3F0GA

Co-crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase with cmp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
159
structure length
159
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 53
structure length 159
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3f0gA00
3JVHA 4C8GA 3ESJA 3FBAA 3K2XA 1U40A 3RE3A 1T0AA 3Q8HA 3B6NA 1IV4A 1U3PA 3IEQA 1JN1A 4C82A 1H47A 2UZHA 1KNJA 3F0FA 2PMPA 3EORA 2GZLA 1VH8A 3K14A 1IV3A 3ERNA 3IKFA 3P0ZA 1VHAA 1U43A 1IV2A 3IKEA 1H48A 3QHDA 3F0EA 1IV1A 3IEWA 3F6MA 3FPIA 3GHZA 4C8EA 4C8IA 3ELCA 1W57A 4C81A 3MBMA 3P10A 3F0DA 1JY8A 3KE1A 5B8FA 3T80A 2AMTA 1GX1A 1KNKA 1YQNA 1W55A 3F0GA 1U3LA
chains in the Genus database with same CATH superfamily
5JVDB 2B33A 2ZAUA 1W3EX 3HKEB 4KWEA 4BW0B 5GIOC 3RE3A 1UI9A 3VCZA 5IJ0B 1TVKA 3HJWC 1NJIH 3VO8A 4O2BA 2UYJA 1SDSA 3KJJA 4O2AB 1W59A 3CCJF 3S0HA 1U43A 1ZWZA 3N2KB 2BTOA 1T0KB 4BT2A 4EI9A 3CB2A 5HY1A 5J2UB 1VQ5F 3WGKA 2LBTA 3T80A 4G4YA 5HY0A 1X25A 2QTPA 4HNAB 4IHJA 3KHNA 3J7AR 2CSLA 2L26A 3NVKE 3QTYA 1X52A 3FD6A 5FJ4C 1VQPF 5LOVA 2IG8A 3V7QA 1KQSF 2Z01A 3D54A 3WGMA 3ZO8A 1QD9A 3I55F 2ZODA 4G4WA 2QA4F 3NK7A 3EORA 2H8CA 3WJQA 3MQWA 2Z1UA 4M8IA 5DCVA 3JARA 2DYYA 4LNUB 4U3JB 4B45A 2QI2A 1JY8A 1VQ8F 2Z1FA 1YQNA 4ZHQA 1NQ3A 1W5FA 2ZOVA 1W55A 1JFFA 4YJ3A 5FLXM 3JAMM 2UYNA 1YHQF 5JH7A 2OTJF 2MQEA 4C82A 3C9UA 5FNVA 5CA1B 1YJWF 4O4JA 4F6RA 2LBWA 3IKEA 1RQ7A 4TUYA 4R40B 5IYZA 1SA0A 1ODEA 1YGYA 3D00A 2I6RA 2W8BC 5KX5A 2RHJA 4X3MA 5HY2A 4WBNB 4C4WC 3WPWA 4G4XA 1KNKA 3VI6A 3CYPB 4FFBB 3RYFA 4C8GA 1CN7A 3ESJA 5GANK 2HVYD 3P4EA 3M4SA 2R6R1 1FSZA 1QU9A 5J2TB 3VOBA 1QVFF 4ZHYB 2LBXA 3OBWA 5C8YB 5GINC 4X1KA 3IEQA 3C9SA 1Z5WA 1YITF 3ZP7A 3MCAB 3RYIA 2DT4A 1M90H 1J7HA 3S02A 3CMAF 3LWQC 2BTUA 2HS3A 2Z1EA 1VQ6F 3F6MA 1S72F 3HAXD 4C8IA 3G6EF 3HKCB 1XV2A 1GO0A 3MBMA 1W5AA 4X1YB 3TD4A 1GX1A 3JCMM 2I6DA 3PLAC 2ZVZA 3D01A 5IJ9A 3NMUC 1RLGA 4YJ2B 4I55A 1VQLF 3B6NA 3LYBA 3V7EA 4I50A 3E22B 3TD3A 3UT5B 1VQMF 1H7MA 4X20A 3P0ZA 3ERNA 2VGMA 3IKFA 1VHAA 5LA6A 1RA4A 4O4HB 2YXZA 4O2BB 3PAFA 3ELCA 5AVMA 1YI2F 2BO1A 1W40A 3SIUA 2IQQA 4G4VA 3E20B 4O4LB 3J80M 3I3FA 4BVRA 3S06A 4NQ3A 4DRXA 5EAZA 3TD5A 4IHJB 4BT3A 5MN6A 4BT6A 2QEXF 3F0FA 2WALA 2N48A 2GZLA 3U0OA 4ZHWA 3G71F 4TV8A 5CA0A 3WJRA 4NWOB 1Q86H 3F0EA 3CYQA 4ERHA 3BYQA 3CG6A 5LXTA 2Q1YA 3NVIB 5ITZB 3LFOA 5EZYB 3JATA 5BMVB 3WPXA 2AMTA 2G9IA 5HP7A 3MDOA 3JARB 1TUBA 5JQGB 1U3LA 2RHLA 2VAMA 1T0AA 5HY4A 4ZHQB 3JASA 1IV4A 1VQ7F 1JFFB 3RA6A 1RQ2A 4YJ3B 1K73H 4ZHVA 2UYNB 1KD1H 2JNBA 4B5CA 1W2BF 1FFXA 5JH7B 4I4TA 3DC2A 3CC7F 3ZOPA 1X7OA 3HKEA 2NMUA 3I56F 1X7PA 4X3LA 3F0DA 4O4JB 4F6RB 3C8LA 3S0YA 1VK3A 3V4DA 4TUYB 3CD6F 2CW4A 4X1IB 4O2AA 2HP0B 5IYZB 3VMFB 4RQOA 1SA0B 3N2KA 3LWRC 1OFUA 2Z1TA 2EWCA 2PHNA 4BT4A 2CVLA 1H47A 3RYHA 5J2UA 2OTMA 2PMPA 2ZF8A 1Q82H 1K9MH 4BY9D 4U39A 5HWEA 4X1KB 5EWRA 3RYIB 3LWPC 4G4ZA 2ALEA 3HKDA 1QAHA 3RYCB 4TV9A 3IR9A 1FNJA 2CHTA 2UYPA 4O4IA 2OHWA 1YJNF 1W41A 3R0PA 5A2QM 2UYKA 3N2GA 3JAWA 3FD5A 1KNJA 2HRUA 1QVGF 3JAKA 4G88A 5HP8A 2RHHA 3CCEF 3GTZA 4ZI7A 3IEWA 5EYPA 3GYQA 3VYUC 4BVTA 5GIPC 1JD1A 2GLZA 5CB4A 5LA6B 3KJKA 4ZOLA 3N4YA 2CHSA 2YYEA 4BT7A 1PF5A 3SIVA 5HXUA 5CA1A 3FBAA 5MN5A 2AIZP 3OW2F 3K2XA 2KG4A 5LP6A 2ZVYA 1FNKA 3RA5A 4ZK7A 3WXMB 3K14A 3CC2F 2KTUA 2FC3A 3CCQF 3CPQA 3WGLA 4DRXB 5G4VC 1H48A 4FFBA 5LP6C 1JJ2F 4PWTA 1TVKB 5EIBD 4EI8A 3CXCF 4B62A 5JCOA 2RHOA 4IIJA 1Q81H 5EO3A 1YJ9F 5GAPK 3HTNA 5LXTB 3WGNA 3JATB 1XBIA 5JCOC 5MN4A 3Q8HA 3VIUA 5LYJA 1TUBB 3IMPA 3NK6A 2IAFA 3N4ZA 4X1YA 4DXDA 2Q1XA 2R751 3HWUA 5LOVB 3CCVF 3JASB 3CCMF 1XRGA 2LCAA 2KTVA 4YJ2A 1K8AH 2KGWA 5KMGA 4EI7A 3HKBA 3WJPA 4EB6A 4I4TB 3CCUF 3LMEA 3CCLF 3K12A 1PXWA 1Q7YH 4O4HA 2CWJA 3WGJA 3VYTC 1Q8RA 2RB9A 3I7TA 1VQ4F 3JALA 2GVIA 3OBYA 2VGNA 1IV2A 2VAPA 3CPWF 2CZWA 2BTQB 4O4LA 2VAWA 5GONA 5JVDA 3RYHB 3ON1A 5FNVB 3C9TA 5IJ0A 4BVQA 3CCRF 1N8RH 1DT9A 3V3TA 5KX5B 2K1SA 1VQOF 3E1YA 2HS0A 3HKDB 5ITZA 1UFYA 2AIFA 4TV9B 5EZYA 3RYFB 4BVSA 5BMVA 2OZBA 4O4IB 1IV3A 1VQNF 1GZ0A 1NMUB 3M84A 4HNAA 4BT5A 5JQGA 2V9YA 1CLIA 1COMA 3N2GB 3JAWB 1RLUA 1VQVA 2FGYA 3JAKB 4E6EA 3P10A 1E7KA 5B8FA 1M1KH 4RHAA 4ZI7B 5EYPB 3OONA 5EIBC 5CB4B 1DBFA 1U40A 3ZP4A 4ZOLB 3VOAA 1OAPA 2HQSC 3O85A 4LNUA 3M1XA 4U3JA 1KC8H 2HS4A 4NUTA 5IJ9B 1VQKF 3CC4F 3K0TA 5LP6B 5IT9M 3CMEF 2H6LA 4I55B 3C9RA 1W42A 4X1IA 1XHOA 2HP0A 4I50B 3GHZA 3S0WA 4C8EA 5G4UC 4B46A 4C81A 3S03A 1SZQA 4X20B 1IPAA 3F0GA 3LWOC 3AGKA 3JVHA 4LCKA 4IIJB 2P6YA 2HRYA 5EB1B 3J81M 4TZZA 1VH8A 2F9ZC 4WBNA 3CCSF 1VQ9F 3VTIC 1W581 3RYCA 1Z5VA 3FPIA 3DDNA 5LYJB 5HXZA 5J2TA 1CK2A 3LDTA 4TV8B 5C8YA 3FFMA 5CA0B 1ONIA 3MCQA 1GO1A 1R1MA 3VYSC 5KMGB 3HKBB 4EB6B 2VXYA 1U3PA 1JN1A 2H8EA 5EB0A 1W5EA 2UZHA 3L7QA 3HKCA 1YIJF 2HX0A 3QHDA 1IV1A 4XCQA 1W57A 3JALB 3KE1A 3KIZA 3QUWA 2OTLF 2HP3A 1W5BA 1FFXB 3E22A 3LWVC 3UT5A 3G4SF 5GONB
chains in the Genus database with same CATH topology
3JVHA 4C8GA 3ESJA 3FBAA 3K2XA 1U40A 3RE3A 1T0AA 3Q8HA 3B6NA 1IV4A 1U3PA 3IEQA 1JN1A 4C82A 1H47A 2UZHA 1KNJA 3F0FA 2PMPA 3EORA 2GZLA 1VH8A 3K14A 1IV3A 3ERNA 3IKFA 3P0ZA 1VHAA 1U43A 1IV2A 3IKEA 1H48A 3QHDA 3F0EA 1IV1A 3IEWA 3F6MA 3FPIA 3GHZA 4C8EA 4C8IA 3ELCA 1W57A 4C81A 3MBMA 3P10A 3F0DA 1JY8A 3KE1A 5B8FA 3T80A 2AMTA 1GX1A 1KNKA 1YQNA 1W55A 3F0GA 1U3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JVH A;  4C8G A;  3ESJ A;  3FBA A;  3K2X A;  1U40 A;  3RE3 A;  1T0A A;  3Q8H A;  3B6N A;  1IV4 A;  1U3P A;  3IEQ A;  1JN1 A;  4C82 A;  1H47 A;  2UZH A;  1KNJ A;  3F0F A;  2PMP A;  3EOR A;  2GZL A;  1VH8 A;  3K14 A;  1IV3 A;  3ERN A;  3IKF A;  3P0Z A;  1VHA A;  1U43 A;  1IV2 A;  3IKE A;  1H48 A;  3QHD A;  3F0E A;  1IV1 A;  3IEW A;  3F6M A;  3FPI A;  3GHZ A;  4C8E A;  4C8I A;  3ELC A;  1W57 A;  4C81 A;  3MBM A;  3P10 A;  3F0D A;  1JY8 A;  3KE1 A;  5B8F A;  3T80 A;  2AMT A;  1GX1 A;  1KNK A;  1YQN A;  1W55 A;  3F0G A;  1U3L A; 
#chains in the Genus database with same CATH topology
 5JVD B;  2B33 A;  2ZAU A;  1W3E X;  3HKE B;  4KWE A;  4BW0 B;  5GIO C;  3RE3 A;  1UI9 A;  3VCZ A;  5IJ0 B;  1TVK A;  3HJW C;  1NJI H;  3VO8 A;  4O2B A;  2UYJ A;  1SDS A;  3KJJ A;  4O2A B;  1W59 A;  3CCJ F;  3S0H A;  1U43 A;  1ZWZ A;  3N2K B;  2BTO A;  1T0K B;  4BT2 A;  4EI9 A;  3CB2 A;  5HY1 A;  5J2U B;  1VQ5 F;  3WGK A;  2LBT A;  3T80 A;  4G4Y A;  5HY0 A;  1X25 A;  2QTP A;  4HNA B;  4IHJ A;  3KHN A;  3J7A R;  2CSL A;  2L26 A;  3NVK E;  3QTY A;  1X52 A;  3FD6 A;  5FJ4 C;  1VQP F;  5LOV A;  2IG8 A;  3V7Q A;  1KQS F;  2Z01 A;  3D54 A;  3WGM A;  3ZO8 A;  1QD9 A;  3I55 F;  2ZOD A;  4G4W A;  2QA4 F;  3NK7 A;  3EOR A;  2H8C A;  3WJQ A;  3MQW A;  2Z1U A;  4M8I A;  5DCV A;  3JAR A;  2DYY A;  4LNU B;  4U3J B;  4B45 A;  2QI2 A;  1JY8 A;  1VQ8 F;  2Z1F A;  1YQN A;  4ZHQ A;  1NQ3 A;  1W5F A;  2ZOV A;  1W55 A;  1JFF A;  4YJ3 A;  5FLX M;  3JAM M;  2UYN A;  1YHQ F;  5JH7 A;  2OTJ F;  2MQE A;  4C82 A;  3C9U A;  5FNV A;  5CA1 B;  1YJW F;  4O4J A;  4F6R A;  2LBW A;  3IKE A;  1RQ7 A;  4TUY A;  4R40 B;  5IYZ A;  1SA0 A;  1ODE A;  1YGY A;  3D00 A;  2I6R A;  2W8B C;  5KX5 A;  2RHJ A;  4X3M A;  5HY2 A;  4WBN B;  4C4W C;  3WPW A;  4G4X A;  1KNK A;  3VI6 A;  3CYP B;  4FFB B;  3RYF A;  4C8G A;  1CN7 A;  3ESJ A;  5GAN K;  2HVY D;  3P4E A;  3M4S A;  2R6R 1;  1FSZ A;  1QU9 A;  5J2T B;  3VOB A;  1QVF F;  4ZHY B;  2LBX A;  3OBW A;  5C8Y B;  5GIN C;  4X1K A;  3IEQ A;  3C9S A;  1Z5W A;  1YIT F;  3ZP7 A;  3MCA B;  3RYI A;  2DT4 A;  1M90 H;  1J7H A;  3S02 A;  3CMA F;  3LWQ C;  2BTU A;  2HS3 A;  2Z1E A;  1VQ6 F;  3F6M A;  1S72 F;  3HAX D;  4C8I A;  3G6E F;  3HKC B;  1XV2 A;  1GO0 A;  3MBM A;  1W5A A;  4X1Y B;  3TD4 A;  1GX1 A;  3JCM M;  2I6D A;  3PLA C;  2ZVZ A;  3D01 A;  5IJ9 A;  3NMU C;  1RLG A;  4YJ2 B;  4I55 A;  1VQL F;  3B6N A;  3LYB A;  3V7E A;  4I50 A;  3E22 B;  3TD3 A;  3UT5 B;  1VQM F;  1H7M A;  4X20 A;  3P0Z A;  3ERN A;  2VGM A;  3IKF A;  1VHA A;  5LA6 A;  1RA4 A;  4O4H B;  2YXZ A;  4O2B B;  3PAF A;  3ELC A;  5AVM A;  1YI2 F;  2BO1 A;  1W40 A;  3SIU A;  2IQQ A;  4G4V A;  3E20 B;  4O4L B;  3J80 M;  3I3F A;  4BVR A;  3S06 A;  4NQ3 A;  4DRX A;  5EAZ A;  3TD5 A;  4IHJ B;  4BT3 A;  5MN6 A;  4BT6 A;  2QEX F;  3F0F A;  2WAL A;  2N48 A;  2GZL A;  3U0O A;  4ZHW A;  3G71 F;  4TV8 A;  5CA0 A;  3WJR A;  4NWO B;  1Q86 H;  3F0E A;  3CYQ A;  4ERH A;  3BYQ A;  3CG6 A;  5LXT A;  2Q1Y A;  3NVI B;  5ITZ B;  3LFO A;  5EZY B;  3JAT A;  5BMV B;  3WPX A;  2AMT A;  2G9I A;  5HP7 A;  3MDO A;  3JAR B;  1TUB A;  5JQG B;  1U3L A;  2RHL A;  2VAM A;  1T0A A;  5HY4 A;  4ZHQ B;  3JAS A;  1IV4 A;  1VQ7 F;  1JFF B;  3RA6 A;  1RQ2 A;  4YJ3 B;  1K73 H;  4ZHV A;  2UYN B;  1KD1 H;  2JNB A;  4B5C A;  1W2B F;  1FFX A;  5JH7 B;  4I4T A;  3DC2 A;  3CC7 F;  3ZOP A;  1X7O A;  3HKE A;  2NMU A;  3I56 F;  1X7P A;  4X3L A;  3F0D A;  4O4J B;  4F6R B;  3C8L A;  3S0Y A;  1VK3 A;  3V4D A;  4TUY B;  3CD6 F;  2CW4 A;  4X1I B;  4O2A A;  2HP0 B;  5IYZ B;  3VMF B;  4RQO A;  1SA0 B;  3N2K A;  3LWR C;  1OFU A;  2Z1T A;  2EWC A;  2PHN A;  4BT4 A;  2CVL A;  1H47 A;  3RYH A;  5J2U A;  2OTM A;  2PMP A;  2ZF8 A;  1Q82 H;  1K9M H;  4BY9 D;  4U39 A;  5HWE A;  4X1K B;  5EWR A;  3RYI B;  3LWP C;  4G4Z A;  2ALE A;  3HKD A;  1QAH A;  3RYC B;  4TV9 A;  3IR9 A;  1FNJ A;  2CHT A;  2UYP A;  4O4I A;  2OHW A;  1YJN F;  1W41 A;  3R0P A;  5A2Q M;  2UYK A;  3N2G A;  3JAW A;  3FD5 A;  1KNJ A;  2HRU A;  1QVG F;  3JAK A;  4G88 A;  5HP8 A;  2RHH A;  3CCE F;  3GTZ A;  4ZI7 A;  3IEW A;  5EYP A;  3GYQ A;  3VYU C;  4BVT A;  5GIP C;  1JD1 A;  2GLZ A;  5CB4 A;  5LA6 B;  3KJK A;  4ZOL A;  3N4Y A;  2CHS A;  2YYE A;  4BT7 A;  1PF5 A;  3SIV A;  5HXU A;  5CA1 A;  3FBA A;  5MN5 A;  2AIZ P;  3OW2 F;  3K2X A;  2KG4 A;  5LP6 A;  2ZVY A;  1FNK A;  3RA5 A;  4ZK7 A;  3WXM B;  3K14 A;  3CC2 F;  2KTU A;  2FC3 A;  3CCQ F;  3CPQ A;  3WGL A;  4DRX B;  5G4V C;  1H48 A;  4FFB A;  5LP6 C;  1JJ2 F;  4PWT A;  1TVK B;  5EIB D;  4EI8 A;  3CXC F;  4B62 A;  5JCO A;  2RHO A;  4IIJ A;  1Q81 H;  5EO3 A;  1YJ9 F;  5GAP K;  3HTN A;  5LXT B;  3WGN A;  3JAT B;  1XBI A;  5JCO C;  5MN4 A;  3Q8H A;  3VIU A;  5LYJ A;  1TUB B;  3IMP A;  3NK6 A;  2IAF A;  3N4Z A;  4X1Y A;  4DXD A;  2Q1X A;  2R75 1;  3HWU A;  5LOV B;  3CCV F;  3JAS B;  3CCM F;  1XRG A;  2LCA A;  2KTV A;  4YJ2 A;  1K8A H;  2KGW A;  5KMG A;  4EI7 A;  3HKB A;  3WJP A;  4EB6 A;  4I4T B;  3CCU F;  3LME A;  3CCL F;  3K12 A;  1PXW A;  1Q7Y H;  4O4H A;  2CWJ A;  3WGJ A;  3VYT C;  1Q8R A;  2RB9 A;  3I7T A;  1VQ4 F;  3JAL A;  2GVI A;  3OBY A;  2VGN A;  1IV2 A;  2VAP A;  3CPW F;  2CZW A;  2BTQ B;  4O4L A;  2VAW A;  5GON A;  5JVD A;  3RYH B;  3ON1 A;  5FNV B;  3C9T A;  5IJ0 A;  4BVQ A;  3CCR F;  1N8R H;  1DT9 A;  3V3T A;  5KX5 B;  2K1S A;  1VQO F;  3E1Y A;  2HS0 A;  3HKD B;  5ITZ A;  1UFY A;  2AIF A;  4TV9 B;  5EZY A;  3RYF B;  4BVS A;  5BMV A;  2OZB A;  4O4I B;  1IV3 A;  1VQN F;  1GZ0 A;  1NMU B;  3M84 A;  4HNA A;  4BT5 A;  5JQG A;  2V9Y A;  1CLI A;  1COM A;  3N2G B;  3JAW B;  1RLU A;  1VQV A;  2FGY A;  3JAK B;  4E6E A;  3P10 A;  1E7K A;  5B8F A;  1M1K H;  4RHA A;  4ZI7 B;  5EYP B;  3OON A;  5EIB C;  5CB4 B;  1DBF A;  1U40 A;  3ZP4 A;  4ZOL B;  3VOA A;  1OAP A;  2HQS C;  3O85 A;  4LNU A;  3M1X A;  4U3J A;  1KC8 H;  2HS4 A;  4NUT A;  5IJ9 B;  1VQK F;  3CC4 F;  3K0T A;  5LP6 B;  5IT9 M;  3CME F;  2H6L A;  4I55 B;  3C9R A;  1W42 A;  4X1I A;  1XHO A;  2HP0 A;  4I50 B;  3GHZ A;  3S0W A;  4C8E A;  5G4U C;  4B46 A;  4C81 A;  3S03 A;  1SZQ A;  4X20 B;  1IPA A;  3F0G A;  3LWO C;  3AGK A;  3JVH A;  4LCK A;  4IIJ B;  2P6Y A;  2HRY A;  5EB1 B;  3J81 M;  4TZZ A;  1VH8 A;  2F9Z C;  4WBN A;  3CCS F;  1VQ9 F;  3VTI C;  1W58 1;  3RYC A;  1Z5V A;  3FPI A;  3DDN A;  5LYJ B;  5HXZ A;  5J2T A;  1CK2 A;  3LDT A;  4TV8 B;  5C8Y A;  3FFM A;  5CA0 B;  1ONI A;  3MCQ A;  1GO1 A;  1R1M A;  3VYS C;  5KMG B;  3HKB B;  4EB6 B;  2VXY A;  1U3P A;  1JN1 A;  2H8E A;  5EB0 A;  1W5E A;  2UZH A;  3L7Q A;  3HKC A;  1YIJ F;  2HX0 A;  3QHD A;  1IV1 A;  4XCQ A;  1W57 A;  3JAL B;  3KE1 A;  3KIZ A;  3QUW A;  2OTL F;  2HP3 A;  1W5B A;  1FFX B;  3E22 A;  3LWV C;  3UT5 A;  3G4S F;  5GON B; 
#chains in the Genus database with same CATH homology
 3JVH A;  4C8G A;  3ESJ A;  3FBA A;  3K2X A;  1U40 A;  3RE3 A;  1T0A A;  3Q8H A;  3B6N A;  1IV4 A;  1U3P A;  3IEQ A;  1JN1 A;  4C82 A;  1H47 A;  2UZH A;  1KNJ A;  3F0F A;  2PMP A;  3EOR A;  2GZL A;  1VH8 A;  3K14 A;  1IV3 A;  3ERN A;  3IKF A;  3P0Z A;  1VHA A;  1U43 A;  1IV2 A;  3IKE A;  1H48 A;  3QHD A;  3F0E A;  1IV1 A;  3IEW A;  3F6M A;  3FPI A;  3GHZ A;  4C8E A;  4C8I A;  3ELC A;  1W57 A;  4C81 A;  3MBM A;  3P10 A;  3F0D A;  1JY8 A;  3KE1 A;  5B8F A;  3T80 A;  2AMT A;  1GX1 A;  1KNK A;  1YQN A;  1W55 A;  3F0G A;  1U3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...