3F0GA

Co-crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase with cmp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
159
structure length
159
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 53
structure length 159
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3f0gA00
2AMTA 1U3LA 3ESJA 3FBAA 3T80A 3GHZA 3F6MA 3MBMA 3IKFA 4C8IA 1U43A 3ERNA 1IV2A 1IV4A 2UZHA 3F0GA 1U40A 1H47A 1KNJA 3F0FA 3QHDA 1H48A 3Q8HA 1YQNA 4C81A 1T0AA 4C8GA 3P10A 3F0EA 3K14A 1W57A 3ELCA 3JVHA 3RE3A 4C82A 1IV3A 3EORA 1JY8A 1VHAA 4C8EA 5B8FA 3K2XA 3KE1A 3IKEA 3P0ZA 2PMPA 3IEQA 3F0DA 2GZLA 1IV1A 1W55A 1JN1A 1KNKA 3B6NA 3IEWA 1U3PA 1VH8A 1GX1A 3FPIA
chains in the Genus database with same CATH superfamily
3CXCF 3RYHB 3ZP7A 1KD1H 3ESJA 5EO3A 2CHSA 3SIVA 3V7EA 3O85A 1W5BA 1VQVA 1RA4A 3CC2F 1W3EX 2ZVYA 5EZYB 1Q7YH 3LMEA 3VYSC 4O4JB 4I50A 1COMA 2VAMA 4I55A 5IYZA 3I56F 3PLAC 2ZOVA 1XHOA 3VYTC 3VTIC 4BW0B 5JH7B 5GIPC 5ITZA 2W8BC 3WPXA 2GLZA 3VMFB 2QA4F 4X1IB 1W5AA 5EWRA 4X1YB 5HXUA 4X20A 1H47A 3R0PA 2HS4A 2V9YA 4TUYB 3WJRA 5IJ0A 3DDNA 3CD6F 2CSLA 2LBTA 4EI7A 4ZHWA 4NQ3A 1YGYA 1VQPF 2LCAA 3HKCB 3IR9A 5GINC 5JQGA 1QVGF 5LXTB 4BT6A 4ZHQB 2UYJA 5HXZA 5LA6B 3VCZA 3HJWC 2YYEA 4ZI7A 1KC8H 4ZHQA 3JAMM 1K73H 4G4ZA 3N4YA 5G4VC 3S0WA 2CHTA 4B45A 1J7HA 1X7OA 5A2QM 4B5CA 4C82A 2HP3A 3AGKA 5AVMA 2CW4A 3OBYA 3U0OA 2RHLA 2KTVA 2Z1UA 4HNAA 1GO1A 1KNKA 2RB9A 3OBWA 1R1MA 1SA0B 4O4LB 5EYPA 3RYFB 5KX5B 5DCVA 2HRUA 3S06A 4DRXB 2ZODA 2RHHA 4ZOLB 1VQOF 4TZZA 2G9IA 2K1SA 2Z1TA 5FNVA 1ONIA 4R40B 2VAPA 3JATA 2RHOA 3WJPA 5KMGB 1PF5A 3HWUA 4ZOLA 2VGMA 3N2GA 1NMUB 4IIJB 2MQEA 5EB1B 1SZQA 2QTPA 3HKBB 4NUTA 3GTZA 3JAKA 2JNBA 4IIJA 3RYIB 5LP6B 4FFBA 4C8EA 4EB6A 1RLUA 4X3MA 5LP6A 3IEWA 1RLGA 2OTLF 1VH8A 1H7MA 3C9SA 1ODEA 4WBNB 3BYQA 3FBAA 3JASB 2HX0A 5JVDA 4F6RB 3CYPB 3V3TA 3RYCA 3E22A 2HVYD 3MCAB 3FD5A 2CZWA 1S72F 2DT4A 3FD6A 4BT4A 3HKDA 3RA5A 3QHDA 5EAZA 2UYNA 5LOVA 4C4WC 3I7TA 1YJNF 1FFXB 1XRGA 3CB2A 1K8AH 3UT5B 3QTYA 4I4TA 2HQSC 1TUBA 5GAPK 3QUWA 3M4SA 3KIZA 2I6DA 3C9UA 1FSZA 1VQ9F 1U3LA 1W41A 4O4IA 3CCQF 1YITF 5HP8A 3IKFA 4IHJA 4B46A 4BY9D 2HP0A 2QEXF 5GONA 3CCVF 2OTMA 3JAWA 3JALA 3K0TA 4YJ3B 3C8LA 5CA0A 3IMPA 3KJJA 4I50B 4C81A 3HKEA 3ELCA 1VQ6F 4I55B 5IYZB 3CMEF 1IV3A 4YJ3A 3CYQA 3PAFA 4KWEA 1XV2A 4G88A 3CCUF 5ITZB 4X3LA 1X25A 4O4HA 2H6LA 4C8IA 4X20B 2PHNA 3JCMM 2L26A 5IJ0B 3D54A 4X1KA 2LBWA 1T0AA 4C8GA 1VK3A 5IJ9B 2UYPA 3WPWA 2Z01A 3WXMB 1W5FA 5B8FA 5JQGB 5JCOC 3DC2A 3WGLA 5IJ9A 3CCMF 3JARA 4ZI7B 2R751 4BVQA 1CLIA 5C8YA 4LNUA 5IT9M 1KNJA 3F0FA 2FGYA 3CMAF 2H8CA 2R6R1 2Z1EA 1Q81H 2FC3A 3WGKA 4HNAB 1VQ7F 4M8IA 5EIBC 1QVFF 3D00A 5EYPB 2HRYA 3CG6A 4DXDA 5CB4A 2N48A 3N4ZA 5FNVB 3K14A 3JATB 3ZO8A 2AMTA 2OHWA 3LFOA 3RA6A 3N2GB 4O2AA 5G4UC 1QU9A 1FNJA 1Z5WA 4ZHYB 3HAXD 3F0GA 3JAKB 5BMVA 3VI6A 4FFBB 5J2UA 4EB6B 4EI8A 3S03A 3TD4A 4B62A 3WGJA 3EORA 3G4SF 4RHAA 3LDTA 4YJ2A 3K2XA 2BO1A 5CA1B 3P0ZA 3KJKA 1VQLF 3B6NA 4BT7A 5JVDB 5CA1A 3LWPC 1DT9A 5HY2A 3RYCB 3E22B 1CN7A 3VIUA 1QD9A 3ERNA 5J2TA 3HKDB 5HWEA 2Q1YA 1Q86H 2UYNB 5LOVB 3SIUA 2KTUA 5MN6A 2H8EA 1VQKF 1W57A 3JVHA 1JJ2F 1W5EA 4I4TB 1TUBB 3CCEF 5MN5A 1VQMF 4ZK7A 3MDOA 1X7PA 3C9TA 3S02A 3VO8A 1U3PA 1OFUA 4O4IB 4IHJB 3ON1A 3MQWA 2HP0B 1UI9A 3S0HA 2ZAUA 2ZF8A 1UFYA 2AIFA 2VXYA 5GONB 3JAWB 3JALB 3G6EF 3WGMA 5CA0B 2UZHA 3LWRC 3HKEB 1W40A 1H48A 3Q8HA 1K9MH 1GZ0A 2VGNA 1CK2A 1Q8RA 3NVKE 3I3FA 4TV8A 1QAHA 1VHAA 3V4DA 4O2BA 1SDSA 1TVKB 5JCOA 5LP6C 5FLXM 1VQNF 4O4HB 2PMPA 4TV9A 2CVLA 3F0DA 4U3JB 2GZLA 2P6YA 3CC4F 3FPIA 3S0YA 2UYKA 1TVKA 1W581 5LYJA 1JFFA 4U3JA 1Z5VA 5GANK 3RYHA 3OONA 3WGNA 1IV2A 2AIZP 4X1KB 4BVTA 4RQOA 3CPQA 2I6RA 3NVIB 2Q1XA 1VQ5F 1RQ2A 1VQ8F 3P10A 3VOBA 4BVRA 3JARB 5EZYA 3TD5A 3J80M 3NMUC 3LWQC 1VQ4F 4O4JA 3CPWF 1RQ7A 3IEQA 1JD1A 1YHQF 1W42A 1M1KH 1YJ9F 1T0KB 5C8YB 4G4VA 4LNUB 1IPAA 4G4YA 1M90H 3F6MA 4BVSA 5JH7A 3V7QA 3WJQA 4U39A 4X1IA 4X1YA 3K12A 3MCQA 5EB0A 3OW2F 1ZWZA 4G4XA 3E1YA 3RE3A 5FJ4C 3CCRF 2DYYA 2IG8A 5CB4B 2GVIA 4TUYA 3C9RA 1OAPA 2YXZA 1GX1A 3ZP4A 3G71F 3HKCA 2ALEA 5LXTA 4O2AB 1KQSF 2LBXA 3MBMA 5LA6A 3J81M 4ZHVA 4LCKA 1GO0A 4BT5A 4G4WA 5BMVB 2BTUA 4NWOB 2IAFA 3VYUC 1PXWA 2ZVZA 3CC7F 2NMUA 5J2UB 1U40A 1N8RH 3M84A 1DBFA 4YJ2B 2F9ZC 1E7KA 5HY0A 3ZOPA 2HS0A 2HS3A 3P4EA 3KE1A 3NK7A 3CCJF 1IV1A 3LWVC 1X52A 3M1XA 3L7QA 5GIOC 3D01A 5J2TB 3T80A 3GHZA 5KX5A 4O4LA 1SA0A 3RYFA 3LWOC 4DRXA 1IV4A 1FNKA 3CCLF 2RHJA 2IQQA 1YIJF 1Q82H 5HP7A 4ERHA 4EI9A 5KMGA 3FFMA 5MN4A 1NJIH 5HY4A 3F0EA 1W2BF 3HKBA 5EIBD 3TD3A 2BTOA 4BT2A 3GYQA 2OZBA 2B33A 5HY1A 3RYIA 3I55F 1W55A 2EWCA 2KGWA 3N2KB 2BTQB 1W59A 2VAWA 3LYBA 1XBIA 3KHNA 1U43A 2QI2A 3N2KA 4WBNA 3JASA 2OTJF 2WALA 4F6RA 3NK6A 1YJWF 3CCSF 3HTNA 4TV8B 1YQNA 4BT3A 4O2BB 3VOAA 2Z1FA 2CWJA 1JY8A 4TV9B 3J7AR 1NQ3A 4PWTA 1YI2F 1FFXA 3IKEA 4E6EA 3E20B 5LYJB 1JN1A 1JFFB 4XCQA 3UT5A 2KG4A
chains in the Genus database with same CATH topology
2AMTA 1U3LA 3ESJA 3FBAA 3T80A 3GHZA 3F6MA 3MBMA 3IKFA 4C8IA 1U43A 3ERNA 1IV2A 1IV4A 2UZHA 3F0GA 1U40A 1H47A 1KNJA 3F0FA 3QHDA 1H48A 3Q8HA 1YQNA 4C81A 1T0AA 4C8GA 3P10A 3F0EA 3K14A 1W57A 3ELCA 3JVHA 3RE3A 4C82A 1IV3A 3EORA 1JY8A 1VHAA 4C8EA 5B8FA 3K2XA 3KE1A 3IKEA 3P0ZA 2PMPA 3IEQA 3F0DA 2GZLA 1IV1A 1W55A 1JN1A 1KNKA 3B6NA 3IEWA 1U3PA 1VH8A 1GX1A 3FPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AMT A;  1U3L A;  3ESJ A;  3FBA A;  3T80 A;  3GHZ A;  3F6M A;  3MBM A;  3IKF A;  4C8I A;  1U43 A;  3ERN A;  1IV2 A;  1IV4 A;  2UZH A;  3F0G A;  1U40 A;  1H47 A;  1KNJ A;  3F0F A;  3QHD A;  1H48 A;  3Q8H A;  1YQN A;  4C81 A;  1T0A A;  4C8G A;  3P10 A;  3F0E A;  3K14 A;  1W57 A;  3ELC A;  3JVH A;  3RE3 A;  4C82 A;  1IV3 A;  3EOR A;  1JY8 A;  1VHA A;  4C8E A;  5B8F A;  3K2X A;  3KE1 A;  3IKE A;  3P0Z A;  2PMP A;  3IEQ A;  3F0D A;  2GZL A;  1IV1 A;  1W55 A;  1JN1 A;  1KNK A;  3B6N A;  3IEW A;  1U3P A;  1VH8 A;  1GX1 A;  3FPI A; 
#chains in the Genus database with same CATH topology
 3CXC F;  3RYH B;  3ZP7 A;  1KD1 H;  3ESJ A;  5EO3 A;  2CHS A;  3SIV A;  3V7E A;  3O85 A;  1W5B A;  1VQV A;  1RA4 A;  3CC2 F;  1W3E X;  2ZVY A;  5EZY B;  1Q7Y H;  3LME A;  3VYS C;  4O4J B;  4I50 A;  1COM A;  2VAM A;  4I55 A;  5IYZ A;  3I56 F;  3PLA C;  2ZOV A;  1XHO A;  3VYT C;  3VTI C;  4BW0 B;  5JH7 B;  5GIP C;  5ITZ A;  2W8B C;  3WPX A;  2GLZ A;  3VMF B;  2QA4 F;  4X1I B;  1W5A A;  5EWR A;  4X1Y B;  5HXU A;  4X20 A;  1H47 A;  3R0P A;  2HS4 A;  2V9Y A;  4TUY B;  3WJR A;  5IJ0 A;  3DDN A;  3CD6 F;  2CSL A;  2LBT A;  4EI7 A;  4ZHW A;  4NQ3 A;  1YGY A;  1VQP F;  2LCA A;  3HKC B;  3IR9 A;  5GIN C;  5JQG A;  1QVG F;  5LXT B;  4BT6 A;  4ZHQ B;  2UYJ A;  5HXZ A;  5LA6 B;  3VCZ A;  3HJW C;  2YYE A;  4ZI7 A;  1KC8 H;  4ZHQ A;  3JAM M;  1K73 H;  4G4Z A;  3N4Y A;  5G4V C;  3S0W A;  2CHT A;  4B45 A;  1J7H A;  1X7O A;  5A2Q M;  4B5C A;  4C82 A;  2HP3 A;  3AGK A;  5AVM A;  2CW4 A;  3OBY A;  3U0O A;  2RHL A;  2KTV A;  2Z1U A;  4HNA A;  1GO1 A;  1KNK A;  2RB9 A;  3OBW A;  1R1M A;  1SA0 B;  4O4L B;  5EYP A;  3RYF B;  5KX5 B;  5DCV A;  2HRU A;  3S06 A;  4DRX B;  2ZOD A;  2RHH A;  4ZOL B;  1VQO F;  4TZZ A;  2G9I A;  2K1S A;  2Z1T A;  5FNV A;  1ONI A;  4R40 B;  2VAP A;  3JAT A;  2RHO A;  3WJP A;  5KMG B;  1PF5 A;  3HWU A;  4ZOL A;  2VGM A;  3N2G A;  1NMU B;  4IIJ B;  2MQE A;  5EB1 B;  1SZQ A;  2QTP A;  3HKB B;  4NUT A;  3GTZ A;  3JAK A;  2JNB A;  4IIJ A;  3RYI B;  5LP6 B;  4FFB A;  4C8E A;  4EB6 A;  1RLU A;  4X3M A;  5LP6 A;  3IEW A;  1RLG A;  2OTL F;  1VH8 A;  1H7M A;  3C9S A;  1ODE A;  4WBN B;  3BYQ A;  3FBA A;  3JAS B;  2HX0 A;  5JVD A;  4F6R B;  3CYP B;  3V3T A;  3RYC A;  3E22 A;  2HVY D;  3MCA B;  3FD5 A;  2CZW A;  1S72 F;  2DT4 A;  3FD6 A;  4BT4 A;  3HKD A;  3RA5 A;  3QHD A;  5EAZ A;  2UYN A;  5LOV A;  4C4W C;  3I7T A;  1YJN F;  1FFX B;  1XRG A;  3CB2 A;  1K8A H;  3UT5 B;  3QTY A;  4I4T A;  2HQS C;  1TUB A;  5GAP K;  3QUW A;  3M4S A;  3KIZ A;  2I6D A;  3C9U A;  1FSZ A;  1VQ9 F;  1U3L A;  1W41 A;  4O4I A;  3CCQ F;  1YIT F;  5HP8 A;  3IKF A;  4IHJ A;  4B46 A;  4BY9 D;  2HP0 A;  2QEX F;  5GON A;  3CCV F;  2OTM A;  3JAW A;  3JAL A;  3K0T A;  4YJ3 B;  3C8L A;  5CA0 A;  3IMP A;  3KJJ A;  4I50 B;  4C81 A;  3HKE A;  3ELC A;  1VQ6 F;  4I55 B;  5IYZ B;  3CME F;  1IV3 A;  4YJ3 A;  3CYQ A;  3PAF A;  4KWE A;  1XV2 A;  4G88 A;  3CCU F;  5ITZ B;  4X3L A;  1X25 A;  4O4H A;  2H6L A;  4C8I A;  4X20 B;  2PHN A;  3JCM M;  2L26 A;  5IJ0 B;  3D54 A;  4X1K A;  2LBW A;  1T0A A;  4C8G A;  1VK3 A;  5IJ9 B;  2UYP A;  3WPW A;  2Z01 A;  3WXM B;  1W5F A;  5B8F A;  5JQG B;  5JCO C;  3DC2 A;  3WGL A;  5IJ9 A;  3CCM F;  3JAR A;  4ZI7 B;  2R75 1;  4BVQ A;  1CLI A;  5C8Y A;  4LNU A;  5IT9 M;  1KNJ A;  3F0F A;  2FGY A;  3CMA F;  2H8C A;  2R6R 1;  2Z1E A;  1Q81 H;  2FC3 A;  3WGK A;  4HNA B;  1VQ7 F;  4M8I A;  5EIB C;  1QVF F;  3D00 A;  5EYP B;  2HRY A;  3CG6 A;  4DXD A;  5CB4 A;  2N48 A;  3N4Z A;  5FNV B;  3K14 A;  3JAT B;  3ZO8 A;  2AMT A;  2OHW A;  3LFO A;  3RA6 A;  3N2G B;  4O2A A;  5G4U C;  1QU9 A;  1FNJ A;  1Z5W A;  4ZHY B;  3HAX D;  3F0G A;  3JAK B;  5BMV A;  3VI6 A;  4FFB B;  5J2U A;  4EB6 B;  4EI8 A;  3S03 A;  3TD4 A;  4B62 A;  3WGJ A;  3EOR A;  3G4S F;  4RHA A;  3LDT A;  4YJ2 A;  3K2X A;  2BO1 A;  5CA1 B;  3P0Z A;  3KJK A;  1VQL F;  3B6N A;  4BT7 A;  5JVD B;  5CA1 A;  3LWP C;  1DT9 A;  5HY2 A;  3RYC B;  3E22 B;  1CN7 A;  3VIU A;  1QD9 A;  3ERN A;  5J2T A;  3HKD B;  5HWE A;  2Q1Y A;  1Q86 H;  2UYN B;  5LOV B;  3SIU A;  2KTU A;  5MN6 A;  2H8E A;  1VQK F;  1W57 A;  3JVH A;  1JJ2 F;  1W5E A;  4I4T B;  1TUB B;  3CCE F;  5MN5 A;  1VQM F;  4ZK7 A;  3MDO A;  1X7P A;  3C9T A;  3S02 A;  3VO8 A;  1U3P A;  1OFU A;  4O4I B;  4IHJ B;  3ON1 A;  3MQW A;  2HP0 B;  1UI9 A;  3S0H A;  2ZAU A;  2ZF8 A;  1UFY A;  2AIF A;  2VXY A;  5GON B;  3JAW B;  3JAL B;  3G6E F;  3WGM A;  5CA0 B;  2UZH A;  3LWR C;  3HKE B;  1W40 A;  1H48 A;  3Q8H A;  1K9M H;  1GZ0 A;  2VGN A;  1CK2 A;  1Q8R A;  3NVK E;  3I3F A;  4TV8 A;  1QAH A;  1VHA A;  3V4D A;  4O2B A;  1SDS A;  1TVK B;  5JCO A;  5LP6 C;  5FLX M;  1VQN F;  4O4H B;  2PMP A;  4TV9 A;  2CVL A;  3F0D A;  4U3J B;  2GZL A;  2P6Y A;  3CC4 F;  3FPI A;  3S0Y A;  2UYK A;  1TVK A;  1W58 1;  5LYJ A;  1JFF A;  4U3J A;  1Z5V A;  5GAN K;  3RYH A;  3OON A;  3WGN A;  1IV2 A;  2AIZ P;  4X1K B;  4BVT A;  4RQO A;  3CPQ A;  2I6R A;  3NVI B;  2Q1X A;  1VQ5 F;  1RQ2 A;  1VQ8 F;  3P10 A;  3VOB A;  4BVR A;  3JAR B;  5EZY A;  3TD5 A;  3J80 M;  3NMU C;  3LWQ C;  1VQ4 F;  4O4J A;  3CPW F;  1RQ7 A;  3IEQ A;  1JD1 A;  1YHQ F;  1W42 A;  1M1K H;  1YJ9 F;  1T0K B;  5C8Y B;  4G4V A;  4LNU B;  1IPA A;  4G4Y A;  1M90 H;  3F6M A;  4BVS A;  5JH7 A;  3V7Q A;  3WJQ A;  4U39 A;  4X1I A;  4X1Y A;  3K12 A;  3MCQ A;  5EB0 A;  3OW2 F;  1ZWZ A;  4G4X A;  3E1Y A;  3RE3 A;  5FJ4 C;  3CCR F;  2DYY A;  2IG8 A;  5CB4 B;  2GVI A;  4TUY A;  3C9R A;  1OAP A;  2YXZ A;  1GX1 A;  3ZP4 A;  3G71 F;  3HKC A;  2ALE A;  5LXT A;  4O2A B;  1KQS F;  2LBX A;  3MBM A;  5LA6 A;  3J81 M;  4ZHV A;  4LCK A;  1GO0 A;  4BT5 A;  4G4W A;  5BMV B;  2BTU A;  4NWO B;  2IAF A;  3VYU C;  1PXW A;  2ZVZ A;  3CC7 F;  2NMU A;  5J2U B;  1U40 A;  1N8R H;  3M84 A;  1DBF A;  4YJ2 B;  2F9Z C;  1E7K A;  5HY0 A;  3ZOP A;  2HS0 A;  2HS3 A;  3P4E A;  3KE1 A;  3NK7 A;  3CCJ F;  1IV1 A;  3LWV C;  1X52 A;  3M1X A;  3L7Q A;  5GIO C;  3D01 A;  5J2T B;  3T80 A;  3GHZ A;  5KX5 A;  4O4L A;  1SA0 A;  3RYF A;  3LWO C;  4DRX A;  1IV4 A;  1FNK A;  3CCL F;  2RHJ A;  2IQQ A;  1YIJ F;  1Q82 H;  5HP7 A;  4ERH A;  4EI9 A;  5KMG A;  3FFM A;  5MN4 A;  1NJI H;  5HY4 A;  3F0E A;  1W2B F;  3HKB A;  5EIB D;  3TD3 A;  2BTO A;  4BT2 A;  3GYQ A;  2OZB A;  2B33 A;  5HY1 A;  3RYI A;  3I55 F;  1W55 A;  2EWC A;  2KGW A;  3N2K B;  2BTQ B;  1W59 A;  2VAW A;  3LYB A;  1XBI A;  3KHN A;  1U43 A;  2QI2 A;  3N2K A;  4WBN A;  3JAS A;  2OTJ F;  2WAL A;  4F6R A;  3NK6 A;  1YJW F;  3CCS F;  3HTN A;  4TV8 B;  1YQN A;  4BT3 A;  4O2B B;  3VOA A;  2Z1F A;  2CWJ A;  1JY8 A;  4TV9 B;  3J7A R;  1NQ3 A;  4PWT A;  1YI2 F;  1FFX A;  3IKE A;  4E6E A;  3E20 B;  5LYJ B;  1JN1 A;  1JFF B;  4XCQ A;  3UT5 A;  2KG4 A; 
#chains in the Genus database with same CATH homology
 2AMT A;  1U3L A;  3ESJ A;  3FBA A;  3T80 A;  3GHZ A;  3F6M A;  3MBM A;  3IKF A;  4C8I A;  1U43 A;  3ERN A;  1IV2 A;  1IV4 A;  2UZH A;  3F0G A;  1U40 A;  1H47 A;  1KNJ A;  3F0F A;  3QHD A;  1H48 A;  3Q8H A;  1YQN A;  4C81 A;  1T0A A;  4C8G A;  3P10 A;  3F0E A;  3K14 A;  1W57 A;  3ELC A;  3JVH A;  3RE3 A;  4C82 A;  1IV3 A;  3EOR A;  1JY8 A;  1VHA A;  4C8E A;  5B8F A;  3K2X A;  3KE1 A;  3IKE A;  3P0Z A;  2PMP A;  3IEQ A;  3F0D A;  2GZL A;  1IV1 A;  1W55 A;  1JN1 A;  1KNK A;  3B6N A;  3IEW A;  1U3P A;  1VH8 A;  1GX1 A;  3FPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...