3WGLA

Staphylococcus aureus ftsz t7 mutant substituted for gan bound with gdp, deltat7gan-gdp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
303
structure length
303
Chain Sequence
LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGANLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural change in FtsZ Induced by intermolecular interactions between bound GTP and the T7 loop
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
molecule keywords Cell division protein FtsZ
total genus 90
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3wglA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3wglA01
4ZOLA 4HNAB 5EIBC 5JQGA 5BMVA 4M8IA 3VOBA 4X1YA 5IYZB 5J2TA 2GVIA 4O2AA 5MN4A 5LA6A 4O4LB 4YJ3A 3HKDB 4YJ2B 4DRXA 5FNVB 2VXYA 5JVDA 1SA0A 4O4IB 3ZBQA 2Q1XA 5IJ0B 2Q1YA 5KMGB 3RYIA 1OFUA 5EYPA 1TUBA 4I4TA 3WGKA 3N2GB 4I50B 1W5EA 4X20B 3JARB 3C8LA 4LNUB 4TV8A 1Z5VA 4XCQA 5GONB 5CA0B 3JAWA 4IHJB 1W59A 4EI9A 4ZHQA 4ZOLB 1TVKB 4HNAA 4O2BA 4U39A 3UT5A 4EB6A 5JQGB 5BMVB 4DXDA 5JCOC 1JFFA 5LP6A 1W5BA 1FFXA 3HKEA 4TUYB 5CA1B 4O2AB 3WGNA 5LA6B 4KWEA 5KX5B 3HKDA 4YJ2A 2RHOA 1RLUA 5FNVA 1W5FA 3JALB 5J2UB 5CB4B 1SA0B 3JASB 4O4IA 4IIJB 3HKCA 3VOAA 5ITZA 2VAMA 5KMGA 1RQ2A 3RYIB 3WGMA 5EYPB 4X1KA 3WGJA 3E22A 3N2GA 4I50A 4X20A 1RQ7A 3CB2A 3JARA 2BTQB 4WBNB 4LNUA 2XKAA 4X1IB 4ZHQB 5LYJA 1TVKA 4O2BB 3RYCA 3UT5B 4EB6B 4TV9B 1JFFB 3N2KB 5LP6B 3RYFA 5M7EA 1FFXB 2R6R1 2RHHA 3JATB 3HKEB 5JH7B 4E6EA 4TUYA 3M89A 5LP6C 5CA1A 5C8YA 5JCOA 5KX5A 2VAPA 3JALA 5J2UA 4EI7A 5CB4A 4I55A 4ZI7A 4B45A 3JASA 1W5AA 5LXTA 3JAKB 4IIJA 3HKCB 3V3TA 5ITZB 4O4JB 3RYHA 3WGLA 4U3JB 4X1KB 3E22B 4F6RB 5LOVA 2RHLA 1Z5WA 4WBNA 2BTQA 3R4VA 4X1IA 2BTOA 4FFBA 3M8KA 3HKBA 5JVDB 4O4HA 5C8YB 5EZYB 5IJ9B 5IJ0A 5LYJB 2R751 3RYCB 4TV9A 1W581 3N2KA 3RYFB 3JATA 3VPAA 5JH7A 4X1YB 5IYZA 5MN5A 5J2TB 4O4LA 4YJ3B 1FSZA 4DRXB 3RB8A 3VO8A 4EI8A 4I55B 4ZI7B 5LXTB 3JAKA 2VAWA 4O4JA 3RYHB 3ZIDA 5MN6A 4U3JA 1TUBB 4I4TB 4F6RA 5LOVB 2RHJA 3ZBPA 4TV8B 5GONA 4FFBB 5EIBD 5CA0A 3HKBB 4B46A 3JAWB 4IHJA 4O4HB 2XKBA 3VO9A 5EZYA 5IJ9A
chains in the Genus database with same CATH superfamily
2H5JA 3AGKA 5H80A 4JASB 1T0UA 4UEKA 3HN2A 2I6SA 1J70A 4MDYA 4AWXA 1KO1A 3UOGA 2A5GA 4HD8A 4JT9A 2A0KA 2EJCA 4FLEA 4CL2A 5BR7A 1HT0A 4HDKA 4MIYA 2Y6VA 3DL0A 3SDZA 2NQ2C 3NNDA 3H86A 1NBAA 3EGVA 1T6ZA 1UH5A 3GVXA 1OY1A 2IIVA 4PV7A 5KQMA 1CT9A 4RVGA 4X61A 1BEUB 1YL5A 2P0EA 3P9YA 3OC0A 1U81A 3B5IA 5K20A 3T4PA 3UHJA 2HK6A 4CFZA 5P8WA 1RXEA 1R0LA 2XMGA 1TZCA 3AX6A 5KNCA 1XMSA 4B6QA 2I29A 3ODPA 2HRBA 3U1BA 2H2DA 4DR3B 4G23A 5AW0A 3FZQA 2DYYA 3QEKA 3P2IA 3PGVA 4CKEB 1E2NA 1JKIA 3QA9A 5E2AA 4AG3A 1H1LB 2P35A 4O2AB 3WXMB 1DBQA 3IBFA 4UCXA 4DV2B 4I1RA 4UEJA 4RHTA 4RVHA 3BORA 4HZGA 5K0NA 1CQJB 3R7LA 3VXKA 1S7CA 5SYMA 3AWIA 2XH8A 1OX4A 2YINC 1P1BA 1ZY2A 4F56A 3N6VA 3B85A 1RQ2A 1TECE 1Z8HA 3ZGLA 2HU5A 1E2JA 1AZSC 2QQ0A 2REOA 3L84A 5GJCA 1X80B 4TLCA 1GG8A 2Q3LA 2O3TA 2B1JA 4P83A 1SUWA 4B3DA 3MSXA 5JWHA 3OEWA 2BLNA 2HVYD 5JZ9A 5KTOA 3I8XA 3HVRA 4JP8A 2H57A 1I8TA 2Z95A 4ERHA 5AW6A 3TR5A 4TV9B 3CVWA 4C1NA 1IUPA 1GG9A 2P0AA 1JN0A 2DRIA 2Y9MB 3AP3A 3C1OA 3D9QX 4ZEXA 1ECLA 4DYDA 4YV2A 3W5AA 5FKJA 1JIQA 3PFHA 4OQ4A 4RBNA 4C81A 3U0OA 2GXQA 2QWXA 3ITNA 3NONA 2H4FA 3AB3A 4MNTA 1FLVA 3N07A 1SIBE 2BEUB 3U49A 1ZC3A 3HWSA 1ZSNA 3HM2A 4XQCA 2PUEA 4MP6A 5C52B 3D3QA 1VCNA 1ZMOA 1KL7A 3GLFA 3L4KA 3NHFA 1AQYA 2OCKA 1UJ5A 1YQUA 4D81A 3EK2A 2OBFA 3H11B 1IBCA 2MSWA 2ACEA 3B13B 4NECA 5EVCA 3K71B 2ZOVA 1E5QA 3EXIB 2GTIA 1KBQA 4TZ6A 4ZDJA 5JVDB 3DYBA 4H31A 2XGGA 1VRWA 3SYTA 1OZ0A 4ERXA 1RP7A 3WJ7A 3WR5A 1YBAA 4X95A 1H2YA 1RKBA 2JCYA 1JZTA 1PQYA 4BDTA 1QRAA 1XBIA 2O3RA 3GRRA 3NHBA 3QVGA 3R0IA 1SHZA 1P6UA 3A26A 4Y0VA 5IVDA 4G85A 2GASA 2W6NA 3PHCA 1SXQA 3IPLA 5E0OA 3DQZA 5C34B 4D8VA 2FP3A 1YS1X 2FZEA 2N75A 4BMDA 3VAZA 3PHIA 1GOTA 3JAKA 3M84A 3O3CA 4AJ2A 5KKAA 3FTQA 1DZIA 1TO6A 4KIGA 4M21A 1N3IA 1PJBA 1RDFA 2TECE 4X5OA 2UUPA 1O94C 3IHTA 5KVQA 4V38A 4TV8B 2FPIB 2ZS7A 3QG5A 5GOZA 4CQMB 1CJVC 2XGOA 1XD2A 2OFWA 2YJTD 4YTEA 2WAMA 2JJ2D 2IT1A 4HNAB 3QI2A 1T2DA 4JL5A 1DIHA 2JJ1A 4K9NA 3UT0A 5BORA 2W83A 4EW2A 3U81A 4M8IA 4HJXA 4QXOA 2Z04A 1E3EA 5CK5A 3EPLA 2YWRA 3GQBA 5EJ4A 4XLTA 1K89A 2WKWA 3ZNNA 1USUA 3T1NA 1Z0KA 4BV2A 3B5JA 3W8RA 4P7JA 4N7JA 2Q3JA 2V7BA 1LCIA 1FUYB 2B4QA 3PPYA 4YRDA 1DMRA 1D6NA 4IXNA 4KLAA 3L92A 2Y0DA 3O4HA 2FX2A 3C3WA 2CUNA 4CM1A 5IMSA 5KWEA 2ZIUB 1ES9A 1W29A 4KYIB 1RYZA 4ILEA 1O1YA 1OYYA 1P7CA 4BAZA 4N4AA 4W5RA 2XSZA 3D81A 3NRJA 4HUQB 1WMEA 2H2IA 3NKFA 3B1KA 1O96A 3OFVA 1CR6A 1KOLA 2NP6A 2OILA 3UK1A 3CCJF 1E0KA 3ZGZA 2V7WA 1G8FA 1XEXB 4JIGA 3SAJA 1V6AA 3TM4A 4C0SA 5IDYA 2GYYA 3E3NA 6AT1A 5J4LA 4O4IF 4I0WB 4KGZA 2J3QA 2I4NA 2DBQA 3ILSA 2HP0B 3K53A 1V8BA 4QQFA 4UDYX 4WCDA 2ZB3A 3LM8A 2WHEA 3VRHA 1I30A 1WOMA 3DGEC 2HRQA 2ZYGA 1OBHA 3GGSA 5T3YA 1NBMA 1ULZA 3B7PA 1N92A 4UDOA 1GGFA 4D9MA 1QHEA 5AYVA 3RIYA 3TLGB 2ECQA 2Q7DA 1ZGAA 3NXSA 3OQIA 2SKDA 2OBXA 5IVKA 1AUVA 3PEWA 1Z37A 3CPWF 3KYBA 5CTAA 2FEKA 2C61A 3EXIA 4JJ4A 4ZYVA 1DC4A 4C3UA 4RHEA 2NYVA 2F9ZC 3WSTA 3HJFA 4Q9IA 3TIFA 4E32A 2ZT7A 5JNLA 2XCSB 1EG2A 2HMAA 3FGPA 4Q4JB 5CB4F 1QFXA 1ZM2A 1P2UA 2JAOA 5A1JA 4HPWA 1E1DA 1JHAA 2OENG 3C3KA 3B82A 4H18A 3LL7A 3WNVA 1YBVA 1XZQA 2WPNA 2OQVA 3UC5A 1HM5A 4RZHA 4ZGWA 5FQNA 4DEVA 5GGXA 1U2RA 3VDQA 1TYEB 1EX1A 3GK3A 4V0RA 1X86B 1HXHA 5INTA 4MZDA 4QEKA 5T64A 1FFWA 4HLDA 3G6EF 1SG6A 4RZ2A 3VSDA 1L5OA 4N5DA 3V1TC 4EITA 4CQMA 1FP1D 1YFZA 1TIKA 1V3VA 4ZGBA 5C8YB 1A7AA 3FGZA 1U1IA 1VPVA 2IU4A 1OUMA 5BRJA 5DJ5A 1MB4A 1XL1A 2GVZC 3C3MA 2VK1A 3MILA 3I34X 4JJKA 1SB8A 4ZWNA 2JH9A 1YZGA 3MJ4A 1VQPF 5EUMA 1CRLA 3NPMA 1JFTA 4M1KA 2H3EA 2XDWA 1FMTA 3RB8A 5KYNA 3KB2A 4Y7DA 3VO8A 2P0YA 3ZK9A 1LDBA 1RYYA 1M7GA 2FW7A 4K5QA 2OCAA 4B6PA 1FVHA 3QKUA 2OC9A 2F3PA 2OL4A 1UMKA 4IF6A 2EDCA 1VKRA 3RA5A 2GKGA 2ZYUX 4NQRA 1Z8FA 5FBZA 2I33A 4MPJA 2R2GA 4KXNA 1MMFB 2P77A 3ACBA 4U7WA 3RW9A 2IYQA 3TLZA 4NKRA 3C5CA 3U4QB 4GOOD 1EESA 1TPYA 5B3KA 3F0EA 1D04A 2JL1A 2PA3A 3UPDA 2E4ZA 1G18A 4R5MA 3Q3GE 4TQ9A 4GMFA 4A8JB 5DZSA 5HQTA 1DUIA 3I4CA 4QICA 1U99A 1NUHA 4RY9A 4D9GA 1EVLA 1QO7A 1ZN2A 1GO1A 3V7UA 4XX0B 1UPXA 1XZCA 4ZQGA 1QBGA 2RHBA 3UFXA 4DBVO 2A1IA 2FW0A 2RGWA 4DN6A 4FIZA 3BXGA 5CHYA 1FNNA 4J94A 1P1IA 4A6EA 5CBPA 5JCXA 4JN6B 3A28A 4NH0A 5CMLA 1DX4A 2WB4A 3FNEA 3IKMB 3CJRA 5LQMA 1TCVA 2YWEA 1U2ZA 4FCVA 4Q7LA 3P9XA 1B6TA 4LXYA 3KKLA 4JI3B 5L4LA 3RAEC 4L6CA 2RONA 1D6JA 3GYQA 2JIRA 1PSDA 3TGPA 4ALMA 2PLRA 5KYKA 4FYIA 1ORDA 4AXXA 3RFXA 1YS9A 3ZWNA 4CV2A 2EFEB 2NP7A 5FHQA 3TI7A 1MFZA 2C9ZA 1Q3TA 4PC6A 3GJYA 4MUEA 4YRBA 4BT3A 1F6BA 2X0JA 4D1YA 3IDSA 1FUEA 3MQWA 4Y6QA 5ALHA 3STTA 3VO2A 3I53A 2WYWA 1KEEB 3AZPA 3LBAA 3CF2A 4FUTA 1HETA 5TB5A 3UPUA 3BB4A 4FONA 2GHTA 5HQ3B 3HP4A 4F4HA 2I91A 1XTUA 3PWKA 4JR2A 5CYPA 1QK3A 3S4YA 3B20A 4BVRA 4C8EA 2BUAA 4Z49A 1P2FA 2C04A 3B3QA 3Q40A 4MUHA 2ZM5A 2NQTA 2E4VA 1XZLA 2J31A 2NPOA 2CMGA 4H6WA 3CZCA 5BNIA 1G8JA 1KFBB 3Q0EA 2V3VA 3KPWA 5CLJA 3R5FA 1PEYA 1US8A 4WY2A 1QV6A 5TPZA 1QPZA 2H52A 1TZKA 4N8EA 4B7UA 3V48A 3ZJ5A 4WZAB 3PC8A 1P31A 1J7HA 1C9NA 1RM3A 4GM1A 3JQQA 3TW8B 5JNRA 1JKFA 1BVRA 2VN8A 1KYZA 2RGGA 3U80A 3TZCA 3V3TA 2ZTMA 2IYFA 4FI3C 4HWPA 5AK4A 3CCSF 2CXTA 4WZZA 3S06A 2ZVPX 3H5TA 3TLMA 5BWBA 3VNAA 2JHGA 3PF8A 3PJGA 2I4TA 1AHHA 1ODTC 2IFTA 4BP8A 1ATZA 4QLAA 1ISMA 4WKGA 3K3PA 2Y93A 3GT0A 3TD5A 1EFCA 1ZGGA 4M0UA 1BXZA 1EUDB 5EZYB 4FGJA 2PNJA 4UBJA 3UICA 3WK6A 1I6WA 3U60B 2Y0PA 3VR3D 2P1RA 4DLRA 3RYTC 2OV1A 3PD1A 2CFCA 3BB1A 3FD6A 3AI3A 4MPDA 4PRYA 1JDUA 1VYTA 3CPHA 4OGGA 5H9WA 1T9BA 1P1CA 4DCJA 3LDTA 1JLSA 1ZI9A 4GOKA 2RHWA 3F9CA 3CCVF 2F2TA 2IF2A 1X7DA 2V6IA 2VHUA 1IMOA 2WWWA 3LQQA 3OZXA 4NZPA 5G2OA 5CK4A 4K6CA 3UT6A 4A82A 4B4DA 5BMVF 1KOJA 4I55B 2P65A 1JKJA 1HLGA 1UDBA 3D6TB 2LV8A 3K6RA 1JWAB 2AXNA 4ND8A 3AK4A 4R2MA 4U7HA 2ID9A 4AX8A 4NG5A 3NJ4A 1GYPA 2VSXA 5D3QA 1GQQA 2VJBA 3IESA 4TTJA 2PXAA 2QRUA 4BJ6A 2QTPA 4RD2A 5CB0A 1RPAA 1D1PA 3CZQA 5IC4A 3AUKA 3V8EA 5J47A 1YC2A 3JTMA 3W79A 3ZS8A 3CQ9A 1NBME 1L6IA 4A36A 1N6PA 3NC4A 1J09A 3KQMA 4P58A 2GD0A 4PHFA 3V32A 2FDXA 1QP7A 4D4HA 3C5WP 3QVTA 1YHQF 4LNHA 3QVGB 4EPRA 3T7JA 4PXAA 2ZUWA 3EFOB 2R5WA 4CF6A 5A4DA 4MUMA 1VJTA 1ZZGA 3ZQ4A 3GPBA 4G86A 2E5LB 1EUQA 4J75A 1KYVA 2P3LA 1X6VA 4QPPA 1VL0A 2O0KA 3CIFA 3O2NA 2YBDA 4GZ6A 4KQHA 4Q9DA 4UCWA 4UREA 4MKRA 3TZ6A 1VLJA 1XZDA 3MA0A 5LZ4A 1ZGZA 3LWDA 2ZYAA 3FCAA 1TAUA 1PR2A 2CDNA 2UYYA 1JHXA 1D03A 3HC7A 3OE5A 4C29A 3O7MA 4RSRA 5C1DA 5GMOA 1RI5A 3JVUA 4N5LA 4EF4A 1K3FA 2RK4A 1A7UA 3FYSA 1A9XB 1EBFA 1FRVA 1LX6A 1QH0A 1PJ8A 2VFAA 2YHAA 4HHEA 2ZSEA 3T1OA 2JJYA 3GMTA 5DWQA 4MUXA 3EUAA 3V7WA 3FVTA 2X3YA 1KJQA 3LUKA 4UAVA 2WZBA 1A4RA 4WV3A 1BX1A 3IQEA 3R7WB 5KIAA 4IZIA 1R6UA 2XKJE 8ADHA 3DMRA 3EBLA 2AFRA 2C4VA 1GAWA 2CLSA 4TS3A 3ZGYA 1B2LA 4P82A 1V6CA 3B1ZA 1SVNA 3RJTA 4CIBA 2CXHA 1MOPA 2ZKLA 1SQGA 4GU5A 3JAMA 1C9DB 1NKTA 3N86A 4LF7B 2NSHA 5FEMA 2WNHA 1WKCA 4XR9A 4JB2A 5BV0A 2H7YA 2MSEB 3H6HA 2Q50A 3IIIA 3WLAA 1GV0A 3EIFA 4D74A 4RL6A 3ZD9A 1DQPA 1WVMA 4EX6A 2FP4A 4FE7A 2PWYA 1PG5A 1FRFS 1E4EB 3SDBA 1A4IA 5ALTA 5ABPA 1TVMA 3CEMA 5B3AA 5JD3A 3RRNA 1FF9A 2L82A 3E5NA 5IF3A 4MA5A 3FFMA 5CAEA 5HWSA 4JEHA 4O33A 4A15A 3OPVA 1E5LA 1IQUA 2HQ1A 2O7SA 1CR4A 3NIDB 2ZSDA 4HADA 4LS3A 4MMXB 2YHBA 3QWBA 3R4CA 4WN9A 3VR4A 3OX2A 4CKBA 2X7XA 5BPHA 4BMPB 3IMFA 4DKJA 3U6KA 1U3VA 1FX0B 2AG8A 2GGSA 3NHYA 3QMMA 2FFBA 4RKFA 1P19A 1OIVA 2B7CA 3OQIB 1TYAE 3WV5A 1G38A 2VPXA 2XMDA 4MGYR 5TQ2B 1NMEA 5K8UA 5C3UA 2C2WA 4QEDA 3RC2A 4CUKA 2EOAA 5L6MB 2NUBA 2UXCB 4MSUA 2ZWPA 3H8SA 3R40A 4QZVA 3PF9A 3T7SA 2Q99A 3VYWA 4ZEMA 2PZMA 2NTNA 1AQLA 5IC6A 4HNRA 4XYGA 5HP7A 2QTGA 4YAFA 1QHYA 1YR8A 3IOCA 4ZQCB 1HDRA 4WA8A 1VJ0A 1DV2A 3MCUA 3IB6A 4KBYA 5DNYB 2GD6A 2IYYA 2QD5A 1XGKA 3BXEA 3TTYA 2QB5A 2ZTVA 3D6HA 4H77A 4QHYA 4ZJPA 1QP8A 2ORED 2HK7A 2HQSC 3X1XA 3IJPA 3TL2A 1YVUA 1UP7A 1N6NA 1OB5A 4LXHA 1RACA 4MRRA 5J9FA 1K6JA 3IDFA 4DVGA 2UXBB 4OQLA 5LA6F 2W6QA 1TUGA 3A9CA 1JEAA 5JPIA 3RAPR 1KE2A 3DMNA 1SH7A 3I5XA 2VHCA 2XV1A 2J32A 3AEQB 3QKIA 5F78A 5A5EA 3LNCA 1PR3A 2I80A 4NCKA 2OYSA 3PUVA 4TWJA 3FDFA 2CDCA 3FPHA 4XZ3A 2YVAA 3G8BA 1N0UA 5F4ZA 3DEZA 2NSJA 4QG7A 1WVIA 2A8YA 1QOPB 4Y2GA 3PDJA 3OSUA 3I4FA 2R9VA 2R87A 5GPBA 4LMPA 3MELA 5KJEA 1QFYA 1V41E 2LBWA 4HQ0A 2WG1A 4O8CA 5FWDA 3HYCA 4TTPA 3BT7A 4MVJG 2FSSA 1J90A 1PT7A 2D1RA 3C8LA 3CZRA 1KMCA 4MAAA 4RA9A 3EF1A 3EXEA 4IZHA 5E6UA 3QVUA 2FPPA 2ZYRA 3JQAA 5C8XA 1B23P 3OJFA 3EEFA 2JJ1D 4YT5A 1G64A 3RF6A 4CI9A 4F1KA 1E20A 3ZWPA 4EB6A 1PHRA 3KT8A 2HBZA 1D2RA 2FPOA 2XSZD 3CINA 4MMZB 4KAJA 2F64A 4EB8A 3Q7EA 1XTVA 3EFEA 3G2HA 4R7GA 3TL3A 3G0DA 1VQMF 1BMFD 1KVRA 1UT8A 3JVDA 4CMJA 4XARA 3HB9A 1EFUA 4NBUA 2QLTA 3HBJA 4EL5A 3FAKA 2GDJA 3FYCA 3Q8LA 4WN9B 3U4GA 1U8EA 1XFDA 4LC1A 4OK6A 3DB2A 1TU4A 3MPOA 1IHUA 1TCUA 2QMUA 4B9AA 4GXTA 4LZWA 3FPLA 3KOYA 2HI0A 3FMOB 2M6LA 1JHRA 3TRKA 1Z33A 4I1PA 3R3YA 3A1TA 5DGCA 4FBMA 2E1RA 2N42A 3QXGA 3ROEA 2BJHA 1VE7A 1ISSA 1JVSA 3CUYA 3QIVA 2HIHA 4L08A 1CS4C 4OA5A 4WXYB 3OCXA 3GLUA 4FHDA 4FYWA 3U17A 1HYEA 2ZJ4A 4MQ5A 2YZGA 1BNCA 1UXKA 4OIMA 1ID1A 3UA3A 4CUZA 1S8AA 4RTRA 5CDHA 3BE5A 3E2PA 1CUJA 2BFCA 1IUOA 1UKAA 2IXFA 4BTLA 5JH7B 1ACLA 3E9CA 2WF8A 2VPQA 3RRBA 4F60A 5L51A 3E53A 4MVXA 1QYRA 1NHWA 1YJAA 1VL8A 4JVLA 1VBKA 5DGTA 2PZAA 4B3TB 3PQDA 1RSZA 1F2VA 5SY4A 4IIJA 1ZM9A 1S7GA 3C3XA 4I3FA 4RY8A 1ZCJA 5EWJA 4B33A 4DG5A 2WWRA 1P4RA 1QXSA 4DLXA 4CTOA 4FFLA 1ICIA 1DV1A 1SPXA 1H3NA 3OZEA 1SEPA 2B36A 2GBGA 2OLJA 4QXQA 1OJ7A 1RPTA 1TKRA 3TFOA 2BZGA 5IC5A 2X6QA 1AQUA 1OI2A 1GTMA 3AI7A 4PINA 5G0UA 1T34A 2MCFA 1H2FA 2DFDA 3T3MB 4CN8A 3ADCA 3PGXA 1NFFA 2PYDA 3SYRA 3UWPA 3AR7A 2XZOA 1DL5A 3W4JA 4WKCA 3RBAA 2FN9A 1AK1A 2J5QA 2V9ZA 2ZVJA 4IOMA 2YFHA 1UDCA 1ZGHA 1U9CA 2VYVD 4R2JA 3SHOA 2QR5A 3NT2A 2DKFA 4DUZB 1FJGB 2IDJA 3PZBA 3GQVA 2Z30A 4BC0A 5F9HA 2O57A 4B8ZA 4QBIA 2EG9A 2YKGA 3F0FA 3NC0C 1DXOA 3Q7IA 4DF3A 2R84A 3ORYA 1GFIA 1S4QA 5GONA 4FFBB 1XEFA 1L5RA 1RJGA 1V96A 2GN8A 2NX2A 1V48A 2OAQ1 3U44B 1BEEA 2M32A 4I4TF 2EU8A 2ZBDA 4Z0PA 1D6SA 3DTVA 3QI7A 5GADl 1Q1ZA 1N5RA 3PBKA 2NYRA 5JV5A 1RI1A 4AKTA 3D00A 4LHEA 3FBAA 2P75A 3ACCA 5BYJA 4EARA 3TKLA 2EW2A 4IXDA 2K7FA 4HNHA 2P3OA 3ZUPA 1X1RA 1NOJA 2LBXA 2CDAA 3HAXD 2RHDA 1LS1A 5G4VC 2FK8A 4EQZA 1MT0A 1LPNA 3AFIA 5EXEA 2GHRA 4NCBA 5G3ZA 1GLNA 4QC2A 1TUBA 1OKKA 3GUCA 1NNSA 1H22A 1HUQA 4EBFA 1YRWA 4H7KA 4M1EA 3D7SA 3UWDA 4WLFA 1EB9A 2PRJA 1DQNA 2PNFA 4KH0A 3B36A 2ZAUA 3TEFA 1IN1A 3KR2A 1CZNA 1TMGE 3SX2A 1P0CA 4IHQA 3FCCA 1NUAA 2BR3A 1F8UA 3GUVA 4X24A 4M37A 3BBLA 1TM5E 1BXRB 2NSDA 3OEHA 2PU7A 2WE7A 3OKPA 4QU5A 3OA0A 3CYQA 3TCXB 4ND6A 5TQJA 4QXAA 4HB3A 2B7BA 4N7RA 1NM5A 4GOMD 4A16A 4Z4GA 3GT4A 4GKJB 2JJ8A 5BNTA 1WWKA 5KYWB 1GUZA 4GX5A 4P9NA 4K88A 1V45E 2OCIA 3MF4A 4ARAA 2C2YA 3D1LA 1NBWB 2AN5A 4OJTA 3KXKA 1XO1A 5IDVA 1Z6QA 2FMKA 4HQRA 3DB1A 3MRVA 3REQB 4BS9A 3QK7A 5BQFA 3C6ZA 4R9SA 3GZNB 4F4CA 3C5HA 3S7TA 1NJ1A 1QVWA 4IJWA 1O03A 4JC5A 1NWHA 4Y9RA 4TSFD 1ZH0A 4O1HA 3PLNA 1JHZA 2QP4A 5AO9A 1R7RA 1AQNA 2ZJFA 4R1SA 1UBMS 2PM8A 5FPYA 3G2IA 1ZL2A 2VGMA 1F0KA 3MD9A 4TLBA 3UW3A 4DQVA 4EG8A 4P3YA 2FW8A 1R9NA 4BB6A 1WG8A 4ETNA 4B80A 4EYQA 2RKWA 5T7BA 2L17A 1A9XA 2J1LA 3P9SA 4IH1A 4LMAA 1Q0RA 2P9ZA 1VM6A 5KTMA 3FOCA 1EHYA 2WSSD 3CPQA 1YJBA 2DQZA 3TDNA 3KYJB 2DHRA 4HQKA 1WKBA 2Q8QA 1N9KA 4JUIA 4TMZA 4Y2JA 3SEQA 4B3BA 4TL8A 5CM2Z 4KRFA 4DDVA 5I9TA 4A0SA 1E64A 3BMQA 4TV9A 4UBLA 4EM6A 5TS2A 1XMOB 1W5SA 1J8VA 3U9TA 1H2AS 2VDWB 3H19A 1ZJYA 3KM0A 2PHNA 1T6NA 1IUNA 5TRTA 1L3BA 4LFCB 2XTMA 1TADA 3EXG1 1EFLA 1QDEA 1VYVA 2GJ8A 3ABOB 4M7RA 2HFKA 4P4LA 3IB3A 3OJEA 4BIMA 2FSFA 4DT1B 1FP7A 1QX4A 1JVBA 4REQB 5CT6A 4YN3A 3AZQA 1HURA 3TE7A 4D0GA 1EWTA 1HV8A 2VATA 2WJ4A 4O4JA 4TXHA 4BOYA 1N0WA 1MZPA 4KW7A 5DB4A 2EWCA 2WD9A 5ALNA 3SN6A 5TMPA 4YA6A 4U9IS 4C7OB 2ZGVA 5H4GA 2P1ZA 3KV3O 5AOAA 4RMHA 3H2JA 1P8JA 1JEJA 2C9OA 5JVDA 3K14A 1V8ZA 2HN9A 5FEUA 5MGNA 1BQ3A 3BGVA 3ZQJA 3PI7A 4A92A 3OPXA 2DY0A 3B8HA 5JECA 4OKNA 2W90A 5FF9A 3CGGA 3DEKA 4MAMA 3SNHA 3NIBA 3ZLJA 3ESQA 4C6TB 2R6JA 1T4GA 4DCVA 4EPWA 3L9XA 4FN4A 1KERA 1NVWQ 2XUFA 3HG7A 4URYR 5IAGA 3GGDA 1YCHA 1U9YA 3EZ7A 1ZXXA 1ECFA 3KP1A 3Q3HA 2YXDA 2G9VA 4RXMA 1DAGA 1O6GA 1WABA 4KMRA 4R8SA 5F35A 3W2GA 5AM4A 3TWOA 5HJ7A 4KREA 1P9NA 2H31A 1DBWA 3KR9A 4INZA 2CLHB 5DTQA 2P4QA 1CUGA 3K70C 1E58A 1R5NA 3C1TA 4CLDA 4Z86A 1VL5A 2Y8EA 3SQLA 4IYRA 3IE2A 1A1VA 4KX5A 2X42A 2O5EA 4AKIA 1XD2B 3H2GA 1MPTA 3OQOA 4XOIA 5FWYA 3H4MA 3BWEA 3R3ZA 2AJBA 5KCMA 3RJ9A 2Y05A 4BWVA 4DA0A 4J2OA 3KSMA 1Y5LA 1DU4A 1NC1A 4QWWA 2W2KB 4XUGB 4ZKEA 3ZKAA 3GQBB 3EJWA 3QIAA 4FE4A 1QIHA 4UBOA 4JBYA 821PA 1TJ4A 4F5YA 2PFGA 4COKA 2B69A 3MK31 4GWKA 4Q1VA 2B5OA 3MBKA 1T36A 2WT8A 3TF5A 4C8IA 2X41A 3TLEA 3TUIC 3VHXA 2HNBA 2XF8A 4WZBB 4EFMA 1XLUA 4Y0AA 1ZNQO 3CCCA 4ALIA 2DMRA 3G9ZA 3LLSA 4WADA 1EYZA 5IP5A 4D46A 4OQDA 2JIQA 3CD6F 4BGVA 1DEOA 4U5XA 2B82A 1NJSA 4JL6A 4IWNA 4EKYA 3JQAD 1QO0A 1KI3A 1PEAA 2AE2A 4FMPA 4JITA 2RHCA 2VDWA 4M7OA 2E7ZA 4NFLA 4RQBA 5EUQB 5CA1A 1N6RA 1FNKA 1L5HA 5KYTA 1PT8A 2EKDA 4DMRA 3IDAA 4Z99A 3PWTA 1BROA 3R5SA 2QN7A 2BMDA 4Q82A 2B1GA 3HUTA 3QF7A 5EI5A 4G0VA 1V39A 1B26A 3CG4A 2IS4A 1FPMA 2Q9AA 3ZXIA 2C98A 1PDVA 2D5CA 1GTG1 3BEOA 4RLFA 5HF9A 4YMVA 3O8DA 2GAIA 4LI0A 3NVAA 2HJGA 1ZDMA 4S1NA 2QF7A 1Q81H 4BO1A 4GLOA 5CPBA 3EVFA 5LD2B 2ZRQA 5DNUA 2J48A 2IHZA 3J7TA 2VT2A 3UB3A 1TC1A 3D59A 3ILYA 1ULSA 3HVUA 4OJQA 5K0CA 2J3JA 2VAXA 3F6BX 4BMNA 2OZEA 3KZMA 4MRSA 2A9JA 4YCNA 1I0ZA 4MS1A 3THYA 3GCWA 1YD7A 2UYPA 1K7FB 4HDMA 1U3UA 2HDOA 4GZMA 2HS4A 1I4OA 1NMUB 1E7KA 1JHOA 3EOBI 4F3CA 3A31A 1X7PA 4FD3A 4MQFA 3T8YA 3VU0A 3I9NA 4PSVA 2P9TA 2PANA 2AUMA 2BFFA 1A8PA 5BN3A 1UJBA 2AJTA 2DFVA 3L7CA 4BJ5A 3I9KA 3DHNA 2WIAA 3HB0A 3SIRA 4YAGA 3PC4A 4R6XA 2G7ZA 4HNSA 5AD1A 2QN9A 2RAUA 1HY3A 1NNEA 4L7QA 5BYKA 1T9ZA 1X7YB 2F3RA 1K8YB 1RBQA 2FWMX 3IILA 5I3ZA 4V0OA 2G88A 4PYKA 1WNTA 2VDLB 3E9EA 3B12A 5J40A 1MFPA 2ZJ6A 2HRZA 3OTOB 4Q9KA 3QTLA 3WMRA 4Q7MB 3CURA 1P80A 5GZ3A 3IRUA 5HNKA 3VNBA 4G0YA 2F4VB 2SICE 4F4JA 1OFTA 4J16A 4DCOA 1Z0SA 5GM1A 4JX8A 2VTEA 2N9UA 4BQQA 3TAUA 4FM9A 5AQ1A 4FMCB 1XQ6A 5MFZA 3ZDEA 4G4ZA 3WGZA 4QTTB 1O8BA 2QE6A 3I64A 3KS9A 2NNWB 3LDAA 3TIGA 3V2UA 5ES3A 4BZPA 1NJ5A 4JS0A 1P39A 4B74A 3W5BA 3DUFA 4M36A 4PR0A 1C9JA 4JEUA 2VQEB 3K9BA 2EZ8A 4BVLA 1ZA2A 3PLRA 5T4BA 2ES4A 1V4BA 3OZBA 1T0KB 2YL2A 3P2YA 1SUDA 4UPVA 1W52X 1WMBA 4HRYA 3UXYA 1LBSA 1RHUA 2R8BA 3DVRX 4B7CA 1PVOA 3ZYCA 1Z34A 1C80A 1W19A 1WOYA 3R77A 1GKYA 1MTZA 4IVNA 4PGGA 5I6DA 1OLXA 2IYUA 2OPBA 3GPIA 3PHGA 2ZODA 3WYAA 4Y1RB 2P11A 4ZCIA 4B7AA 1VG9B 3L4SO 3HFSA 1N0VC 1A88A 1UMCA 3L6CA 3T99A 1JNYA 4Q9AA 3W90A 2WWYA 2AFHE 4YFYA 2IXBA 3P97A 2O7VA 1EK5A 2ZRCA 4AMUA 2IEDA 4KJXA 4FIDA 2VP5A 1RAHA 3JWEA 2GEBA 2ZZNA 4DV4B 5KNCH 5F3DA 3TQFA 1B8OA 3LUPA 3ZHBA 2YIDA 1XX6A 3ETEA 3ZHZA 3EW9A 4J1NA 4Y9DA 4YCBA 5LBTA 5AVSA 2EX4A 5J2UF 3UK6A 2HWWA 5A06A 3ELYA 4BO3A 4NBKA 3FNQA 1I01A 2G1UA 1KOFA 5B8FA 1IB0A 4UOZA 4RULA 3KEOA 3EVNA 3W6NA 1P4SA 1P3JA 4LK2A 3C3EA 4H7EA 1OIXA 3A37A 2QZJA 1ZSYA 4N0PA 1KY2A 4Y98A 2PX8A 2G04A 1TI7A 4ACBA 2J3KA 3DLAA 4BTEA 4F2PA 3BIWA 3CSDA 4JFRA 4YLGA 4EJMA 1ADGA 2QAJA 3I92A 2A9KA 2A5FA 3HCCA 2JRCA 4JSRA 5BW5A 4OQZA 3SYNA 1U3PA 1NBHA 3WL3A 3ZO8A 3T5PA 2W6OA 2G9QA 2ZIVB 2XVXA 3X1YA 3R0XA 1KHTA 1K4YA 3K1JA 4M9UA 5JSHA 1E3MA 3CLVA 3RK0A 5F7JA 3AR5A 4K9QA 4BNDA 1CZRA 3OTGA 1PR1A 3CZ4A 4WZAA 4O4LA 2IVZA 3HSYA 1IN8A 1I2BA 3KKPA 1Q91A 1MD9A 2P41A 2Q3CA 4LGYA 5E6SA 3I52A 2FWBA 4YAIA 4DL9A 1UZLA 3MCAA 1X7HA 2B3TA 3KWFA 3G13A 4L0MA 3Q6IA 1W2HA 3QFSA 1NE2A 4XOUA 4C6HA 1OKKD 1ZIPA 4OXXA 4G65A 3VI6A 2OP0A 2E48A 4EHAA 3Q8XB 3C97A 3ZHRA 1XNHA 1U7OA 5ELXA 3T7RA 1BG6A 2XMBA 1ZINA 4GBMA 4RFVA 5FPKA 1V2GA 1P77A 4GD3Q 2KE5A 1ZKDA 4DPKA 1Q95A 4LYDA 4F97A 4X60A 2DAPA 4QVGA 1ECBA 3PCXA 4LOAA 4YK7A 4EW1A 2HBRA 1IK6A 3NIFB 1M6YA 3TZBA 1UFQA 3TUZC 4ENWA 4YJ2B 4HFMA 4W5JA 1Y81A 3BWBA 2C83A 4YMIA 4FJ1A 5HKOA 1B0PA 3T6KA 1SDSA 3IP9A 4YCAA 5UKDA 1FYDA 4XVUA 4GKVA 2FWAA 2D3WA 2QLJA 3OF5A 1A2KC 1CY2A 4FXPA 4ZANA 2QRKA 5FCDA 1GN8A 4J03A 4N3BA 3RFCA 2VDMB 5GZ6A 3C8MA 1RCFA 1LVUA 2O20A 3CLTC 3G59A 3IQIX 3QE3A 3UOAB 4CIWA 5IULC 2GBCA 1MNAA 2CBGA 3OECA 4MW6A 2RAPA 2D0IA 2DFKB 3L0YA 3K9QO 3SF8B 3ZDFA 3ET4A 2JGLA 4GKKB 4IBOA 1MW8X 1RXSA 4B47A 4P4NA 1ZIOA 1H9AA 3QFCA 4F06A 4IOLA 2W2NA 3QVXA 3EG9B 3E5RA 2UYNB 4PW0A 5K6RA 3W1EA 4AF6A 4YGXB 2F9FA 4ZALA 4PBRA 1O94D 2X6TA 3B3JA 3E1KA 4DJAA 2CLDX 2EBUA 3I2YX 1T8UA 2FYTA 3U31A 3F96A 3QWFA 1AXEA 1QH1A 1WXIA 1GPLA 1T4BA 2W43A 1RPJA 2JFBA 5DCUA 5EMJA 2J3HA 5IMBA 2FLVA 3A1SA 2J09A 4X1IB 3LWVC 3PCTA 2POCA 5EWRA 4TXLA 4Z9XA 2IV7A 1ORIA 3E48A 1H2XA 3BRWA 3DOUA 4KXLA 1WNFA 1ACJA 2M9MA 2RHRA 4CW7A 2VJCA 3LVQE 2CV0A 4DR7B 4UE3S 3HGQA 1C30A 1ZNYA 2NZ8A 1TF7A 4CQLB 1IVSA 2KGWA 3W77A 3DD1A 2F00A 3EY9A 3L02A 4HB2A 4QJBA 5HIIA 4ZV9A 5CNIA 2I3DA 4GOND 2YIVX 4RM3A 4DLKA 4S1VA 4KN8A 5I7UA 4RX1A 4BFTA 4QUHA 2GI4A 1UAAA 4XWOA 3JZDA 3FI0A 3QX8A 2QRHA 4QQ8A 4DJ5X 2JCVA 3HK2A 2HPHA 2NTJA 2WWXA 4NONA 3O4IA 3LO5A 5JI3E 5EZQA 2VI5A 4PLCA 3OCZA 3OURA 3T1TA 2OCBA 1O0BA 3KKOA 4QHSA 1N3BA 1EFAA 5T67A 2GKOA 1XQ1A 2CFTA 1QO9A 3RFTA 3TPZA 4OK5A 4QU0A 5CAEB 1PT6A 4QT4A 4QG3A 2NZJA 1YAHA 4X91A 4BT4A 1BQ4A 1E94E 3I23A 3MZ0A 2ZAMA 1IN6A 5BYAA 1UANA 3KJKA 5EN4A 5G0VA 3VNRA 2CNBA 3WBJA 1QF6A 1HTBA 1HZZA 2TMGA 3NOVA 1OVMA 1JQKA 1TD1A 1Z2CA 3FDIA 1UBEA 4KMSA 4RVCA 4ZO7A 2EKQA 1DMSA 4FHFA 4OGKA 4Q3BA 4B0PA 1N32B 2UYOA 1BX3A 4R1OA 4Y2RA 5K8JB 1N7GA 1Q44A 4N39A 2ST1A 1DUSA 4G1EB 3OCWA 4B46A 1V5EA 3BPSA 5DRTA 1KKLA 3KX2A 5IAOA 3E9QA 4FHZA 2DGDA 1ZR2A 4OX9B 4UFPA 4QAQA 2BCGY 3NPAA 1B41A 4MS1B 5CX1B 1M34B 2I6RA 3FOEC 1A97A 4N3AA 4AQ7A 2PVPA 5KI6A 1OFVA 1TLFA 2R85A 2ERCA 3L1IA 3SSMA 2ZROA 4M89A 2O8EB 4P4SA 4GVXA 2WUVA 1IPFA 3DUWA 3KYCB 1DCFA 5ERGB 1I5RA 4BNLA 4KTVE 1DOHA 2AC4A 5CJJA 3K2XA 1QQBA 2QUIA 3ZV7A 4QXMA 5AK5A 2A5DA 5FBRB 1YFLA 5I01A 1OVGA 3OY2A 1VIYA 2WKRA 5ENZA 3REQA 3H0CA 3L5KA 4PLVA 3OOJA 4LRTB 1PWZA 3W4KA 1PR0A 3RRYA 1C0LA 1JYEA 3OFKA 4PVDA 4OJNA 1TIBA 4F96A 5EE3A 1E9VA 4OYRA 2V1XA 4AVYA 4KR6A 5LR6A 1OXXK 2JI6A 1E0JA 2R00C 3M4YA 9GPBA 1VA5A 3MC1A 3OQJA 1W76A 3RUFA 1AD2A 4M22A 1L1EA 5L3QA 3K5IA 3I45A 3MWJA 4ZCMA 4E88A 3EZ9A 4L8VA 5BT8A 3HKCA 1RKUA 2WC1A 3QUTA 4ETMA 2F59A 1A8IA 3EWNA 4II2A 3GLIB 4ZV7A 2F1OA 3R0JA 1XVVA 6NULA 4J9VA 2JLYA 1QAQA 3DV0A 4RA9B 4FX5A 1P6QA 5E6UB 5JNWA 1QYVA 4AP5A 2PSSA 3DZKA 4EMTA 1Y7IA 1GGHA 1WCXA 4LMRA 1JKMA 1P5FA 2IELA 1JFFB 2ZEJA 1LSOA 5ANRB 5MF6A 1ZJJA 4HWTA 2HREA 5LMNB 1V37A 1V1RA 2ANCA 4UD6A 3UG6A 2SKCA 2E6UX 3HDYA 3R0VA 1AMNA 3VC2A 3QX7A 2JD1A 4TLEA 5EHZA 2AJDA 2E6KA 3JWPA 4GWLA 5JADA 3I9MA 4HLNA 2RGEA 4CFYA 1NP3A 2Y0BA 4LI3X 2EVWX 3IO3A 5DCLA 5AK3A 3SS8A 4NBNA 2BOVA 1JV2B 1PV2A 5D3ZA 1PR5A 1L9XA 3U61B 2P6NA 4US1R 1VKJA 3QZUA 4TMKA 1N2CE 1L7RA 2K1SA 4QUJA 1I1OA 4PANA 4YLEA 1T5DX 3SJUA 3PGJA 5LYJB 1N6IA 2B6NA 3MN1A 3WGQA 5EY5B 4US0R 5HILA 2CV1A 1BGWA 3GLGE 4AU1A 1VJDA 2G3YA 2IHVA 3I12A 1SU6A 2J0SA 1I7NA 2IYWA 5F52A 1MB9A 5FUVA 5CX1A 3ZPXA 3UMBA 1XYGA 1H8HD 4FYJA 1M2NA 2GUGA 4DQDA 1Z63A 3B1WA 3FMGA 2E5FA 3UYKA 1PX2A 4FGLA 4ZU1X 5GVRA 4MW0A 1TK2A 2UDPA 3DDZX 5I9MA 3T38A 1KEWA 1ODLA 4GF5A 4BVKA 1ZVVA 2VHYA 2C7GA 5HR5A 4W1SA 1H4VB 2I7TA 4K87A 4DDMA 4W6QA 1U9IC 3OBWA 2GEUA 2GHIA 4MQEB 3IR5A 2ZI4A 3P1JA 4BLUA 5KTNA 3S5UA 5DN9A 3A10A 2ORYA 5DLPA 3N28A 4J1QA 4PGMA 3RBXA 1PNOA 3HCRA 5FUXA 2AV6A 4BNDB 3DLHA 2XAAA 3P7MA 4U5QA 3RU3A 5EIFA 1Z0UA 3CZ5A 3FPFA 1WCIA 2O1XA 3ZE0B 3IEVA 1AH2A 5K6TA 2C97A 2OV3A 4JU8A 4ON9A 5EE9A 2ZYIA 1W1WA 1K97A 4ZA2A 4FB5A 1NYQA 1K08A 3OX1A 5F98A 5FAXA 4DCMA 1TJ5A 4PY2A 5JC1A 3N2GB 4KYTA 1U04A 3LCVB 1E3TA 1H9CA 1SVMA 4J43A 1LDGA 3OM1A 1X7OA 2E4UA 3RANA 1MC4A 5E6RA 5H68A 1KO4A 2C5AA 1A5ZA 4ER5A 1X92A 1Y7LA 1PFUA 2ADFA 1OU4A 1BE0A 5TGZA 2Z57A 4LWOA 3STUA 2O3QA 4OLAA 3X44A 4FZVA 1IIRA 2AX3A 3LYHA 1J2JA 3HKEA 1PYOA 1UMBB 2WFMA 3CHYA 5BSHA 1SVOA 1TXGA 3WGNA 1V1RB 1YZUA 2XZPA 4HUTA 2O8CA 1P3Y1 1XJQA 4EIWA 2PGOA 2VRNA 1RLUA 4P6VF 4IFIA 1JAIA 5CB4B 1O58A 1ZHFA 4KOEC 4E1AA 5I4KA 4V0LA 5JYBA 4P5EA 3NIWA 1XKQA 1CE8A 5HY2A 1IV3A 1U2DC 3MWFA 2EW8A 3VSEA 1F8FA 4AZ0B 5I7VA 1AKYA 3K6SB 2O0LA 1RQ7A 3K1AB 4C6SA 2DEUA 2QQ5A 2A4KA 2VTKA 1A4UA 3ELWA 3H8VA 4GGMX 1ADJA 1RMYA 2AK2A 4ZMRA 4WGGA 1IXYA 1CUFA 3V8VA 1L7VC 1FYFA 4ZI3A 5F7OA 2JD0A 1A9QA 1G8SA 1TVKA 4RGVA 5JCZA 1RJ9B 2H1CA 3F3YA 3PPVA 4BVBA 3SVLA 2QSUA 5AK6A 1FDOA 5K09A 4N9QA 1XNGA 2FHPA 3AUSA 2LIVA 1HORA 1H9BA 2BR4A 5DHQA 4K05A 2ONZA 4UNPA 5BVGB 3M1AA 3I7TA 5ICGA 5BW4A 1C1XA 1WXXA 1XQVA 2XT6A 4U6QA 3NWEA 4RKQA 3MJEA 2HMWA 4HDOB 4G0ZA 2WYHA 4Z54A 1WDTA 1SBQA 1P17A 1Y89A 4MQ4A 1WP4A 2ZETA 4WI1A 5DGIA 3ST7A 4ARZB 4BLQA 4U7DA 1XP8A 2OCXA 2XADA 2Y6UA 3BCUA 1M10A 2C20A 4MUAA 2XRFA 4QX6A 4YRMA 4WECA 2GX6A 3UB4A 3VSCA 1X7YA 2CF6A 2IZ7A 2J46A 4MQEA 1H8HA 4FN5A 4G56A 4TOIA 3ZBTA 1RWXA 2Q6IA 4F86A 5C53B 1SZQA 1Q7YH 1E6EA 1ZX1A 2P2GA 2GVDC 5IYZA 1NIPA 3GC6A 1ESEA 3GJZA 1S4MA 3EQZA 3DFUA 4G9BA 3GDWA 5AW4A 1MUUA 1CLIA 2AN9A 1HQKA 3BDIA 3OPMA 1XZ8A 1NULA 1ISHA 2WSYB 1HMYA 1LQUA 2CFOA 3X2EA 3U7GA 1THGA 5C8VA 4RSHA 5EFOA 4U3JA 4JOSA 1NW7A 3T3GA 1DXYA 1EJ0A 2A7XA 5HFJA 1FQJA 2WA2A 8ATCA 3F3KA 1IHOA 3G1UA 3C9UA 1XU4A 2FV8A 4EPVA 3UPTA 4ERNA 1AUOA 1EM8A 3IELA 4B3FX 1B1AA 2OHXA 1LRKA 4UAUA 3I56F 3PIDA 2B33A 3T3PB 1W88A 1FU7A 3BGOS 3FAZA 4YO7A 3D54A 3GRZA 3UH1A 2A0WA 3BH6A 4LPKA 1B43A 5FOVA 3KC2A 4Y2XA 4YIKA 5LC1A 4L6IA 4OV6B 3SM3A 2O8CB 3NYIA 5T4EA 5HWEA 1PFYA 1EFTA 4WLEA 2I6QA 5HUHA 2F17A 2OP1A 4KHZA 2BBOA 2Q45A 2J30A 5KHLB 1IN7A 4J29A 1W40A 2CNKA 4IJ6A 1SIOA 2DTDA 3SIPA 3DA8A 3IAM1 4I50B 4FHCA 5K3SA 4C7OA 1E9CA 1HO3A 1P91A 2VZLA 5AKZA 2O7NA 4DSZA 2BE7A 4G1CA 3FD8A 1YQTA 1XXHA 4BVHA 5ADVA 1EDEA 2PRKA 3GEEA 5JZMA 4ETIA 3RE3A 7MDHA 3LHKA 2JA1A 1UKCA 1ZVKA 5DM60 1DDGA 1KS2A 2P2SA 1CC1S 4FFDA 1U02A 2NUAB 4RF3A 3RVBA 4C6TA 1M2VA 3CH6A 3L6EA 1JBEA 4OU4A 3N8GA 4P38A 5AM5A 1C1XB 1YZVA 4EGAA 3ZZ1A 2Y99A 3ZGVA 1JX6A 4L2IA 3ETGA 3T9BA 3FHOA 1VB3A 3LUHA 2OFFA 1ZC4A 2DJIA 2XA9A 4GUDA 3RWBA 3KOMA 3D5EA 1T4CA 1N5LA 3NHWA 4PPYA 1WR8A 3AESB 4MB6A 1CS0B 1OX6A 3BXFA 5AJZA 3PQ8A 4KRYA 1SGWA 4FX2A 4PZPA 5C31A 4D79A 2CKMA 2VJNA 3VR4D 3X1WA 4TWBA 1U6KA 1VCHA 3HJAA 5KQGA 2PXCA 4PG7A 1GCIA 1C7RA 1NZDA 2IZ5A 2HMUA 4I50F 4QOJA 1Z5PA 2YWDA 3IV7A 2QRJA 1VCMA 4A8HA 4BQIA 1C1DB 3RYFA 4QIHA 3IEWA 1SCNE 4R8LA 2W2KA 1KQNA 1XEWX 2FRDA 3T3IA 4DY4A 3K8YA 4XR4A 2D54A 3JVEA 1VTKA 4RKWA 5FP0A 4CT0A 1ZQ9A 4PPQA 4DA4A 1YJWF 2WT4A 3MS4A 3ZCXA 3BYQA 3BILA 1M9NA 3QF4B 1Z39A 3LY9A 3AVYA 1EVQA 3K0HA 1XR3A 4P33A 5ED0A 4AY5A 2WHXA 4M9ZA 4S12A 2OFOA 1GZSA 4WZBA 4Y6PA 1UKZA 4PSDA 3TSYA 3R4VA 2FGJA 1JBQA 2GFIA 1POWA 4HEQA 5BWLA 4DUGD 1RXUA 4RCZA 3ZE2B 1ZOSA 1D0SA 4ZOQI 2AZTA 4RF2A 4JOQA 1YS4A 4CG3A 4YCLA 3FBWA 3T1VA 3ZGOA 2WSIA 1O4VA 4R9NA 1IN5A 3I3OA 2G1AA 3C7KA 2EJVA 4QLBA 1G5HA 3CKLA 2GK6A 4IM7A 1TKCA 1WIWA 5K0TA 4C4PA 2AFIB 2OAP1 3LZDA 4I46A 2IHBA 2C8JA 2PD6A 2OGZA 2EEZA 3KT0A 1W36C 1RHJA 4J7AA 2XOKA 5EUCA 1KTIA 1ZCBA 5FLXM 1J9EA 1H85A 3WL6A 5B36A 5A71A 4F6RA 3BD7A 1UBKS 2RHJA 3KOWA 3PUZA 3PUJA 4Q18A 4RACA 1PJSA 2XXJA 3BSSA 3OIUA 1MVOA 1K75A 1U1EA 3OWHA 4X7RA 4YJGB 3BHJA 4DREA 2ATEA 5IKPA 3U26A 3OPYI 4CTMA 4JH0A 1IUKA 1FFDA 2E1PA 2FGKA 1KQFA 5AI5A 2O0MA 4HQNA 3W2FA 1XCOA 2R8ZA 5IVHA 4F91B 2WJPA 2YYSA 1V9SA 2Q3BA 2OBNA 4LDAA 2RC5A 3AWDA 3TUJC 6REQB 3HKDB 2FR8A 3KRTA 1IU9A 3IULA 1QNLA 5LZ5A 2ZRGA 3CZPA 4XH9B 1W8IA 3QXJA 1DG3A 3KQVA 1KVSA 5KDLA 2XE6A 2FPGB 3AVTA 3LLUA 3TTWA 2I34A 2IEBA 4R0NA 5BSKA 1T4CB 2KLHA 4WESB 4J0CA 4ALLA 5C8DA 2FSPA 2A92A 4OI1A 2FN7A 4RO0A 5D7BA 3TGLA 4Q4AA 5HM8A 3I0ZA 5KWIA 4M0KA 1CUEA 1Q77A 4K8OA 5EJMA 4MS3A 1SO8A 5DP2A 3EFBA 1EZ4A 3I5AA 3ICWA 5JQGB 4D4LA 1Q2XA 2C9BA 5HP4A 4Z4FA 1T0IA 2F67A 3GEHA 2Y0EA 3FUTA 3N8NA 4F3YA 3NVDA 1UFVA 1LPBB 1YL7A 2ZUUA 1ZI8A 1VLHA 3LX4A 1U8XX 2D1SA 3O9ZA 3MWYW 3QBJA 2HH9A 3CVJA 5B2FA 4CKZA 3AUFA 2D1YA 4XGQA 1JA0A 5E2IA 3KAKA 4MR7A 4G5GA 1JFSA 4YAWA 1PEKE 3AM4A 4HRXA 3M4NA 4ZYXA 4OQEA 1E2PA 1UBLS 1G55A 1P29A 2H5LA 2GPAA 2KW5A 3VTFA 3Q41A 2IHUA 3RD5A 1ADYA 2GD1O 3KE1A 1AU9A 1KO7A 1L8QA 2QSYA 2A35A 4K2HA 5E7MA 3RSSA 5A9SB 5JJBA 2IKSA 4WBNB 4I3GA 1L5ZA 3WQQA 4NARA 3VV3A 4YWHA 5A6VA 1FPQA 2EGUA 4LZZA 4DC1A 3QGMA 2FF7A 4HDRB 5ERXA 3MJSA 3S2GA 1IBRA 1JMYA 1MC1A 4O6VA 4J7CA 4U1RA 4ZT3A 2WD7A 3HPRA 3SBXA 3TCNA 3ZWXA 2GKSA 3DJYA 2QTVB 5I4BA 2XA1A 3M3PA 1T3TA 1XTSA 1YR1A 3TMAA 3EQ9A 3DE7X 3LLMA 5I3CA 1PKXA 3V4ZA 2VSNA 3JALA 3NHJA 3R8CA 3UFBA 9LDBA 1W3EX 2NIPA 1DSSG 2XQFA 4K6FA 3SZUA 5KJFA 2B4AA 3B9BA 1JPVA 3D7MA 3AEZA 3OH8A 2YJ5A 1ZESA 3A32A 1E59A 3AVWA 3SFVA 4WDRA 3ICOA 3MW8A 2WV9A 3ZNOA 2RGNC 1NURA 1NKSA 2KJQA 4LZLA 2R7NA 2CNNA 2KSQA 3DCJA 2A67A 1BN7A 2P5UA 2R1ZA 3IURA 4UM5A 1CP3A 4BV9A 5CTJA 5EPEA 3B3AA 5GAPK 2R1UA 3G5MA 2B2XA 3IRVA 2UUAB 3D6FA 4UPDA 3ROPA 4BB5A 1KETA 1Y34E 3FCOA 5CA0F 4IMPA 3BSWA 4NMWA 3L7DA 1Y3DE 3PFBA 1WETA 5DLQC 2GLTA 2J9XB 5FI3A 2IV3A 1BHQ1 3WTCA 4G63A 1AK2A 4XQGA 2OR3A 4FZ5A 3EJ6A 1EFRD 1HEUA 5DX0A 4EHBA 3OQBA 3I1IA 2QAGB 3PUIA 1E5DA 2GPTA 4JB8A 3LCMA 2HXSA 3KJNA 1CQIB 2WU4A 5IAAA 4MW2A 5IKEA 2YDXA 4ZQEA 1F2UB 4GI1A 5AW1A 2FMTA 1ONIA 4IO0A 4TTIA 3SX0A 3VX4A 1HMPA 2LPMA 2O14A 2X0NA 3JXEA 5HYVA 5D5QA 2MYNA 1TA4A 4D5EA 2J3LA 2NUPB 4V03A 2JAQA 4XUCA 1RFGE 5G4LA 4DV6B 1KNXA 2PS1A 4QUDA 1LPOA 2G63A 2EC5A 4QJ4A 3K5PA 2FVYA 3FWKA 3OQHA 5JSFA 2Y1WA 1SU4A 1II0A 1BQEA 1X7XB 3V34A 1UMDA 1MLDA 1SZCA 1MX9A 2EP7A 3MCQA 4KDFA 3QV2A 3F74A 2AKYA 3EA5A 2C03A 4QE3A 2O4CA 3PEUA 3GBVA 1XWFA 1E9EA 3BZBA 3HUDA 1JEQA 3GO4A 1N3YA 3VR6H 1ORVA 1J24A 4AICA 4INPA 5A1TA 1DC7A 1THTA 4R2XA 5AW7A 4DB2A 1M2FA 4LJSA 1U40A 1K3TA 4HNAA 4RQOA 3UT5A 4GBED 3INYA 1O95D 4QDXA 3SMVA 4ZARA 3THOA 3ZVRA 4EVSA 2QM0A 3KJXA 2Y92A 1Y8ZA 3LFHA 4JJ6A 4URUR 1KP9A 2JAPA 3GFTA 3BQNB 3L1JA 3V7NA 5G0TA 1DBVO 3PB3A 3BKWA 2QBYB 2B4TO 3AI2A 1KAOA 3TQQA 2GFQA 2Y1KA 1JIXA 3PNVA 2F43A 3ZW9A 5CA1F 1BDHA 3NH9A 2QJTA 4EFLA 3OICA 4UHHA 2QVBA 1TRKA 3U3ZA 2FHSA 1CDEA 4ZCSA 2D59A 2EXXA 4AJHA 4PO1A 2BUCA 4U7GA 1ZLYA 3IQGX 5H70A 3RJ5A 1NBEA 4FK8A 3K5HA 2ZM6B 1A8SA 3DO6A 3ZJTA 3QYFA 1JXQA 4UCFA 3NTXA 3OZUA 2FUG6 1VIVA 3CH4B 2ODWA 2NN3C 2XUZA 5AW8A 1D2AA 1B4DA 2XITA 5A4JA 2JAHA 3VI4B 4D45A 3H6GA 3TLBA 1SXHA 3GEGA 4YUYA 2FJUA 2EAUA 3ZJYA 4IZOA 4M1QA 4I6JA 2G1KA 3RTAA 3C39A 1F0NA 1KMHB 2J08A 3VDRA 5A4AA 4S1WA 5F23A 1ZP6A 4COOA 4UUMA 2AJ8A 2FFHA 3MWEA 3GFPA 3MIIA 3DMHA 4N6NA 3WGGA 4C78A 5KYWA 1JIIA 3STVA 1E3DA 4AJPA 4JWTA 4UFOA 2ZUEA 4Z9AA 5K4HA 4UBKA 3I62A 4NZOA 3KR1A 1VE3A 3VZPA 4N48A 4RV5A 5L3ZA 3DXZA 3E9NA 3FSGA 4WQMA 1E3SA 3RYFB 3RCBA 1T0JB 2O59A 5CVJA 2WT9A 4TSKA 1UJ6A 3UAYA 4NL4H 4A8JC 4QJIA 1C30B 3DM5A 1YSCA 3HXTA 4BFSA 3PQ7A 3ZWQA 121PA 4TKMA 4UNRA 1DEAA 5ALGA 1XKXA 3KTAB 3V2GA 1UMDB 1T2NA 3DEFA 1ORTA 3DYVA 1U0JA 2VAWA 1S0UA 3PP8A 1AXGA 3G71F 1Y5MA 5MN6A 1DQRA 2V9CA 2XGMA 3F47A 4J6FA 4NF2A 5DNWA 4MI1A 2GZMA 5BSTA 1WQ4A 4NRDA 3LVRE 3DZJA 3KKQA 5HIJA 1JEQB 3V1YA 1A9OA 2Q49A 2ZB4A 3H9GA 3QE4A 1XKLA 4DYHA 3LFUA 1GTJ1 2CJYA 4OMFG 1JG2A 1V47A 3TXXA 3G6WA 4NCAA 1JTEA 1FRZA 3O8NA 3QXHA 4J4HA 3C41J 5KDDA 3OIYA 1FMCA 2C31A 1I4WA 2YV3A 2GVIA 2QV0A 3RC9A 4FWTA 1HNZB 3ER8A 1LDEA 3UKOA 4OO3A 1R0SA 1TA0A 5EHNA 2GXUA 4GLBA 1BVYF 1U65A 2YZ2A 1HRKA 3IV9A 2QRQA 3C70A 3R9WA 2XMRA 3NHSA 1DC6A 3P9KA 1Z5OA 3EFHA 1L8LA 5DM2A 2AIRA 4D99A 3ZIAD 1Q0QA 3R3SA 2PKQO 4AO8A 3JZIA 1GL9B 3N0TA 5KYUB 1NVDA 1KJJA 1QMGA 2YN2A 4YJHA 5B1HA 3GUHA 1SBHA 1RZRA 2PX5A 2J4DA 1TTHA 3HHEA 4B0OA 1E4EA 2ZRFA 1JNXX 1G8MA 2Q1SA 4LCEA 4GMDA 3DMPA 3NNSA 4JYAB 2IV2X 1ODKA 3IS3A 3O85A 4U7TB 1ZIDA 2B1QA 1JEDA 1J0EA 1FS5A 2QU7A 2DFLA 3OBYA 3C9SA 3TFWA 2ZWMA 3HRIA 1UBTS 2FZVA 5KBYA 4UULA 1WUYA 3I4LA 5ECWA 1GEGA 1XZKA 3LK7A 3WI7A 4B82A 4CMCA 3ZP4A 5I9IA 3PI6A 3FB4A 1LLFA 2XVYA 4L7VA 3G7NA 1A9PA 5ESWA 2OT3B 5TY0A 4WESA 1SBTA 4ZAFA 2DUNA 2ECKA 5JTTA 2QQGA 2WWGA 2H4JA 3DVAB 1EDZA 4PLTA 3QVWA 4QU8A 1Y5NA 2BFEA 4PRZA 1FFYA 4DCGA 1V7QA 4WZ6A 2OXFA 4WIAA 4CEIA 1CXZA 3AM1A 3JPYA 3ZHCA 3NRCA 4U2BA 3HP7A 2M6RA 4JDUA 2VJLA 4XX1A 1Z26A 3IP5A 2FPSA 1X19A 4MVJD 4LTNA 3W2HA 2ZRBA 4PGFA 1ZOPA 3BRQA 1VSUA 2O2GA 4G81A 4Q5IA 2IA5A 2VHVA 4YECA 5AKLA 1WDKA 4BO8A 1EFKA 7YASA 3ER9A 5K03A 4QYMA 2C9CA 4IWYA 1E6UA 2EZUA 3K0FA 3B6EA 1GPUA 3O93A 4OHBA 3BX1A 5DYTA 4E94A 3G7UA 2ZSHA 4FDUA 3A3KA 4RL4A 4EBBA 1U8AA 3NANA 3T1QA 4WBSA 4JELA 2R751 1KDRA 3QELA 4AP9A 3MCWA 4R8RA 4AJKA 3CR3C 4H1HA 5EAIA 4QRDA 5CD9A 2CHSA 2YH2A 3TJMA 3H9CA 1O95A 3BMOB 5IU6A 3OX3A 4QDKA 3WIEA 2J85A 1PUIA 2ODTX 5AW5A 3TSZA 3BMCA 3A11A 4MIOA 3CNBA 3O82A 3UF0A 3QVSA 3OQNA 3TE6A 3E9DA 1TTTA 4JXZA 4B32A 4UVDA 4AYWA 2HGZA 4UXJA 4I4TB 2GVNA 3OT5A 4YROA 1J56A 3NKLA 3HWRA 2FQYA 2O0HA 1IZ0A 2YQ5A 5TQ0B 1U2EA 1QKKA 2FEMA 1BD3A 4DLSA 3JD2A 5KYUA 4ML3A 1RI4A 4X65B 4N01A 1YVEI 2HHJA 1NXWA 3ABIA 4I1UA 5CVDA 4D3DA 1M2KA 3QVOA 1R0WA 1T5IA 4AS2A 4RKRA 2NUAA 3ES9A 5IZCC 1PNQA 2X40A 1RW4A 1XROA 4BASA 1L5MA 3DHVA 3E70C 4DJTA 1JR3E 1E7YA 4MGIR 4E4YA 3UH0A 4YUZA 2V8OA 2JLUA 1PV4A 2HSWA 2ODPA 3C48A 2BL4A 2VWQA 2JC3A 4Y6RA 1E7MA 2EFYA 2LKCA 4YRQA 1MA0A 1G20B 2CK3A 4KI0A 5HK8A 4A6PA 1E2QA 3B2EA 1FMJA 3WRVA 4CKWB 1DNPA 3IXQA 3NW9A 3IVMA 1CZUA 1D4OA 2X0IA 2V59A 1TMKA 3FCYA 3HA3A 3N0XA 4NE7A 1DKQA 4GAEA 5CLQA 4JJZA 1ZG3A 4LXQA 3TRHA 1EA5A 4C07A 4P3OA 3IIJA 4LBYA 3D2BA 4MVJI 4DA8A 1VBFA 3X1JA 3BWYA 4FQ8A 1ZD9A 1I2AA 1BYUA 4H9GA 4RH0A 5JCJD 2UYJA 3QXSA 5HDQA 4CI0B 2I9KA 2XXAB 3L4EA 4KAXA 3I30X 1BTOA 5B58T 5A7GA 3BIJA 2XIJA 3KXPA 1J8YF 1WE2A 1DFIA 5KX5B 5CH5A 2PUHA 4AKHA 1GFSA 1GPJA 1TZMA 3QX3A 2WUGA 1Y4SA 2J5BA 4OD0A 3L7MA 5DP1A 1PWHA 3ZI0A 3NP9A 4EA8A 4JLNA 4TUYF 3CX6A 4YYZA 3ZI4A 4A1OA 2CN1A 3AF6A 2P27A 5EYPB 8OHMA 1LK0A 2AOTA 1XRRA 5FFFA 2PRYA 3ZI7A 2NNLD 4R1QA 4ZT5A 1YVPA 2EARA 4UTOA 1KJYA 4CIVA 5MGBA 1R0ZA 1RLIA 5HX7A 2ISQA 4GPZA 5IZ4A 3R3HA 3ONDA 1KSHA 1FTYA 2RE8A 1VJ5A 4KOAA 3R3JA 3UAOA 1QIJA 3JATB 4DM4A 4U2FA 2CKDA 3KE9A 3N9IA 1OW3B 2B4YA 2B6HA 2IPNA 1YHZA 3R7BA 1H8EA 1QV9A 1P9RA 2YUTA 3EPKA 3IP1A 2YJ3A 3H04A 5AI9A 1V71A 1DIGA 2JBHA 4GPAA 1I7DA 1Z5WA 4JI0B 1G6KA 3OO0A 1WSBA 2B35A 4D4MA 3ILXA 5JAIA 5IVIA 2IWRA 5JU6A 2VLBA 3N8IA 1CUSA 3H2SA 2FX5A 2AF3C 1KEEA 1WLYA 2PMDA 4UTRA 5J4HA 5TF0A 4WBNF 2DPGA 1AY0A 2FXIA 2ZSKA 4LJ7A 1XTPA 3G2MA 3MXOA 4UEQA 1GYRA 1RQXA 1FY2A 2FVXA 2UZ1A 2ESRA 2VF8A 3GRVA 3Q12A 4HDAA 4J3FA 4OBEA 4XJSA 2OHWA 4YP7A 3V00A 2PJDA 4MUGA 3PYMA 4AF7A 621PA 2PU5A 3ZXXA 1C3OA 2ZJ3A 1AQJA 1CBUA 5C7OO 1FX0A 1ZXBA 1DJMA 2V6JA 1OYWA 1EXVA 1SEVA 2R4UA 4PG4A 1NX6A 3NUQA 4C2UA 5BURA 1FDWA 3C4QA 2OYCA 2FE4A 4C7XA 5BSFA 3U5ZB 3CV3A 1CETA 1M1NA 3LQFA 3DZGA 4B48A 5C7IO 2J33A 1W4ZA 3DAGA 3NEAA 3Q9NA 1SCKA 3COVA 3THXB 3UK7A 3LWQC 1HDXA 2YBEA 3ETHA 5E4FA 1XDDA 1QHNA 4RHFA 1SELA 1W4RA 3H2YA 4NUTA 5FBHA 2W8BC 3ZCTA 4QYIB 1Y9ZA 1MRNA 1X1EA 1WM1A 4I99A 5JXHA 2FN4A 1FOEB 1AO3A 3F4BA 3WKDA 1U2DA 3BDAA 3QMVA 2J5XA 3PEVA 1QFSA 2ZBPA 3FHTA 3G0OA 2NUTA 3D7NA 4EK9A 4W5OA 2AG1A 4HSGA 2X0KA 4H16A 3EQ8A 4YAJA 2B0CA 2ZATA 2IDMA 3ONNA 4J0FA 5F3RA 5B7PA 5IASA 3OT4A 4UUPA 5DNDA 1SCAA 2HF8A 1X8KA 2CNLA 2XWSA 1ZN7A 2OGTA 1JT2A 3HS3A 1NF2A 2YV4A 4GBJA 1I2ZA 5IDQA 3V8RA 1J33A 1Z28A 1G6OA 1WZEA 5DYGA 2RGCA 2AR7A 3GNTA 1EHCA 1X87A 3Q6NA 4G5HA 4E51A 2HF9A 1VPEA 2QS9A 5HRAA 4M0LA 4DZTA 4ECEA 4UU8A 1V9CA 1Y37A 3UXEA 3KSRA 2JFHA 4ZDKA 4EQ6A 2C3PA 1UPUA 1YRAA 2CWWA 4LGMA 3UENA 1N5DA 3UUGA 3UAGA 4KHPB 4TMVA 1JAHA 4Q4DA 5HMMA 3UQZA 3PPXA 2F7SA 3FYTA 4S0ZA 4TQAA 4R69A 4X3MA 3UJ6A 4EECA 3J81M 2E4XA 2O06A 3R5XA 4L0CA 5CBKA 2I65A 4QM6A 3I39X 3HB5X 3RLIA 1U31A 3QM1A 4LNUA 4PWYA 4CIAA 5TJ9A 3K8QA 1O96B 5J5CA 3U3KA 1RVV1 3RUDA 4ZHQB 4R8KA 3ENNA 3L77A 4GRDA 1BH6A 5ALPA 2VPTA 2PYZA 4PU0A 1XA4A 3D6MA 4PLHA 1HEYA 1YGPA 2J7KA 3A6FA 3AUTA 5J5VA 3AJDA 4H7DA 1HTTA 1XHFA 1KS9A 4YQEA 1XK7A 2WAOA 4TT3A 1XRGA 1Q0UA 4ARVA 1DAFA 2H8KA 1CY4A 1JU4A 1L7QA 1ZD3A 2AG5A 2GCNA 2IBMA 3A06A 4TKVA 4D80A 3T5TA 4W9RA 4PZAA 3ZV4A 4CMEC 3WLOA 5LLDA 2HW8A 3P20A 4E3ZA 2C7PA 4KYUA 1XWWA 2WIJA 3E8SA 4FILA 5D3MA 4U8HA 1GRNA 1L5LA 4K3UA 1KKMA 4X7MA 4KQ9A 4E46A 1UXIA 2JIZA 1H2EA 4Q1FA 3JQPA 3LCRA 4MWCA 5KVAA 1ZOOA 2WLTA 4YJDA 2BFEB 5GIPE 3FUCA 3A2KA 1QE0A 2HWYA 3CUEF 4BLSA 2LDXA 5F1YA 4YI3A 4JLSA 1P6XA 4M9SA 4PHHA 5BSVA 5KYVA 3PSAA 1G7TA 1BMDA 5BY2A 1QK4A 2PKWA 3FWHA 1MXFA 2QPLA 4UHFA 2I0FA 1TDJA 1EXMA 4MW1A 4H60A 3N8HA 1QVZA 1TIPA 4KYVA 1HDGO 2DX7A 1RIIA 3FH0A 3NM4A 3P2KA 5EKXA 3ZY4A 3OJOA 2Y1OA 5SZIA 2P2DA 3HTNA 1XUOA 2O8DA 3BN3A 2ZUBA 3S1LA 4AIIA 1YOBA 1V0JA 2CXQA 3UCFA 4Y2SA 1A2QA 3TD4A 3MD0A 1NW8A 4IO1A 5CT5A 3T3HA 2QG9A 2ADMA 2ACKA 2C4MA 2IUYA 2NO4A 3ASYA 1IVNA 1R10A 2JFOA 3G9QA 1GARA 3NAZA 4L76A 1MHTA 2HEIA 4MO2A 3SQWA 1Z4KA 2JIPA 3MJTA 2ZWVA 3P26A 1CWUA 1QLHA 3E1GA 3VC7A 3QPAA 4R7ZA 4ZAYA 1MIHA 3KB1A 2BC9A 2D00A 1FNCA 2JS7A 4BRZA 2NGRA 2ATIA 1OFHA 1MXHA 5DF1A 2PL9A 4ED9A 1OI7A 2LBPA 3RLFA 1TFUA 4BPBA 3H9EO 3LFTA 1JQAA 3MJCA 1E9DA 2GF0A 1CUCA 2Z83A 4LQDA 4ND4A 5ALOA 2E18A 4US2R 2P4HX 3ELBA 1NVEA 4NNOA 2EWMA 3T52A 1LTQA 4PSUA 1FQWA 4ZZ2A 3G2LA 2JGKA 4LGCA 3DVSX 3UJPA 5JRZA 1T0PA 4YJFA 2YOHA 3AVQA 4GMHA 2QRVB 2Q6TA 1AKMA 4J0JA 4M3NA 3GT3A 5ESXA 3QFRA 2XA2A 1DJQA 3GEBA 3DOIA 1NZFA 4N6OA 5HVNA 2NO0A 2NOAA 3KB8A 5LB4A 3UK2A 2I3GA 2ILTA 3HM9A 4U39A 3GW8A 2EFCB 4IGAA 1G4HA 4DV0B 4IJUA 3D1JA 4MRMB 1MGOA 3M33A 5CRIA 3TZQA 1EX6A 1Q6ZA 1BS2A 2F9MA 3C6MA 4M2LA 7ADHA 1U0SY 2BZSA 3WK4A 1HG0A 1QHHA 1UBFA 1UCFA 2HA4A 3WPWA 2HQOA 3BZUA 2BEUA 4OB8A 5ICFA 2BJVA 1LRJA 2VDJA 1I0IA 2BEWB 3IYLW 1MT3A 2ZSAA 3M1IA 5JD6A 1ZOLA 3C8DA 5H0IA 3WAJA 4NX2A 2J9FA 2ONYA 1KMHA 1YRQA 4L9SA 4OAQA 4Z4HA 1G20A 3UGQA 2P62A 1EGAA 2E2WA 2A14A 1M8JA 2NVWA 3G68A 3G0CA 4JP1A 1B2RA 4QREA 2O7RA 1UAGA 2OUKA 3VMMA 3ZZNA 1DS6A 1ZICA 1JLLA 3KLPX 3MS7A 4MVJE 1XZGA 2JHFA 3HH8A 3LPMA 3HWUA 3WFIA 4TYYA 3CXCF 3WP0A 3INTA 2LKDA 4OOEA 4B4KA 4OHYA 1QM5A 5NULA 3LDFA 3WISA 4CM3A 5M7EA 1KDOA 2X1MA 1T5OA 3I58A 1E5XA 3S8MA 4C0JA 1VGVA 3U48A 2HPVA 1HOXA 3WMGA 3DFIA 4EO9A 4BNJA 3UBMA 1CERA 3IPCA 3IT3A 4LZJA 2GBLA 1JPJA 3CW2A 3FJ1A 4TLAA 3WQHA 1U7TA 3IDQA 1GNVA 1JQDA 1ABFA 1GO2A 3DFFA 4FC6A 3B2NA 4K46A 4ZVTA 5IYZF 3SFTA 4DWVA 2O8DB 1K8QA 3ZWKA 3F2IA 1XQXA 3M9XA 1RKQA 3D4PA 1WS6A 2JB9A 3GRYA 3B2QA 4P3XA 1KVUA 4HT3B 1ZS9A 2HV8A 2D7CA 3N2NA 2W8BA 1EJ6A 3GIWA 2JGFA 4MDHA 2QLMA 4C5BA 2YHIB 1KNQA 3HBAA 1DX6A 4I4LA 1KFJB 2C5EA 4YQFA 4WVFA 3IVAA 1XZIA 2H85A 3ZX4A 1PG2A 3QWAA 1SPBS 1VSBA 4EHFA 1RI2A 4PX5A 2ZJBA 3ORQA 1M3SA 2G17A 3IE0A 4UM9B 4S24A 1Z47A 2EBHX 2ETVA 3F6PA 3PXGA 3WKAA 3LBNA 2VTBA 1YRYE 5IT4A 1WDLA 5G41A 1X9GA 1X52A 4PZZA 1UBUS 2HA5A 5FTKA 2VJMA 1P4HA 4NU8X 4HF7A 1QIIA 5J4YA 1S2MA 1JSCA 4ZO9A 2O8BB 2O2YA 5CDUA 5A5FA 3VIUA 2PMKA 4IFBA 4BFXA 5DDIP 3ED1A 4BNXA 4NPCA 1KYQA 3DTVD 1JHMA 1GGNA 3MUNA 4IDNA 3M1LA 4NS1A 4B7XA 1QRTA 2FZWA 3HWWA 1NYLA 3A04A 5H02A 1Z17A 2QN6A 3BE6A 2AOUA 1K1EA 4MWEA 3RV4A 5C1PA 4B44A 4XSHA 5D51S 1E2DA 1SC4A 3CF6R 1I6KA 3N39C 4CN9A 1PK8A 3SR4A 5DWDA 3OU7A 4RTMA 1A71A 8MHTA 2IU6A 2FQXA 2HP0A 1X3SA 5CNJA 2EX1A 1Z88A 3BK1A 3MINB 1VHTA 4QGFA 5ETJA 1Z6TA 4EUSA 3N7TA 4WJLA 2O8FA 1W2WB 1RBYA 2P9HA 1A5SB 1K7YA 3E5MA 4LYHA 4H4DA 1U3LA 2G4LA 4DLWA 4MUKA 3QJ5A 3K0SA 5DHTA 3TW4A 1CP2A 4BP1A 5AIBA 1RWPA 5GGYA 2Y66A 4N9WA 1GR0A 5T6BA 4WFKA 3Q1KA 1NI3A 1QOZA 4KACA 5FAKA 2PBZA 2YTZA 4B40A 2CCKA 4IH4A 4AC9A 5AVYA 3IAUA 3MJHA 2HDNB 2JLBA 3QITA 1GNRA 2X9VA 5AH0A 4LXGA 1EBBA 3W2TA 3CT6A 3AVUA 1E1KA 2CB9A 5DBGA 4ENQA 3MBIA 3D2AA 4QQRA 1DWPA 1CK4A 1PUXA 3EZFA 4KVFA 1S01A 3GA7A 4H3HB 4UQOA 1CR0A 4Y2QA 1XDWA 3AY3A 3PXEA 5GZ1A 4F9EA 2Z8XA 4JK3A 3ZDAA 2W42A 4OFWA 4TRNA 5KTRA 1NQ3A 3EEBA 4F3RA 1SJ9A 3OI7A 4FFNA 1BSVA 5ALYA 2V8BA 4LHYA 3ZK8A 1YH3A 3T5BA 2BHSA 4OHPA 3DD5A 4CTKA 4RDIA 1CUDA 4MR9B 2XB4A 3S8EA 3NR2A 1IHXA 2YICA 4S1TA 4CYMA 3VJMA 4QA9A 3RDPA 2NV0A 3WWOA 4AL4A 3NDJA 1IEXA 3ORFA 1UM8A 4EFDA 1RXYA 3C85A 4Q3KA 1U7XA 2ECOA 2PZ8A 1ZYUA 2B25A 4W8OA 3RSQA 3TMKA 2HHAA 3GEDA 4C4YA 2AMTA 1NFQA 1RVDA 4G25A 3UM9A 3L41A 1RAEA 3TW6A 5ALVA 2VSFA 3BICA 3IXLA 3SBOA 1UEIA 2I2WA 2O2HA 2Q2QA 2C1EA 1THZA 3GJQA 4X6YA 1H0HA 3BWXA 2Y27A 4XGKA 1U2PA 3WIVA 5JYEA 1KK3A 1U8YA 3THWA 1VG8A 2GNPA 3O8OB 2CHUA 1HPLA 2WV7A 2HWKA 3ADPA 4NV0A 5F77A 1MW9X 1Q74A 2PZKA 3WOHA 1W30A 4GPTA 1R0RE 1N4AA 4ZJZA 3ZV3A 3RTDA 1ONSA 3HB4X 4FYVA 5JH7F 4UZFA 3KHNA 1E1MA 1RE1A 1H5NA 4KVZA 2K2WA 3AUXA 4OPMA 3P9RA 4FGKA 4HXFB 3O2SB 1XWIA 3JZAA 1GADO 2DWQA 1MH1A 2G9IA 3P9ZA 1AZLA 3AI1A 3D3NA 5HJ2A 1I32A 4Q1AA 5MHTA 3MINA 3NBMA 4BN5A 3KETA 1N2GA 2B34A 3GVPA 4C03A 4EJSB 3T5GA 3UNXA 3VC3A 4H4CA 1QQ6A 2OCDA 1I6LA 3IUJA 5M2QA 5L7TA 2L18A 3QFHA 3DDCA 1Q1GA 3G5AA 3ZP7A 4KWCA 5IABA 5REQB 2YXEA 3WJ1A 1LLDA 3HN6A 3K6KA 5CLGA 4Q6BA 5ALDA 2JJQA 2HA2A 2RB4A 2VCEA 2ODQA 3OEED 5HDBB 1JHYA 4K9KA 2NT3A 3NTOA 2FEAA 1O8CA 1KFCB 1N2CB 1NVVQ 2C1ZA 1CJSA 4LYGA 1C0IA 1AGXA 2JASA 2JLAA 3ZCPA 3JWGA 3EBOA 1DC8A 1PLLA 1R8SA 3M6LA 4P32A 1Z15A 2JFGA 5GP1A 1T8YA 4JU9A 4N12A 4N5NA 1W46A 3KOOA 4AZSA 2Q1XA 1T3LA 1DC5A 1SCBA 2C7BA 4B6GA 4HRAA 3N4YA 3NCTA 2X0RA 1M74A 5FUYA 3HCBA 1D1SA 2CMFA 2XCUA 5AJWA 2GOYA 2PFKA 5EKTA 1QSGA 5AMXA 4GIBA 4BX8A 4B3CA 2I03A 1J21A 4XPIB 3LOUA 2Z2KA 4ZO8A 2CSXA 1Z6AA 2HCBA 3G8YA 1NFRA 5LU8A 3DE6X 1NW6A 2G83A 3PVZA 4X63A 2LVBA 3EEYA 3AEQA 5HE9A 5LYYA 1S6YA 4TUYB 3H9JA 3J81A 1CJUC 3KJZA 3KKEA 4QFDA 1C41A 2R4TA 3E23A 2QI2A 1NYTA 1RWWA 3NU1A 3CEJA 5ITSA 4RIEA 4AWAA 3GLHA 1EDBA 2ID4A 4M8LA 5BWCA 4LY6A 1V4VA 3PK0A 1S3SA 3LKBA 3D3KA 2BGLA 2W6MA 5F4BA 5KU1A 1ODFA 5AXBA 4YRPA 4JXJA 3TDKA 5KKNB 4M1SA 4BPRA 2RIPA 1IHDA 1TMYA 3BWCA 1U2TA 4ZVPA 1Q22A 1DOAA 1GNPA 3MM4A 4R2HA 5EHQA 3VZSA 3R8FA 3NOQA 2R5NA 4HJRA 4YJHB 2FFRA 3V8PA 1HDOA 1COWD 1KVTA 2I8CA 4LXUA 1GSOA 1FTNA 3N75A 1N3LA 2XR1A 4JI1B 2YXNA 3SBEA 3A3OA 3WGOA 5DHSA 1X7ZA 2PS3A 4FMDF 4K9MA 2GR9A 5GOTA 4AY3A 4DMGA 2BE9A 2ZSUA 3AFGA 3TKAA 1G2IA 1PFVA 1ZH4A 2XMPA 1NONA 5CPFA 4CEHB 1A0OA 1EHIA 2PX2A 4EB3A 2JKVA 2YVLA 3Q1LA 3RSFA 3IQFA 3TLGA 5BWNA 1L5WA 2VPZA 4ITVA 4QTZA 5C1BA 1O2DA 2BEKA 1FZQA 2QTFA 3CKMA 4NWIA 5JS2A 5AKIA 2BTQA 3EWIA 4FLMA 1K68A 5GWXA 3WA7A 2QY9A 1II8A 1KSJA 1HBJA 4MWBA 2EATA 2F1RA 2F6RA 3ODGA 3L4BA 1LBQA 1WUKS 3OE7D 2WSLA 1P1RA 1K88A 1R0CA 4EI2A 2ZSJA 3UJBA 4DDHA 2XYVA 4M8KA 4RKEA 1AMUA 3PA6A 3P5SA 1WPGA 4XLZA 4IIDA 2VKQA 3QY9A 4P4UA 4Q05A 1LFAA 3CCRF 3CCMF 1PD1A 2KQUA 1LDMA 2PSHA 4JUBA 3PL1A 2HAEA 1BOOA 3U4DA 4DADA 1O94A 1BKYA 1YITF 2GCIA 1MVNA 5FR2A 2NU9B 1XPRA 3H9UA 3PQ5A 3TOZA 2VC2B 4X00A 1BGVA 3SQXA 3ICEA 4TWRA 1JSZA 2BFBB 3AETB 2H6EA 1WB6A 5C8YA 2NVUB 3T80A 2OV2A 1AZTA 3B89A 4IL5A 2G8LA 4NCXA 2IEAA 5FA5A 3KJHA 1J0AA 2J6CA 3KIZA 3IIEA 1ZJ4A 2VTVA 2VP9A 4AZVA 2GJKA 2VT6A 3HO1A 3BUSA 1XZPA 1PGPA 1CJTC 4GSYA 5EMNA 3JQGB 1KEKA 1YMVA 2QD3A 3OBBA 2AEEA 2VQSA 4NOMA 1WB5A 4O02B 4J0EA 4YP6A 2BR5A 3IKLA 4GOLD 4C05A 2Q8NA 4JT8A 1ORWA 4ZHWA 2XB9A 4FFSA 2PGIA 3JSXA 4XWGA 4RLSA 2V5UA 2XNHA 4WRRA 1A76A 5CIYA 1FVFA 2VS1A 1GCOA 3F0TA 4NU5A 1RRFA 3S99A 5ARBA 4BO6A 1X80A 2GQ0A 3L8YA 3U3OA 3M3HA 3I42A