1R1MA

Structure of the ompa-like domain of rmpm from neisseria meningitidis
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
b'PQYVDETISLSAKTLFGFDKDSLRAEAQDNLKVLAQRLSRTNIQSVRVEGHTDFMGSDKYNQALSERRAYVVANNLVSNGVPVSRISAVGLGESQAQMTQVCEAEVAKLGAKVSKAKKREALIACIEPDRRVDVKIRSIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein class 4
publication title Structure of the OmpA-like domain of RmpM from Neisseria meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Membrane protein
total genus 51
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2003-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 1r1mA00
2L26A 2AIZP 4G4WA 3S03A 5EB1B 3S0HA 4G4YA 2LBTA 2ZF8A 4ZHVA 3WPXA 3TD3A 5EB0A 2ZVYA 3CYQA 3S02A 3S0YA 3KHNA 4B5CA 5EAZA 3S0WA 4G4XA 2ZVZA 3OONA 4PWTA 4G4VA 3IMPA 4G4ZA 3TD5A 4G88A 4B62A 3LDTA 3TD4A 3WPWA 4ZHWA 1R1MA 2W8BC 2HQSC 3CYPB 2LCAA 3S06A 2N48A 1OAPA 2K1SA 2ZOVA 4ERHA 4RHAA 4ZHYB 4R40B 2MQEA 2KGWA
chains in the Genus database with same CATH superfamily
2VGMA 2HRUA 2IAFA 5JQGA 5HXUA 1YI2F 1E7KA 3M4SA 3TD3A 1W42A 4HNAA 3U0OA 4O4JA 3S02A 3N2GB 2OTLF 5LYJB 3G6EF 3CCQF 5LOVA 5IYZA 3RE3A 1ODEA 1YJWF 3WPWA 4ZHWA 4XCQA 4FFBA 5EIBD 3CG6A 4X1YA 1IPAA 4ZI7A 1DT9A 1GO1A 3WXMB 2KGWA 3CCEF 1IV3A 2R751 3WGLA 4I50A 1YIJF 4BT7A 3K0TA 4NQ3A 3MQWA 5CA0B 3O85A 3SIUA 2HS3A 1W5FA 4ZHQA 1JFFA 2B33A 5KMGB 4DXDA 4TV8B 1GZ0A 4BT4A 2AIFA 2KG4A 5KX5A 4O2BA 2HQSC 3C9TA 3S06A 3VYSC 1J7HA 4NUTA 2Z01A 2LBXA 1K8AH 3FD6A 3K12A 4RQOA 1TUBB 1QVFF 3JALA 1H48A 2IG8A 3C9UA 5EIBC 1SA0A 4G4YA 3CCJF 2DYYA 3L7QA 1X7PA 3CPWF 5EZYA 3LYBA 3S0WA 3BYQA 4X1IB 1W3EX 2Q1YA 3HKBA 2Z1TA 1JY8A 2UYNB 3FFMA 4LCKA 3CD6F 5GANK 3JAMM 5HP8A 3NMUC 1RQ7A 2CSLA 3UT5A 5LA6B 4YJ2A 5LP6C 3MDOA 5GIOC 1JJ2F 3F0DA 2EWCA 1XV2A 3N2KB 2CHTA 3JCMM 4I55B 4EB6B 3HKCA 1IV4A 3F0FA 2ZVYA 4F6RA 1VQ8F 4IHJA 4ZOLA 2R6R1 3JARA 4HNAB 1QVGF 2IQQA 1VQMF 1FNJA 2ZAUA 4G88A 2HP0A 1QAHA 1KC8H 4O2AA 1KNKA 5IYZB 3PLAC 1RLUA 5CB4A 1FFXB 1NMUB 1VQVA 2BTQB 3ZO8A 5LXTB 1Q86H 1K9MH 3RYHB 3PAFA 1GO0A 3MCAB 1ZWZA 3KIZA 4IIJA 4C4WC 4TZZA 5MN5A 4BVRA 4LNUB 4YJ3B 5HY0A 3CYQA 4I4TA 3S0YA 4O4IA 4BVQA 1U43A 3VTIC 3E1YA 2BO1A 3E22B 1PF5A 2QEXF 3IEQA 4X1KA 1Q82H 1JFFB 4TUYA 3HJWC 2UYKA 5EYPA 4G4WA 1SZQA 2L26A 2RHHA 2UZHA 5GAPK 3J7AR 3JALB 3MBMA 5C8YB 4C82A 4O4HA 5JVDA 3KHNA 2Z1EA 3RA5A 3VYUC 1Q81H 2VXYA 3G4SF 1VQPF 5EZYB 3LWQC 4C8GA 4E6EA 2QA4F 1RLGA 1X52A 3EORA 4BVSA 4O4LA 5J2UA 4NWOB 5HXZA 2ZODA 4U3JB 3LWVC 1W41A 2UYPA 3N4ZA 1XHOA 2JNBA 3HKBB 5G4VC 4R40B 2LBWA 3JAWA 3WJPA 1W2BF 1JD1A 2ZF8A 3RA6A 4B5CA 4G4XA 3HKCB 3V7EA 1UFYA 3FD5A 4G4VA 4BT6A 3Q8HA 3WGJA 4ZOLB 3LDTA 5IJ0A 3HKEA 5GINC 3F0EA 2ALEA 1QD9A 1VQ6F 3QTYA 1VQ5F 3CC7F 5BMVA 1IV1A 5FJ4C 4BW0B 3OBYA 5ITZA 3CCUF 3LWRC 3F6MA 3B6NA 4TV9A 3ERNA 3MCQA 4DRXA 5HY2A 1VQ7F 3JAKB 1NQ3A 4WBNA 2RB9A 1IV2A 3IKEA 4B62A 3HKDA 3IR9A 1RQ2A 2F9ZC 3OBWA 5IJ9A 2RHLA 3C9SA 2N48A 2RHOA 2Q1XA 2HS0A 4X3LA 4C8EA 1SDSA 2VAPA 3VO8A 3ELCA 1YJNF 4TUYB 5EB1B 3WGNA 3V4DA 3N2GA 1FNKA 3FBAA 5LYJA 3CCRF 5J2TA 3NK7A 3WPXA 3F0GA 3I7TA 1COMA 3M84A 3E20B 1X7OA 5HY1A 5JQGB 5JCOC 1M90H 4C8IA 5CA1A 3HTNA 2G9IA 1YGYA 3ZP7A 2HX0A 4G4ZA 5HP7A 3TD5A 4O4JB 2HVYD 5LOVB 1M1KH 4B45A 3N4YA 1U40A 3VMFB 4B46A 2GZLA 4BVTA 4RHAA 3HAXD 2WALA 2PHNA 3C8LA 5J2UB 3T80A 2OZBA 4C81A 4FFBB 1FSZA 4X1YB 1XBIA 3CPQA 3CCVF 1JN1A 4ZI7B 5CA0A 3R0PA 4ZHVA 3K2XA 5A2QM 3JAWB 2QTPA 5KMGA 4TV8A 1ONIA 3M1XA 4I50B 3CC2F 5GONA 1W5EA 3VOBA 2I6DA 3P0ZA 3I3FA 5IT9M 4BT2A 2ZOVA 2K1SA 4ZHQB 2QI2A 5HWEA 1VQ4F 3CXCF 1W57A 2CHSA 5KX5B 4O2BB 1H47A 3NVIB 3IKFA 3JASA 3V7QA 3LWOC 3S0HA 5JH7A 1KD1H 2V9YA 4X1IA 1YJ9F 1UI9A 3OW2F 4X3MA 1T0AA 3D54A 3LMEA 1SA0B 5EAZA 5GIPC 5LP6A 2BTOA 2ZVZA 4PWTA 1YQNA 2UYNA 3J81M 5MN6A 1VQNF 3VYTC 1VH8A 1NJIH 3WGMA 4WBNB 5LA6A 1QU9A 3CYPB 3P10A 1U3LA 2BTUA 2H6LA 3N2KA 3K14A 4I55A 4EB6A 4M8IA 1W5BA 2GLZA 2FGYA 2OTMA 3UT5B 3LFOA 3VCZA 4YJ2B 4BT3A 1VQOF 5AVMA 3RYCA 5J2TB 3RYFA 3WGKA 3OONA 1Z5WA 3JATA 3I55F 1FFXA 2HRYA 3IMPA 5LXTA 4F6RB 1Q7YH 3RYHA 5CA1B 3WJQA 4IHJB 4EI7A 3JARB 2W8BC 1CK2A 1Q8RA 2LCAA 2YXZA 2HP0B 3GTZA 4ZHYB 3CMAF 2VGNA 4KWEA 4O2AB 3CCMF 1PXWA 1N8RH 3IEWA 3J80M 4LNUA 5CB4B 4YJ3A 3ZP4A 2AIZP 3ZOPA 5G4UC 2VAWA 2CZWA 1GX1A 1W55A 1KQSF 3WJRA 1VHAA 4IIJB 2YYEA 1H7MA 5FNVA 1TVKA 1X25A 5EB0A 1KNJA 3E22A 1W581 5HY4A 5MN4A 4BT5A 2KTUA 1RA4A 3VIUA 4I4TB 2Z1UA 4O4IB 4X20A 2H8EA 3RYIA 2RHJA 1VQKF 3D00A 1YHQF 5GONB 4U39A 3CMEF 1U3PA 1W5AA 2CW4A 4X1KB 5C8YA 2H8CA 5DCVA 1DBFA 2HP3A 3FPIA 2LBTA 5EYPB 3JASB 1W59A 1XRGA 3HWUA 5JH7B 2PMPA 3VI6A 5EO3A 3JVHA 2P6YA 2CVLA 3SIVA 4EI8A 3NVKE 4U3JA 2CWJA 3KE1A 4O4HB 5JVDB 2DT4A 5LP6B 1Z5VA 1OFUA 3KJJA 1OAPA 3C9RA 2FC3A 4ZK7A 2HS4A 1W40A 3TD4A 4O4LB 3GYQA 3VOAA 5EWRA 3S03A 3NK6A 2NMUA 1VQ9F 2AMTA 1CN7A 3GHZA 4EI9A 3ON1A 3QHDA 3RYCB 2GVIA 3CCLF 3RYFB 3JATB 1CLIA 2OHWA 3V3TA 1TUBA 2UYJA 4ERHA 2Z1FA 5IJ0B 3HKEB 1S72F 3CC4F 3JAKA 2I6RA 2KTVA 5BMVB 4BY9D 5ITZB 5FLXM 3G71F 4TV9B 3D01A 3LWPC 1VQLF 4DRXB 5FNVB 1TVKB 1VK3A 1T0KB 3I56F 3P4EA 3DC2A 1R1MA 5B8FA 1K73H 3AGKA 3CB2A 2OTJF 5JCOA 4X20B 3QUWA 3RYIB 3CCSF 1YITF 3HKDB 3ESJA 3KJKA 2VAMA 3DDNA 2MQEA 5IJ9B
chains in the Genus database with same CATH topology
2L26A 2AIZP 4G4WA 3S03A 5EB1B 3S0HA 4G4YA 2LBTA 2ZF8A 4ZHVA 3WPXA 3TD3A 5EB0A 2ZVYA 3CYQA 3S02A 3S0YA 3KHNA 4B5CA 5EAZA 3S0WA 4G4XA 2ZVZA 3OONA 4PWTA 4G4VA 3IMPA 4G4ZA 3TD5A 4G88A 4B62A 3LDTA 3TD4A 3WPWA 4ZHWA 1R1MA 2W8BC 2HQSC 3CYPB 2LCAA 3S06A 2N48A 1OAPA 2K1SA 2ZOVA 4ERHA 4RHAA 4ZHYB 4R40B 2MQEA 2KGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L26 A;  2AIZ P;  4G4W A;  3S03 A;  5EB1 B;  3S0H A;  4G4Y A;  2LBT A;  2ZF8 A;  4ZHV A;  3WPX A;  3TD3 A;  5EB0 A;  2ZVY A;  3CYQ A;  3S02 A;  3S0Y A;  3KHN A;  4B5C A;  5EAZ A;  3S0W A;  4G4X A;  2ZVZ A;  3OON A;  4PWT A;  4G4V A;  3IMP A;  4G4Z A;  3TD5 A;  4G88 A;  4B62 A;  3LDT A;  3TD4 A;  3WPW A;  4ZHW A;  1R1M A;  2W8B C;  2HQS C;  3CYP B;  2LCA A;  3S06 A;  2N48 A;  1OAP A;  2K1S A;  2ZOV A;  4ERH A;  4RHA A;  4ZHY B;  4R40 B;  2MQE A;  2KGW A; 
#chains in the Genus database with same CATH topology
 2VGM A;  2HRU A;  2IAF A;  5JQG A;  5HXU A;  1YI2 F;  1E7K A;  3M4S A;  3TD3 A;  1W42 A;  4HNA A;  3U0O A;  4O4J A;  3S02 A;  3N2G B;  2OTL F;  5LYJ B;  3G6E F;  3CCQ F;  5LOV A;  5IYZ A;  3RE3 A;  1ODE A;  1YJW F;  3WPW A;  4ZHW A;  4XCQ A;  4FFB A;  5EIB D;  3CG6 A;  4X1Y A;  1IPA A;  4ZI7 A;  1DT9 A;  1GO1 A;  3WXM B;  2KGW A;  3CCE F;  1IV3 A;  2R75 1;  3WGL A;  4I50 A;  1YIJ F;  4BT7 A;  3K0T A;  4NQ3 A;  3MQW A;  5CA0 B;  3O85 A;  3SIU A;  2HS3 A;  1W5F A;  4ZHQ A;  1JFF A;  2B33 A;  5KMG B;  4DXD A;  4TV8 B;  1GZ0 A;  4BT4 A;  2AIF A;  2KG4 A;  5KX5 A;  4O2B A;  2HQS C;  3C9T A;  3S06 A;  3VYS C;  1J7H A;  4NUT A;  2Z01 A;  2LBX A;  1K8A H;  3FD6 A;  3K12 A;  4RQO A;  1TUB B;  1QVF F;  3JAL A;  1H48 A;  2IG8 A;  3C9U A;  5EIB C;  1SA0 A;  4G4Y A;  3CCJ F;  2DYY A;  3L7Q A;  1X7P A;  3CPW F;  5EZY A;  3LYB A;  3S0W A;  3BYQ A;  4X1I B;  1W3E X;  2Q1Y A;  3HKB A;  2Z1T A;  1JY8 A;  2UYN B;  3FFM A;  4LCK A;  3CD6 F;  5GAN K;  3JAM M;  5HP8 A;  3NMU C;  1RQ7 A;  2CSL A;  3UT5 A;  5LA6 B;  4YJ2 A;  5LP6 C;  3MDO A;  5GIO C;  1JJ2 F;  3F0D A;  2EWC A;  1XV2 A;  3N2K B;  2CHT A;  3JCM M;  4I55 B;  4EB6 B;  3HKC A;  1IV4 A;  3F0F A;  2ZVY A;  4F6R A;  1VQ8 F;  4IHJ A;  4ZOL A;  2R6R 1;  3JAR A;  4HNA B;  1QVG F;  2IQQ A;  1VQM F;  1FNJ A;  2ZAU A;  4G88 A;  2HP0 A;  1QAH A;  1KC8 H;  4O2A A;  1KNK A;  5IYZ B;  3PLA C;  1RLU A;  5CB4 A;  1FFX B;  1NMU B;  1VQV A;  2BTQ B;  3ZO8 A;  5LXT B;  1Q86 H;  1K9M H;  3RYH B;  3PAF A;  1GO0 A;  3MCA B;  1ZWZ A;  3KIZ A;  4IIJ A;  4C4W C;  4TZZ A;  5MN5 A;  4BVR A;  4LNU B;  4YJ3 B;  5HY0 A;  3CYQ A;  4I4T A;  3S0Y A;  4O4I A;  4BVQ A;  1U43 A;  3VTI C;  3E1Y A;  2BO1 A;  3E22 B;  1PF5 A;  2QEX F;  3IEQ A;  4X1K A;  1Q82 H;  1JFF B;  4TUY A;  3HJW C;  2UYK A;  5EYP A;  4G4W A;  1SZQ A;  2L26 A;  2RHH A;  2UZH A;  5GAP K;  3J7A R;  3JAL B;  3MBM A;  5C8Y B;  4C82 A;  4O4H A;  5JVD A;  3KHN A;  2Z1E A;  3RA5 A;  3VYU C;  1Q81 H;  2VXY A;  3G4S F;  1VQP F;  5EZY B;  3LWQ C;  4C8G A;  4E6E A;  2QA4 F;  1RLG A;  1X52 A;  3EOR A;  4BVS A;  4O4L A;  5J2U A;  4NWO B;  5HXZ A;  2ZOD A;  4U3J B;  3LWV C;  1W41 A;  2UYP A;  3N4Z A;  1XHO A;  2JNB A;  3HKB B;  5G4V C;  4R40 B;  2LBW A;  3JAW A;  3WJP A;  1W2B F;  1JD1 A;  2ZF8 A;  3RA6 A;  4B5C A;  4G4X A;  3HKC B;  3V7E A;  1UFY A;  3FD5 A;  4G4V A;  4BT6 A;  3Q8H A;  3WGJ A;  4ZOL B;  3LDT A;  5IJ0 A;  3HKE A;  5GIN C;  3F0E A;  2ALE A;  1QD9 A;  1VQ6 F;  3QTY A;  1VQ5 F;  3CC7 F;  5BMV A;  1IV1 A;  5FJ4 C;  4BW0 B;  3OBY A;  5ITZ A;  3CCU F;  3LWR C;  3F6M A;  3B6N A;  4TV9 A;  3ERN A;  3MCQ A;  4DRX A;  5HY2 A;  1VQ7 F;  3JAK B;  1NQ3 A;  4WBN A;  2RB9 A;  1IV2 A;  3IKE A;  4B62 A;  3HKD A;  3IR9 A;  1RQ2 A;  2F9Z C;  3OBW A;  5IJ9 A;  2RHL A;  3C9S A;  2N48 A;  2RHO A;  2Q1X A;  2HS0 A;  4X3L A;  4C8E A;  1SDS A;  2VAP A;  3VO8 A;  3ELC A;  1YJN F;  4TUY B;  5EB1 B;  3WGN A;  3V4D A;  3N2G A;  1FNK A;  3FBA A;  5LYJ A;  3CCR F;  5J2T A;  3NK7 A;  3WPX A;  3F0G A;  3I7T A;  1COM A;  3M84 A;  3E20 B;  1X7O A;  5HY1 A;  5JQG B;  5JCO C;  1M90 H;  4C8I A;  5CA1 A;  3HTN A;  2G9I A;  1YGY A;  3ZP7 A;  2HX0 A;  4G4Z A;  5HP7 A;  3TD5 A;  4O4J B;  2HVY D;  5LOV B;  1M1K H;  4B45 A;  3N4Y A;  1U40 A;  3VMF B;  4B46 A;  2GZL A;  4BVT A;  4RHA A;  3HAX D;  2WAL A;  2PHN A;  3C8L A;  5J2U B;  3T80 A;  2OZB A;  4C81 A;  4FFB B;  1FSZ A;  4X1Y B;  1XBI A;  3CPQ A;  3CCV F;  1JN1 A;  4ZI7 B;  5CA0 A;  3R0P A;  4ZHV A;  3K2X A;  5A2Q M;  3JAW B;  2QTP A;  5KMG A;  4TV8 A;  1ONI A;  3M1X A;  4I50 B;  3CC2 F;  5GON A;  1W5E A;  3VOB A;  2I6D A;  3P0Z A;  3I3F A;  5IT9 M;  4BT2 A;  2ZOV A;  2K1S A;  4ZHQ B;  2QI2 A;  5HWE A;  1VQ4 F;  3CXC F;  1W57 A;  2CHS A;  5KX5 B;  4O2B B;  1H47 A;  3NVI B;  3IKF A;  3JAS A;  3V7Q A;  3LWO C;  3S0H A;  5JH7 A;  1KD1 H;  2V9Y A;  4X1I A;  1YJ9 F;  1UI9 A;  3OW2 F;  4X3M A;  1T0A A;  3D54 A;  3LME A;  1SA0 B;  5EAZ A;  5GIP C;  5LP6 A;  2BTO A;  2ZVZ A;  4PWT A;  1YQN A;  2UYN A;  3J81 M;  5MN6 A;  1VQN F;  3VYT C;  1VH8 A;  1NJI H;  3WGM A;  4WBN B;  5LA6 A;  1QU9 A;  3CYP B;  3P10 A;  1U3L A;  2BTU A;  2H6L A;  3N2K A;  3K14 A;  4I55 A;  4EB6 A;  4M8I A;  1W5B A;  2GLZ A;  2FGY A;  2OTM A;  3UT5 B;  3LFO A;  3VCZ A;  4YJ2 B;  4BT3 A;  1VQO F;  5AVM A;  3RYC A;  5J2T B;  3RYF A;  3WGK A;  3OON A;  1Z5W A;  3JAT A;  3I55 F;  1FFX A;  2HRY A;  3IMP A;  5LXT A;  4F6R B;  1Q7Y H;  3RYH A;  5CA1 B;  3WJQ A;  4IHJ B;  4EI7 A;  3JAR B;  2W8B C;  1CK2 A;  1Q8R A;  2LCA A;  2YXZ A;  2HP0 B;  3GTZ A;  4ZHY B;  3CMA F;  2VGN A;  4KWE A;  4O2A B;  3CCM F;  1PXW A;  1N8R H;  3IEW A;  3J80 M;  4LNU A;  5CB4 B;  4YJ3 A;  3ZP4 A;  2AIZ P;  3ZOP A;  5G4U C;  2VAW A;  2CZW A;  1GX1 A;  1W55 A;  1KQS F;  3WJR A;  1VHA A;  4IIJ B;  2YYE A;  1H7M A;  5FNV A;  1TVK A;  1X25 A;  5EB0 A;  1KNJ A;  3E22 A;  1W58 1;  5HY4 A;  5MN4 A;  4BT5 A;  2KTU A;  1RA4 A;  3VIU A;  4I4T B;  2Z1U A;  4O4I B;  4X20 A;  2H8E A;  3RYI A;  2RHJ A;  1VQK F;  3D00 A;  1YHQ F;  5GON B;  4U39 A;  3CME F;  1U3P A;  1W5A A;  2CW4 A;  4X1K B;  5C8Y A;  2H8C A;  5DCV A;  1DBF A;  2HP3 A;  3FPI A;  2LBT A;  5EYP B;  3JAS B;  1W59 A;  1XRG A;  3HWU A;  5JH7 B;  2PMP A;  3VI6 A;  5EO3 A;  3JVH A;  2P6Y A;  2CVL A;  3SIV A;  4EI8 A;  3NVK E;  4U3J A;  2CWJ A;  3KE1 A;  4O4H B;  5JVD B;  2DT4 A;  5LP6 B;  1Z5V A;  1OFU A;  3KJJ A;  1OAP A;  3C9R A;  2FC3 A;  4ZK7 A;  2HS4 A;  1W40 A;  3TD4 A;  4O4L B;  3GYQ A;  3VOA A;  5EWR A;  3S03 A;  3NK6 A;  2NMU A;  1VQ9 F;  2AMT A;  1CN7 A;  3GHZ A;  4EI9 A;  3ON1 A;  3QHD A;  3RYC B;  2GVI A;  3CCL F;  3RYF B;  3JAT B;  1CLI A;  2OHW A;  3V3T A;  1TUB A;  2UYJ A;  4ERH A;  2Z1F A;  5IJ0 B;  3HKE B;  1S72 F;  3CC4 F;  3JAK A;  2I6R A;  2KTV A;  5BMV B;  4BY9 D;  5ITZ B;  5FLX M;  3G71 F;  4TV9 B;  3D01 A;  3LWP C;  1VQL F;  4DRX B;  5FNV B;  1TVK B;  1VK3 A;  1T0K B;  3I56 F;  3P4E A;  3DC2 A;  1R1M A;  5B8F A;  1K73 H;  3AGK A;  3CB2 A;  2OTJ F;  5JCO A;  4X20 B;  3QUW A;  3RYI B;  3CCS F;  1YIT F;  3HKD B;  3ESJ A;  3KJK A;  2VAM A;  3DDN A;  2MQE A;  5IJ9 B; 
#chains in the Genus database with same CATH homology
 2L26 A;  2AIZ P;  4G4W A;  3S03 A;  5EB1 B;  3S0H A;  4G4Y A;  2LBT A;  2ZF8 A;  4ZHV A;  3WPX A;  3TD3 A;  5EB0 A;  2ZVY A;  3CYQ A;  3S02 A;  3S0Y A;  3KHN A;  4B5C A;  5EAZ A;  3S0W A;  4G4X A;  2ZVZ A;  3OON A;  4PWT A;  4G4V A;  3IMP A;  4G4Z A;  3TD5 A;  4G88 A;  4B62 A;  3LDT A;  3TD4 A;  3WPW A;  4ZHW A;  1R1M A;  2W8B C;  2HQS C;  3CYP B;  2LCA A;  3S06 A;  2N48 A;  1OAP A;  2K1S A;  2ZOV A;  4ERH A;  4RHA A;  4ZHY B;  4R40 B;  2MQE A;  2KGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...