3F0GA

Co-crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase with cmp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
159
structure length
159
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 53
structure length 159
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3f0gA00
1U3LA 1U40A 2AMTA 5B8FA 3QHDA 3FBAA 2PMPA 3IEWA 4C81A 1KNJA 3P0ZA 1IV4A 1W57A 1H47A 3K2XA 1GX1A 3IKEA 1VHAA 3F0FA 3EORA 1W55A 2UZHA 1IV1A 4C8GA 1KNKA 3F6MA 3FPIA 1YQNA 3MBMA 3F0DA 3GHZA 3KE1A 3IEQA 1T0AA 4C82A 1JN1A 3F0GA 3JVHA 1IV2A 3P10A 1H48A 3T80A 4C8EA 1U43A 4C8IA 3RE3A 1U3PA 1IV3A 3IKFA 3B6NA 3ELCA 3Q8HA 2GZLA 3ERNA 1JY8A 3ESJA 3F0EA 1VH8A 3K14A
chains in the Genus database with same CATH superfamily
1Q7YH 2UYNB 4E6EA 1YGYA 3QTYA 4ZI7B 4BT5A 1FFXB 2K1SA 1J7HA 1X52A 1GZ0A 3WGKA 3V4DA 3WPWA 1RLUA 1YIJF 2I6DA 3NVKE 4BT3A 4LNUA 3CB2A 4X20A 5LYJB 4IHJA 2QI2A 3LWQC 2LBTA 3Q8HA 1UI9A 3WGMA 1X7OA 2MQEA 2AMTA 3C9UA 1NJIH 1SZQA 2Z1EA 2L26A 3EORA 2IAFA 5HY0A 2FC3A 5C8YB 1VQLF 4BT6A 3CG6A 3VO8A 3FD5A 4G88A 4X1YB 3ZOPA 5JH7A 1YQNA 2OTMA 3RYHA 1K73H 2DT4A 3S0HA 4X1IA 3F0GA 3N2KB 4X1IB 3MCAB 2HQSC 4BT7A 5HY4A 1X25A 4WBNA 2PHNA 2RHOA 1FNJA 4FFBA 3RA5A 5DCVA 1W5FA 3CXCF 2NMUA 5G4UC 1W5BA 5IJ9A 4ZOLA 2YXZA 3JASB 4LNUB 3UT5A 4EI7A 3E22B 4IHJB 3JASA 2QA4F 2HRYA 1CK2A 2UYPA 3VI6A 3CCQF 1W5AA 2H8CA 1ONIA 2Q1YA 4ZK7A 4C8EA 3S0WA 5KX5A 1VQPF 3OONA 2HP0B 1RLGA 5EYPA 4G4WA 3LWRC 3OBYA 5HP8A 2BTOA 2N48A 3K14A 1PXWA 3CCRF 2PMPA 2RHLA 3S03A 4KWEA 1TUBB 3HKEA 5IJ9B 5LP6B 4B62A 3CCLF 3VIUA 2CWJA 4R40B 3N2GA 2ZVZA 1Q82H 3QUWA 3U0OA 1RA4A 1FSZA 2YYEA 4YJ3A 3G4SF 5FNVB 4X1KB 3RYFA 3BYQA 3WGLA 4O2BA 3ELCA 2GZLA 4ZOLB 3MDOA 5LA6B 3F0EA 5MN5A 3N4YA 2CVLA 5JQGA 3WJQA 3LMEA 3MCQA 1H7MA 3LWPC 4O2AB 4FFBB 1KNKA 4YJ2B 5JH7B 3P4EA 3E20B 2Z1FA 2AIFA 3RYHB 3RA6A 3GHZA 5EAZA 1YJWF 1S72F 4F6RB 4I55A 3RYCA 5HY1A 5J2TA 5LP6C 5ITZA 5EWRA 4I55B 3ON1A 1PF5A 3CMEF 3ZP4A 3JCMM 2CZWA 3LDTA 3M1XA 5IJ0B 2HS0A 4O4HA 1Q8RA 3JARB 5KMGB 3JAWB 2GLZA 4LCKA 4BT2A 5BMVB 5AVMA 1M90H 2CHSA 5LA6A 2VGNA 2BTQB 1SDSA 3IEQA 2VGMA 1GO0A 4O4IB 3CC7F 3VOBA 1YITF 2R751 3CCVF 2OZBA 1ZWZA 3S02A 3HJWC 1H48A 5HXZA 5EIBD 2H6LA 3FFMA 4TUYB 1OAPA 5EYPB 3SIVA 1U3PA 2UYNA 2CW4A 3C9RA 3I3FA 2GVIA 2BO1A 3VYUC 3V3TA 1W3EX 4U3JA 3TD5A 3D00A 3P0ZA 1DT9A 5FLXM 1VHAA 2UYJA 3CCSF 4M8IA 3JATB 4RHAA 1Z5VA 4G4YA 2DYYA 3CYPB 1QD9A 2I6RA 3NK6A 1DBFA 4O4HB 3G71F 3SIUA 5GINC 2RHHA 2IQQA 4BVRA 4RQOA 3HAXD 1SA0B 1VQVA 3MQWA 3N2KA 3KHNA 3CMAF 4ZI7A 4BW0B 2F9ZC 1UFYA 1YI2F 3M4SA 5CB4A 3JALB 4BVSA 1ODEA 1W57A 3CCUF 1H47A 3K2XA 3JAKA 2Z1TA 5GIOC 3M84A 3VCZA 3HWUA 3C8LA 4X3MA 1RQ7A 2LCAA 5GONA 3E22A 5GIPC 5HXUA 2BTUA 4ZHVA 1W5EA 1M1KH 3JVHA 4X1YA 2WALA 3IMPA 4IIJA 5C8YA 4O2AA 1OFUA 2EWCA 3GYQA 3N4ZA 1KC8H 1VQ8F 1JFFB 5IYZA 2HX0A 5HY2A 2Z1UA 5LYJA 3JAKB 1XRGA 5A2QM 4O2BB 1YJ9F 1NQ3A 2HVYD 4EI9A 5EIBC 3FPIA 4C4WC 4I4TA 3NK7A 1TVKA 4X20B 2ALEA 5CB4B 2UYKA 3HKCA 4O4LB 3CC2F 1IV2A 3LWVC 1KD1H 4X1KA 4G4ZA 4ZHWA 3VYSC 4HNAB 3PLAC 5GAPK 5IT9M 3I7TA 3L7QA 4DRXA 2OHWA 3NVIB 1TUBA 1Q81H 3QHDA 3OW2F 2H8EA 4B45A 5JVDB 5J2UA 2VAMA 1QVFF 2VAWA 4G4XA 4XCQA 3HTNA 3K0TA 4O4JB 1T0AA 4ZHYB 3AGKA 3N2GB 2JNBA 5J2UB 5JVDA 3LFOA 4TV9A 5EB0A 1T0KB 3IKFA 1JJ2F 1N8RH 2CHTA 3O85A 2RHJA 4TV9B 1VQ9F 2KTUA 4X3LA 3S06A 3VMFB 1TVKB 4NUTA 1IV4A 1VQOF 2W8BC 1GX1A 3JARA 1CLIA 4BVTA 4I50B 2ZODA 3CCMF 1QVGF 2ZVYA 1CN7A 1W581 4EB6B 3C9SA 3RYIB 3C9TA 3KJKA 3MBMA 3V7EA 4TV8B 5J2TB 4I4TB 5FJ4C 5ITZB 2HRUA 3T80A 3HKBB 4C8IA 1Z5WA 3RE3A 5CA0A 5MN6A 3RYFB 4WBNB 1XV2A 2AIZP 3B6NA 4TUYA 1YHQF 4HNAA 1K9MH 3ERNA 4EB6A 3FBAA 1VQ7F 5LXTB 2B33A 4I50A 1NMUB 3GTZA 3IKEA 4O4JA 3F0FA 4NWOB 1IV1A 3J81M 4BVQA 3R0PA 3ZO8A 5LP6A 3D01A 3J7AR 4TV8A 1YJNF 1XBIA 1W41A 3LWOC 3LYBA 3CD6F 5EO3A 3ZP7A 5EZYB 4YJ3B 1U43A 5GONB 3OBWA 5JCOA 3RYIA 1IV3A 1FFXA 5EB1B 3JAMM 3HKDB 3JALA 2ZAUA 1VQ6F 3HKCB 2VAPA 5GANK 4C8GA 1VQ4F 1GO1A 2HS4A 3IR9A 2HP0A 3KE1A 4PWTA 5HP7A 2KGWA 4G4VA 3HKEB 3JAWA 1VQ5F 1QAHA 3DDNA 5CA1A 3WGJA 3D54A 2VXYA 2KTVA 2OTLF 3VOAA 1VH8A 5JCOC 5G4VC 4C81A 3VTIC 2HS3A 4U3JB 2FGYA 1W55A 2CSLA 3WPXA 2KG4A 4B46A 4DRXB 2Q1XA 5CA1B 1KQSF 1K8AH 1COMA 1W40A 2ZOVA 5EZYA 2G9IA 1Q86H 3CCEF 3RYCB 1VQNF 4IIJB 4O4LA 1VQMF 4O4IA 4BT4A 3HKDA 5LOVB 5BMVA 1JY8A 4YJ2A 5LXTA 1U3LA 5B8FA 4B5CA 4ZHQA 1SA0A 3IEWA 2QTPA 5JQGB 2LBXA 1R1MA 1JFFA 5IYZB 3F6MA 3TD3A 3HKBA 2V9YA 3V7QA 3I55F 1X7PA 1W42A 5FNVA 3S0YA 5KMGA 1JN1A 1IPAA 1QU9A 1JD1A 4ZHQB 1E7KA 1W2BF 4NQ3A 3P10A 5IJ0A 3I56F 4F6RA 5HWEA 1RQ2A 2RB9A 4ERHA 3CYQA 3WGNA 1FNKA 3WJRA 3NMUC 3WJPA 2QEXF 1VK3A 3VYTC 1VQKF 5MN4A 3ESJA 4U39A 3G6EF 1U40A 5KX5B 1W59A 2HP3A 3K12A 3WXMB 1KNJA 5CA0B 3KJJA 3CCJF 2UZHA 3KIZA 5LOVA 2LBWA 4BY9D 2IG8A 3UT5B 3FD6A 4TZZA 3CPQA 3F0DA 1XHOA 3PAFA 3J80M 2ZF8A 4C82A 3CC4F 4EI8A 3E1YA 3CPWF 2R6R1 2OTJF 2Z01A 3TD4A 2P6YA 3JATA 3DC2A 4DXDA
chains in the Genus database with same CATH topology
1U3LA 1U40A 2AMTA 5B8FA 3QHDA 3FBAA 2PMPA 3IEWA 4C81A 1KNJA 3P0ZA 1IV4A 1W57A 1H47A 3K2XA 1GX1A 3IKEA 1VHAA 3F0FA 3EORA 1W55A 2UZHA 1IV1A 4C8GA 1KNKA 3F6MA 3FPIA 1YQNA 3MBMA 3F0DA 3GHZA 3KE1A 3IEQA 1T0AA 4C82A 1JN1A 3F0GA 3JVHA 1IV2A 3P10A 1H48A 3T80A 4C8EA 1U43A 4C8IA 3RE3A 1U3PA 1IV3A 3IKFA 3B6NA 3ELCA 3Q8HA 2GZLA 3ERNA 1JY8A 3ESJA 3F0EA 1VH8A 3K14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3L A;  1U40 A;  2AMT A;  5B8F A;  3QHD A;  3FBA A;  2PMP A;  3IEW A;  4C81 A;  1KNJ A;  3P0Z A;  1IV4 A;  1W57 A;  1H47 A;  3K2X A;  1GX1 A;  3IKE A;  1VHA A;  3F0F A;  3EOR A;  1W55 A;  2UZH A;  1IV1 A;  4C8G A;  1KNK A;  3F6M A;  3FPI A;  1YQN A;  3MBM A;  3F0D A;  3GHZ A;  3KE1 A;  3IEQ A;  1T0A A;  4C82 A;  1JN1 A;  3F0G A;  3JVH A;  1IV2 A;  3P10 A;  1H48 A;  3T80 A;  4C8E A;  1U43 A;  4C8I A;  3RE3 A;  1U3P A;  1IV3 A;  3IKF A;  3B6N A;  3ELC A;  3Q8H A;  2GZL A;  3ERN A;  1JY8 A;  3ESJ A;  3F0E A;  1VH8 A;  3K14 A; 
#chains in the Genus database with same CATH topology
 1Q7Y H;  2UYN B;  4E6E A;  1YGY A;  3QTY A;  4ZI7 B;  4BT5 A;  1FFX B;  2K1S A;  1J7H A;  1X52 A;  1GZ0 A;  3WGK A;  3V4D A;  3WPW A;  1RLU A;  1YIJ F;  2I6D A;  3NVK E;  4BT3 A;  4LNU A;  3CB2 A;  4X20 A;  5LYJ B;  4IHJ A;  2QI2 A;  3LWQ C;  2LBT A;  3Q8H A;  1UI9 A;  3WGM A;  1X7O A;  2MQE A;  2AMT A;  3C9U A;  1NJI H;  1SZQ A;  2Z1E A;  2L26 A;  3EOR A;  2IAF A;  5HY0 A;  2FC3 A;  5C8Y B;  1VQL F;  4BT6 A;  3CG6 A;  3VO8 A;  3FD5 A;  4G88 A;  4X1Y B;  3ZOP A;  5JH7 A;  1YQN A;  2OTM A;  3RYH A;  1K73 H;  2DT4 A;  3S0H A;  4X1I A;  3F0G A;  3N2K B;  4X1I B;  3MCA B;  2HQS C;  4BT7 A;  5HY4 A;  1X25 A;  4WBN A;  2PHN A;  2RHO A;  1FNJ A;  4FFB A;  3RA5 A;  5DCV A;  1W5F A;  3CXC F;  2NMU A;  5G4U C;  1W5B A;  5IJ9 A;  4ZOL A;  2YXZ A;  3JAS B;  4LNU B;  3UT5 A;  4EI7 A;  3E22 B;  4IHJ B;  3JAS A;  2QA4 F;  2HRY A;  1CK2 A;  2UYP A;  3VI6 A;  3CCQ F;  1W5A A;  2H8C A;  1ONI A;  2Q1Y A;  4ZK7 A;  4C8E A;  3S0W A;  5KX5 A;  1VQP F;  3OON A;  2HP0 B;  1RLG A;  5EYP A;  4G4W A;  3LWR C;  3OBY A;  5HP8 A;  2BTO A;  2N48 A;  3K14 A;  1PXW A;  3CCR F;  2PMP A;  2RHL A;  3S03 A;  4KWE A;  1TUB B;  3HKE A;  5IJ9 B;  5LP6 B;  4B62 A;  3CCL F;  3VIU A;  2CWJ A;  4R40 B;  3N2G A;  2ZVZ A;  1Q82 H;  3QUW A;  3U0O A;  1RA4 A;  1FSZ A;  2YYE A;  4YJ3 A;  3G4S F;  5FNV B;  4X1K B;  3RYF A;  3BYQ A;  3WGL A;  4O2B A;  3ELC A;  2GZL A;  4ZOL B;  3MDO A;  5LA6 B;  3F0E A;  5MN5 A;  3N4Y A;  2CVL A;  5JQG A;  3WJQ A;  3LME A;  3MCQ A;  1H7M A;  3LWP C;  4O2A B;  4FFB B;  1KNK A;  4YJ2 B;  5JH7 B;  3P4E A;  3E20 B;  2Z1F A;  2AIF A;  3RYH B;  3RA6 A;  3GHZ A;  5EAZ A;  1YJW F;  1S72 F;  4F6R B;  4I55 A;  3RYC A;  5HY1 A;  5J2T A;  5LP6 C;  5ITZ A;  5EWR A;  4I55 B;  3ON1 A;  1PF5 A;  3CME F;  3ZP4 A;  3JCM M;  2CZW A;  3LDT A;  3M1X A;  5IJ0 B;  2HS0 A;  4O4H A;  1Q8R A;  3JAR B;  5KMG B;  3JAW B;  2GLZ A;  4LCK A;  4BT2 A;  5BMV B;  5AVM A;  1M90 H;  2CHS A;  5LA6 A;  2VGN A;  2BTQ B;  1SDS A;  3IEQ A;  2VGM A;  1GO0 A;  4O4I B;  3CC7 F;  3VOB A;  1YIT F;  2R75 1;  3CCV F;  2OZB A;  1ZWZ A;  3S02 A;  3HJW C;  1H48 A;  5HXZ A;  5EIB D;  2H6L A;  3FFM A;  4TUY B;  1OAP A;  5EYP B;  3SIV A;  1U3P A;  2UYN A;  2CW4 A;  3C9R A;  3I3F A;  2GVI A;  2BO1 A;  3VYU C;  3V3T A;  1W3E X;  4U3J A;  3TD5 A;  3D00 A;  3P0Z A;  1DT9 A;  5FLX M;  1VHA A;  2UYJ A;  3CCS F;  4M8I A;  3JAT B;  4RHA A;  1Z5V A;  4G4Y A;  2DYY A;  3CYP B;  1QD9 A;  2I6R A;  3NK6 A;  1DBF A;  4O4H B;  3G71 F;  3SIU A;  5GIN C;  2RHH A;  2IQQ A;  4BVR A;  4RQO A;  3HAX D;  1SA0 B;  1VQV A;  3MQW A;  3N2K A;  3KHN A;  3CMA F;  4ZI7 A;  4BW0 B;  2F9Z C;  1UFY A;  1YI2 F;  3M4S A;  5CB4 A;  3JAL B;  4BVS A;  1ODE A;  1W57 A;  3CCU F;  1H47 A;  3K2X A;  3JAK A;  2Z1T A;  5GIO C;  3M84 A;  3VCZ A;  3HWU A;  3C8L A;  4X3M A;  1RQ7 A;  2LCA A;  5GON A;  3E22 A;  5GIP C;  5HXU A;  2BTU A;  4ZHV A;  1W5E A;  1M1K H;  3JVH A;  4X1Y A;  2WAL A;  3IMP A;  4IIJ A;  5C8Y A;  4O2A A;  1OFU A;  2EWC A;  3GYQ A;  3N4Z A;  1KC8 H;  1VQ8 F;  1JFF B;  5IYZ A;  2HX0 A;  5HY2 A;  2Z1U A;  5LYJ A;  3JAK B;  1XRG A;  5A2Q M;  4O2B B;  1YJ9 F;  1NQ3 A;  2HVY D;  4EI9 A;  5EIB C;  3FPI A;  4C4W C;  4I4T A;  3NK7 A;  1TVK A;  4X20 B;  2ALE A;  5CB4 B;  2UYK A;  3HKC A;  4O4L B;  3CC2 F;  1IV2 A;  3LWV C;  1KD1 H;  4X1K A;  4G4Z A;  4ZHW A;  3VYS C;  4HNA B;  3PLA C;  5GAP K;  5IT9 M;  3I7T A;  3L7Q A;  4DRX A;  2OHW A;  3NVI B;  1TUB A;  1Q81 H;  3QHD A;  3OW2 F;  2H8E A;  4B45 A;  5JVD B;  5J2U A;  2VAM A;  1QVF F;  2VAW A;  4G4X A;  4XCQ A;  3HTN A;  3K0T A;  4O4J B;  1T0A A;  4ZHY B;  3AGK A;  3N2G B;  2JNB A;  5J2U B;  5JVD A;  3LFO A;  4TV9 A;  5EB0 A;  1T0K B;  3IKF A;  1JJ2 F;  1N8R H;  2CHT A;  3O85 A;  2RHJ A;  4TV9 B;  1VQ9 F;  2KTU A;  4X3L A;  3S06 A;  3VMF B;  1TVK B;  4NUT A;  1IV4 A;  1VQO F;  2W8B C;  1GX1 A;  3JAR A;  1CLI A;  4BVT A;  4I50 B;  2ZOD A;  3CCM F;  1QVG F;  2ZVY A;  1CN7 A;  1W58 1;  4EB6 B;  3C9S A;  3RYI B;  3C9T A;  3KJK A;  3MBM A;  3V7E A;  4TV8 B;  5J2T B;  4I4T B;  5FJ4 C;  5ITZ B;  2HRU A;  3T80 A;  3HKB B;  4C8I A;  1Z5W A;  3RE3 A;  5CA0 A;  5MN6 A;  3RYF B;  4WBN B;  1XV2 A;  2AIZ P;  3B6N A;  4TUY A;  1YHQ F;  4HNA A;  1K9M H;  3ERN A;  4EB6 A;  3FBA A;  1VQ7 F;  5LXT B;  2B33 A;  4I50 A;  1NMU B;  3GTZ A;  3IKE A;  4O4J A;  3F0F A;  4NWO B;  1IV1 A;  3J81 M;  4BVQ A;  3R0P A;  3ZO8 A;  5LP6 A;  3D01 A;  3J7A R;  4TV8 A;  1YJN F;  1XBI A;  1W41 A;  3LWO C;  3LYB A;  3CD6 F;  5EO3 A;  3ZP7 A;  5EZY B;  4YJ3 B;  1U43 A;  5GON B;  3OBW A;  5JCO A;  3RYI A;  1IV3 A;  1FFX A;  5EB1 B;  3JAM M;  3HKD B;  3JAL A;  2ZAU A;  1VQ6 F;  3HKC B;  2VAP A;  5GAN K;  4C8G A;  1VQ4 F;  1GO1 A;  2HS4 A;  3IR9 A;  2HP0 A;  3KE1 A;  4PWT A;  5HP7 A;  2KGW A;  4G4V A;  3HKE B;  3JAW A;  1VQ5 F;  1QAH A;  3DDN A;  5CA1 A;  3WGJ A;  3D54 A;  2VXY A;  2KTV A;  2OTL F;  3VOA A;  1VH8 A;  5JCO C;  5G4V C;  4C81 A;  3VTI C;  2HS3 A;  4U3J B;  2FGY A;  1W55 A;  2CSL A;  3WPX A;  2KG4 A;  4B46 A;  4DRX B;  2Q1X A;  5CA1 B;  1KQS F;  1K8A H;  1COM A;  1W40 A;  2ZOV A;  5EZY A;  2G9I A;  1Q86 H;  3CCE F;  3RYC B;  1VQN F;  4IIJ B;  4O4L A;  1VQM F;  4O4I A;  4BT4 A;  3HKD A;  5LOV B;  5BMV A;  1JY8 A;  4YJ2 A;  5LXT A;  1U3L A;  5B8F A;  4B5C A;  4ZHQ A;  1SA0 A;  3IEW A;  2QTP A;  5JQG B;  2LBX A;  1R1M A;  1JFF A;  5IYZ B;  3F6M A;  3TD3 A;  3HKB A;  2V9Y A;  3V7Q A;  3I55 F;  1X7P A;  1W42 A;  5FNV A;  3S0Y A;  5KMG A;  1JN1 A;  1IPA A;  1QU9 A;  1JD1 A;  4ZHQ B;  1E7K A;  1W2B F;  4NQ3 A;  3P10 A;  5IJ0 A;  3I56 F;  4F6R A;  5HWE A;  1RQ2 A;  2RB9 A;  4ERH A;  3CYQ A;  3WGN A;  1FNK A;  3WJR A;  3NMU C;  3WJP A;  2QEX F;  1VK3 A;  3VYT C;  1VQK F;  5MN4 A;  3ESJ A;  4U39 A;  3G6E F;  1U40 A;  5KX5 B;  1W59 A;  2HP3 A;  3K12 A;  3WXM B;  1KNJ A;  5CA0 B;  3KJJ A;  3CCJ F;  2UZH A;  3KIZ A;  5LOV A;  2LBW A;  4BY9 D;  2IG8 A;  3UT5 B;  3FD6 A;  4TZZ A;  3CPQ A;  3F0D A;  1XHO A;  3PAF A;  3J80 M;  2ZF8 A;  4C82 A;  3CC4 F;  4EI8 A;  3E1Y A;  3CPW F;  2R6R 1;  2OTJ F;  2Z01 A;  3TD4 A;  2P6Y A;  3JAT A;  3DC2 A;  4DXD A; 
#chains in the Genus database with same CATH homology
 1U3L A;  1U40 A;  2AMT A;  5B8F A;  3QHD A;  3FBA A;  2PMP A;  3IEW A;  4C81 A;  1KNJ A;  3P0Z A;  1IV4 A;  1W57 A;  1H47 A;  3K2X A;  1GX1 A;  3IKE A;  1VHA A;  3F0F A;  3EOR A;  1W55 A;  2UZH A;  1IV1 A;  4C8G A;  1KNK A;  3F6M A;  3FPI A;  1YQN A;  3MBM A;  3F0D A;  3GHZ A;  3KE1 A;  3IEQ A;  1T0A A;  4C82 A;  1JN1 A;  3F0G A;  3JVH A;  1IV2 A;  3P10 A;  1H48 A;  3T80 A;  4C8E A;  1U43 A;  4C8I A;  3RE3 A;  1U3P A;  1IV3 A;  3IKF A;  3B6N A;  3ELC A;  3Q8H A;  2GZL A;  3ERN A;  1JY8 A;  3ESJ A;  3F0E A;  1VH8 A;  3K14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...