1PBTA 3CMEF 3J7AR 2BEWA 2VIIA 4RKRA 3RM3A 3RO7A 1V8DA 2P30A 3E1SA 3IAHA 3B3GA 4R2LA 3PYLA 3NVKE 1O77A 2NSLA 5CK4A 2V1XA 4AFNA 1IWPB 3MT0A 2XUIA 1H2XA 4XSHA 3GLGE 4KAAA 3AFHA 3KQVA 4FSHA 3W1VA 3K9LA 2Z5GA 3ZDRA 5J47A 3A4TA 4KDRA 3ANSA 3CO0S 1KZ4A 5TV2A 1AIPA 4AN0A 4RAOA 5KYXA 4BC1A 4CJXA 4D9KA 1OH7A 3NGMA 1VQNF 4KZPA 1W94A 1JGTA 1ZUNB 1Y0BA 3Q3JB 4PLCA 4TTVA 3TSAA 3JAKA 1FNMA 3U4AA 3BZBA 3SM3A 3WLHA 2XT0A 1V5GA 4B7XA 1LBEA 2C7OA 1ZH6A 5EY5B 3RAGA 1R6AA 1SKMA 2AFHE 3JTMA 2PO7A 5BW5A 3IP8A 4MKXA 5ED4A 3RH0A 1A69A 2C7GA 1X15A 2PNFA 1QZXA 3ZCSA 4O2LA 3A6PC 2GESA 3BE8A 5ICSA 3GRYA 1TK9A 1JQKA 2FQYA 3QJ5A 4YRPA 5BRNA 2O8FA 3FYUB 4YP5A 4M0DA 1H69A 2VP2A 2Z8XA 1Z8NA 3W2GA 2IYQA 3DT9A 2JLWA 3Q0TA 4AKSA 2PBZA 2OHGA 4RF2A 1Z25A 4UEQA 3U7QB 1KRHA 4NU5A 1UDXA 4BZWA 4CKWB 5TJ9A 1JAYA 4LDPA 3ZDXB 2FSGA 1GZDA 3EWIA 4JUCA 5LQSA 4RH3A 3PEEA 4JQCA 1G20A 4X71A 4BNLA 4CPDA 3KJEA 2QAJA 2WLSA 2P9GA 1Y9AA 5CP8A 2XXAB 5E6RA 1KYYA 3AGPA 1G5IA 3CZRA 1QV6A 5AM1A 4FHGA 1Q74A 3SJAA 1S7CA 2E2WA 1WBBA 2JVKA 2Z08A 2ZSBA 3LCCA 2OILA 4ZMRA 4G4XA 4D25A 4UNRA 3COPA 4X3CA 1U9JA 3UK7A 2QYSA 2ZG6A 1J7HA 3ZU4A 2AMFA 1YFZA 1NR1A 2OSVA 3A6GA 4HB0A 4JWTA 4MIOA 4QUEA 4Y2XA 5JMPA 1Z5NA 3KTAA 4G1VA 4DJDC 4S04A 4TMYA 1MQAA 2PH7A 1YIOA 3TOXA 5ERYA 4Y2JA 5JS8A 5CLFA 4E1AA 5EZYA 1YASA 1X7DA 3IE0A 4MA5A 2PSSA 2GPSA 1YZ3A 3KU1A 1WMAA 1HYGA 4RO0A 4JC5A 4JLOA 4YUVA 2GK6A 4K9OA 4AZTA 4ZKDA 1DQPA 4P0TA 3R9WA 4FDTA 4OHYA 3AUUA 4HGNA 4UBMA 2FRXA 1VPTA 3K30A 1UWCA 2B7LA 3G5MA 4FB5A 2JI8A 2N3ZA 4ILKA 2EWVA 4WZ6A 4X1YA 1AN0A 2R1VA 2PUEA 3KJFA 4D3XA 1AY0A 4GFDA 4LRWA 1FSGA 4OI1A 1NBIA 3WTBA 1ABFA 1EB8A 1ZOIA 5HKKA 1IY2A 4ZIRA 1UBTS 3CO5A 3DV0B 2WUDA 1QYCA 3EAFA 4QYXA 3WLLA 5ALVA 5GTDA 5JWOA 3FF1A 1HDZA 4GI3A 1V11B 3IJ5A 3PGA1 4V0RA 4HR7A 4BQOA 1JJIA 4TKVA 1KC3A 2XMBA 3U7JA 2PX6A 4OQDA 3IPCA 3LWPC 3D8UA 1NMSA 2G67A 3ESYA 3ZWCA 4HXGA 1IONA 2ZJOA 2BT4A 1ND5A 1UBMS 3IO5A 3MGKA 4WNAA 3IE1A 5HF8A 1M0SA 1OZFA 4HAXA 1CW2B 1SUWA 4RD3A 4NMXB 4Y6RA 5DLPA 3GLFE 5FF9A 1JSZA 3QENA 4JLDA 3QFHA 2JGIA 1LKZA 5BW6B 2J46A 5SY9A 1JBQA 3R76A 3STHA 4YP1A 2W98A 3F97A 3LOQA 1ZSYA 2B99A 2GETA 2UUPA 3Q2OA 1YXMA 3Q11A 4KIGA 5TGDA 2C0QA 4DCPA 1I9CA 1EUYA 4XXHA 3VC1A 1SG6A 2ZUFA 4CEIA 4KRXA 5BSFA 1K4YA 4LI3X 3ADOA 5AKXA 5JO0A 2A5FA 4DMGA 2J5QA 4EEKA 1X8JA 1SPBS 5ES3A 1MG0A 5ABPA 3GJ7A 1X7XA 2CVZA 3KD2A 4O6VA 1GL6A 1JWBB 1Z4OA 3AKDA 4G5YA 3R23A 4AMBA 1POXA 3ND7A 4DR4B 4I9HA 1ZZGA 4XD7A 4KGVA 4LS3A 1C3LA 2QT9A 3K15A 2JCBA 5A1JA 1QRTA 4FMDF 4YRCA 3ML1A 2IEGA 4TYNA 3CH5A 2HU5A 5FOSA 3TCXB 3EB9A 1HPLA 1WXGA 1CY2A 3L49A 4YN3A 1RAAA 2VAMA 2GK7A 3ONFA 3OU7A 4GZLA 3WADA 3X1DA 3CXRA 3DHYA 4WT7A 3UXMA 1PNTA 1TLFA 1EEHA 1Z74A 2SHKA 4MR8B 3DUFB 4ZICA 4MYHA 3D3WB 1Z16A 5KYYA 3K7EA 4CMBA 2NU8B 3H05A 3KDSE 3TQOA 1VJDA 1DKPA 1R8XA 2J6HA 4DOMA 3CSUA 1HE3A 3KJHA 3OBYA 3GVPA 4FNOA 2QDXA 4KXXA 3WLMA 1ZHFA 3D8RA 3OE7D 1LQ2A 2ZRGA 3LT1A 3GPIA 3WWYA 4AECA 2R1ZA 4RJ2A 5IAAA 5LN1A 1S2NA 2ZJYA 3VR6A 5E9JA 1BVRA 1H05A 4DQXA 5F9FA 2VP3A 5JYDA 2G1AA 1H0RA 2ZPUA 1QJ4A 5JAIA 1OBFO 1YRLA 1DX4A 3Q88A 2IV2X 1T26A 4HPXB 1XNQB 2VATA 4EB6B 1QIIA 4O4IF 3BIFA 4QJBA 4IMIB 4BTVA 9GPBA 3L8FA 2JIZD 2P35A 3ADPA 5DW0A 3DLAA 3OUUA 3QBEA 1MB3A 4P1ZA 1SUSA 1Z0KA 4RYDA 1H0SA 2KWIA 3F4BA 3OJXA 1N6NA 3X1ZA 4EQZA 2GJ9A 1DEOA 4OL0A 4BMDA 1YA6A 3OZFA 1JEQB 1A1SA 3B2QA 4J0HA 1L7OA 1D2RA 1X3LA 4EATA 4TLBA 4RVCA 4W8OA 1NQVA 4EEXA 3FLMA 3WJRA 1Y9DA 3K05A 3V8EA 1NNEA 3F73A 2V4UA 4JUIA 1XC7A 2FWJA 1N0UA 2YNMA 4LC1A 3O8OA 4LXQA 4RGVA 4DIUA 3TTYA 1M8JA 1M6VA 2QUIA 3GLIE 3CLUD 2OBNA 5DHFA 3G7SA 2YIDA 1ULHA 5HY1A 1W47A 1RYMA 3M8KA 4EG7A 1MRSA 3OPYI 3DKRA 1G8PA 3L7YA 3R6DA 1CLEA 3EPPA 2QS9A 4LYDA 1E7MA 1G9XA 4WOKA 2XF8A 3T4UA 2AN5A 2QP3A 4Y0NA 1QXSA 1LLQA 2JW5A 2I7DA 5TARA 4KSYA 4KBGA 5D00A 3RA6A 5K45A 4MV0A 3IOEA 2BJWA 3QA3E 1QU3A 1RXUA 4RKFA 3U3KA 4LPSA 5FUXA 4V03A 1DO0A 3PE3A 1RBMA 4MARA 5JBQA 4MV4A 1YNOA 2I5PO 1XWFA 1CRWG 1UBHS 2DQYA 2JFZA 1YONA 2E85A 3FJOA 2LXNA 3T3MB 3AF0A 4NAVA 4H27A 2CEAA 1NSYA 1T8TA 4P3NA 4L5YA 4EX7A 2HWYA 3LKDA 1XXHA 4EA7A 2D2IA 4GWKA 5CM9C 3R3VA 3GJ0A 2VPTA 3U7QA 1U3FA 3BX1A 4YJGB 4CKWA 3PJDA 4KO4S 1XDWA 2F43B 3WWZA 5I7UA 1NMYA 5KU7A 3U3JA 3NAZA 1W19A 3EWSA 3D54D 3WYBA 2JD1A 4B8YA 4XX1A 2XXAA 2QR2A 2SKCA 2VZ9A 4M22A 1R12A 5DTJA 1K9VF 5C46F 1TD1A 3B1FA 3IMCA 2IZ1A 3VH2A 1A8PA 4KXFB 4YRAA 3AJDA 3A32A 1KIAA 2NTYC 3NK6A 3F5FA 5K3AA 4F11A 4Z1OA 1L8OA 1KYXA 1M1YE 3AUJB 2HW8A 3EVCA 5FJ4C 1KY2A 4XE5A 3K8QA 5L51A 3BUSA 1U0TA 5DN6A 2ZJ6A 4JZYA 4NDNE 4A8JC 4E3WA 2OTLF 3K16A 2WWHA 3EZ2A 4P82A 3UJCA 4JSYA 3LWNA 4Y2PA 5EJ6A 1ZMOA 5KQSA 2FA9A 3EZXA 4X1OA 1JHOA 3NPMA 3O1LA 1PUJA 3P2EA 5AVYA 2WQ7A 4P98A 4HNUA 3NNNA 1P0CA 1L7AA 3RT7A 5AK6A 4K5QA 1KBQA 3AB8A 5BP7A 1U0OC 1YBHA 1YFLA 3WNCA 4OY3A 5FBVB 1F2VA 1GCIA 3MJ4A 5A2QA 3HN7A 2Q6VA 3KPVA 4G5HA 3W2HA 4F4UA 3AY0A 2O5EA 2E5LB 4QUAA 4RTMA 2JVIA 2AMVA 2G04A 4YNBA 4ZJUA 1QGUA 1XD9A 3BQNB 1B0AA 3OT4A 1SOVA 3ORSA 2PH5A 5KYKA 4WEOA 1I3OA 3EUFA 1D1SA 4NJMB 4B45A 5DGHA 4PTLA 2ZVZA 2CZGA 3QIAA 4MRMA 1JJFA 1VXOA 5F73A 1S3IA 2O5RA 1F20A 1V1MB 2P65A 3GDHA 3QJGA 1C2YA 5KREA 2FE4A 3PEFA 3WDMA 2AC7A 3RHFA 1S5PA 2YFYA 1H3FA 1PF7E 3IAM6 3FDFA 2QUBA 2FGKA 3DCIA 4ZFNA 4DR2B 1M7GA 4TS9A 1IB0A 3ROMA 1VIAA 1IQ0A 3R5HA 4E4TA 1GPJA 3TKYA 3LO8A 3RRJA 4JFAA 4DR3B 1XBTA 5KS2A 4M0MA 4W1SA 4LHWA 4A8PA 4DZRA 4BATA 3N8KA 1G5PA 2Q2OA 3R0QA 4HH3C 4MWOA 2DUWA 3STVA 2VC2B 2OORC 1EX1A 3G0IA 1RYBA 1ARZA 4UJ3A 1SOMA 1YDEA 3CG4A 1PTKA 2GJ8A 5SZJA 4BZPA 3FOZA 4NFSA 2HHLA 3QE9Y 1Y6RA 3LBNA 3AWIA 4AYXA 4ESOA 2F3RA 1ONBA 3PF9A 5H83A 3FMVA 2NYAA 4IV8A 3CY6A 1NNLA 4EG6A 3QXXA 3GPBA 1IXZA 5JT1A 1TYDE 2XNSA 1XK7A 2XRZA 1PUIA 2X2PA 3F3KA 2QA4F 4DSZA 4D8WA 5FRDA 2IYZA 3VR2A 3ZGYA 2P2SA 4Z0HO 1YJCA 2FEPA 1SVKA 4BBJA 3VOAA 2Q62A 3E1GA 2QJWA 1NFFA 1OXKB 4YY3B 4NPCA 4UDYX 5F52A 1X94A 3KJZA 2PE5A 3I6ZA 3MMNA 3OQ1A 3RYIB 1L5NA 3V2IA 3VCZA 1K8RA 1GAJA 1SXJB 3VDNB 1FMLA 1OUMA 4MKRA 2EKDA 1CULC 1SZCA 1X80B 1N2CE 5LYYA 2O3JA 4Q1FA 1M74A 2R8RA 5FFMA 1PR6A 2EAUA 3A6DA 4FT4A 4RIEA 1K7EB 3IEVA 4DY4A 1SEVA 3B53X 3KR1A 4OM7A 1R74A 1WF6A 3T3EA 4WI1A 3PLRA 1P81A 3V8VA 1AUVA 1NC3A 1CQIA 1TD9A 3SC4A 2CYCA 1Z26A 3ANMA 5K8VA 1UINA 3EUAA 5C8YB 2DBRA 2B7CA 3L8ZA 3LUJA 2AN3A 4WFJA 4C4AA 4Y8VA 3P9ZA 2OL4A 5SY6A 1REQA 3GJYA 2BFNA 3IALA 2DTEA 2PX2A 3ZJ4A 2ZIFA 3OIGA 1GPUA 3NAQA 5B1HA 3QBDA 4H7KA 2VGNA 2HB6A 3C48A 2IQQA 1X7GA 1YVUA 2WTBA 3NB0A 4BVFA 4LMRA 1WVGA 4RVOA 1PUXA 4HT3B 2RAFA 5E38A 2PWPA 1ELOA 1JR3A 1Z35A 1M2GA 2DKOA 2EF0A 1TAQA 2JZCA 2QRPA 2UYGA 3D6VA 4DLUA 4FMDB 4I9NA 2GSDA 1ENPA 4U63A 5JANA 2X14A 2OPHA 3O92A 4XQEA 4MGYR 3TZEA 3R4VA 4MTCA 3IBSA 1ESNA 1DTEA 2OG2A 3B6EA 1FX0A 1VHDA 1E60A 4ZI5A 1ZNYA 4DUGA 4CNBA 4Z3DA 1TGVA 2B7BA 3R1IA 3F7MA 4A73A 3UMVA 3CPJB 3PXCX 2QI2A 4FMCF 4IP0A 3RIEA 1XRSB 4DRZA 1BZYA 4DMLA 5IHXA 3HXPA 4S3MA 2ZAIA 2IS1A 4AKIA 4GPZA 1LV7A 1X87A 2II6A 3CR3C 5JE8A 1L1FA 4I4TA 1J2TA 2NO5A 4EL5A 3VA7A 1RTKA 2N75A 4JEUA 1UDRA 4G01B 5DVZA 5K3FB 5ICCA 3JD4A 1FBNA 2D5IA 1NUHA 1T36A 2AJCA 2NPIA 1PNVA 1FFAA 4KNWA 4BO4A 3U6BA 4FIDA 4RUKA 4L28A 3KZNA 1M34B 4D4KA 3TXYA 1GLNA 4Q9NA 2IP1A 3TIIA 3WLIA 4MUYA 4D3DA 4UW9A 1WB9A 1HO3A 5LXTA 1W25A 1ZOPA 3MCQA 1NRWA 1VRCA 4PVDA 3VR6H 3C7KA 2PT6A 1MH1A 1IPHA 2OBBA 4OHZA 2ZM6B 4B4WA 2QPTA 1T15A 4OP3A 4QGHA 2Z95A 4QIHA 5E7QA 1G20E 5DNWA 4LCEA 3K6SA 3NHJA 5JS1A 1JSCA 2FXIA 1XL1A 3MTIA 4G4IA 5BV7A 5SICE 3VYVA 3PA6A 3MGCA 1E7WA 3EZGA 4JEMA 1KVQA 4FZ5A 2CFCA 1I4OA 2YJTD 3QNWA 4NABA 4TS4A 2JGMA 5I9SA 1TLLA 1TU0A 2GJKA 4JAVC 2XXBA 4JL8A 4XB6B 3BTVA 3ESJA 1YT5A 2SKEA 3S7ZA 2F43A 3RIMA 1NJ5A 4N5LA 4IIHA 4QASA 3CZCA 1YH3A 2C2HA 4ENVA 4BO8A 3ZV5A 3VVLA 1V1RA 5K9ZA 1Q92A 2P79A 4F6RA 4ALNA 4OHKA 1XNGA 3B1KA 1DWUA 3PVCA 4NKRA 5FPQA 3O8RA 4ARUA 1M7BA 2PEZA 3MT8A 4LFBB 4CMGA 4UMVA 4ZYXA 4DV7B 1T2UA 2Y4OA 2ARKA 3QWHA 5EWLA 3RFFA 3EYAA 3R5TA 1QFYA 3EUWA 1CJSA 3WPXA 3LVQE 3QEOA 4G4SO 2BRUA 4C82A 3E9MA 3W9YA 4A2WA 2C57A 5TQ2B 5B4VA 3MA0A 1UFRA 2ORIA 2WYOA 4G5FA 2J31A 2PIDA 3WVNA 3K0CA 3UH1A 1PXWA 3EA4A 1K2WA 1BOFA 4O08A 3R3SA 4YV1A 3DMYA 1R8SA 4KOAA 3FJ1A 3VR4A 3ZBTA 1U7ZA 4R0MA 1Z4LA 2YWBA 3H7IA 3ILXA 1SIWA 3Q6NA 4J1SA 3TAHA 3GDWA 2Q1SA 5AKIA 5AW2A 4D9NA 2QTPA 4L8LA 3ON5A 4QJ4A 1C1YA 3CCEF 3W5SA 5CVDA 4M1YA 3O94A 2KSQA 1YZHA 3TM5A 2EFHB 2W9XA 4M53A 1RW4A 1W4CA 2Z01A 1A5ZA 3C3PA 4IWNA 3F1KA 2ZYUX 2RGDA 1QVFF 4HQNA 3WJ7A 4W1PA 4DLAA 2POQX 4Q05A 3COJA 4BT4A 2O2IA 1L1QA 2J0SA 3LZCA 4OHOA 1F12A 4FGKA 4X6XA 5AKHA 2Q4BA 4H7IA 4YBRA 3I9MA 4O4HA 1US8B 1O5IA 2ONCA 5HMLA 4XJTA 1R8JA 3INYA 2H1HA 2YMLA 2PRKA 2VTVA 2NO7A 3TK1A 1DX6A 2DTDA 5JPDA 4TTRA 1FVFA 3V6MA 2O8DA 1R3UA 1GGMA 3SZMA 4EY5A 4KFUA 3HWRA 4KVAA 3UAOA 2AB0A 1PR1A 3DE5X 1OH5A 2X6RA 5J4HA 2HP0A 4JKIA 5JCOA 4PXSA 3T6KA 2O7RA 3GFQA 5BVHB 3EG5A 1THTA 2GCIA 3Q85A 4YAOA 3GZNB 2P41A 4F1KA 3T35A 4FZ3A 1RJEA 2J3HA 3CJTA 2QN3A 5CTAA 4ZMBA 5ITWA 3EXIB 4JUAA 3MPOA 3V00A 1KMHB 3TRDA 3ZCRA 3NHPA 3GC6A 4BLSA 4LZOA 3QI2A 2O52A 1EUDB 4CIXA 4UOEA 3OJ0A 1ENOA 1LTHR 1QVWA 2BC9A 3FHLA 4KREA 3RJMA 3LLSA 5K5EA 2Y92A 3RVSA 1A8HA 1ZNXA 1W4BA 3G82C 5GIOE 4I81A 5BOVA 3GLTA 3E5RA 3BYQA 3N39C 4CQLA 1L7RA 3FHTA 3UXHA 2FFAA 4A5SA 4MQ6A 3H1GA 4WX2B 4G5SA 1Y4ZA 4LCKA 1A7KA 2VLIA 3EW7A 2QX6A 5K1ZA 1R6UA 5JAMA 2RG7A 3KLNA 1BKDR 5ECYA 3Q8KA 1U63A 2BSXA 2WAAA 3SZLA 3H19A 4LNUA 1P8JA 3Q2KA 4KPFC 5LQRA 1Z5WA 1JMYA 4RV5A 4AI6A 3HEMA 4E4YA 3T9AA 1RMYA 3F90A 3BIWA 5JPCA 4CFZA 3TGLA 2KG4A 1FRZA 4DIDA 4MW9A 1QDLB 5FOUA 1SXJA 4IXNA 3LTNC 3DFKA 2C2ZA 6GPBA 3QYFA 4I4IA 5H7XA 1X80A 1QE0A 1XRLA 2IZOA 4UZSA 4DCTA 3V97A 1WV1A 1QH1B 1XZPA 1QOQB 2RHRA 4MRRA 4QICA 4YK7A 2R96A 4C4ZA 4A36A 1P2FA 2X23A 5KAMA 1IK4A 4K1XA 4M76B 1TUEA 3LCVB 4MGEA 3IEMA 1WDMA 4ER0A 3MQ2A 1QQAA 3JQDA 4JI8B 2OM6A 5TS2A 3T4EA 5C8YA 1IN8A 3VPHA 3N8NA 3QFFA 4B6FA 2VDNB 4EY7A 4M55A 4U00A 1MNQA 3KJNA 1NM5A 1T4GA 4TTAA 3WLOA 4WOCA 3CVUA 2WHXA 1PK7A 2W90A 3DKIA 3FGOA 4JUBA 4M1MA 1KKLA 4WZBB 2JASA 2QVZX 3KSZO 3VR5A 5BUCA 3HKDA 2AJBA 1XCLA 3O4GA 3TZHA 4CR6A 5A5EA 3HB7A 2ZTVA 3BMOA 4IMRA 3WKDA 4Z51A 1WY5A 3WFIA 3LC2O 1P9NA 4HJXA 2XWPA 3KUUA 2V7QA 1K86A 1XRJA 2GHQA 3H65A 2FQQA 2JGKA 1X38A 3CF4A 3DGEC 3ELUA 1EFPA 3OJEA 4ZQEA 3GQVA 4PSAA 2C88A 3PEVA 1W36B 4HB3A 1SIUA 3L1KA 1XF9A 1JXOA 5KTPA 4W5WA 3TLBA 3HB4X 3ZTTA 4BLTA 3DW3X 4CCWA 1ZJJA 2YKGA 5I47A 5HJEA 1C1DA 1C50A 3LRPA 1P6XA 2XAUA 3PXDA 3FDZA 2GM5A 2HU8A 2O3QA 2LDXA 4GKAA 2OV2A 1SCQA 4YAUA 4U7GA 3F3MA 3AJAA 4S05A 3KQOA 1JB9A 3DG9A 3MINB 2ZUWA 4RMJA 5K3FA 4C4TA 3NAMA 1OTYA 2JCXA 4IS2A 4RZ2A 2XQFA 4BU1A 4BUCA 1T4DA 1A2OA 1KK3A 1Q0ZA 3MBKA 3KAPA 4RM3A 1XEFA 3IT1A 4B6QA 2J3QA 5JS6A 4LV8B 1RWPA 5BWCA 1XXHE 2RIRA 2HU7A 2JAHA 3KR0A 1WTCA 4UATA 1YOBA 2P8JA 3JQEA 3SN6A 1ETUA 4J0EA 3A7EA 1G21B 2XRMA 5HGJA 4LRTB 3LV8A 3EXAA 5KWEA 1A7AA 1VMKA 4YT5A 3V34A 1HDXA 4PYLA 1Q81H 5EB1B 2HQRA 3PCXA 3DYBA 1B7GO 1BYIA 4AF6A 2PXAA 4RIGA 1AUOA 1ESCA 4PV7A 3G9QA 4PZZA 3L8DA 2GO7A 4GX2A 4KODA 5K2MA 3MJTA 3MM4A 1G4AE 4XVCA 3JATA 5IFKA 4BRZA 2QD3A 1O1YA 3SYNA 3VZCA 3ZWPA 4ZAYA 2PH3A 1SVLA 1NA5A 1K8ZB 5C7OO 4R8MA 3FOAA 2VPQA 1GPLA 1T5OA 4G0ZA 1E77A 4MI9A 1K8AH 1KAOA 1UQUA 3HADA 4OFBA 4XLLA 5BSWA 2EQAA 2HAEA 4FMCB 5KTRA 3LX6A 1WMSA 1YNSA 3IPYA 5JTUA 1Z5PA 4DR1B 4P84A 1D1QA 2Z0MA 1FRQA 1N2ZA 3FTNA 4H18A 4O2AA 4Q9LA 1W5EA 3N3BC 1JHAA 5D01A 4IHJA 2WJHA 1AVTA 1BXGB 3O9ZA 3COWA 4MPPA 4Q6WA 1DOAA 1ZJ6A 5BYJA 3Q8WA 1P7ZA 4H3HB 5HJ2A 2Q41A 3T7AA 2ZATA 3VTIC 1IZ0A 1PZXA 4XJVA 1YZVA 5JR3A 1OPRA 4HX5A 4RMNA 4KRYA 2IUYA 5CITA 3O4HA 5ALWA 1EZZA 4ENWA 3BZUA 1R4NB 4OEHA 3CUUA 1GZ4A 5IK2D 1EP2B 2ZTLA 1S4MA 2B5WA 3I45A 3QVKA 1N2SA 4D9IA 5LD2B 4K6MA 4CMEA 5FYDA 4PBSA 2PKWA 4JROA 2I3BA 4JJFA 4V0NA 3LDUA 3TIGA 5FJIA 4MX8A 1OXXK 2V45A 4RDHA 4TWRA 4WCFB 1U9YA 5TXGA 4QT4A 4GI1A 1MEEA 1FXWF 1Z17A 3L7MA 1PQPA 4H1HA 4E5MA 2DBQA 3PIDA 4YVFA 7REQB 2GXAA 1GFSA 1DKMA 3H7AA 3KV3O 3QY0A 2INGX 4RVGA 4B44A 4UCFA 4L51A 2CNOA 2DY0A 4XCXA 5KDLA 4EHNA 4ID3A 3OIFA 1YKGA 2V5VA 1G8HA 4TWJA 4UM7A 4EHFA 4LQLA 3RVMA 5K6RA 3CH4B 2M2IA 4HB4A 2G4VA 5KINB 4XWWA 4MS4B 1EDZA 2CK3A 4XTRA 1G41A 1ZRSA 10MHA 2ZF8A 1IM8A 2GLUA 1BQEA 5H5JA 1OBCA 4NCXA 4CM4A 1ULTA 2HD4A 3HA5A 4MUIA 1FDOA 4P4LA 4AG3A 4BQNA 1BG6A 3S2YA 1O6GA 1UPCA 3I5MA 1T5SA 1N6IA 4FFMA 3SS7X 1VHAA 1UP4A 2Z8YA 2GYUA 2Q9UA 4RMGA 4I5FA 4XDYA 2V98A 2PWYA 5B6JA 4C4RA 2FQ1A 3OUZA 1PTJA 3RDPA 3GELA 2WUVA 5LOVF 3Q2IA 1Y9ZA 4IICA 2V65A 4R1MA 4YMWA 2YWDA 3IVGA 3TFWA 4F71A 3GFFA 4WDQA 1OWLA 5HM8A 3C6KA 3KFXA 2ZPTX 4LJLA 2J0QA 1SUFA 2WHQA 4C04A 4DCUA 5KCZA 5HRUA 4L5AA 2BIFA 5CFQA 3OZWA 1XLTA 1TF2A 1B6RA 3VMMA 3NIWA 1OAKA 1YJAA 1DAHA 3W2TA 2PMWB 3EZ7A 1D3AA 3R8CA 1A7JA 2OHJA 3T5CA 2GF9A 4MYSA 4NZ9A 1DKLA 2YJ5A 3F4KA 3KB1A 2GEJA 1HI9A 4RIHA 3I2HA 3I61A 2JGAA 4HUQA 1ZIYA 2FZVA 4FBMA 3W6UA 4DW8A 4YMUA 1Z2DA 4TRJA 2ECFA 1GQQA 3NP7A 5JSHA 3MJFA 1O6ZA 4F8YA 3DC7A 2CNDA 4BO3A 3IA2A 3S2GA 1EX7A 5EIBC 4P4GA 1XMOB 3FGNA 2I4RA 4O8CA 5JQGA 2UZAA 3C6MA 2EW1A 2QVYX 2GZ2A 2VWGA 4RIFA 1JQBA 5DI3B 3PGJA 5LZ8A 4ARZB 3ROTA 1GIAA 2OV4A 1NQXA 3UHPA 4UBLA 4O1HA 1NX9A 2GLZA 4JI3B 4L08A 4WSOA 4BMXA 1NE7A 2YR0A 3HDHA 1CEQA 1YI2F 1LH0A 4MVJI 5BXYA 5AW1A 2JI4A 1R5JA 1ZMBA 2OMKA 3SQNA 4P5EA 1JR3E 5E95A 3NUGA 1Q1NA 4PTZA 3WRVA 3THYA 1KEZA 3V5NA 1HQDA 3HCBA 1MGOA 3MQFA 4LJYA 5FLXA 5I3ZA 4MW4A 3R41A 2F4VB 3C41J 3WGLA 3CX3A 3HDQA 2DWPA 1SOUA 1RRMA 3FN4A 1KSFX 1NN1A 2CY0A 2NQ8A 2YUIA 3H5NA 4R6XA 3ZC3A 1WTAA 3BCRA 4IYJA 1AO0A 1PHRA 2GAFA 1T1EA 4DQKA 4YV0A 4F8JA 1E7KA 2XZPA 1BCRB 4OH7A 4TVOA 1A9TA 1OYOA 2MYNA 5HY0A 1JLKA 5ARCA 4HP8A 1MABB 2PZBA 3RJTA 1W3EX 3K71B 5DNAA 3DF9A 1FNKA 1L5ZA 2LR0A 1BE1A 1YWGO 2DFTA 2OCAA 2WSBA 4J1TA 2B8WA 4KI0A 2HK7A 4KO2S 1KDTA 4FDVA 4UFNA 1X7YA 3UJ6A 4JBHA 1Y89A 4YWHA 5DSZA 1KORA 1ADJA 1KP3A 3FNFA 3KB8A 4QULA 1E0AA 1NJ1A 4P6VF 4MP3A 4WZAA 3WGKA 2DT5A 1II8A 1QRAA 2VPIA 2W5UA 1CQPA 4DLKA 1WW8A 4GU5A 2CFIA 4ZOLA 2ZS7A 1NONA 3K0AB 3OKPA 1UM8A 5F1OA 3VU3A 1EVIA 2H16A 2AQIA 2FWMX 4JVSB 1MIOB 2ZVPX 3FNQA 3SOZA 4EY6A 1Q50A 1HE4A 4UUBA 3UIEA 3AM5A 1Z33A 4UAVA 1DEHA 1GAWA 1MC5A 2PGXA 4B85A 5CDTA 2CL5A 4C6TA 3WMXA 2DFNA 3HB0A 3C7DB 3KDPA 1VI2A 1YBAA 4NENB 4QEKA 3S27A 5AVZA 3HYRA 5HS4A 3C15C 3LT0A 3RHSA 1WDWB 1SHLA 2FPSA 3X1YA 4BVLA 2B1JA 4DGQA 3KKNA 4X20A 3DMHA 2B69A 1AKTA 1OFHA 2XMDA 3AJ9A 3M2PA 3KQTA 2JPDA 2RGEA 2GVNA 2C3OA 2JK1A 2I6QA 3CPHA 3H97A 4GAEA 4PEVA 4RTLA 4P0QB 1TO6A 4F2HA 5BR8B 1XD8A 3O0TA 3PGLA 2QY9A 4AJOA 1M2EA 2AUMA 1THMA 5H4HA 1C5KA 1E0JA 1UKAA 3MJRA 3AVVA 2FPUA 3P9KA 1KF0A 2WJ4A 4NAHA 3KALA 4AJ1A 1T8RA 1QPZA 3BULA 2RKBA 4NBRA 4NS1A 4F56A 1W6RA 2NQTA 3KAQA 4N0QA 4I55A 5SZIA 1J1IA 1J8DA 4IV0A 4A5OA 5CEEA 4HZIA 3H9JA 2F1IA 3O73A 3UT6A 1Q22A 4RQBA 1N6HA 3RSCA 4RD6A 3NBZC 2I29A 2Q8PA 2V5AA 1XAGA 3NCTA 2H1SA 4G84A 5DRYA 3SJZA 2VEDA 4PLFA 1KR5A 3LUBA 1B73A 3SIXA 1PZFA 3QKSA 4TYWA 1XV2A 4XQGA 3BVPA 4WXPA 2G25A 3IUBA 2GPAA 3IH5A 5GV8A 4XB2A 4D4MA 1NVWQ 4PQGA 1H4QA 1A8IA 4IWYA 2GD1O 4F91B 4KE6A 1ZK2A 3FZEA 2Q5CA 3PK0A 4MQEA 1ZJ5A 2AN4A 3KEFA 5F2KA 4ZTUB 1YE8A 2HL6A 1U0LA 3L6UA 1QIEA 2VP9A 1MHPA 4K6OA 3WLQA 4LSMA 3AK4A 1ZK1A 2R11A 5F9MA 3VR0A 1XD2A 3QYPA 3DEKA 1P3JA 5HDBB 4CTNA 1QVVA 2F9LA 4RD4A 5IDXA 4LBVA 4LC0A 1QQ7A 1SH7A 2PPLA 1FRNA 2HYDA 4FXOA 3WWEA 4ZDJA 1ETHA 1W85B 3AU8A 3BQ9A 3KS9A 1DXHA 3KO8A 1RWXA 3OEED 5E6UA 2WQZA 4DC0A 2QEQA 1QMPA 1XCBA 2UVPB 2P4QA 3UT5A 1FLAA 1ADFA 2AT1A 5P21A 4D02A 3B6NA 3WAGA 1GA6A 5H9VA 3D4LA 3AUSA 2GASA 1KIFA 1JAXA 4LHYA 5IC5A 2VYVD