3WGLA

Staphylococcus aureus ftsz t7 mutant substituted for gan bound with gdp, deltat7gan-gdp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
303
structure length
303
Chain Sequence
b'LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGANLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Structural change in FtsZ Induced by intermolecular interactions between bound GTP and the T7 loop
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
total genus 90
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3wglA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3wglA01
3R4VA 3RYFA 3V3TA 5IJ9A 4EB6B 3CB2A 1JFFB 5ITZB 3ZIDA 2VAPA 5CA1A 3ZBPA 1SA0B 3C8LA 5LP6A 3HKCA 5M7EA 1JFFA 5ITZA 1TUBB 4X1YB 1FSZA 1Z5WA 5FNVB 1SA0A 4TUYB 5C8YA 1W5BA 3HKEB 5J2TB 5IJ0B 1TUBA 2R6R1 1RQ7A 4X1KB 5J2UB 5LA6B 4TUYA 3RYCB 4ZOLB 4TV9B 3HKEA 4LNUB 5EYPA 5IJ0A 3M89A 4TV8B 4IIJB 5MN6A 5J2UA 3RB8A 5BMVA 5LYJB 4YJ2B 3RYCA 4I4TB 2XKAA 3VO9A 4TV9A 4LNUA 3RYFB 4X1IA 4IIJA 5IJ9B 4DRXA 2RHLA 1W5FA 3HKBA 5EZYA 2RHOA 3JATA 1RQ2A 5LYJA 1W581 4KWEA 5CA1B 3UT5A 5LP6B 3HKCB 5JQGA 3VPAA 2VAWA 4ZI7B 3WGNA 4M8IA 5KX5A 3RYIB 4O4JA 5C8YB 2RHJA 4IHJA 4WBNB 2Q1YA 4ZI7A 4FFBA 2GVIA 1OFUA 3WGJA 3RYIA 4XCQA 3WGKA 5EYPB 4WBNA 4EI7A 4ZHQB 5LOVA 5LXTB 1FFXB 5BMVB 1W59A 3M8KA 5GONA 4X1IB 1W5EA 4ZHQA 5LXTA 4DRXB 1FFXA 4O2AB 3HKBB 3JARA 5EZYB 3JATB 3VOAA 5JVDA 5MN4A 3VOBA 5CA0A 3UT5B 5IYZB 3E22A 3VO8A 4F6RB 5JQGB 4YJ3B 4O2AA 1RLUA 5JH7A 4HNAA 3WGMA 5IYZA 5KX5B 4O4JB 4U39A 4F6RA 4B45A 4IHJB 4O4IB 4YJ3A 5EIBD 4O2BA 4FFBB 5EIBC 4O4LA 3N2GB 3JASA 2R751 4E6EA 4O4IA 4O4HA 3WGLA 5LOVB 4I50B 2BTOA 3N2GA 4X20B 5GONB 4B46A 2BTQB 3N2KA 3JALB 2XKBA 4I50A 3JARB 4X20A 3ZBQA 5JVDB 3RYHA 5CA0B 3HKDA 2BTQA 3JALA 3E22B 1W5AA 5JCOC 5JH7B 1TVKB 4HNAB 1Z5VA 4U3JA 3JAKA 4O2BB 1TVKA 4O4LB 3JASB 4EB6A 2VXYA 4O4HB 5JCOA 5CB4B 3JAWB 2Q1XA 3N2KB 4DXDA 4X1YA 5FNVA 5CB4A 3JAWA 5KMGB 4EI9A 3RYHB 5J2TA 5MN5A 3HKDB 4X1KA 4EI8A 4I55B 5LA6A 5KMGA 4ZOLA 5LP6C 2VAMA 2RHHA 4TV8A 4U3JB 3JAKB 4I55A 4YJ2A 4I4TA
chains in the Genus database with same CATH superfamily
6REQB 1P5FA 3RTCA 3WFZA 3UV3A 4BQRA 2C2BA 3CMEF 2XUZA 3ZGXA 3KOMA 1X39A 2FETA 1QV6A 3MQFA 1TU3A 3DL7A 2X86A 4NV3A 3JAMM 2OM2A 3HCCA 4MUNA 1YJWF 1RWKA 3S0HA 3JWPA 4JLOA 4O63O 3NNSA 4AMVA 3RYCB 3VZCA 5HIMA 3LQQA 1DQRA 2QS9A 5CT6A 4J6EA 1UBNA 4MQ5A 2VK2A 3NMUF 3A2LA 4H3VA 2TYSB 4LNUA 1YH3A 4IZOA 2W2XA 2GN6A 5FTJA 4FE4A 2FPPB 1R0LA 3VNQA 5JRDS 5K2OA 2WSSA 1SGWA 2JA2A 1NQUA 4KN8A 3NT2A 5FPKA 3EPRA 3IE0A 3FYHA 3O8LA 4YRAA 2C4TA 3P2KA 3UW3A 1CBUA 2VEDA 4UPEA 4UUNA 3TMYA 1WXQA 4E07A 3AT1A 2BR3A 1T4GA 1B2LA 1QCCA 1RACA 1VCOA 3GRRA 1YRWA 5CX1B 1PW5A 3WDKA 3DUFB 5KKCA 5IH7A 1Z56C 1QIDA 5DBOA 2WSSD 5DGHA 3WAJA 2OSBA 2E4XA 4DM4A 3ICPA 5HILA 1TO1E 1XL0A 3ZHOA 4NYJR 2VSNA 5K3BA 1E6EA 1WJGA 2X6RA 1C1HA 3URKA 4MP6A 4RJTA 1UAAA 1V11A 4AQ7A 1U81A 1BE8A 3K0BA 2DKOA 2E6KA 1CJSA 1MXHA 2D5BA 1ZA2A 2J9FB 2R6GA 1SUPA 3H17A 2GCOA 2JGMA 3EZYA 3DE0X 3WA7A 1YIOA 2H51A 1GT6A 4WK6A 4CM4A 2ZJ4A 4UU7A 5COQA 3OUUA 3P0RA 1Y9EA 4JBXA 4U39A 1BTOA 1CJKC 1RBQA 5DISB 4M0DA 2NGRA 3W8NA 4ABTA 2RB5A 3BTSA 4YRTA 2CHQA 1W4RA 3CSDA 1KVSA 3FOWA 2DHQA 1PR5A 1U2DC 2ZW9A 4AULA 4G5GA 2Q29A 3ZXSA 1WMSA 4A15A 1L4BA 2ODQA 2YIMA 4EBBA 3UK6A 1Z8HA 2G09A 4INZA 5FWXA 2HHLA 3ZV3A 3DYIA 3KIZA 3G3EA 5A9TA 3X1DA 1ADYA 2HRUA 1SVLA 1T1IA 1Z22A 3V4ZA 1ZMOA 1CR4A 3Q8HA 4G88A 5JZBA 3JZDA 2YMQA 1FW8A 1WCWA 4YY3B 4L2IB 4W9RA 1YJBA 4JI3B 1UK6A 3NDIA 2W42A 4HAIA 3FJOA 1SVMA 2GH1A 4TKVA 4ZZIA 1NRXA 1PV4A 3HPQA 3PC8A 4NPCA 1UPUA 4JLSA 2PZEA 2C8VA 5MDHA 5ALEA 5CG1A 4NYMR 3ETGA 1U2EA 3L6UA 4BO4A 1R6BX 3IQGX 3LUFA 4JB0A 2CWWA 2X4IA 3I23A 4ZVTA 2NT3A 2P1RA 4B2IA 2CHFA 4TLMB 2B1JA 3FPKA 4S1WA 1RJWA 3GVXA 2IHUA 4ZVPA 4JP5A 4LF9B 5J2TA 1HDIA 3DLHA 2X0NA 1GRRA 1JDTA 5KMGA 1QYXA 2FGKA 3FIJA 2ZXUA 2NMUA 5HKOA 3TL2A 1TL7C 3VBEA 5THXA 3R5JA 1R5JA 4D82A 2WJ4A 4G24A 5I3ZA 4EHKA 1ZO8A 3GFOA 1VCIA 2DXIA 1G1AA 1E2EA 4RX1A 2VG8A 3VR5H 3OX3A 1ZVMA 3EWIA 4R2XA 4X8LA 1T1EA 2TSYB 2QSUA 1PEDA 2QY6A 3BTUA 3H99A 3K94A 4OQ4A 5FJIA 1GNLA 3EOZA 3HTNA 5AK0A 3RODA 2AEEA 3EIHA 1MRNA 3JW8A 5B3JA 2ZB4A 1VFNA 3BXXA 3RG8A 1I01A 1VK3A 2QUBA 2K87A 3BXZA 2BYTA 3NAMA 3NDBB 2HLDA 1VP9A 4O4HF 1NNSA 4UBLA 1W4BA 3O0TA 2VH1A 4G5OA 4XUDA 3SZUA 4F2DA 1Z63A 2P4UA 2CNNA 1HE3A 3B1WA 3F4BA 2HYDA 4WDQA 2ASEA 5DNAA 3MUFA 5DE3A 1Z2AA 4B34A 1K88A 3FVRA 2IP1A 3KAQA 5EESA 3RIXA 3IS3A 3CRZA 2FPGA 1E8NA 3FKSD 1M73E 1OBCA 2JFXA 2WFMA 1Q15A 3JQGB 4H2DA 5ETJA 2WHRA 3C3AA 2CGEA 2IVFA 1E7SA 3Q3VA 1THTA 1RPTA 3OEHA 5HKAA 2GJKA 1V9SA 2IS1A 1U28C 4HC4A 1ZVJA 3CCSF 2PS3A 4RKYA 2WWTA 3CPEA 1Y4UA 4AROA 4XCQA 1XMQB 1R4MA 3BF8A 4J6FA 3HDTA 1L4NA 1CY6A 5TY0A 2V97A 2X0JA 3AH8A 2MT9A 2XD4A 1JSLA 3K2EA 3X2FA 4ENQA 4DR2B 5KCZA 2VDKB 3ID6C 3NBAA 1UJBA 1C4XA 2C8LA 3CCQF 1N8TA 2YW9A 1KJWA 4V0OA 3NTVA 3ETJA 4D3DA 5KWSA 1WVMA 2VZ0A 1NY5A 4YRMA 2ZG6A 5A4FS 4Z0PA 3V4PB 1ZCZA 3UOWA 3VKGA 4LZOA 1SK8A 1NI4A 1GDTA 3A26A 1XTBA 1Q1ZA 2H3EA 3LVQE 1IN7A 1PFGA 1UODA 1RWQA 1HRDA 2BP7A 2ZTMA 1E3EA 4CQNA 5K2MA 4FZ5A 4O29A 4YR7A 4EKIA 3GNTA 5H80A 1XZHA 4J0CA 1DEHA 4EO7A 5JYCA 2PQMA 1ZK2A 2HJ9A 2V4UA 3KYCA 4X62B 1QFJA 2GCOB 3WK7A 3GEGA 1X7ZA 3AI2A 1YGYA 4DA9A 4QYIA 4CM4B 1O9HA 2NNLD 2ZIAA 2YJ3A 3RJ9A 1Y3FE 5IU6A 4U0KA 4H7HA 4LHWA 1EBFA 5BSEA 1DKNA 4GIBA 4FYHA 1EUDA 5J5AA 1UKAA 1IJFA 1IZYA 3OE1A 4CG1A 1EVLA 3U9LA 3OETA 4AKIA 4MNTA 2Q5FA 3CF4G 4X7RA 1T0UA 4MZXA 5CB4B 1IN1A 3VAAA 2VUTA 2FZWA 4PHTA 1KEKA 1FFHA 1P7ZA 2Q3BA 3FN4A 5FWXB 1T4BA 2H4FA 2OTCA 2UYPA 1B14A 1U3FA 3AF4A 4X1YA 3X1XA 4BQQA 5BNIA 4CDGA 3C14C 5LNK1 2O7QA 1N9KA 4NS1A 4R0NA 3ZY4A 4BQFA 2CZCA 3AM1A 1J42A 3G2IA 3SOPA 3TIFA 4BNTA 2C61A 2Y1WA 4CUKA 2P91A 3R5KA 4JU8A 4RHUA 3ETCA 4TKVB 4BNUA 3ER8A 3AVTA 5GONF 1L7EA 1F8GA 1Y3CE 1IU9A 2I34A 1E2PA 2ZWOA 2WKRA 3CEMA 4IQ8A 4W5JA 4AO6A 4BP1A 5FOSA 5KWVA 3WI7A 1AV6A 2VO1A 4DVGA 3C8DA 2MR6A 2FGJA 3TQIA 4GI3A 4ZN6A 3PC6A 4JODA 3OPYB 2P41A 4FBMA 3P9ZA 1Z5WA 3N2IA 1T8WA 4BB6A 2X4DA 5J2TB 1IQ0A 3KFXA 4NMLA 5I7HA 4ZYLA 2DPHA 2H4WA 3TTSA 3T6KA 2DCMA 2DWPA 4IIHA 4FCTA 3WLAA 3CHYA 4IQ0A 4F8EA 2R7AA 5F35A 3TXXA 2PY6A 5BUZA 3U3XA 3R44A 4G9BA 4BMPB 4OBWA 2XVZA 4ZIRA 5JBQA 5FWNA 1E1LA 2A7XA 2VDQB 2QQ5A 3AL3A 1ZH0A 5JSFA 4LCJA 1OAPA 1O6BA 1LRLA 3DKKA 3SZGA 4F96A 3BE5A 5F73A 4BVJA 3DMGA 5EMMA 1XCBA 2ZI4A 2ZJYA 4NU0A 2PT9A 3OC0A 1F3OA 3JYQA 4HH3C 2VCYA 1EVKA 2IYQA 3FPEA 2V65A 2I9PA 3FGZA 5EE1A 2FA9A 4CMBA 4JEUA 1MDFA 1YF3A 1OYVA 4XIJA 1CJMA 5FOUA 5A3SA 4DQKA 1MENA 1I5EA 4Z4HA 1PZNA 1IB6A 5AQ1A 1HDYA 4IF4A 1WP4A 5LOVA 2HBRA 4DCSA 2VDUE 1WLYA 3A25A 3P2YA 4IO1A 5CT5A 1VZ3A 4CT5A 4D8YA 2IEDA 2EYUA 2ZKLA 2ZIZA 4OFXA 2H4HA 4C7JA 3KTDA 2QD4A 2QEQA 3SFTA 1GZDA 1VQ1A 1VMIA 2H16A 3Q7EA 4LZWA 3P0FA 4C14A 1B6RA 4LDRA 3RF7A 3LPLA 2PTGA 4AP5A 3TOVA 4ZJUA 1UDRA 1A9XA 2FW0A 1ONIA 1I10A 2P75A 3V00A 3FWYA 3IQHX 4B80A 6Q21A 1BEEA 5B58T 3UCEA 4HWSA 2PH3A 2NSHA 1J49A 1R4MB 4RC9A 1QPGA 2P2CA 4ARAA 2X76A 4JJFA 3PUVA 3F4KA 3IJEB 4MRVA 2X2EA 3CLVA 1PUIA 1LPOA 1ZOIA 1ORDA 3NTUA 7REQB 4ESOA 5ELXA 3RHFA 1UR5A 3V8EA 1LQUA 4XRGA 3BWMA 2Y1EA 4C6SA 1DWPA 2YV2A 2H5LA 2E82A 3UV6A 1F3LA 3G88A 3L3BA 5E3HA 1P6XA 1X38A 1YRBA 2AZTA 1E2QA 2H1WA 2R6JA 2C54A 3EDRA 2YJGA 4N47A 3TLKA 1Z5VA 4FLFA 4B9EA 1QP0A 2DTDA 1L7QA 1NFFA 3GA7A 3T7CA 1DIGA 1NI4B 2ZYDA 1Z07A 3ZOZA 4IO0A 1G9XA 3W34A 1DBWA 1ZJ6A 2V96A 4ER6A 3JQBA 2IHZA 1Q7CA 4CLOA 3FWKA 5TE9A 4DAEA 3AFGA 5ER6A 5AYVA 1E94E 3G5LA 5ISMA 2OOKA 4K26A 3EDMA 1AD2A 2F90A 3F6BX 3OOYA 3UB4A 4NWOB 5J59A 1DJNA 4R4JA 5JY6A 2DWCA 3FFMA 1GDHA 3KYCB 1NHWA 1FP7A 2C7GA 1ZXXA 2C4HA 2OBXA 1H8EA 1X7ZB 1H2BA 2CK3D 3DEHA 3FMPB 4QYIB 4EO9A 4JHLA 3FYCA 5I45A 3IKTA 4QUGA 1QYDA 3B36A 1RWPA 3EEOA 3GY0A 3ZHQA 1WU8A 3RS7A 1QX4A 3RVDA 1Y89A 1IV4A 3R4VA 2I22A 2V7VA 3GD7A 3I73A 4PRKA 3MC1A 1XV5A 3RPEA 5CLQA 5J4KA 3ZLJA 3QG5A 1VQPF 4LSWA 1K0UA 3RF6A 2ENUA 4B62A 1H8ED 2P7IA 4GP7A 1VIYA 2IEZA 1E98A 1VGQA 4X1YB 1SUAA 3EF1A 3KAPA 4C4ZA 1AS3A 1MV8A 4R8SA 3QQPA 2D8MA 1N2JA 1XCPA 4PXYA 4OU4A 3TBHA 1Y6RA 5LJIA 3R8CA 5KU7A 1H4TA 5CXSA 1NVWQ 5ER9A 4D56A 3EZ6A 1XKLA 3IB3A 4WY8A 4AO8A 4BMYA 4K9DA 1SQ0A 1Z62A 3BRWD 1XCGB 2LCQA 4DREA 3LP6A 2EJWA 4LOLA 2GAAA 3LC7O 3OX4A 3W78A 4L5CA 1R64A 5G2OA 1R1DA 2JARA 5MFPA 1TUGA 1YQTA 3RNOA 2XYPA 4BB5A 2BI7A 3D0KA 3LF2A 2DY1A 4F2GA 2XNJA 5E1OA 3PSAA 4O4JA 4DLUA 4B73A 1GARA 1WEHA 3RIHA 4BMVA 3OTWA 1YXMA 2YN2A 3OLYA 3OO1A 4AWAA 2BSAA 1OVMA 3CT6A 3R8FA 1DCTA 1F7UA 3HYNA 3F1LA 3UQZA 4ND7A 1XPRA 2PLAA 3QTBA 2JLAA 3TQCA 2PWYA 2AR7A 5I3CA 1NR5A 2JJ8A 1ADCA 1Y3DE 4AWBA 2PAFA 1YBAA 3AIMA 3GWGA 5K09A 2YJZA 1B43A 1YCDA 3H2KA 2IHVA 4O2AA 1XT6A 2AJTA 3LRPA 5DWVA 4RTPA 1ESDA 1ADBA 1EINA 3BJRA 5JAOA 1CR2A 2E7ZA 2PGDA 1T4MA 2GTPA 4UTVA 4LTDA 5BV1A 4CUZA 4HEA1 5AH0A 5FQOA 5EMKA 1RXIA 4ZICA 4ACBA 1MX9A 3FPLA 3ROMA 2AWNA 3HB5X 1VBFA 1GFIA 5LOVB 2QXTA 3EB9A 3QEKA 4K3VA 1JS1X 4C88A 4DLLA 4I50B 5BSGA 3TF5A 1QKJA 1XQXA 2Y2UA 3AJDA 3A4TA 3PFBA 4OVKA 3TTTA 1X1SA 1PX0A 3GRKA 3GLSA 2ZPTX 3RS0A 2J08A 2EBUA 1ZWLA 3ANYB 1JBEA 4HXYA 2O07A 3EGCA 1F1JA 1QSGA 3VC2A 1AUVA 2GZ1A 3WGHA 3ZHUA 4DDVA 1PT8A 3WLSA 4RXMA 4MEJA 4ZOQI 1CCWA 1KZ1A 3EHEA 2GN9A 4Q9AA 4M38A 1N77A 3FSGA 3JQ9C 1PDVA 4R6XA 1JHZA 1CG6A 4JXZA 3NVKE 3K2XA 1EFVA 5EVCA 5LVAA 1IVYA 2NG1A 4ME6A 3ZCQA 4BMDA 4F1WA 4C4YA 3J81k 2OGSA 4RMJA 4YALA 4FB4A 2QLBA 2WTNA 1LI7A 5GWXA 1TADA 2D06A 3B7PA 3BXOA 4RACA 3S1SA 5JTTA 5E1MA 3RW9A 1WHSA 4RMIA 4CLDA 1GWNA 1T1GA 2GJAA 1M67A 1BA2A 4L8GA 3QE9Y 1EFAA 4Q34A 3ZKAA 1BQ4A 4G5HA 4DR7B 2ZB2A 3QWHA 1K8RA 1WD7A 3OOSA 3AHIA 3F71A 3TLAA 4BMCA 1HZZC 2BMWA 3JYPA 3V3TA 2BZ1A 1EXNA 3AU9A 4WCVA 4PONA 1T2DA 2GXSA 1JDUA 1D09A 4RZUA 5KNCA 1TYBE 2WIDA 3KLMX 4OU5A 4TYMA 3GTZA 5JDCA 4EA8A 2E4VA 3HXOA 3THWA 3D3NA 4ZC8A 4KQJA 5DTEA 1GCAA 4BGEA 4L3OA 3UJCA 2J59A 5KWIA 1A98A 1ZITA 3EXHB 5KSOA 3QBVA 1M5UA 4TLDA 2PANA 3GA0A 3AY6A 4I6GA 4BDTA 1A7UA 2Z8YA 4J29A 4WX2B 5C32A 4H6XA 1MNQA 1XAIA 2QNIA 2VZ9A 3QSGA 4MWZA 3RVRA 4QO8A 5CURA 3VQTA 1EZ1A 3ZP4A 3T5AA 1AC5A 3L0BA 3NKVA 4LWZA 5LBTA 4CMEC 1NBEA 4M98A 2R6FA 2WA1A 4KQ2A 4MQBA 1KQOA 3GLFA 3GEIA 4YK7A 5FFFA 3E70C 3ZJVA 4IDGA 4FNAA 1FFGA 3MS4A 5GIPE 1P44A 2Z2KA 2GETA 3B12A 1KK1A 2FG5A 1L1RA 2ZR9A 1SQSA 3G59A 3G2LA 4Z7NB 3CH4B 2GVIA 5EPOA 5BR8B 2JIQA 2G5PA 3F47A 5A4AA 1MAAA 3L8YA 3VSDA 3ZD6A 4C0LA 3E05A 4BC0A 4M1YA 3FZNA 4CKBA 3GCWA 3L8HA 3CR8A 3OT5A 1H5NA 1K0FA 4CLHA 221PA 2HJSA 1KQSF 3I2IA 4IPTA 4PZDA 1GG2A 1PNOA 2N1BA 1MKYA 1RXSA 1VPEA 2X5XA 1KAMA 2VHEA 4M1WA 2O06A 2ZB7A 3GNQA 5LYJF 3NMUC 4O4JB 1OE0A 1ABFA 4OO3A 5JDCC 5JJIA 2JAQA 2YZGA 4PE5B 1UAGA 3NP9A 5B3AA 2HU2A 4LYJA 4M8SA 2DHRA 1X9IA 2C2XA 4WERA 3PD0A 4WK4B 3G0HA 3F7NA 4IY1A 1UXGA 2GBIA 4AMUA 5LZ2A 3FNBA 4OXRA 5C1OA 3PNVA 3HHEA 1ZMTA 2GN1A 4MQLA 3RS8A 3T4PA 1T3TA 5DCVA 4PNZA 4PZUA 4RM2A 5BW6B 4BKRA 3ZBQA 1ZH4A 3D5TA 4WKCA 4N01A 1Q81H 1R6DA 1FNNA 2F1KA 5FUWA 2HJGA 3TNFA 1FP2A 4BAGA 3AR9A 2XNDA 1S3SA 1X77A 2CVFA 2FWJA 3MRTA 3CRRA 3K9BA 2WR8A 2QL5A 5BRJA 5JWOA 2XX3A 4KRGA 2VDPB 5EQFA 4CM9A 1QHIA 1IPAA 1TVKA 1TJNA 4R51A 4EG4A 1GXSB 3REGA 3DZHA 4RPIA 3PDIB 4X85A 4B5LA 2IY7A 3SEFA 1U0JA 2W6ID 1CK2A 1PWYE 2PA3A 3BTOA 3KR2A 4HLNA 3RIEA 4D9EA 3PXBA 2WT4A 5EXDA 5SY6A 3MLBA 3BCHA 2D3TA 3H5IA 3PHIA 4EYKA 5IBCA 1GQOA 4HZGA 1U3VA 4OQNA 2JHAA 4IUYA 2WU3A 3NC0C 1JJ2F 1T35A 5CCBA 1M0TA 1UK7A 4RK0A 5AXCA 2HY7A 3UMFA 4JXJA 3UTCA 3ZWOA 4MARA 2B8EA 1DIBA 4Y2RA 5A03A 1LTHR 4LXQA 4R31A 4G5QA 3O4FA 5C31A 5UKDA 1KZHA 5ALKA 1G59A 2PUAA 1VQ6F 3IO3A 4TTSA 2B83A 5TMBA 2PKQO 4WGGA 1RW4A 1DDIA 2ZRMA 4PVDA 3RHZA 1B0AA 3TK1A 1OTYA 2NTJA 4CKXA 1RP1A 2D2VA 2V3WA 5B1IA 3HY4A 1VMEA 2GEVA 2YTZA 1OU4A 2C2ZA 3TZ6A 1SXIA 121PA 3EDOA 3ETDA 3HA7A 3A1WA 3DHEA 3C6ZA 3CJRA 3MJDA 3VYRB 3BGWA 1NQTA 5FT9A 2ZJ7A 3NYIA 3W1VA 1OAOC 1W55A 1JIIA 1WHSB 2VUIB 3DXXA 2OCDA 1QIMA 3LLUA 3QPCA 4ZO4A 4BX2A 2QZPA 3E20B 1PGQA 4NSNA 4P1ZA 1KVQA 1DV2A 2A9QA 2Y77A 3IP3A 2H54A 2QRPA 2Q41A 2P3LA 3HUDA 4J03A 2HJHA 3RC1A 3UC5A 4ZCIA 2GXUA 3P2IA 5H70A 3RNLA 1U2TA 4FE7A 3MJTA 4DWVA 4PVCA 4ZCSA 1NQXA 4US1R 4JKIA 4QE3A 5I4IA 1BG6A 2BEVB 2VAXA 3O8BA 1UXHA 1QZTA 3ORFA 3LQFA 4C29A 4BUCA 4Y2QA 5JZMA 2PKQP 2PS0A 2J46A 4K3UA 5ICCA 3VBCA 1VQ8F 4LJ6A 1WZCA 4X24A 3TRDA 3UMCA 2QGNA 1JECA 3N2LA 5HHTA 3IUBA 5D84A 3U3RA 3LBAA 3VZSA 3PHJA 5B1EA 1AKEA 1H65A 1F5SA 3E15A 1SHLA 2ZDGA 4N1AA 1RJFA 4JGGA 2B4YA 3LQ2A 3HVUA 1EWTA 1VSBA 4FMDB 4RZIA 5ALZA 3VYSB 4EEXA 4XWAA 2GPNA 3CXRA 1CUVA 2P9QA 4HB4A 4R98A 2OAEA 4A0SA 3K6JA 4E7OA 4L0CA 1MABA 1JDJA 4QXOA 4D9JA 3E9DA 4B5KA 4DLPA 1J23A 5CD1A 4AJ1A 1JJIA 4J49A 2ZRJA 1RLUA 4QHTA 1B6SA 3LK6A 4GEGA 4LDQA 4RZHA 4KXYA 3M4XA 2IVZA 2VZEA 2ZBGA 3GGGA 3M6XA 2J33A 2VR1A 1Z7WA 2M32A 3IMCA 3MRSA 3CCVF 5L4LA 2PIDA 2IC5A 3GDOA 5F23A 2Y1FA 1KOLA 4CKBB 1RKBA 3N0TA 4ZT4A 4BFVA 1D03A 3PNYA 1FQOA 2V7QA 1YRAA 5L9AA 1W3EX 1LBIA 3I3OA 3EGEA 4G2TA 2HQSA 2I4NA 4MQMA 4XWKA 1EZZA 1BCSB 1E6KA 3NORA 5GMOA 1QH8B 3DZFA 3CEPB 1RYBA 1UL1X 2BM1A 1J21A 1BWRA 2OTJF 3EXAA 1QQTA 1LJLA 4I36A 4P2BA 3DOEA 2OD7A 3IIKA 5BSMA 1W88A 2AQ8A 1MOQA 4RS3A 2Q5IA 4TGLA 5ENZA 3J81M 3O92A 4NIMA 1N6HA 1JEOA 3MRVA 3QOWA 5DN9A 4PS1A 2V7QD 3AJRA 1USVA 4QTZA 2Q62A 2ZTLA 2OWDA 5CVTA 1ZICA 2XMPA 2F8MA 2FFAA 3HCBA 3QHPA 4F71A 4GI5A 4N7BA 2HPZA 3SKVA 1SFRA 3KE1A 3MGGA 5D8DA 4DIDA 1UXKA 3R5SA 2BMEA 5EXPA 4YYZA 2RBKA 3IQXA 2R6CA 1YWGO 3CUVA 1KO7A 3ELWA 2TMYA 3PICA 1AK9A 1KJ8A 2HNAA 2IIPA 3CCUF 2P9YA 2ZUBA 3JQQA 4UZEA 4EA9A 1QH0A 4TXMA 3VPDA 1H1LA 2NZUG 3K35A 5FWYB 1MW8X 3EG9B 4WCFB 2XA1A 1VFPA 3OH8A 4G26A 5SZIA 2IXGA 2YXZA 4DLAA 1QAMA 4R9VA 1R1MA 1CEEA 1I3KA 1FNDA 1JD1A 2F64A 1ORIA 1QYWA 2HR1A 3WIVA 4R9RA 4G5SA 2FE1A 3BMCB 3UJNA 4MVJD 1VL2A 1EXWA 1GR1A 3B78A 1Z6PA 3FR7A 4EL0A 4CKZA 5KYXB 1U63A 1DZIA 3LZCA 3BQNB 4GVLA 5IULC 1QLHA 5E3JA 2P7HA 3IOYA 3O2QB 2WWHA 2OP0A 1SVKA 3B9BA 1PLKA 2BKLA 5DNWA 5FUMA 2FY8A 4YP7A 2B4RO 4F86A 2A0XA 2C98A 1FQWA 1RJ9B 3MRXA 4M1SA 3WO1A 3IOEA 2AOVA 2YX1A 3FVTA 4PCVA 4CR6A 2R4UA 3BOSA 4AICA 1AKYA 3D9QX 4M0LA 3GMDA 1ZGJA 3E7WA 4ERHA 1UJMA 3EGXA 3I92A 4G84A 2IYOA 4YVFA 3RIYA 4CWAA 1E6WA 2EC5A 2PO7A 1FXWF 4DRXA 1XQ9A 3GRCA 1CLIA 3LUGA 5HGJA 2ZQ5A 2J8ZA 4IOKA 1ACLA 4XFKA 3VNVA 2WLTA 1ZN7A 1P6UA 2XWSA 4UW9A 1JAYA 1N2ZA 4Q05A 3D2CA 3D8RA 2R86A 5FL7D 2VAWA 4DUGD 4HDMB 2FMHA 3IKMB 1TYEB 3KAKA 3H5TA 5CLJA 1KVRA 2DTEA 2GD1O 3GN1A 4KRXA 5HZGA 3IGFA 1ELOA 1YVRA 2JJ1A 3DLCA 4R5HA 2I6UA 1N0VC 2ID9A 3WGJA 3Q6IA 2IOFK 2XBUA 1JQLB 4ZHQB 4NAHA 3INGA 2JH3A 4UHFA 4WOKA 2I29A 1QWOA 4RQAA 1LSOA 5IABA 3JAMA 2RKBA 5LXTA 3BERA 4OXIA 4A5OA 2FEAA 2HDNB 3BGSA 4UBIA 4G4XA 1ULAA 4O2LA 1BROA 1D4AA 1DL5A 1I3NA 4B3MB 2OM6A 3WLKX 5BUQA 4HDNA 1H4VB 3C6BA 5EIWA 3VHXA 1TD1A 4GE3A 4YRGA 1AB5A 2A9JA 1TW3A 2NZWA 1WXEA 3H05A 1YMQA 5B58C 2C5GA 2O2HA 3I37X 4BV9A 3BH7A 4RPKA 1ESCA 3C48A 4GDMA 5GZ1A 2IZ1A 4DARA 3D7KA 1CUYA 3LPMA 5EB1B 1CB0A 4RV5A 5DRTA 4XUGB 1B8VA 3UT6A 1Z5OA 1YE5A 2BT4A 2ZSIA 521PA 3A6PC 5CNIA 1TQHA 1NT2A 2C9ZA 2VP2A 4GZLA 3VJLA 4WUVA 3MCAB 1NDUA 2OO5A 1MABB 1B16A 3E81A 4BWVA 2OR3A 2Q4TA 2VT7A 2IOFA 2ZIFA 4JS0A 4UAUA 4LC0A 1NXVA 3SZOA 1K5DA 4NI5A 3O83A 1WMFA 4LHXA 2GMWA 1K6XA 3PQ5A 2WAXA 4JLAA 2EZ8A 3K0HA 4LYFA 3UYKA 2W2PA 1GQSA 4DKJA 4LXIA 3W2IA 1D9ZA 2IEIA 1I4DD 3QUBA 2B36A 3I12A 3LOUA 3E5HA 3IQDB 4EY3A 4EPWA 5LIPA 3PQDA 1KMCA 4G5YA 4L75A 3UEOA 5B6JA 5L6MB 1XVUA 1ZWZA 4MKGA 2Q28A 1TLLA 2VH5R 3EH2A 2ODAA 3W6OA 1G42A 1R0YA 1IAVA 1FJHA 4FUQA 3S29A 1AT1A 5BURA 3OIUA 1QIJA 4FEAA 4TTRA 5IH3A 3ZE9A 1N6RA 3HWX1 1PWHA 3L8DA 1Q8RA 2BKXA 2JVIA 2ZYUX 3G5UA 4MV6A 1H1DA 1W88B 1U0RA 3PRHA 4GUAA 3TDMA 2VTBB 3N0RA 5FL3A 2UVPA 3E3NA 2XJ4A 4IDBA 2FUNB 2FXVA 3OPYI 1D7OA 1UP6A 3I4FA 2I5PO 4YDRA 2ZS7A 1QVAA 3RI3A 4BLRA 2XECA 1JYEA 4HN4B 3KJHA 3IELA 4MH0R 5LZ5A 4UM9D 2A0FA 1TIKA 1KAEA 1QV9A 3AUAA 5DGIA 3RV4A 1GZ3A 3L7IA 1A1SA 3CPJB 2H1SA 4AZTA 1I1HA 4ZYZA 2PUFA 3QLTA 1PGNA 1AKWA 4J3FA 4O4IF 1H1LB 1KYVA 3SBXA 1FSGA 1P0FA 2HK7A 4URZR 2BBWA 5H59A 4GHWA 3MWJA 3UCFA 2JB9A 3DEJA 3S03A 4P31A 3ONDA 2PWBA 3CRMA 1G0OA 1BXGA 2QM8A 2R00C 5L7WA 1QMGA 1GL9B 3MQ2A 3OG9A 4AN1A 2Q8PA 4BIIA 1T15A 1R27A 5AK3A 4BCDA 3H4IA 3HU3A 5T8KA 1NJSA 1P1CA 4G0OA 4DLYA 3CG4A 3GFFA 1N6PA 4J2OA 4X54A 4ZVQA 3T15A 3L04A 3WISA 2XOKD 3GB9A 4CMHA 3KYDB 2EZ9A 2IYXA 1EFPA 2QAJA 3QELA 2JI4A 1UP4A 3HWUA 2JAWA 2R8XA 3VGPA 2YC4C 3NXSA 4G01B 3U81A 1QHNA 1TEHA 2CB9A 3EGXB 1OYOA 3ZZUA 4TLCA 4JBYA 1V6CA 1XWFA 3BX1A 4DRXB 4LWQA 1NDHA 4BBAA 3FWZA 3PA6A 5CT8A 4X95A 3DAHA 1YL6A 2UXCB 4G1CA 1HQCA 4NCXA 3VO8A 2BFBB 1HTWA 2ZT8A 3H97A 5IZCA 1FU4A 5KSYA 2QVBA 2YWGA 3PHHA 3DA8A 4WFQA 4RMGA 4ZDWA 3U19A 1HZJA 1O8BA 2TMGA 4IS2A 4S35A 3G6WA 3HL4A 3R3ZA 1HDZA 2CMDA 5AI6A 2HTFA 4PHHA 3F5QA 1GG9A 1ARZA 4KQWA 1OREA 2TMDA 5DM2A 3T1HB 1YDHA 4OIMA 3DAOA 3TSWA 4RVGA 2C07A 1NU6A 4K7JA 1UAYA 1YU6A 1FYEA 1NI5A 2F1HA 3D6UA 4Q3DA 3O9VA 4TPKA 2DF8A 1Q91A 5EJ2A 5JXGA 4O0LA 4RJIA 5IAJA 3UMGA 3IP7A 2EFDB 4A92A 3EVAA 4MCIA 1CC1S 1N9GA 5D3KA 3AOEA 2HMAA 3GJZA 3I3SR 1E2JA 3E7XA 4YJGA 1C7JA 2RGCA 3QTLA 5EHGA 1EWRA 2FP3A 4RHXA 1L5HA 3TZEA 1E58A 1EHIA 1GN8A 1EFHA 3WBBA 4I5GA 3DMFA 3ITNA 2HHHB 1MTOA 2KGWA 3VV2A 2Q21A 4KXLA 4UNIA 1VA5A 5EZYF 4JMPA 5FIUA 3OPXA 3ZDXB 4RHAA 1TTQB 2I1QA 1XRPA 4J0DA 2CBGA 4Q03A 1E60A 4P6VF 5G0UA 3QKWA 4PU0A 3RVQA 3K3PA 4AB1A 1I1QB 1PXWA 4DR6B 4PYRA 1OLUA 2O52A 2BGJA 4UUOA 3I64A 3IT1A 4NOMA 3H1BA 1FUKA 5CPFA 1DBIA 2MYUA 4A8PA 2VDLB 3PF9A 4OQPA 4P4SA 4Z7JA 5K0BA 1EI9A 1NMUB 1JB9A 1QIEA 3QBTA 4LE1A 3V97A 4BNDA 4CLRA 2CLLB 3FTQA 4BGIA 2FWAA 2RCNA 1NUTA 3C24A 2UYOA 3A14A 2FEMA 3I8OA 4RQTA 3WYNA 4RTRA 1ZJZA 4ITVA 2QTPA 2NAFA 4S0ZA 5IN5A 4F85A 3TNLA 2E1PA 2AF3C 4KFUA 4RWEA 1K9MH 1UIRA 3G2QA 4YA6A 5GOZA 1DGQA 2O3UA 5KEIA 2ZEJA 4KR7A 1F6WA 3F78A 1PAUA 2NO9A 1WOYA 5IDYA 4R1TA 2H1IA 3L6BA 1ZH2A 5EP3A 3B5EA 3G7SA 1W9MA 4H60A 4KI0A 3ROEA 4LW8A 4JLMA 2CUTA 1RC0A 1NIJA 5H0IA 4WZBE 1Q86H 1G8KA 2FUKA 1DC3A 3TZCA 2E0IA 1OW3B 2OAP1 1LB1B 3OEED 4UFPA 2IW1A 5BSTA 4CDNA 4X7BA 5CAEA 1M8PA 5GZ3A 3AL2A 3IUYA 4GQIA 2WSIA 4LCKA 3LVRE 3FWPA 1G21B 1ZM2A 3FCAA 1UDWA 3G2MA 2PBZA 4PC2A 1MB9A 4H3KB 4FUTA 3MB8A 1W36C 1N34B 3DOHA 2H17A 2SICE 3MBOA 4IG4A 4KE7A 2F9MA 3SBDA 1UF9A 3ZUGA 5DTIA 3QK7A 4HDKA 5G0TA 1CRPA 5KTSA 4NPAA 2IH2A 3ICEA 4MR8B 4UOEA 3TMKA 4C1NA 1R3DA 2FPXA 1EVEA 3KVVA 1KMQA 2GNOA 3BF7A 3RRZA 1KU0A 3FUUA 3H4TA 4WBSA 2JW5A 3O8RA 4TMXA 2LBXA 4B81A 3PPIA 1QNFA 2A1UB 2CLEB 3KALA 3MAJA 2NYAA 4R6WA 1BXGB 5IT4A 1ENZA 4JDPA 4N9WA 3JWGA 4NX2A 4UCQA 5ITWA 1O6ZA 3OSUA 4CV3A 5B6PA 3E5RA 2Z0MA 4XLLA 2WY2D 5SYMA 4IIGA 3U49A 1D6MA 1CZOA 1V6SA 2P6MA 2FK8A 2QWXA 5DZSA 2YN0A 1Q1GA 3HYCA 4KQXA 3VYUB 2EWVA 4PSAA 1YOVA 4ODIA 2I03A 3JASA 2RARA 4X97A 3HC7A 2QMQA 4HBGA 2P2NA 2VJKA 4LDAA 2WJGA 3ZWCA 3UGKA 3HJFA 1QGUB 1KEZA 1N2CA 2YWCA 3GZJA 4Q7QA 4C2UA 4OM8A 4DNQA 1KBZA 2X22A 3R2JA 5TGTA 4E1AA 4HTFA 1P19A 4ALJA 1K89A 1KARA 2VSXA 1PO7A 2ZT5A 4FFSA 3HDVA 1YCGA 3N5CA 4HH0A 3ODPA 2I2XB 3D1LA 3HBJA 4FINA 1PJLA 4K1XA 3T3NA 3ETHA 3A1NA 1NQVA 2W2LA 2KYRA 3AVQA 3HLKA 4RD0A 2PTHA 4L4RA 1YFKA 3HJWC 2RONA 4RM3A 1K7YA 3N86A 3UJHA 1Q17A 2BHSA 2PGXA 4QDZA 3MGKA 3T1TA 2WWIA 5FUBA 4J0GA 2E2WA 2QW0X 3EW7A 4B47A 4K9SA 3D64A 4TVBA 2J3IA 4GBJA 5E1DA 1E6UA 2YICA 4B76A 3KK0A 3EIQA 2W2LD 3INRA 1TKAA 1A04A 1BS9A 1JAIA 3QW4B 3JQ8A 3T8YA 5A3JA 3ADPA 4MPJA 3MW8A 5BQOA 2FV8A 3PEEA 4PIVA 1Y1RA 4MA4A 2R8ZA 2WTUA 1KZ9A 3CLUD 2K1SA 1XG5A 2BW0A 5F21A 1L5HB 3RRNA 3TLMA 2QD1A 4QBIA 1JIVA 1OYWA 2L17A 3V2UA 4AUMA 4ETMA 3CCEF 5AW1A 3MBKA 4DV5B 4DA4A 2R8RA 1QWSA 2NZVG 3WQRA 2P2YA 3BCUA 5HF6A 3W5UA 2X58A 3BRSA 3FR8A 1GVHA 3M33A 5TS2A 3GI1A 4JT9A 5EB0A 2QV7A 4G4VA 2Q9UA 3Q15C 1QHXA 4KN9S 5B1DA 3SLGA 1G20A 3WSWA 4BRUA 2BPOA 3NHMA 3G9UA 3GLIE 2WWRA 3NANA 4WZAE 1FVFA 1KQNA 5TS3A 1SQ5A 2REXB 3LT1A 1IOVA 1CR1A 1P77A 2VZ8A 2WF8A 3LHSA 2V7GA 2X6QA 2ZJOA 1S7GA 4DN6A 5BNFA 4QPNA 2VJOA 1QZXA 4BMXA 1ZCAA 2KBFA 1AUXA 1RKXA 4G3XA 2ZYTX 4IMPA 4DR1B 1AXRA 2CVOA 3U3ZA 3K9QO 3SYTA 2FQXA 4AYXA 3NOQA 2C2KA 5AUPB 1ZI6A 2QT9A 4XYLA 3SWWA 4A27A 1DAGA 2HGZA 3JTEA 2P6YA 3I4CA 1ISMA 3AVXA 3AHGA 1T0AA 2GGSA 3SQOA 1WUKS 1SELA 1OFUX 4ZV4A 3WGNA 3E03A 4RTSA 2W6NA 1RWXA 2YJ6A 3OJLA 5FV4A 1YFJA 2AZXA 1NQOA 5HP7A 3MAGA 2HSGA 2VK8A 1JQEA 3ROKA 5CHYA 1L5MA 3DDNA 1DVRA 1LZKA 2FX2A 5HK9A 4JU9A 4MJ3A 1NUQA 4QD3A 2OGWA 1U0EA 1UZNA 4LY0A 3I53A 1WZ2A 1YS9A 2C9BA 3AR5A 3DHYA 3X2EA 1FTQA 1P5HA 4XD7D 1X19A 1QD9A 3EZGA 3LKDA 1KDYA 3X1MA 3U7RA 5A9RA 1WCYA 3M81A 2P62A 3O95A 4NCAA 2C2HA 2H63A 1SG9A 1ZM3A 3MYYA 3W1EA 3ESCA 2XQVA 1P1FA 2G7MC 4FOSA 1BXZA 2PX8A 3V4VB 1EUCB 1W87A 2J9GA 3CC4F 3GX1A 3QXSA 4PEVA 3SBOA 5J47A 4DNXA 2YQ4A 4L4XA 4LJ5A 1Q16A 2OAQ1 3Q7SA 4M55A 3WLEA 3DDUA 3WK5A 2UXDB 3SK0A 2ZSUA 2PKWA 5AK5A 4UMEA 3OTHA 5CDGA 1XZIA 2ZI3A 3G0OA 3G0CA 2JRLA 2AD1A 4Q1FA 3JVIA 1KYWA 1DOHA 2Z5GA 4I14A 2F8SA 1SKQA 2C2OA 3CLSC 4BVQA 4R8MA 1XX6A 2RGAA 3U3OA 2O3QA 1KQGA 4PSUA 4NXMB 1KOFA 2CYAA 2ZTSA 4UE6A 4AUKA 2CLIB 1DBQA 4C78A 4U7FA 2EQ5A 4KVAA 5F51A 3X1JA 3U3JA 2OOSA 3IUJA 4IXWA 4TWAA 3VNBA 5JPCA 1J0XO 1D0VA 2AN1A 4ND8A 2Y1KA 1YOVB 4W7IA 5CYOA 2IYZA 3JASB 5FLXM 1CRLA 1HG0A 2Q5OA 3Q9SA 2VXYA 5EINA 5IYZF 5LC1A 3RA5A 5DSTA 3BIJA 4XQGA 1N2CB 1P9NA 4NBUA 1BSVA 4WKGA 4MWBA 1SXJE 1M1NA 2BWJA 1C3LA 1EBUA 5FNVA 1L2TA 3FLEA 4HTFB 2BI8A 4I5FA 2R65A 4HK4A 2JNWA 1U04A 1Q0ZA 1UK9A 4BC1A 1Z4JA 4M0EA 4QTXA 4Z0HO 4PYKA 2CD7A 4ZOLA 2OZEA 4MR7B 2ZSKA 1N3BA 1VB3A 3QFFA 5ELLA 5FI3A 3C4QA 3EWNA 5ESDA 4CIWA 3IDSA 4FHGA 2QE6A 1F2VA 1AA6A 1Z39A 1DRUA 1QYRA 2P4HX 4ZYVA 4DUYB 1YQNA 1FW6A 5BO5A 3TAXA 2G40A 2XMSA 5DHAA 2Z1NA 4JBHA 4QVGA 4ML3A 4ZJPA 5HMLA 2FJUA 4JMLA 1TUBB 2WEKA 4ZMSA 3JQ8B 1VG8A 4UNPA 1WCV1 4Q7MB 1H2WA 4QU9A 2P6RA 3T5GA 2JGAA 1U0OC 2DSNA 1NONA 3EAGA 2GN0A 4LGVA 3FFXA 1UJNA 3RE3A 1ZN2A 3QITA 3LIPA 4L0QA 1HNNA 1QOQB 2VDMB 3BMQB 3MFQA 3RAJA 3AF2A 3B1JA 4KAJA 4MV8A 4DE5A 4MYDA 3NHKA 1QAQA 4OKSA 4IIJA 1I33A 4MV1A 5K0LA 3EMKA 1YZ3A 3DLAA 2IYNA 1G20B 1WPQA 2XZTA 5IVKA 5KDDA 1ZRSA 3AHDA 3B60A 1VE7A 4YCAA 2Q3LA 2Z2IA 4AG6A 1QCDA 1BKDR 4HWRA 4I9GA 5BPHA 5YASA 3C41J 3M5DA 3P9XA 4EW3A 2NW6A 1W93A 5HDBB 1W40A 2RGBA 1BEZA 1QPBA 2X77A 4KFCA 1Z0KA 1E79D 1RTKA 2RH5A 2XUPA 3FCUB 4JBWA 5KI6A 3FFAA 5A02A 1A71A 1BD3A 3V8RA 1TGYA 2JFHA 1BHJA 5I6DA 1NR1A 4QDJA 2VP3A 1X2EA 1G0NA 1USIA 2G28A 4RANA 3WWCA 4YLYA 5C80A 1S2DA 3E22A 1U31A 1PS9A 2WB2A 1IUKA 2GAFA 4IICA 4G0NA 2J5QA 4OFZA 1TO2E 3KSBC 3N6XA 8LDHA 4EHLA 5DM0A 2HS4A 3K1ZA 3GIDA 3H0KA 3T3OA 1FBNA 2MSEB 1FTSA 5ALTA 5T41A 1M1YE 4C3OB 5E6SA 4P5EA 5EP1A 3NLLA 4F11A 2RBGA 2SECE 1W30A 2ZR7A 4RPGA 5ALMA 5JLAA 5K0TA 4N5IX 1TJ4A 1ZM4A 3EVTA 3K0FB 3PD7A 3EARA 1DKUA 5K3OA 2I3AA 2OC9A 3FYSA 3M1LA 2WYVA 1ICIA 1PQ4A 2VJCA 3D0RA 3H9BA 3IEQA 1F60A 2WQZA 5CGQB 5BNZA 3MINA 3EZ2A 5A3QA 2VQSA 1RKUA 1OLSA 1OZHA 2HAEA 3B51X 3EDYA 3ENQA 2Y0CA 5IMSA 4LV5B 2PLWA 3MS2A 5E9QA 1YRLA 2LBPA 4PO8A 3PNLA 3TNYA 2GA8A 4CU2A 3EX7C 3C15C 4ZANA 5JALA 1JBKA 3CMMA 3VAYA 3O9MA 1U9YA 4GBGA 4C0KA 1TLTA 2AXQA 3GJ0A 4FLEA 4C3UA 4KBYA 4PCUA 2PUHA 3B82A 1ILEA 3DWEX 2PX6A 1Y5IA 3PCRB 4FONA 1NMXA 1BHO1 1RLOA 2CFSA 2HHJA 3L01A 1GRVA 3WYEA 3ZWBA 4H3HB 1XXHA 5DCUA 2X9VA 3E3OA 1KS2A 2ZJ2A 1T6XA 2ODPA 3S68A 2WYUA 1FJ2A 1XE3A 5IXJA 3ADCA 3NAQA 1Q0PA 2CVHA 5G4VC 3B2QA 2I2BA 3GR6A 5AKKA 3STHA 1B00A 3HM9A 4D74A 2FFHA 2PEZA 4FZVA 1N7GA 1PBTA 1SOWA 4Y0AA 5D5HA 2QK4A 5JH7F 4ND8B 1GQQA 4PFKA 3EPKA 4ND4A 5H1YA 2A6PA 1XTSA 3GGDA 2CXUA 2ZCVA 3O31A 5CA1A 3Q9UA 2V9PA 4JJ4A 5CVVA 5D5PA 3U40A 4KYUA 1U2GA 4UOZA 3FTFA 3SKXA 5LZ9A 4GM1A 1Y1TA 2VBIA 3WB9A 5I9LA 5FNVB 5TJHA 4YJ3F 1KDZA 1VIVA 2GF2A 2F62A 2OZVA 1V41E 2YINC 1BQ3A 1NMEA 2GRAA 4MKFA 4P4LA 1R6VA 4BB0A 4U9HS 3SR0A 4ZOLB 1P39A 1VLQA 1AQUA 2ETXA 3QUSA 4IYRA 4CKYA 2IPLA 3EMVA 5D3ZA 3GRFA 4CLEA 2V7BA 5CNJA 5SICE 1Z2DA 2I67A 4C0BA 1NVDA 1Z2OX 1RR6A 2W2OA 3DV2A 1U8XX 1R0BA 3DT6A 1LSSA 3A9CA 1N5JA 5K8VA 5EMNA 2MOKA 1IXRC 4ZI7B 3D1JA 3TUJC 1T3GA 2B0JA 2CNBA 5LB4A 1G38A 4JEIA 2GHTA 1TJ5A 2YY7A 3MS7A 4QHYA 4D8TA 1X52A 2GOYA 3D8UA 3OJXA 2CNWD 4LUCA 4CIAA 2AUMA 2JI9A 5BSKA 2H5IA 1I2BA 2J6CA 3KQQA 4U63A 4EY5A 3DJYA 4PHFA 1SKYB 1CY4A 2H52A 3BJMA 3E1KA 3GYBA 3OQBA 3PCXA 4UHCA 4ZA2A 5K3AA 4MI1A 3HG7A 1HYEA 3WB0A 4DNOA 4YJKA 1ZOSA 3MTJA 4K6KA 4G8JA 2PYDA 4L0MA 3UMVA 1ZKDA 1GL7A 4CLOB 5BXQC 3I5YA 2GASA 3VKHA 1QHHA 4AKTA 2C20A 2WZBA 5JI3E 1CUEA 1COZA 3MCTA 1SNYA 1GKYA 1TZBA 1BDJA 3AYXB 5CT4A 1DRJA 1XFAA 2W8BC 4PLGA 4NZNA 3ICCA 2JIDA 1IWPB 2O2JA 3ZXUB 4U2CA 1FCJA 1UBTS 4IJUA 3RWBA 3CTPA 1XQ1A 3HO8A 2QVXX 3QPUA 4D3FA 2ZZMA 1YR6A 4L3VA 4KIWA 3KNZA 3GVIA 4QULA 3HGMA 1JVSA 3NIWA 1PKXA 5M2QA 3KB8A 3ST7A 2O19A 2Q2QA 2VHXA 1V8FA 4QWMA 5J58A 4LK2A 3RROA 3G71F 1WSAA 1E0SA 2QAGA 2QM7A 1IWBB 3R3YA 1STOA 4YI3A 4A0HA 5ALNA 1M1ZA 1PDOA 4NG4A 4JT2A 2IGTA 3C8HA 4MRSA 2VJDA 3D43A 2O7SA 3TQOA 3TR0A 4CIBA 4E3ZA 2GN8A 2X0EA 1IPFA 2Y27A 4O3MA 2R7MA 3E22B 1U9IA 3WWYA 3LFOA 3NHWA 3QLUA 2RHCA 1QQBA 3IALA 3QUTA 5A3VA 3BN3A 3P19A 4PFJA 1R50A 3MWEB 2PUTA 1ZL0A 1IJKA 3DKRA 4MVJP 2DQZA 3ROZA 3N75A 2VPTA 8OHMA 4X7PA 4E94A 2ILTA 5G4UC 1HDEA 5CJ2A 3C5EA 3HFSA 2ZR0A 3SN6A 3B1YA 3VDMA 1HFEL 2WHPA 4L07A 7AT1A 4M0UA 4FFRA 3A2NA 1DBPA 4HLDA 2XV1A 2PM8A 3EF0A 5ARDA 3GROA 1L8XA 1SC3A 3HJBA 3QNMA 4AMZA 1N2HA 3ZGLA 3AL0C 3BB1A 2ZJ6A 1CUCA 2NZXA 2C0CA 1KVTA 3EDCA 3VU9A 3AM4A 1WIWA 3IC5A 2B5OA 3PC3A 4WH0A 4G0VA 1JE1A 1T91A 1YBMA 3QHDA 2J4CA 2P65A 2ROQA 4RPJA 3SX2A 4RTJA 3RARA 2PQ6A 3WDSA 3R41A 4ZRMA 3KX2A 4I9UA 3NU1A 3H1PA 4JL5A 3WXBA 2BMAA 2KB0A 3VVBA 4BTVA 4MVJI 5AHWA 1YNSA 1NBMA 2D4AA 1XXHB 2BEKA 3GT0A 2X7HA 3A1FA 3FE2A 3P2OA 4X63A 1LK0A 3PVZA 4L85A 2Q7OE 3J81A 2ZULA 2P9HA 1A9TA 5CDFA 1Y1KE 1KMHA 3HWWA 4P3OA 1X1RA 1K86A 1E1YA 2FDCA 2HMYB 3AJEA 1KC8H 4JQOA 2RKOA 1EB8A 3W5AA 1QC5B 4FLMA 2DOKA 2C5LA 1V3TA 1TCCA 1Y4AE 4CIVA 2XWPA 1TEVA 2NU6A 3VH1A 2IYLD 5IRCD 3JATA 5CA1B 4RDXA 1SOUA 4P3NA 1PUXA 2PSEA 2DH5A 5D3QA 4HPJB 2EJCA 2AN3A 1BHSA 3P9CA 1OF1A 2A5LA 1AGYA 1L0BA 4HDRA 4XD2A 5NLLA 3GFTA 3U3MA 1DXHA 4F97A 1U99A 2PKCA 1QP4A 1W85A 2O4CA 1G19A 2UV8A 3N8KA 4L16A 1W19A 1PG5A 1AIPA 3CUSA 1G5PA 1UMCA 2ZJ3A 4X8OA 1U65A 3RBVA 2WSLA 3B20A 5EWJA 1SVIA 5IAKA 3TE6A 1XPUA 1NMSA 1KC3A 1ZCBA 3T12A 2ODNA 4P82A 4IMRA 2JI6A 3ZY2A 3U56A 2FEPA 5T6BA 4NH4A 3W6NA 2WJJA 1VJ5A 1T29A 2AIZP 1ZA1A 4MAAA 1BMFD 5KAPA 1L8OA 2GD2A 4EUHA 4TV8F 4KR3A 1P0QA 3KQKA 1Y6JA 1VLHA 4C8EA 4GGOA 1HLPA 1M8GA 5LQMA 1TJ3A 2ISQA 3VOSA 4ZAGA 1SZCA 2D2EA 2P67A 2B8NA 1WUYA 2Z2ZA 3AXSA 1B76A 2GK7A 4XYGA 3KSDO 3F6CA 1EIWA 4F56A 4DIEA 1S2MA 1V35A 3GDGA 3RSSA 1R6TA 1C9EA 1ODKA 3JXEA 3M5PA 4WMLA 5JNLA 1T0BA 4DHWA 1NM5A 1E5QA 4MA0A 4GL4A 5JJKA 2AMFA 5ECGC 2DSTA 2Q7DA 3B53X 2BTQA 1RZUA 3BWXA 2QN1A 1CEQA 1YU9A 2IEYA 3HA5A 3MMZA 3NI2A 3FYUA 3GLGA 4US0R 4EW6A 1Z3CA 1SHZA 1Y8QA 3SY8A 4JYCA 3WP1B 5I9IA 2HLPA 4J1QA 2H8GA 1BRTA 3D5EA 3SQXA 5T6MA 2G82A 2CL0X 2RI0A 2L19A 1S01A 2BZGA 3H87A 3PZRA 3M3DA 1DQPA 4A6EA 4YMLA 3CBGA 1FF9A 1OPRA 4L5JA 5JCOA 2ZUDA 3DL2A 4RZSA 1QIHA 3LHIA 2AUNA 3W7VA 4D9CA 2QAGB 3EA5A 4K28A 4OQEA 4UUQA 3GZTB 1ZNZA 5BWBA 1X94A 2OCGA 3RRYA 3ZTYA 3CMAF 3F5DA 2JRCA 3IH5A 1IPEA 3F5MA 1A5TA 2ETVA 1TTPB 5F64A 1QGYA 5L7TA 1KFKB 1W2HA 3FVVA 1BO6A 1ITZA 1NFRA 1AG9A 4OSPA 3RSLA 4AJJA 4CM1A 1Q83A 3PX3A 1QAHA 2WIBA 3IMEA 3NBYC 1F8XA 1LX7A 4WLVA 3VAZA 5FLKA 1K97A 1JFRA 3BD6A 4WNAB 1SOAA 3QX9A 5AM3A 3ZNOA 3KJEA 4JHXA 4W82A 4M1TA 5JXIA 3H1EA 4LSMA 4DILA 1SXGA 2O0LA 3U4QA 3L7YA 2GK4A 1SKMA 4P0QB 1IZ8A 2P9JA 3ESRA 3KLOA 5AVKA 1QP8A 1ZLYA 2EF1A 1IY2A 1FDOA 2H6EA 2FP4A 2W6ZA 3P0JA 3HV2A 1HOXA 1P4GA 2BFPA 4TQ9A 5IXSA 3N0VA 1VQLF 5DPMA 1WO8A 2EWCA 2ZE8A 3SNKA 4TV9B 3HJCA 3AF1A 5JCZA 3ZOKA 1HSZA 3UWOA 3RASA 2C8KA 2QBYB 2BBOA 3IBYA 4F2WA 3NH9A 2XA2A 3IB6A 4AZWA 3I9JA 2X8JA 5K9ZA 4G1VA 1B74A 4WLFA 1JI0A 1MO4A 2OB1A 2ZXFA 3VRHA 4YT2A 4YO7A 4BCBA 1PGOA 4B6FA 1ZK4A 1VQ4F 5C81A 1W36D 5BWMA 5HZKA 3N9IA 4Y2TA 2J5XA 3VVLA 3QLEA 1DKOA 2ZBPA 1Q7BA 3TGPA 4MPTA 1E2BA 1KMHB 4C6TA 2OWEA 4E11A 4R9SA 2H0QA 1TZ2A 1JFTA 2AC2A 1GUDA 1QOPB 1VCNA 4R1OA 3ESZA 4DIBA 2JL1A 3UXHA 3I9FA 3TG2A 4DB4A 4BZZA 4TZ0A 2VBCA 4TTTS 2JGLA 1NW4A 3O1HB 1IV2A 1MOZA 1VJ0A 1FS6A 1I7NA 4FKZA 2ZTVA 4REQA 2NU6B 3ANLA 1RYYA 3ILVA 4B6PA 5AVYA 2R25B 3S0WA 4LOKA 4GMXA 4Q16A 5DN6A 2AOTA 1V4VA 2PQ2A 3JATB 4LTMA 1FQJA 5J2UF 2BLNA 3EMDA 4RQUA 5I9TA 3LKVA 3M6MD 1KGSA 5TQ2B 4AIRA 5E4YA 3T4XA 4UMFA 3M2PA 2ZTHA 4DSNA 1E1QD 4HDRB 1OGJA 3D4IA 3AFNA 1OASA 3G2KA 1GPLA 2B69A 4Y9DA 2HA3A 3UENA 1W85B 2CFCA 5BQXA 1VGRA 2HMTA 4CF4A 4KRFA 4U8GA 1YUBA 3WGLA 3KTOA 4HO1X 2WAMA 1J0CA 1JPNA 1OXVA 1UT8A 4Y1GA 4Z3DA 4DY6A 1GU7A 1R15A 5IT9M 2X5KO 3BXFA 1FRNA 3I8SA 4MVXA 1PLJA 4S1PA 3VXKA 3RV3A 1S3GA 2A9PA 1Q1AA 2PL1A 3KCQA 1ULHA 2C58A 4OHRA 4S05A 1T9KA 3M4ZA 1SU7A 3MBMA 4P4NA 1KZGB 4UAGA 5E7QA 1EFLA 2SKCA 2ZBDA 3VH2A 1HYBA 1F0PA 3L7CA 2QT0A 3Q5DA 4MB6A 2WQ6A 1UEIA 3ET5A 5ESXA 4A8TA 4DVJA 4YRBA 2IITA 2J9ZB 2BIFA 5MHTA 4KXNA 1YRQA 4NHEA 5DMXA 4OHMA 4S1NA 1ZM9A 2HV9A 3K5PA 5EHQA 2YNMA 2E9SA 1DAEA 2X5OA 1ZIDA 2V6MA 2EJBA 1OGYA 1PQYA 1M2VB 3IQZA 5A71A 3MERA 4BKPA 3BZUA 3IEWA 3IAHA 4ZCRA 1N0HA 1VHQA 1T2AA 2NSJA 2GXQA 2WINI 5D3MB 2CLCX 3SC3A 1GX1A 3FAKA 3NRCA 3NFRA 2NO6A 4FU0A 5BP7A 1Y8QB 3V2HA 3VZPA 4C03A 2BGGA 1Y82A 2XNCA 2Z5VA 5B53A 1AUPA 1Z4PX 1DUSA 5BXYA 4MYRA 1HDGO 1Y5RA 3RKSA 3RC9A 1FL9A 2HXGA 1SAYA 3L7DA 4J1SA 1U0NA 4Z8YA 1PSDA 2ALJA 1B3BA 5BV8A 3NP7A 3AQIA 4HBZA 5JCJA 3ZIAA 4WLOA 3ZCTA 4YRZA 5EAIA 2EATA 2C3MA 2QN3A 2W93A 2YUIA 4KCGA 1CHDA 3GPDG 3OLXA 4RGQA 1MFPA 4G07A 2VP5A 4UMVA 3V8PA 4LCEA 3OOWA 1UKYA 1B6TA 4FEEA 2C7BA 2GD6A 2ZS8A 3GYQA 4IEIA 2V8OA 4KAXA 1Z8NA 2GR9A 4EPTA 4H18A 4OG2A 1QE0A 2VK4A 3FD8A 3GEBA 4NBLA 2IS2A 1QVGF 2CC2A 3MHPA 3WG9A 3WYGA 5KTTA 1MORA 4DW8A 1C8VB 4TXNA 4EG3A 2JGRA 4YGXB 4UTNA 4JVNA 5KHOC 2ZE6A 3EXG1 1WQ3A 1W581 5E9JA 3RAGA 2J41A 5GIOE 1IM8A 3OU6A 4L6IA 1P18A 3DULA 2H18A 2Y05A 4MKRA 1JHPA 3L7AA 4YUWA 5JXHA 1QIGA 2A9OA 4IUDS 2A3RA 1ULTA 4ZTZB 4ASUA 3LUCA 1HWYA 3OF3A 1REQA 2FP4B 4DBLE 3B1ZA 5IT0A 1IMOA 2WIGA 4F5WA 5K45A 1DBFA 4BT7A 1D4ZA 4TSFA 5F5NA 2D13A 1W36B 3L9XA 1ZRNA 1RHKA 3I1YA 3KD2A 3UY4A 3X1ZA 1UDBA 3KKNA 1QF9A 2DLDA 2DPGA 3OWXA 1U5AA 2MMCA 2YHIB 3DT8A 1VA4A 5CGZA 4QYTA 5BR4A 1ES9A 2X8JB 5LP1A 4RFSB 1L1QA 4DCMA 1OHHD 2QJFA 4ASUD 4RL6A 1GUBA 3WJRA 1R6XA 1KJIA 4ZAWA 4FBLA 1OBHA 4F6RB 3BBPA 3ZD8A 1DINA 2F67A 4BMOB 1KYQA 2C9CA 2COEA 2H92A 2KS6A 2OCBA 3EG5A 4ZPXA 3VA7A 2WG0A 3LI2A 4KVGA 1MC1A 2AZ4A 1UXOA 2WU1A 3LWRC 4NY1A 4JLPA 5EIBC 1NYLA 4O4LA 4RSHA 5IBPA 4OUKX 1TM7E 4ZYYA 4Q4LA 2C8JA 2YMMA 1P3DA 1QPZA 1PWXA 3DCYA 1YHYA 2O0MA 2IX9A 2QTTA 1WY7A 3AUSA 2IYYA 4DBVO 4Z1OA 4REQB 5JEDA 1WXDA 3CU5A 1OWPA 1J9ZA 4MUEA 4ZT2A 1EM8A 4DCVA 1U7ZA 3GP3A 5B4VA 5LJLA 1Y3IA 2Q2OA 2RC5A 1BNCA 3NJRA 3SEZA 3DP7A 2Q9CA 1G8AA 1EK2A 2BUCA 1JLHA 4F5YA 2QYSA 2CN1A 1W42A 1C29B 2I65A 2O0HA 2X40A 2ZIXB 3A37A 3U13A 4BUJA 5IW8A 5HTOA 1XDZA 1E9RA 2JFNA 4XRRA 4G4WA 1DBRA 4UDNA 2F43B 4MW2A 2VRBA 4NZYA 3OA0A 1JQJC 1EGMB 1P7PA 3GH3A 3TOZA 4LHZA 5FYDA 2HCTA 2IU3A 3T35A 3GLGE 3USES 2PX5A 2AJCA 2PT5A 1YDEA 2A9RA 2W43A 2ACWA 1GVNB 2RFLA 3OOHA 1V39A 2WF5A 2EEPA 5TVKA 2FWRA 1V7PC 1RJGA 2Q49A 4U2GA 4F4HA 1PYDA 1PL6A 2BJHA 3V1TC 2WV9A 1OFTA 4P4TA 2RSLA 4YQZA 2CHVA 2BONA 3DXFA 4NNJA 3GLHA 3MWDA 4F45A 5L7YA 1TNDA 1RRFA 2JIRA 2PGOA 3NK6A 2IFTA 4F9FA 1FMTA 4KH0A 3TFQA 3DCJA 1IBSA 2VT2A 3KDSE 3NIBA 5SZJA 2VNKA 4F4CA 2J5KA 3C8LA 1E5XA 3FRHA 5HFAA 4HNVA 1W4ZA 1P9RA 1YASA 2P3OA 1R8XA 3AY3A 3G89A 2PXHA 4ARSA 3JPWA 3IDAA 1Z5NA 1W6UA 1YVEI 3A7EA 2Y66A 2EKQA 5DVZA 4B2PA 5K3SA 4RTLA 3Q7PA 3HKEB 5JXWA 1JHMA 3TQHA 4DG8A 1EA5A 5G4LA 3IYLW 3ZE2B 2IF2A 4ON9A 1GLVA 1K68A 2QR5A 3G0IA 3MTBA 2Z3VA 3LWNA 3PQ7A 5JNRA 2HKIA 3U44A 1JFSA 1SIWA 1J2JA 5BMVA 2K5UA 1GZSA 3IEXA 3ZHRA 1OFVA 4K9MA 5FTNA 2O1EA 4JELA 5CP8A 3IV6A 3ACDA 5FR2A 4ER5A 1BVRA 3CLHA 2OORC 3L0SA 2ARKA 3QE3A 1YGPA 2C82A 2N1MA 3NT4A 2C97A 2XYGA 4JJGA 4NOKA 3ZQUA 2NUPB 4KR9A 1MZVA 4X9XA 5KQGA 4HUQB 4PO3X 4CKCA 3KXIA 2BMFA 3SF8B 5EPUA 3G0GA 2QVZX 4YCLA 1Q0RA 4MUIA 1CRZA 1S2NA 2IYRA 4LWPA 5DCWA 1KETA 1BEUB 3H2GA 5AKHA 5P8WA 1CE8A 4G1UC 1N2EA 3A1SA 4TM7A 2IHNA 4QU8A 2FGYA 1BE6A 1XTZA 1YB2A 4CMJA 3QMWA 4CF3A 1K5GA 2XWJI 5KU1A 1TA0A 3BQMB 1USWA 2BFDA 2GCIA 3RFCA 3BH6A 3UM9A 1SO8A 1TCUA 4ZAFA 2UUOA 3AEQA 4RD2A 2Z3WA 5AJVB 4J94A 4QARA 4OHWA 3ZEAA 2P9BA 5BN5B 1TXGA 2EG5A 1CF4A 1B7GO 1J9EA 4B3GA 5FTLA 1LLCA 2GPJA 3AJAA 2E37A 5L8VA 4ZXFA 1HDXA 5JZOA 3IBCA 5KNDD 1REQB 2UYNA 2FDRA 2O5EA 3AERB 1JKIA 2R87A 3F6SA 2DULA 1IY1A 1FUUA 1PT9A 4BMSA 1T6YA 3I5UA 1I6WA 3NHRA 3UH1A 2DWOA 1DTWA 3VNSA 1SZJG 2E3JA 4KSYA 2ZRPA 3L4BC 1XQWA 1I0IA 4ER3A 3ELCA 5THKA 4TWJA 5M3BA 3RSFA 1W41A 3W5IA 4XWWA 3CVYA 3KBOA 4ITRC 4ZYXA 5H68A 2QP3A 3W5JA 4OP1A 5FKJA 1KYIA 3KFVA 2HQOA 3ISVA 3H42B 1Y7HA 4KNWA 4QJ5A 4X0EA 4C4RA 2Z1FA 1R12A 1Z2CA 4Y6GB 5DKFA 1EPUA 1QORA 5FFNA 4J1NA 5IK2A 3LKZA 1Z4LA 2HS0A 1VLVA 5KNBH 2RHDA 3HCAA 3PPVA 1RM3A 3Q0TA 4YDSA 1GDDA 1EVYA 4TYPA 2VQFB 4RELA 1XJWA 3EUEA 4CGZA 4O4LB 1KNXA 2AWOA 4LG1A 1QGDA 3EODA 2CLHB 5D01A 1JZSA 3A36A 2LD4A 3ECCA 2WFAA 3IP5A 3M5WA 3W7AA 1H6BA 2YJ5A 1WMEA 3LSTA 3JD2A 5H3CA 1KU6A 1UBEA 1UDAA 3DMPA 3PAFA 3NRBA 4H0FA 5AK4A 1J8YF 1NLMA 5IK2D 1EM8B 2FEOA 3GMSA 1XU7A 1QHYA 3X3HA 3CVUA 3RADC 4CTMA 4PPQA 2ANBA 1NMZA 3PVSA 4G6ZA 3DMYA 5JASA 1ZS9A 4YRLA 1ODFA 4XUCA 1RDFA 5BN3A 3ESJA 5LA6A 4DSUA 4DQDA 4KNYA 3KWFA 4D79A 1TM5E 3ZDEA 4EVSA 2ZBEA 2Q8NA 2ZSJA 3FMOB 3VM6A 4V0LA 4BO8A 1H8HD 2YWRA 3LBFA 1U8UA 2ONKA 5HVNA 3ZGYA 4ESHA 1LUAA 4WN3A 1QIKA 1TB4A 1X8XA 3M2TA 5FO1A 1GPUA 3ZBPA 3WB1A 3PL5A 4RDHA 1JFFA 2PH5A 1ISGA 1Z7EA 4C22A 2LE0A 2OZKA 1G9TA 1GKKA 2JGFA 2VBGA 1WEKA 4B7XA 4C4PA 5FLXA 3ZVMA 1D07A 3CUUA 4QUHA 4IJKA 3N59A 2RAVA 1V47A 1XU4A 3I6MA 1GD1O 5DHQA 4PQEA 3CWZA 4RL4A 1II8A 1TF5A 1L5FA 2IYFA 2ZRCA 4JDUA 4HYTA 4OGLA 1PGJA 4N5LA 3R7BA 3RIGA 1V2HE 1EP2B 3HBLA 3PGMA 4YGYA 3TTUA 1K27A 3B7GA 3LQKA 4JI6B 4KXXA 4E03A 2NMVA 1L5VA 3ZU5A 2H8EA 4IDOA 4LZNA 2QSJA 4TROA 1J0DA 4RK1A 5E8RA 3W6PA 4C08A 2WD7B 3AVOA 5JQGA 2QG9A 3H9QA 1E2MA 3NATA 1ABBA 3JYLA 1TT7A 3K4HA 1SIBE 4GEKA 3VR3D 2H5EA 3IPYA 2FTKE 3N1UA 5L3QB 1JQKA 4ENPA 4MR9B 3G85A 1M2OA 2OXFA 3VYTC 3U44B 1DTSA 1F0YA 4RIGA 2ISSD 3IE2A 2HZBA 2PGJA 4MMYB 4ZU3A 4BZXA 1BYUA 1FRQA 5BMVB 1OIWA 3FHOA 5H82A 5IJAA 1BGWA 1EWVA 4PGAA 4XWYA 2P0EA 1I30A 1HE5A 5PNTA 4B6EA 4BO9A 3VR5A 3H5OA 2JC3A 2PX3A 1ADGA 3CA8A 2GZAA 4PRLA 2V0GA 4OL9A 1KY5A 1JH8A 2V03A 2JANA 2YXNA 3PLRA 5DK6A 1C7ZA 4GLOA 2YJNA 1A2QA 1DO8A 1PZGA 4M54A 4D8UA 3SFZA 4CKCB 1BHQ1 4IDHA 2BDEA 4FOOA 3F46A 4WZZA 4ONEA 1U7WA 4G0UA 1OFHA 4GGPA 4JL8A 3N2GB 2AQHA 5EC8A 1CE8B 1O9BA 1F6DA 3GEDA 3QHQA 3KYBA 1RJEA 4L9RA 4J1TA 4ND6A 4YAGA 5IFKA 4X20B 3KWMA 3AUKA 1OIVA 3NUGA 3K92A 2CMFA 1K7EB 2B25A 2WSBA 4IXMA 3AFOA 4GBED 3AEQB 1EM6A 2CMHA 4MZDA 3DWGA 4YACA 2PT6A 3V2GA 2HWWA 3BMXA 4BLOA 3VNAA 2D59A 1A8QA 2VTVA 3ANXA 2O2SA 3C70A 4OY3A 1YD7A 1WTAA 3H2SA 4V0MA 3HMQA 2FN3A 2VQEB 3ZVKA 1E9FA 2UYNB 5DX8A 4JJIA 3V4RA 4WNCA 1EK6A 2XNKA 4WKOA 2ONJA 1V5WA 2AQIA 2VI5A 4MUJA 4P35A 5HF5A 3W3AH 4QPCA 1MB3A 1DTWB 3WMWA 1N0UA 5A05A 1RCTE 3D0QA 3SXJA 2VTEA 2G9IA 1P1KA 3VCZA 3KUKA 4ID3A 1V43A 4J9VA 3QU4A 3PIRA 3QKRA 1QRUA 1V1JA 4YV0A 3U7QB 1LBHA 3JQRA 3HZZA 4PY2A 4GZ3A 3COPA 3USZA 4P58A 2M6LA 3VZBA 4A2PA 1FMCA 3G17A 7GPBA 3QTTA 1GZVA 2M9MA 3G2NA 1DBVO 3PIDA 3OZGA 3RVJA 3ED5A 2E55A 2PX0A 2VN8A 3IQEA 2VSQA 3L7JA 3SYKA 4EDFA 3MUOA 3DZJA 1V8BA 1GN9A 3H4MA 3WLOA 3BDIA 2BFMA 5LD2B 4F6CA 4DTCA 3MWGA 2WW8A 1FTGA 5FEMA 5L6LB 3T9DA 3I9OA 4QUJA 1EJ2A 3C85A 3R7WB 2FWNA 3M7IA 3KUXA 3HE3A 3UUEA 5BN3B 1L5WA 2P6UA 5LA6B 2Y76A 3DBRA 3F7MA 2XRFA 4AMYA 4OX9Y 5AI0A 2O2IA 3BSSA 4D80A 5F2KA 1FNSA 3EEIA 4HRYA 2E87A 4HDAA 4DIFA 1M8KA 3EQ7A 1NBHA 2EX1A 4XE5A 4EPXA 3PDUA 3QKIA 3WLJA 2W71A 4JR2A 1LDEA 5DXJA 2JHGA 4U5XA 4YROA 1KZ7B 2GM5A 2NO7A 1P62B 2VSFA 2GDZA 4XSVA 4U00A 3G79A 3N05A 3VPAA 3ZXYA 3IVCA 3EVFA 1VB5A 3MTIA 1KAOA 2NU8A 2V6IA 1WMDA 2I54A 3FLBA 5K8IA 4IRMA 1PEYA 1AV7A 1PL0A 2B7BA 4OKIA 4TQGA 4OLBA 5DH9A 5AVTA 1ZONA 4N7RA 4DMKA 3CCMF 1P5RA 3AW9A 3K2BA 4N49A 4GD3Q 2E5WA 4P98A 3SHVA 3EVGA 3ZHBA 1K6JA 1Q2UA 2QYTA 3LS2A 4FC6A 5KVVA 1NJ8A 2QTLA 3DF9A 2H0RA 3DJFA 3TGLA 1J22A 1Y98A 4HGPA 2IEBA 2FKAA 4PAMA 3K9WA 1ZIPA 2LNDA 3T38A 1HK7A 1U02A 3A8TA 3BSFA 3C5WP 3DAGA 3I2GA 4WOCA 5DBHX 3NPMA 3C2QA 3AVVA 4EKNB 5DM4A 2XSZA 4F4FA 1CX9B 5JQGB 4RVSA 3F8WA 1D8AA 1SHKA 2BN4A 1W4AA 1J8QA 3IMFA 4MTLA 4EW2A 2E21A 5FWDA 2HCJB 5HFJA 1U8AA 2IV7A 4AECA 4O4IB 3A7DA 2W8BB 5KJCA 4R40B 4P92A 3REOA 1XTRA 1QYVA 1XMXA 3OZ7A 2A1TS 4N7MA 2OZPA 3QIAA 4AY5A 3H86A 1TQDA 1XTPA 3WNBA 5DOVA 3VTFA 4K88A 2WC1A 1BAPA 3WWEA 3O94A 2ZUTA 2GAJA 4E5UA 3DNFA 2AEFA 1TF7A 4TWBA 1K5HA 3ZI7A 5HCNA 4GAEA 1NQAO 3PT5A 1CQJB 2P5TB 1C9YA 5B64A 3GMIA 2Y71A 1WSDA 1ONPA 4QIHA 5E6RA 1UWKA 2G9NA 3RKUA 3ZWQA 4I4IA 3DUWA 3VNUA 2RGWA 1ECGA 1L7AA 2AFIA 3LGXA 1YK1A 4I4LA 1YVPA 2NPOA 3ZU4A 1NN5A 1OGIA 3DLPX 3MJEA 4W8OA 1FYFA 3BE6A 3GPCA 2V9CA 4C0JA 3PS9A 1GNTA 1U8ZA 2IXBA 3E53A 3WMXA 3C3YA 3AINA 1F8UA 2I2CA 3DW1X 4ND1A 1WTCA 1H42A 4JC5A 4YFYA 4D7AA 4EGSA 2W0MA 2W7TA 4IKPA 4AXBA 2VPWA 3ZZ1A 1CZKA 4AZ3B 4ZO9A 4I55B 2IH4A 4LXYA 1JA0A 5ALOA 3CCJF 5EMLA 4RNDB 3WV4A 5KOJB 3A0RB 1IDN1 2JHPA 4JI8B 1GTJ1 2IS4A 3A70A 1UEJA 1PV2A 4EA6A 3AVYA 3P10A 2PSDA 1ZUNA 1T6BY 3L1KA 3NHPA 1RXCA 4BT2A 1DELA 3CB2A 1F9EA 2HU8A 1ZFNA 5J4VA 3DEIA 4RKEA 2GHQA 3GDFA 4NE2A 4AO7A 3FCOA 4CFZA 1O0SA 1ZK3A 4KR0A 2JAPA 2O7NA 5HG0A 3S1AA 4V38A 4CZ2A 1JR3D 2JEZA 3TZLA 1X7YA 2GKOA 5KYTA 3HN7A 4OB7A 1XNQB 1H6DA 3QENA 4W9NA 2C9OA 4FW8A 1DKRA 4FVTA 1GQYA 1KIMA 1H93A 2HWKA 5JRZA 1EDZA 1PL7A 3EUFA 1KI6B 1DEOA 4B8ZA 2C4KA 2FZGA 3RVPA 3QVXA 3NW9A 1G1MA 3OTQA 2A57A 3NBFA 4G4GA 1CUWA 5JE8A 4BVTA 1W75A 1M66A 4E14A 1TGVA 2YFHA 4MGHA 4KXVA 4OHBA 3NHJA 4Y7CA 1DTEA 3DXYA 1KI7A 4KP7A 3ONNA 2C94A 2QB5A 4ZYTA 4PGHA 1D4FA 4CT0A 1EQAA 1VKJA 2PL9A 3FF1A 5GJWC 4C7VA 4P34A 4XB1A 3VKUA 1SHTX 1VDZA 1QQAA 2PMCA 3PWSA 4MA5A 3RUPA 3RANA 3WGKA 5JBIA 3DE5X 1VRWA 1EE2A 2YYAA 3GG2A 2VDOB 3WIEA 5TXGA 5HQ3B 1XLTA 4HVTA 4HWKA 4XARA 5IKOA 5J2TF 3T9FA 1W8DA 2V6FA 2ZE7A 4FYKA 3WJAA 4BATA 4N82A 5B36A 3SXPA 4INAA 3H11A 4NFLA 4HTAA 3F9RA 3KE9A 4BNZA 4KLZA 2PR7A 4NU5A 5ED0A 2MSCB 4R1SA 3WTBA 3G2JA 1R6AA 1CUAA 3B6EA 4L15A 2OUKA 2A5DA 2QRGA 1KSFX 3DB2A 4CUJA 5EJ6A 2JNBA 1YV9A 3IR5A 2WHYA 1A77A 2AC7A 4N7JA 2KTVA 4RV4A 1W46A 5H9WA 3GOQA 2XMBA 1UK8A 2YWXA 4Q1CA 4JFRA 1R2QA 1GSIA 2E85A 3FKQA 3C4JA 4D6PA 1TZMA 3KT0A 3WJ7A 1VE1A 4ZFNA 2D8AA 4H6PA 1EVQA 4NENA 4R7GA 1HE4A 1HETA 3I09A 4I99A 5F76A 1H69A 3VHQA 2B3DA 1ODJA 1VMDA 4O59O 5EFZA 1IXSB 2XF2A 2HF8A 4B3BA 4B6GA 1VKOA 1MIOA 1KNJA 3FJ1A 4HNGA 3HDYA 4OFBA 2PMEA 3DEKA 3V8MA 1M90H 2VDRB 2PV7A 1I7SB 1EFTA 4OAQA 4GYJA 3LLVA 1QH1A 3BKXA 3CW9A 3Q9LA 3KPVA 1BE1A 4MGYR 2NPFA 1UWCA 1S3IA 3RK4A 3WL8A 3TLCA 3CEJA 2GKSA 2SCUA 4DV6B 2G88A 2F17A 4XVCA 5C5CA 4KFSA 4MMXB 2C4WA 3RUHA 4YUAA 2FEXA 1PL8A 4IGKA 4XYBA 3LA6A 1XEWX 3MWFA 1Y7TA 4ZQBA 1ZINA 4B4UA 1C7FA 3OLVA 1JG3A 5JYBA 2P35A 3G5TA 1EZ4A 3WIUA 1QDUA 3VI4B 4CTJA 3TLJA 3JVHA 4BVHA 1J7HA 3HFRA 2IDKA 3GFRA 5E6RB 4D81A 4S04A 4EHJA 3CVXA 1W34A 3BHNA 4G5XA 5F33A 1E1NA 3OTIA 3PWKA 4Q7JB 4CF7A 2DFVA 4PINA 1HNXB 1F7VA 2GEKA 3PF8A 5K6AC 3WE7A 4U7PB 2WB4A 2HHCA 1QVFF 2ZT6A 4MVCA 2XHEA 4JFAA 1ENPA 3ML1A 3PD1A 4M4SA 4N8SA 5DEIA 1UOOA 5DM60 1SC6A 3QUWA 1W96A 2GFIA 1T36A 4YMGA 4EUNA 2WJZB 1KKLA 4OBXA 3TD5A 4EMTA 4PV7A 4M8NE 1V1RA 3TD3A 4IDPA 2ADOA 3SZRA 4D46A 1KYXA 1M6VB 1MEOA 1QX3A 1XZBA 2QTZA 2BH9A 3H0EA 1RVDA 1MW9X 2AMVA 4WPGA 4XUEA 1XMOB 2YZ7A 3BWEA 1KR5A 1SBYA 1ZUNB 1PK7A 3RKRA 3T7DA 3ZDYB 1X3SA 2C57A 1DC8A 2GESA 2CNDA 2JEOA 2H2FA 3NHFA 3T7TA 4A82A 2VNSA 2KLHA 1JHDA 4GX5A 5G0SA 5JHGB 3ZHSA 2BCJQ 5EP2A 1ZAYA 4FGUA 1MJGM 3KVRA 1JUDA 3EXFA 5B4UA 5E0OA 1XA3A 1T9HA 2NTVA 1B8PA 1P80A 2C1ZA 2QRVB 3RR2A 4LYHA 1O0CA 1V4BA 5EWMA 3F3MA 1SC1A 2AFVA 2GYYA 1PJZA 4R69A 3RYIA 1QO0A 3R0QA 3PE3A 3WL5A 4F9EA 3ESQA 3ZVLA 2PQ0A 4BNJA 4E5DA 4Q66C 3QRWA 2AI3A 1GKIA 1E7RA 1CS4C 1H1TA 1X0VA 2BY4A 2F3SA 2R1UA 3W9SA 2JH9A 4JA0A 3G7NA 2CHGA 4C8IA 1VYUA 2H08A 4ISBA 4KXWA 4Q82A 3FSEA 3G2OA 3QI7A 1THZA 2HK8A 3QOYA 3CZ5A 1JE0A 2CYBA 3P4XA 4Q3OA 4M7OA 4EPRA 4Q3BA 3VC3A 5CG2A 1M2GA 5EKSA 4ZAVA 3ZCXA 4PZPA 5ADWA 2M1XA 2ZRKA 2JFBA 5L3RA 3U26A 1A7KA 5EIBD 3OD5A 4JIGA 4KPUB 4P7GA 4KPGA 2EW1A 4FT4A 5HGXA 5C51B 1TK3A 1IUPA 3EDQA 4MTCA 4ZVUA 5LUAA 5HNKA 4NZOA 5CDUA 1UWLA 4PCLA 5ALIA 2PNJA 4D9FA 4X6XA 1H5QA 4DV1B 1Z68A 2ADFA 2FUEA 3ZCRA 3SLKA 4MUKA 3I58A 1P9WA 5HY0A 2CHSA 2FJ0A 4ZHWA 1ODLA 1R37A 3RLFA 1OX4B 2X0KA 1B73A 3WK9A 1LCIA 1FNJA 1QAOA 4YAEA 3ZS9A 4B79A 3WIBA 3EORA 4H1UA 2O8DA 2ESRA 4MW5A 3OFNA 4BFZA 1DXQA 4QUBA 2NU7B 3FI9A 4V0RA 4MYUA 2FPUA 2M6RA 4GQBA 4Y67A 5IAOA 5KTMA 3AVWA 3TD6A 1HT3A 3CY6A 5SYNA 3BE8A 4B75A 1KEEA 1JBQA 4NXNB 2PFGA 3R3JA 1SBCA 3CBQA 2DGDA 3HDGA 3MTQA 4TL8A 3A1DA 1FC0A 1N78A 2R85A 2FF7A 4E31A 2A33A 3D6MA 1CT9A 1G2QA 1KEVA 1KF0A 1NJGA 5CBKA 4GNRA 3EHDA 1I0ZA 1WM1A 1OVGA 1U3CA 3I6IA 3JTMA 3TR6A 1OT5A 4NMMA 5MN5A