3F0GA

Co-crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase with cmp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
159
structure length
159
Chain Sequence
b'MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 53
structure length 159
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3f0gA00
4C81A 3F0FA 2UZHA 3F0GA 1IV2A 3F6MA 2AMTA 3RE3A 2GZLA 1JY8A 3ERNA 5B8FA 3K2XA 4C8EA 3ESJA 1H47A 1JN1A 1H48A 3EORA 1IV4A 1U40A 1W55A 3F0DA 3MBMA 3FBAA 3F0EA 3FPIA 3B6NA 1U43A 3JVHA 4C82A 3IEQA 3KE1A 1KNJA 3P0ZA 1T0AA 1W57A 1VHAA 1KNKA 3QHDA 1YQNA 4C8GA 3P10A 1GX1A 1IV1A 3IEWA 3IKFA 2PMPA 1U3PA 3K14A 3GHZA 1VH8A 3IKEA 1U3LA 1IV3A 3T80A 3ELCA 4C8IA 3Q8HA
chains in the Genus database with same CATH superfamily
1UFYA 4G4XA 5JCOC 5J2UB 3OBYA 4DRXA 1X25A 3JAKA 1FFXB 3NK7A 5MN5A 4YJ2A 5GIOC 3C9UA 3MBMA 2ZF8A 3P0ZA 2KTUA 3RYIB 4O2BA 5LYJA 3FFMA 4RHAA 4O4JA 1W5EA 5KX5B 5LOVA 3CG6A 3CCQF 4G4VA 2OTLF 3N2GA 2VGMA 4X1IB 1VQ5F 5GIPC 4LNUA 2AIZP 4NQ3A 2UZHA 3F0GA 2HP3A 4G88A 4X3MA 4TV8A 2UYPA 3J80M 3JAMM 2BTQB 2CZWA 3JVHA 1JFFA 2MQEA 1YITF 5HXZA 1VQLF 5GANK 4PWTA 3E20B 1KQSF 3ON1A 2RHLA 3CCJF 5DCVA 2PHNA 3HKEB 2HS0A 2CHSA 3MDOA 3MQWA 2N48A 1IV3A 3ELCA 2KGWA 3LWRC 1NMUB 2DYYA 2UYNA 1IV2A 3I3FA 5IYZB 1W2BF 2AMTA 1VQ6F 4NWOB 3L7QA 4B45A 4F6RA 4TUYB 1VK3A 2Z1EA 1TUBA 2YXZA 5HP7A 3VTIC 4X20B 2KTVA 1YQNA 1QVFF 3CXCF 3JARA 3JASB 3C9TA 3D01A 3JALA 1YGYA 3FD5A 1NJIH 5KMGA 4X1YA 3CD6F 5EZYB 1VQNF 2L26A 2LCAA 3JAWA 4B62A 4I55A 5EWRA 4HNAB 4ZHWA 3CCVF 5G4VC 2ZODA 3O85A 4RQOA 3ERNA 3HKCA 3HKBA 3K2XA 4ZHQA 1QD9A 3LYBA 2CWJA 2HRYA 4O4HA 3RYFA 2ZAUA 4EB6B 2DT4A 1W5BA 1T0AA 4DRXB 3OW2F 1YJ9F 3CCSF 2Z1FA 5JH7A 3K14A 3U0OA 4BVSA 3HKDA 3OONA 4O2BB 5LYJB 1W59A 2Q1YA 4O4JB 5BMVB 5J2TA 3C9SA 1YI2F 2HP0A 3C9RA 5GAPK 5B8FA 5JVDB 1TVKB 4O2AA 3P4EA 4KWEA 1VQ9F 4IIJA 3CMEF 1YJNF 3LDTA 2BTUA 5LP6A 4TV8B 5A2QM 1Z5VA 2IAFA 3WGMA 3RYHB 5C8YA 3JATB 3V3TA 1SA0B 3S0HA 3VYUC 1XRGA 2VGNA 1CK2A 1VQ7F 3R0PA 1KD1H 3GTZA 3QUWA 5LA6A 5HXUA 3RE3A 1GO0A 4O4LA 5AVMA 4TV9A 2RHOA 1IV4A 4U39A 1N8RH 3K0TA 5CA0A 3WGLA 1S72F 2OTJF 1Z5WA 4M8IA 3G71F 2JNBA 5IJ9A 3QHDA 4U3JB 3K12A 3AGKA 3IEWA 1U3PA 1TUBB 5JQGA 3WJPA 3CYPB 1K8AH 4B5CA 1X7OA 4I4TA 1Q81H 5EAZA 4BT5A 1Q86H 3JARB 4X1KA 3VYTC 2LBWA 3JALB 1RQ2A 4YJ3B 4G4YA 5FJ4C 3UT5A 4X1YB 3CPWF 3KJKA 1RLGA 3G6EF 1H47A 3JAWB 3S02A 1RQ7A 3PAFA 3KHNA 3VCZA 1U43A 1GO1A 4O4IA 3HKCB 2ZOVA 4ZI7B 2QA4F 2OHWA 3CCMF 4BW0B 2GVIA 3N2KB 3HAXD 2HRUA 1NQ3A 1OFUA 5GONB 3WGKA 4BY9D 4I50A 5EYPA 3RYCA 3WPXA 3ZP7A 1PXWA 5LXTA 1T0KB 3S0YA 3NMUC 5HY2A 5J2TB 5CA1A 5HWEA 5CB4B 3FPIA 3WPWA 4BT7A 3TD4A 4C4WC 2HP0B 5FLXM 1KNKA 1R1MA 2EWCA 3CYQA 3MCQA 1IPAA 3E22A 5HY4A 1IV1A 4IIJB 2H8CA 3GHZA 3NVKE 3FD6A 5HY0A 5LP6B 5J2UA 3CCEF 2RHHA 3V7EA 3CPQA 3D54A 1E7KA 3VI6A 3WGJA 5EB1B 1XV2A 3LWOC 3HTNA 3I55F 1Q7YH 4BT3A 1JD1A 1FSZA 5LA6B 3RA6A 1QU9A 5JCOA 3CC4F 3V7QA 3JAKB 1Q8RA 3VIUA 4YJ2B 3ZOPA 3S06A 2QEXF 4X3LA 4BVTA 4XCQA 3WJRA 1W40A 4EI9A 2ZVZA 2QTPA 3WJQA 2WALA 2YYEA 5LOVB 2KG4A 5JQGB 3S0WA 3VOBA 4I4TB 3EORA 3N2GB 4LNUB 4BT4A 1UI9A 3UT5B 4C82A 3IEQA 2HVYD 1DT9A 2H6LA 4FFBA 2OZBA 2PMPA 1JFFB 3VO8A 3KJJA 2R6R1 3NK6A 2W8BC 4IHJA 4TUYA 3RA5A 2QI2A 3GYQA 4BVQA 5EIBC 2LBTA 1W41A 3LWPC 2UYJA 4X20A 2HQSC 3E1YA 2IQQA 5IJ0A 2UYNB 3B6NA 5EZYA 5EYPB 3N4ZA 3RYCB 3CC2F 1KNJA 2BO1A 3HWUA 1M90H 1H7MA 1W57A 4C8GA 4HNAA 1W3EX 1M1KH 3IKFA 4F6RB 1VQ8F 1COMA 1ONIA 2LBXA 4BT6A 3M1XA 3E22B 1K73H 4C81A 5FNVA 3VMFB 4WBNA 2V9YA 3G4SF 4EB6A 5KMGB 3ESJA 5EO3A 2CSLA 1K9MH 3CCUF 4ERHA 3DC2A 3J7AR 4I55B 2UYKA 4BT2A 1GZ0A 5HY1A 2VAPA 1X52A 1Q82H 2CHTA 2VAWA 3HKBB 4ZHQB 1JJ2F 5BMVA 3CCRF 1W42A 1SDSA 5ITZA 1XHOA 3MCAB 4O4HB 3RYFB 5JVDA 4B46A 1CLIA 2Q1XA 1TVKA 1FNKA 4ZHYB 3F6MA 5JH7B 3DDNA 5LP6C 2Z1UA 3HKDB 1VQMF 3C8LA 1DBFA 4EI7A 1XBIA 2GLZA 2FGYA 3KIZA 3RYHA 4ZOLA 3TD5A 3JATA 1SA0A 4LCKA 1PF5A 3HJWC 4G4ZA 1VQOF 2H8EA 2ZVYA 3P10A 1GX1A 4O2AB 3SIVA 1OAPA 2CVLA 5EB0A 3TD3A 3IKEA 3J81M 2AIFA 4C8IA 3IR9A 4FFBB 1YHQF 1FFXA 3PLAC 4DXDA 1QVGF 2K1SA 5C8YB 3CB2A 3RYIA 4U3JA 2R751 2B33A 4IHJB 3V4DA 2HX0A 3NVIB 1RA4A 1W55A 3LMEA 3FBAA 2BTOA 2RB9A 3F0EA 5KX5A 1W581 4ZK7A 4O4LB 4X1IA 4TV9B 2RHJA 5IJ0B 1VQKF 4YJ3A 3CCLF 5CA0B 1RLUA 3JCMM 1VH8A 1U3LA 1J7HA 4R40B 2VXYA 1W5AA 1SZQA 5G4UC 3CC7F 5IJ9B 3LWVC 3ZP4A 2I6DA 2FC3A 2IG8A 2GZLA 5EIBD 4ZI7A 3I7TA 4C8EA 3M4SA 3BYQA 5GINC 1ODEA 5FNVB 3WXMB 4WBNB 3I56F 3F0DA 2OTMA 3HKEA 1VQPF 4X1KB 3N2KA 2G9IA 3IMPA 4NUTA 5MN4A 2ALEA 1CN7A 5IT9M 2VAMA 5GONA 3VYSC 3LFOA 1KC8H 1W5FA 5IYZA 3M84A 3D00A 3N4YA 1VQ4F 4O4IB 3Q8HA 2HS3A 2CW4A 3F0FA 5ITZB 5CB4A 1FNJA 3LWQC 3CMAF 4E6EA 1JY8A 2I6RA 1YIJF 3ZO8A 4G4WA 1JN1A 1H48A 3QTYA 1U40A 3JASA 1ZWZA 1X7PA 3OBWA 3S03A 3KE1A 4I50B 4TZZA 1VHAA 5MN6A 2HS4A 5HP8A 4ZOLB 4EI8A 5LXTB 1YJWF 3SIUA 2Z1TA 4BVRA 2F9ZC 5CA1B 2NMUA 1QAHA 3T80A 3VOAA 3WGNA 2P6YA 4ZHVA 1VQVA 2Z01A
chains in the Genus database with same CATH topology
4C81A 3F0FA 2UZHA 3F0GA 1IV2A 3F6MA 2AMTA 3RE3A 2GZLA 1JY8A 3ERNA 5B8FA 3K2XA 4C8EA 3ESJA 1H47A 1JN1A 1H48A 3EORA 1IV4A 1U40A 1W55A 3F0DA 3MBMA 3FBAA 3F0EA 3FPIA 3B6NA 1U43A 3JVHA 4C82A 3IEQA 3KE1A 1KNJA 3P0ZA 1T0AA 1W57A 1VHAA 1KNKA 3QHDA 1YQNA 4C8GA 3P10A 1GX1A 1IV1A 3IEWA 3IKFA 2PMPA 1U3PA 3K14A 3GHZA 1VH8A 3IKEA 1U3LA 1IV3A 3T80A 3ELCA 4C8IA 3Q8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C81 A;  3F0F A;  2UZH A;  3F0G A;  1IV2 A;  3F6M A;  2AMT A;  3RE3 A;  2GZL A;  1JY8 A;  3ERN A;  5B8F A;  3K2X A;  4C8E A;  3ESJ A;  1H47 A;  1JN1 A;  1H48 A;  3EOR A;  1IV4 A;  1U40 A;  1W55 A;  3F0D A;  3MBM A;  3FBA A;  3F0E A;  3FPI A;  3B6N A;  1U43 A;  3JVH A;  4C82 A;  3IEQ A;  3KE1 A;  1KNJ A;  3P0Z A;  1T0A A;  1W57 A;  1VHA A;  1KNK A;  3QHD A;  1YQN A;  4C8G A;  3P10 A;  1GX1 A;  1IV1 A;  3IEW A;  3IKF A;  2PMP A;  1U3P A;  3K14 A;  3GHZ A;  1VH8 A;  3IKE A;  1U3L A;  1IV3 A;  3T80 A;  3ELC A;  4C8I A;  3Q8H A; 
#chains in the Genus database with same CATH topology
 1UFY A;  4G4X A;  5JCO C;  5J2U B;  3OBY A;  4DRX A;  1X25 A;  3JAK A;  1FFX B;  3NK7 A;  5MN5 A;  4YJ2 A;  5GIO C;  3C9U A;  3MBM A;  2ZF8 A;  3P0Z A;  2KTU A;  3RYI B;  4O2B A;  5LYJ A;  3FFM A;  4RHA A;  4O4J A;  1W5E A;  5KX5 B;  5LOV A;  3CG6 A;  3CCQ F;  4G4V A;  2OTL F;  3N2G A;  2VGM A;  4X1I B;  1VQ5 F;  5GIP C;  4LNU A;  2AIZ P;  4NQ3 A;  2UZH A;  3F0G A;  2HP3 A;  4G88 A;  4X3M A;  4TV8 A;  2UYP A;  3J80 M;  3JAM M;  2BTQ B;  2CZW A;  3JVH A;  1JFF A;  2MQE A;  1YIT F;  5HXZ A;  1VQL F;  5GAN K;  4PWT A;  3E20 B;  1KQS F;  3ON1 A;  2RHL A;  3CCJ F;  5DCV A;  2PHN A;  3HKE B;  2HS0 A;  2CHS A;  3MDO A;  3MQW A;  2N48 A;  1IV3 A;  3ELC A;  2KGW A;  3LWR C;  1NMU B;  2DYY A;  2UYN A;  1IV2 A;  3I3F A;  5IYZ B;  1W2B F;  2AMT A;  1VQ6 F;  4NWO B;  3L7Q A;  4B45 A;  4F6R A;  4TUY B;  1VK3 A;  2Z1E A;  1TUB A;  2YXZ A;  5HP7 A;  3VTI C;  4X20 B;  2KTV A;  1YQN A;  1QVF F;  3CXC F;  3JAR A;  3JAS B;  3C9T A;  3D01 A;  3JAL A;  1YGY A;  3FD5 A;  1NJI H;  5KMG A;  4X1Y A;  3CD6 F;  5EZY B;  1VQN F;  2L26 A;  2LCA A;  3JAW A;  4B62 A;  4I55 A;  5EWR A;  4HNA B;  4ZHW A;  3CCV F;  5G4V C;  2ZOD A;  3O85 A;  4RQO A;  3ERN A;  3HKC A;  3HKB A;  3K2X A;  4ZHQ A;  1QD9 A;  3LYB A;  2CWJ A;  2HRY A;  4O4H A;  3RYF A;  2ZAU A;  4EB6 B;  2DT4 A;  1W5B A;  1T0A A;  4DRX B;  3OW2 F;  1YJ9 F;  3CCS F;  2Z1F A;  5JH7 A;  3K14 A;  3U0O A;  4BVS A;  3HKD A;  3OON A;  4O2B B;  5LYJ B;  1W59 A;  2Q1Y A;  4O4J B;  5BMV B;  5J2T A;  3C9S A;  1YI2 F;  2HP0 A;  3C9R A;  5GAP K;  5B8F A;  5JVD B;  1TVK B;  4O2A A;  3P4E A;  4KWE A;  1VQ9 F;  4IIJ A;  3CME F;  1YJN F;  3LDT A;  2BTU A;  5LP6 A;  4TV8 B;  5A2Q M;  1Z5V A;  2IAF A;  3WGM A;  3RYH B;  5C8Y A;  3JAT B;  3V3T A;  1SA0 B;  3S0H A;  3VYU C;  1XRG A;  2VGN A;  1CK2 A;  1VQ7 F;  3R0P A;  1KD1 H;  3GTZ A;  3QUW A;  5LA6 A;  5HXU A;  3RE3 A;  1GO0 A;  4O4L A;  5AVM A;  4TV9 A;  2RHO A;  1IV4 A;  4U39 A;  1N8R H;  3K0T A;  5CA0 A;  3WGL A;  1S72 F;  2OTJ F;  1Z5W A;  4M8I A;  3G71 F;  2JNB A;  5IJ9 A;  3QHD A;  4U3J B;  3K12 A;  3AGK A;  3IEW A;  1U3P A;  1TUB B;  5JQG A;  3WJP A;  3CYP B;  1K8A H;  4B5C A;  1X7O A;  4I4T A;  1Q81 H;  5EAZ A;  4BT5 A;  1Q86 H;  3JAR B;  4X1K A;  3VYT C;  2LBW A;  3JAL B;  1RQ2 A;  4YJ3 B;  4G4Y A;  5FJ4 C;  3UT5 A;  4X1Y B;  3CPW F;  3KJK A;  1RLG A;  3G6E F;  1H47 A;  3JAW B;  3S02 A;  1RQ7 A;  3PAF A;  3KHN A;  3VCZ A;  1U43 A;  1GO1 A;  4O4I A;  3HKC B;  2ZOV A;  4ZI7 B;  2QA4 F;  2OHW A;  3CCM F;  4BW0 B;  2GVI A;  3N2K B;  3HAX D;  2HRU A;  1NQ3 A;  1OFU A;  5GON B;  3WGK A;  4BY9 D;  4I50 A;  5EYP A;  3RYC A;  3WPX A;  3ZP7 A;  1PXW A;  5LXT A;  1T0K B;  3S0Y A;  3NMU C;  5HY2 A;  5J2T B;  5CA1 A;  5HWE A;  5CB4 B;  3FPI A;  3WPW A;  4BT7 A;  3TD4 A;  4C4W C;  2HP0 B;  5FLX M;  1KNK A;  1R1M A;  2EWC A;  3CYQ A;  3MCQ A;  1IPA A;  3E22 A;  5HY4 A;  1IV1 A;  4IIJ B;  2H8C A;  3GHZ A;  3NVK E;  3FD6 A;  5HY0 A;  5LP6 B;  5J2U A;  3CCE F;  2RHH A;  3V7E A;  3CPQ A;  3D54 A;  1E7K A;  3VI6 A;  3WGJ A;  5EB1 B;  1XV2 A;  3LWO C;  3HTN A;  3I55 F;  1Q7Y H;  4BT3 A;  1JD1 A;  1FSZ A;  5LA6 B;  3RA6 A;  1QU9 A;  5JCO A;  3CC4 F;  3V7Q A;  3JAK B;  1Q8R A;  3VIU A;  4YJ2 B;  3ZOP A;  3S06 A;  2QEX F;  4X3L A;  4BVT A;  4XCQ A;  3WJR A;  1W40 A;  4EI9 A;  2ZVZ A;  2QTP A;  3WJQ A;  2WAL A;  2YYE A;  5LOV B;  2KG4 A;  5JQG B;  3S0W A;  3VOB A;  4I4T B;  3EOR A;  3N2G B;  4LNU B;  4BT4 A;  1UI9 A;  3UT5 B;  4C82 A;  3IEQ A;  2HVY D;  1DT9 A;  2H6L A;  4FFB A;  2OZB A;  2PMP A;  1JFF B;  3VO8 A;  3KJJ A;  2R6R 1;  3NK6 A;  2W8B C;  4IHJ A;  4TUY A;  3RA5 A;  2QI2 A;  3GYQ A;  4BVQ A;  5EIB C;  2LBT A;  1W41 A;  3LWP C;  2UYJ A;  4X20 A;  2HQS C;  3E1Y A;  2IQQ A;  5IJ0 A;  2UYN B;  3B6N A;  5EZY A;  5EYP B;  3N4Z A;  3RYC B;  3CC2 F;  1KNJ A;  2BO1 A;  3HWU A;  1M90 H;  1H7M A;  1W57 A;  4C8G A;  4HNA A;  1W3E X;  1M1K H;  3IKF A;  4F6R B;  1VQ8 F;  1COM A;  1ONI A;  2LBX A;  4BT6 A;  3M1X A;  3E22 B;  1K73 H;  4C81 A;  5FNV A;  3VMF B;  4WBN A;  2V9Y A;  3G4S F;  4EB6 A;  5KMG B;  3ESJ A;  5EO3 A;  2CSL A;  1K9M H;  3CCU F;  4ERH A;  3DC2 A;  3J7A R;  4I55 B;  2UYK A;  4BT2 A;  1GZ0 A;  5HY1 A;  2VAP A;  1X52 A;  1Q82 H;  2CHT A;  2VAW A;  3HKB B;  4ZHQ B;  1JJ2 F;  5BMV A;  3CCR F;  1W42 A;  1SDS A;  5ITZ A;  1XHO A;  3MCA B;  4O4H B;  3RYF B;  5JVD A;  4B46 A;  1CLI A;  2Q1X A;  1TVK A;  1FNK A;  4ZHY B;  3F6M A;  5JH7 B;  3DDN A;  5LP6 C;  2Z1U A;  3HKD B;  1VQM F;  3C8L A;  1DBF A;  4EI7 A;  1XBI A;  2GLZ A;  2FGY A;  3KIZ A;  3RYH A;  4ZOL A;  3TD5 A;  3JAT A;  1SA0 A;  4LCK A;  1PF5 A;  3HJW C;  4G4Z A;  1VQO F;  2H8E A;  2ZVY A;  3P10 A;  1GX1 A;  4O2A B;  3SIV A;  1OAP A;  2CVL A;  5EB0 A;  3TD3 A;  3IKE A;  3J81 M;  2AIF A;  4C8I A;  3IR9 A;  4FFB B;  1YHQ F;  1FFX A;  3PLA C;  4DXD A;  1QVG F;  2K1S A;  5C8Y B;  3CB2 A;  3RYI A;  4U3J A;  2R75 1;  2B33 A;  4IHJ B;  3V4D A;  2HX0 A;  3NVI B;  1RA4 A;  1W55 A;  3LME A;  3FBA A;  2BTO A;  2RB9 A;  3F0E A;  5KX5 A;  1W58 1;  4ZK7 A;  4O4L B;  4X1I A;  4TV9 B;  2RHJ A;  5IJ0 B;  1VQK F;  4YJ3 A;  3CCL F;  5CA0 B;  1RLU A;  3JCM M;  1VH8 A;  1U3L A;  1J7H A;  4R40 B;  2VXY A;  1W5A A;  1SZQ A;  5G4U C;  3CC7 F;  5IJ9 B;  3LWV C;  3ZP4 A;  2I6D A;  2FC3 A;  2IG8 A;  2GZL A;  5EIB D;  4ZI7 A;  3I7T A;  4C8E A;  3M4S A;  3BYQ A;  5GIN C;  1ODE A;  5FNV B;  3WXM B;  4WBN B;  3I56 F;  3F0D A;  2OTM A;  3HKE A;  1VQP F;  4X1K B;  3N2K A;  2G9I A;  3IMP A;  4NUT A;  5MN4 A;  2ALE A;  1CN7 A;  5IT9 M;  2VAM A;  5GON A;  3VYS C;  3LFO A;  1KC8 H;  1W5F A;  5IYZ A;  3M84 A;  3D00 A;  3N4Y A;  1VQ4 F;  4O4I B;  3Q8H A;  2HS3 A;  2CW4 A;  3F0F A;  5ITZ B;  5CB4 A;  1FNJ A;  3LWQ C;  3CMA F;  4E6E A;  1JY8 A;  2I6R A;  1YIJ F;  3ZO8 A;  4G4W A;  1JN1 A;  1H48 A;  3QTY A;  1U40 A;  3JAS A;  1ZWZ A;  1X7P A;  3OBW A;  3S03 A;  3KE1 A;  4I50 B;  4TZZ A;  1VHA A;  5MN6 A;  2HS4 A;  5HP8 A;  4ZOL B;  4EI8 A;  5LXT B;  1YJW F;  3SIU A;  2Z1T A;  4BVR A;  2F9Z C;  5CA1 B;  2NMU A;  1QAH A;  3T80 A;  3VOA A;  3WGN A;  2P6Y A;  4ZHV A;  1VQV A;  2Z01 A; 
#chains in the Genus database with same CATH homology
 4C81 A;  3F0F A;  2UZH A;  3F0G A;  1IV2 A;  3F6M A;  2AMT A;  3RE3 A;  2GZL A;  1JY8 A;  3ERN A;  5B8F A;  3K2X A;  4C8E A;  3ESJ A;  1H47 A;  1JN1 A;  1H48 A;  3EOR A;  1IV4 A;  1U40 A;  1W55 A;  3F0D A;  3MBM A;  3FBA A;  3F0E A;  3FPI A;  3B6N A;  1U43 A;  3JVH A;  4C82 A;  3IEQ A;  3KE1 A;  1KNJ A;  3P0Z A;  1T0A A;  1W57 A;  1VHA A;  1KNK A;  3QHD A;  1YQN A;  4C8G A;  3P10 A;  1GX1 A;  1IV1 A;  3IEW A;  3IKF A;  2PMP A;  1U3P A;  3K14 A;  3GHZ A;  1VH8 A;  3IKE A;  1U3L A;  1IV3 A;  3T80 A;  3ELC A;  4C8I A;  3Q8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...