3F0GA

Co-crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase with cmp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
159
structure length
159
Chain Sequence
b'MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
molecule tags Lyase
source organism Burkholderia pseudomallei
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
total genus 53
structure length 159
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3f0gA00
1IV3A 1W55A 3ESJA 3JVHA 1IV1A 1JN1A 1KNJA 1GX1A 1W57A 1KNKA 3P10A 4C8EA 1YQNA 4C81A 3MBMA 1U40A 3K14A 1VH8A 3P0ZA 3F6MA 3KE1A 3ERNA 2UZHA 3RE3A 3FPIA 5B8FA 4C8IA 3IKFA 4C8GA 3IKEA 3QHDA 1U3LA 3F0DA 3F0FA 1IV2A 3IEWA 3FBAA 4C82A 3GHZA 2GZLA 1U43A 2AMTA 3F0GA 3Q8HA 1T0AA 3T80A 3ELCA 3EORA 1U3PA 1VHAA 3B6NA 3F0EA 1H48A 1JY8A 1H47A 1IV4A 3K2XA 3IEQA 2PMPA
chains in the Genus database with same CATH superfamily
5EO3A 1NQ3A 1CN7A 3WGMA 1GZ0A 1TUBB 4BVTA 3VIUA 4C8EA 5LA6B 5C8YA 3S0HA 1RA4A 1W5BA 1VQ8F 1DBFA 3JAKB 3JATA 5HXUA 1IV2A 5GANK 2QI2A 3LMEA 1YJ9F 3N2GB 3Q8HA 2HP0A 1U3PA 1GO0A 1W59A 1CLIA 2K1SA 1YGYA 3VYTC 3ZP7A 3CMEF 2V9YA 3I55F 3NMUC 3IEQA 5LYJA 4X1IB 3NVIB 2DYYA 1JN1A 2QEXF 5MN5A 2UYJA 3BYQA 4I4TB 2HS3A 3OBYA 1VQNF 3HKDB 4YJ3B 2HS0A 4X1YB 1W5FA 3JAWB 2AIFA 4WBNB 3RE3A 2ZODA 4KWEA 5FLXM 2DT4A 3V7EA 4BVQA 5HXZA 3R0PA 1XHOA 3C8LA 4IIJA 3CC7F 3SIUA 4O2AB 1ONIA 1RLGA 5EIBC 5CA0B 1SDSA 2Q1XA 2W8BC 5KX5A 4EI8A 1VQKF 5LP6C 2Z1EA 2ZVZA 1UI9A 3L7QA 2PHNA 3PLAC 4IHJB 2CW4A 2KTVA 4LNUA 3J81M 4O4IA 5EYPB 3JASA 4O4JB 2Z1TA 3GHZA 3HAXD 2CSLA 5FJ4C 5JH7B 4G4YA 2ZOVA 3LWRC 1FNJA 5J2TB 2LBWA 4NQ3A 5IYZA 1T0KB 4X20B 4O4JA 1OAPA 3WJRA 1KC8H 5LYJB 2KGWA 4G4XA 5B8FA 5HY4A 3F0DA 3CPWF 3CC2F 5IT9M 3OW2F 1VQOF 1U43A 3T80A 4G4WA 4DRXA 2VXYA 1VHAA 1NJIH 4U3JB 4I55B 2OTLF 5J2UB 3K2XA 1X52A 5JQGB 3ESJA 3RYHA 1JFFA 3RYFB 4B5CA 5LXTA 5JVDA 5GONB 1JJ2F 5EYPA 2CVLA 3LYBA 1NMUB 1W57A 5LP6B 4M8IA 4YJ2A 3RYIB 3WPWA 5JQGA 3G6EF 4XCQA 1YHQF 3MQWA 3KIZA 3I7TA 3JALB 3FPIA 3S0WA 4BT4A 4C8IA 5ITZA 3M4SA 4ZI7A 3HKDA 3N2GA 1M90H 3IEWA 3KJKA 3FBAA 1W42A 4I50A 4TUYA 4TV8B 4HNAA 1T0AA 5BMVA 5EAZA 3CCLF 4X1KA 1Q86H 4O4LA 4ZHWA 3ON1A 4BY9D 1S72F 3RA5A 1GO1A 4F6RB 1IPAA 5BMVB 1IV3A 3JVHA 4IIJB 3I3FA 3VYUC 3HKBA 3WGKA 1KNKA 1YI2F 1N8RH 3MBMA 5KX5B 1VH8A 4X3MA 5CA1B 5FNVA 4YJ2B 5JCOA 3K0TA 3QTYA 1Q7YH 3LWOC 3OONA 2AIZP 1FNKA 1VQ6F 3DDNA 1W5AA 2H8CA 1VQVA 1JY8A 1W41A 2CZWA 3CMAF 1M1KH 2HVYD 4I55A 1Q82H 2RHLA 5IJ0A 3CYQA 3HTNA 3RYHB 3JARA 2RHOA 3CPQA 1X7PA 4BT5A 3WJQA 2LBXA 2VGNA 3PAFA 4BT6A 3SIVA 5LP6A 3HKBB 5GIOC 2MQEA 4R40B 1KD1H 1YITF 3F0GA 2BO1A 2OHWA 3LFOA 5FNVB 5MN4A 1UFYA 3C9RA 1VQLF 2CWJA 5GINC 3HKCA 4HNAB 1COMA 2BTQB 2HQSC 2PMPA 4NUTA 3S03A 2BTUA 3WGNA 4BVRA 1KQSF 1YJNF 1GX1A 3CCVF 4RQOA 1QVGF 3CCEF 5JCOC 3N2KB 5CB4A 3OBWA 4BVSA 4G4VA 3JCMM 4TZZA 1QAHA 1RQ2A 1SA0B 3MCAB 3G4SF 4C8GA 4G88A 1X25A 3HJWC 4NWOB 5IJ0B 3C9SA 4C4WC 5J2UA 2CHTA 1VQ4F 4WBNA 2B33A 4U3JA 3FD6A 3VCZA 2OTMA 1QU9A 3WGJA 2QA4F 2ZVYA 1JFFB 1XV2A 3RYFA 4ZHVA 1YQNA 2H8EA 5MN6A 3VO8A 2NMUA 2IG8A 1Q81H 4O2AA 3V3TA 3NVKE 3IKFA 2KG4A 3QHDA 3FD5A 2YXZA 3CYPB 4TUYB 5EZYA 5HY2A 3P4EA 5HY0A 3HKEB 2GZLA 2KTUA 2N48A 4EI7A 5J2TA 5HWEA 5CA1A 3JAKA 4ZOLA 1H48A 2FC3A 2UYPA 3RYIA 1W581 3WPXA 4X3LA 3CCRF 1W3EX 3G71F 4EB6A 2HRUA 4BT2A 4O4IB 3UT5A 2LCAA 2R751 3P10A 4B45A 2RHHA 4ZI7B 2VAPA 2VAWA 1RLUA 4DRXB 4ZHQB 3JARB 4YJ3A 3F0FA 2VGMA 3WJPA 1ZWZA 4U39A 1W5EA 3ELCA 1FSZA 2HX0A 2I6DA 2ZF8A 3TD4A 5EB0A 3IR9A 5IJ9A 5DCVA 3LWQC 4O2BA 3IMPA 1Z5WA 5GONA 3VTIC 2CHSA 3D00A 1QVFF 1KNJA 1RQ7A 5ITZB 4C81A 3VMFB 3ZOPA 4O4HA 3JALA 3M84A 5JH7A 3P0ZA 1R1MA 2RHJA 3ERNA 5LA6A 1YJWF 1FFXB 4I4TA 5LXTB 5JVDB 1PXWA 3C9TA 4X20A 3AGKA 4F6RA 4ZK7A 3JATB 4ZHQA 2Z01A 5G4VC 1J7HA 2F9ZC 3JAWA 5LOVB 4ZHYB 5HP8A 2OZBA 1VQ7F 1W55A 2JNBA 1IV1A 3J7AR 3WXMB 4LCKA 3CD6F 5HY1A 1VQPF 1W2BF 1YIJF 4EB6B 4RHAA 3E20B 1SA0A 2Z1FA 4X1KB 3CCSF 3U0OA 2VAMA 4TV9A 1W40A 2YYEA 3RA6A 2UYKA 1K8AH 3HWUA 4BT7A 2FGYA 3F0EA 3MCQA 1JD1A 4FFBA 1ODEA 4B46A 3CXCF 5GIPC 3CG6A 3JAMM 3JASB 3I56F 3VI6A 3GYQA 1X7OA 1TUBA 3N4YA 4LNUB 5EWRA 1K73H 5GAPK 2UYNA 5KMGA 2H6LA 2IQQA 3FFMA 4O4LB 5LOVA 2HP3A 2Q1YA 2HS4A 5AVMA 2HRYA 3N4ZA 3DC2A 3CCUF 3HKEA 4DXDA 3LWPC 3LWVC 3ZP4A 2IAFA 3ZO8A 2L26A 1XBIA 2G9IA 1H7MA 1CK2A 3B6NA 4TV9B 1IV4A 3VOBA 3N2KA 1K9MH 3E22A 3C9UA 3KJJA 4X1IA 5A2QM 2RB9A 2ZAUA 1VQMF 5EZYB 1PF5A 3K14A 3K12A 5EB1B 3NK6A 3HKCB 2UZHA 4BW0B 3D01A 3LDTA 2EWCA 4BT3A 2GLZA 3WGLA 1Q8RA 1VQ9F 2P6YA 3S0YA 1VQ5F 3UT5B 4EI9A 1VK3A 3KHNA 3EORA 1FFXA 5CA0A 3S02A 5CB4B 5G4UC 4TV8A 3MDOA 3J80M 3V4DA 3CC4F 5HP7A 4I50B 2GVIA 3D54A 2ALEA 3CCJF 1U40A 4ERHA 3O85A 3KE1A 3CCQF 1Z5VA 1QD9A 2UYNB 5KMGB 4PWTA 2I6RA 4IHJA 1TVKB 3RYCA 3VOAA 2AMTA 1SZQA 1E7KA 4O4HB 3NK7A 2BTOA 1OFUA 3E1YA 3TD3A 1TVKA 4B62A 3RYCB 3E22B 3QUWA 2QTPA 4E6EA 4G4ZA 3V7QA 3F6MA 3CB2A 5EIBD 2HP0B 3CCMF 1DT9A 4ZOLB 3IKEA 1U3LA 2R6R1 2Z1UA 1XRGA 3VYSC 4C82A 2WALA 5IYZB 4O2BB 3TD5A 4FFBB 5IJ9B 5C8YB 1H47A 3GTZA 4X1YA 3S06A 2OTJF 3M1XA 2LBTA
chains in the Genus database with same CATH topology
1IV3A 1W55A 3ESJA 3JVHA 1IV1A 1JN1A 1KNJA 1GX1A 1W57A 1KNKA 3P10A 4C8EA 1YQNA 4C81A 3MBMA 1U40A 3K14A 1VH8A 3P0ZA 3F6MA 3KE1A 3ERNA 2UZHA 3RE3A 3FPIA 5B8FA 4C8IA 3IKFA 4C8GA 3IKEA 3QHDA 1U3LA 3F0DA 3F0FA 1IV2A 3IEWA 3FBAA 4C82A 3GHZA 2GZLA 1U43A 2AMTA 3F0GA 3Q8HA 1T0AA 3T80A 3ELCA 3EORA 1U3PA 1VHAA 3B6NA 3F0EA 1H48A 1JY8A 1H47A 1IV4A 3K2XA 3IEQA 2PMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV3 A;  1W55 A;  3ESJ A;  3JVH A;  1IV1 A;  1JN1 A;  1KNJ A;  1GX1 A;  1W57 A;  1KNK A;  3P10 A;  4C8E A;  1YQN A;  4C81 A;  3MBM A;  1U40 A;  3K14 A;  1VH8 A;  3P0Z A;  3F6M A;  3KE1 A;  3ERN A;  2UZH A;  3RE3 A;  3FPI A;  5B8F A;  4C8I A;  3IKF A;  4C8G A;  3IKE A;  3QHD A;  1U3L A;  3F0D A;  3F0F A;  1IV2 A;  3IEW A;  3FBA A;  4C82 A;  3GHZ A;  2GZL A;  1U43 A;  2AMT A;  3F0G A;  3Q8H A;  1T0A A;  3T80 A;  3ELC A;  3EOR A;  1U3P A;  1VHA A;  3B6N A;  3F0E A;  1H48 A;  1JY8 A;  1H47 A;  1IV4 A;  3K2X A;  3IEQ A;  2PMP A; 
#chains in the Genus database with same CATH topology
 5EO3 A;  1NQ3 A;  1CN7 A;  3WGM A;  1GZ0 A;  1TUB B;  4BVT A;  3VIU A;  4C8E A;  5LA6 B;  5C8Y A;  3S0H A;  1RA4 A;  1W5B A;  1VQ8 F;  1DBF A;  3JAK B;  3JAT A;  5HXU A;  1IV2 A;  5GAN K;  2QI2 A;  3LME A;  1YJ9 F;  3N2G B;  3Q8H A;  2HP0 A;  1U3P A;  1GO0 A;  1W59 A;  1CLI A;  2K1S A;  1YGY A;  3VYT C;  3ZP7 A;  3CME F;  2V9Y A;  3I55 F;  3NMU C;  3IEQ A;  5LYJ A;  4X1I B;  3NVI B;  2DYY A;  1JN1 A;  2QEX F;  5MN5 A;  2UYJ A;  3BYQ A;  4I4T B;  2HS3 A;  3OBY A;  1VQN F;  3HKD B;  4YJ3 B;  2HS0 A;  4X1Y B;  1W5F A;  3JAW B;  2AIF A;  4WBN B;  3RE3 A;  2ZOD A;  4KWE A;  5FLX M;  2DT4 A;  3V7E A;  4BVQ A;  5HXZ A;  3R0P A;  1XHO A;  3C8L A;  4IIJ A;  3CC7 F;  3SIU A;  4O2A B;  1ONI A;  1RLG A;  5EIB C;  5CA0 B;  1SDS A;  2Q1X A;  2W8B C;  5KX5 A;  4EI8 A;  1VQK F;  5LP6 C;  2Z1E A;  2ZVZ A;  1UI9 A;  3L7Q A;  2PHN A;  3PLA C;  4IHJ B;  2CW4 A;  2KTV A;  4LNU A;  3J81 M;  4O4I A;  5EYP B;  3JAS A;  4O4J B;  2Z1T A;  3GHZ A;  3HAX D;  2CSL A;  5FJ4 C;  5JH7 B;  4G4Y A;  2ZOV A;  3LWR C;  1FNJ A;  5J2T B;  2LBW A;  4NQ3 A;  5IYZ A;  1T0K B;  4X20 B;  4O4J A;  1OAP A;  3WJR A;  1KC8 H;  5LYJ B;  2KGW A;  4G4X A;  5B8F A;  5HY4 A;  3F0D A;  3CPW F;  3CC2 F;  5IT9 M;  3OW2 F;  1VQO F;  1U43 A;  3T80 A;  4G4W A;  4DRX A;  2VXY A;  1VHA A;  1NJI H;  4U3J B;  4I55 B;  2OTL F;  5J2U B;  3K2X A;  1X52 A;  5JQG B;  3ESJ A;  3RYH A;  1JFF A;  3RYF B;  4B5C A;  5LXT A;  5JVD A;  5GON B;  1JJ2 F;  5EYP A;  2CVL A;  3LYB A;  1NMU B;  1W57 A;  5LP6 B;  4M8I A;  4YJ2 A;  3RYI B;  3WPW A;  5JQG A;  3G6E F;  4XCQ A;  1YHQ F;  3MQW A;  3KIZ A;  3I7T A;  3JAL B;  3FPI A;  3S0W A;  4BT4 A;  4C8I A;  5ITZ A;  3M4S A;  4ZI7 A;  3HKD A;  3N2G A;  1M90 H;  3IEW A;  3KJK A;  3FBA A;  1W42 A;  4I50 A;  4TUY A;  4TV8 B;  4HNA A;  1T0A A;  5BMV A;  5EAZ A;  3CCL F;  4X1K A;  1Q86 H;  4O4L A;  4ZHW A;  3ON1 A;  4BY9 D;  1S72 F;  3RA5 A;  1GO1 A;  4F6R B;  1IPA A;  5BMV B;  1IV3 A;  3JVH A;  4IIJ B;  3I3F A;  3VYU C;  3HKB A;  3WGK A;  1KNK A;  1YI2 F;  1N8R H;  3MBM A;  5KX5 B;  1VH8 A;  4X3M A;  5CA1 B;  5FNV A;  4YJ2 B;  5JCO A;  3K0T A;  3QTY A;  1Q7Y H;  3LWO C;  3OON A;  2AIZ P;  1FNK A;  1VQ6 F;  3DDN A;  1W5A A;  2H8C A;  1VQV A;  1JY8 A;  1W41 A;  2CZW A;  3CMA F;  1M1K H;  2HVY D;  4I55 A;  1Q82 H;  2RHL A;  5IJ0 A;  3CYQ A;  3HTN A;  3RYH B;  3JAR A;  2RHO A;  3CPQ A;  1X7P A;  4BT5 A;  3WJQ A;  2LBX A;  2VGN A;  3PAF A;  4BT6 A;  3SIV A;  5LP6 A;  3HKB B;  5GIO C;  2MQE A;  4R40 B;  1KD1 H;  1YIT F;  3F0G A;  2BO1 A;  2OHW A;  3LFO A;  5FNV B;  5MN4 A;  1UFY A;  3C9R A;  1VQL F;  2CWJ A;  5GIN C;  3HKC A;  4HNA B;  1COM A;  2BTQ B;  2HQS C;  2PMP A;  4NUT A;  3S03 A;  2BTU A;  3WGN A;  4BVR A;  1KQS F;  1YJN F;  1GX1 A;  3CCV F;  4RQO A;  1QVG F;  3CCE F;  5JCO C;  3N2K B;  5CB4 A;  3OBW A;  4BVS A;  4G4V A;  3JCM M;  4TZZ A;  1QAH A;  1RQ2 A;  1SA0 B;  3MCA B;  3G4S F;  4C8G A;  4G88 A;  1X25 A;  3HJW C;  4NWO B;  5IJ0 B;  3C9S A;  4C4W C;  5J2U A;  2CHT A;  1VQ4 F;  4WBN A;  2B33 A;  4U3J A;  3FD6 A;  3VCZ A;  2OTM A;  1QU9 A;  3WGJ A;  2QA4 F;  2ZVY A;  1JFF B;  1XV2 A;  3RYF A;  4ZHV A;  1YQN A;  2H8E A;  5MN6 A;  3VO8 A;  2NMU A;  2IG8 A;  1Q81 H;  4O2A A;  3V3T A;  3NVK E;  3IKF A;  2KG4 A;  3QHD A;  3FD5 A;  2YXZ A;  3CYP B;  4TUY B;  5EZY A;  5HY2 A;  3P4E A;  5HY0 A;  3HKE B;  2GZL A;  2KTU A;  2N48 A;  4EI7 A;  5J2T A;  5HWE A;  5CA1 A;  3JAK A;  4ZOL A;  1H48 A;  2FC3 A;  2UYP A;  3RYI A;  1W58 1;  3WPX A;  4X3L A;  3CCR F;  1W3E X;  3G71 F;  4EB6 A;  2HRU A;  4BT2 A;  4O4I B;  3UT5 A;  2LCA A;  2R75 1;  3P10 A;  4B45 A;  2RHH A;  4ZI7 B;  2VAP A;  2VAW A;  1RLU A;  4DRX B;  4ZHQ B;  3JAR B;  4YJ3 A;  3F0F A;  2VGM A;  3WJP A;  1ZWZ A;  4U39 A;  1W5E A;  3ELC A;  1FSZ A;  2HX0 A;  2I6D A;  2ZF8 A;  3TD4 A;  5EB0 A;  3IR9 A;  5IJ9 A;  5DCV A;  3LWQ C;  4O2B A;  3IMP A;  1Z5W A;  5GON A;  3VTI C;  2CHS A;  3D00 A;  1QVF F;  1KNJ A;  1RQ7 A;  5ITZ B;  4C81 A;  3VMF B;  3ZOP A;  4O4H A;  3JAL A;  3M84 A;  5JH7 A;  3P0Z A;  1R1M A;  2RHJ A;  3ERN A;  5LA6 A;  1YJW F;  1FFX B;  4I4T A;  5LXT B;  5JVD B;  1PXW A;  3C9T A;  4X20 A;  3AGK A;  4F6R A;  4ZK7 A;  3JAT B;  4ZHQ A;  2Z01 A;  5G4V C;  1J7H A;  2F9Z C;  3JAW A;  5LOV B;  4ZHY B;  5HP8 A;  2OZB A;  1VQ7 F;  1W55 A;  2JNB A;  1IV1 A;  3J7A R;  3WXM B;  4LCK A;  3CD6 F;  5HY1 A;  1VQP F;  1W2B F;  1YIJ F;  4EB6 B;  4RHA A;  3E20 B;  1SA0 A;  2Z1F A;  4X1K B;  3CCS F;  3U0O A;  2VAM A;  4TV9 A;  1W40 A;  2YYE A;  3RA6 A;  2UYK A;  1K8A H;  3HWU A;  4BT7 A;  2FGY A;  3F0E A;  3MCQ A;  1JD1 A;  4FFB A;  1ODE A;  4B46 A;  3CXC F;  5GIP C;  3CG6 A;  3JAM M;  3JAS B;  3I56 F;  3VI6 A;  3GYQ A;  1X7O A;  1TUB A;  3N4Y A;  4LNU B;  5EWR A;  1K73 H;  5GAP K;  2UYN A;  5KMG A;  2H6L A;  2IQQ A;  3FFM A;  4O4L B;  5LOV A;  2HP3 A;  2Q1Y A;  2HS4 A;  5AVM A;  2HRY A;  3N4Z A;  3DC2 A;  3CCU F;  3HKE A;  4DXD A;  3LWP C;  3LWV C;  3ZP4 A;  2IAF A;  3ZO8 A;  2L26 A;  1XBI A;  2G9I A;  1H7M A;  1CK2 A;  3B6N A;  4TV9 B;  1IV4 A;  3VOB A;  3N2K A;  1K9M H;  3E22 A;  3C9U A;  3KJJ A;  4X1I A;  5A2Q M;  2RB9 A;  2ZAU A;  1VQM F;  5EZY B;  1PF5 A;  3K14 A;  3K12 A;  5EB1 B;  3NK6 A;  3HKC B;  2UZH A;  4BW0 B;  3D01 A;  3LDT A;  2EWC A;  4BT3 A;  2GLZ A;  3WGL A;  1Q8R A;  1VQ9 F;  2P6Y A;  3S0Y A;  1VQ5 F;  3UT5 B;  4EI9 A;  1VK3 A;  3KHN A;  3EOR A;  1FFX A;  5CA0 A;  3S02 A;  5CB4 B;  5G4U C;  4TV8 A;  3MDO A;  3J80 M;  3V4D A;  3CC4 F;  5HP7 A;  4I50 B;  2GVI A;  3D54 A;  2ALE A;  3CCJ F;  1U40 A;  4ERH A;  3O85 A;  3KE1 A;  3CCQ F;  1Z5V A;  1QD9 A;  2UYN B;  5KMG B;  4PWT A;  2I6R A;  4IHJ A;  1TVK B;  3RYC A;  3VOA A;  2AMT A;  1SZQ A;  1E7K A;  4O4H B;  3NK7 A;  2BTO A;  1OFU A;  3E1Y A;  3TD3 A;  1TVK A;  4B62 A;  3RYC B;  3E22 B;  3QUW A;  2QTP A;  4E6E A;  4G4Z A;  3V7Q A;  3F6M A;  3CB2 A;  5EIB D;  2HP0 B;  3CCM F;  1DT9 A;  4ZOL B;  3IKE A;  1U3L A;  2R6R 1;  2Z1U A;  1XRG A;  3VYS C;  4C82 A;  2WAL A;  5IYZ B;  4O2B B;  3TD5 A;  4FFB B;  5IJ9 B;  5C8Y B;  1H47 A;  3GTZ A;  4X1Y A;  3S06 A;  2OTJ F;  3M1X A;  2LBT A; 
#chains in the Genus database with same CATH homology
 1IV3 A;  1W55 A;  3ESJ A;  3JVH A;  1IV1 A;  1JN1 A;  1KNJ A;  1GX1 A;  1W57 A;  1KNK A;  3P10 A;  4C8E A;  1YQN A;  4C81 A;  3MBM A;  1U40 A;  3K14 A;  1VH8 A;  3P0Z A;  3F6M A;  3KE1 A;  3ERN A;  2UZH A;  3RE3 A;  3FPI A;  5B8F A;  4C8I A;  3IKF A;  4C8G A;  3IKE A;  3QHD A;  1U3L A;  3F0D A;  3F0F A;  1IV2 A;  3IEW A;  3FBA A;  4C82 A;  3GHZ A;  2GZL A;  1U43 A;  2AMT A;  3F0G A;  3Q8H A;  1T0A A;  3T80 A;  3ELC A;  3EOR A;  1U3P A;  1VHA A;  3B6N A;  3F0E A;  1H48 A;  1JY8 A;  1H47 A;  1IV4 A;  3K2X A;  3IEQ A;  2PMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...