1R1MA

Structure of the ompa-like domain of rmpm from neisseria meningitidis
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
PQYVDETISLSAKTLFGFDKDSLRAEAQDNLKVLAQRLSRTNIQSVRVEGHTDFMGSDKYNQALSERRAYVVANNLVSNGVPVSRISAVGLGESQAQMTQVCEAEVAKLGAKVSKAKKREALIACIEPDRRVDVKIRSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein class 4
publication title Structure of the OmpA-like domain of RmpM from Neisseria meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Membrane protein
total genus 51
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2003-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 1r1mA00
5EB0A 4B5CA 3S0HA 2ZOVA 2LBTA 4G4VA 4G4WA 3CYPB 2W8BC 2L26A 3CYQA 4ZHWA 4G4ZA 2KGWA 3IMPA 2ZVYA 4R40B 2LCAA 3TD5A 2ZF8A 3TD4A 3S03A 5EAZA 4PWTA 4ZHYB 3S0YA 3TD3A 3OONA 2HQSC 4G4XA 4B62A 2MQEA 3WPXA 3KHNA 4ERHA 3S0WA 2AIZP 4G88A 2N48A 3S06A 4RHAA 4ZHVA 3S02A 3LDTA 1R1MA 5EB1B 1OAPA 4G4YA 2K1SA 3WPWA 2ZVZA
chains in the Genus database with same CATH superfamily
3F6MA 5MN6A 5JVDA 2B33A 1RQ2A 3DC2A 4LCKA 3V3TA 3CYPB 2W8BC 3G71F 4O2AB 3C9UA 4PWTA 2EWCA 3WJPA 3TD3A 1VQNF 1QD9A 4U3JA 5ITZA 4RHAA 3HKCA 2UYNA 5J2TB 2AMTA 4G4YA 1GX1A 1JFFA 3JASB 5A2QM 1VQMF 1OFUA 3VIUA 1N8RH 2IG8A 4IIJA 1Q86H 3RYIA 3F0GA 4EI7A 3P4EA 3CB2A 4G4WA 4ZHWA 3DDNA 1GO1A 5LP6A 1KC8H 3IEQA 3L7QA 2H6LA 3NK6A 1YITF 4DXDA 2Q1YA 3GHZA 3VI6A 5AVMA 3VYTC 1FNJA 4C82A 3KJJA 2VXYA 1M1KH 1IPAA 3JARB 3S0WA 2AIZP 2IAFA 3HKDA 3C9SA 3S06A 5EIBD 3C9TA 4U39A 5EZYB 3FD5A 2PHNA 4NQ3A 5JQGB 5MN4A 4O2BB 1VQOF 4X1KB 1W581 2HS3A 1S72F 5IJ9B 5HP7A 5HWEA 5GIPC 1Q7YH 1M90H 4RQOA 2ZF8A 5CA0B 3JCMM 2Z1TA 5CB4B 1GO0A 4XCQA 1QVGF 3B6NA 5IJ0B 2QTPA 3WJQA 1Q8RA 2KTVA 1VQKF 5IYZB 3JALA 3CCEF 3HKEB 1JN1A 3RYCB 4HNAB 2LBWA 2JNBA 4EB6A 2GLZA 3M4SA 3SIUA 2H8EA 4X20B 4WBNA 1FFXA 1RA4A 3C9RA 3PLAC 4TUYB 4YJ3A 1JD1A 1H7MA 2RHOA 2H8CA 1SA0A 4G4ZA 4C8GA 2OTJF 1UI9A 1W5FA 1VQ8F 3T80A 1ONIA 1FSZA 2OHWA 3F0EA 1YJ9F 3ZP7A 3RYHA 5JVDB 1KNKA 4X1YA 2GZLA 1W57A 5G4UC 1RLUA 2QEXF 3FD6A 3KJKA 4B5CA 1H48A 2KTUA 2Z01A 2LBTA 1TVKB 4U3JB 3I55F 5ITZB 1VH8A 1VQ4F 3HKCB 2Z1UA 1X25A 4YJ2A 3S0YA 2R751 3C8LA 5LYJB 4BT5A 1YQNA 5B8FA 1JFFB 1U40A 4ZHVA 3ESJA 2YXZA 1XHOA 3FPIA 3E22A 3N2KA 4FFBA 1RLGA 3D00A 5LOVA 5J2UA 1PXWA 5BMVA 5LP6B 3HKBB 2I6DA 4TV8A 4O4HB 5HY2A 4IHJA 3CPWF 3CCQF 4X1IA 4ZHQA 5JH7B 3VCZA 3M1XA 3I7TA 5GINC 2ZAUA 4DRXA 4ZI7A 2AIFA 3TD5A 3HKDB 4I4TA 1YJWF 3TD4A 2ZODA 2RHLA 1GZ0A 3N4YA 3V7EA 2WALA 3N4ZA 3JAKB 2KG4A 2F9ZC 3ON1A 2QA4F 3S02A 1OAPA 5HXZA 4O4LB 3I56F 3KE1A 5JCOC 4I55A 3RYFB 2VGMA 5HXUA 1XBIA 2RB9A 3VTIC 1NQ3A 2HVYD 3MQWA 3HWUA 2HS4A 2FGYA 3JALB 4I50A 1SZQA 5EO3A 3IEWA 3GTZA 3E1YA 1VQ9F 5C8YA 4LNUB 3LDTA 1FFXB 1DT9A 3JATB 1SA0B 3IKEA 2VGNA 5KX5A 2I6RA 2ZOVA 2CHTA 5EYPA 2BTOA 3M84A 3VOBA 3CCJF 2BTUA 3WGLA 4TV9A 1CN7A 4ZHYB 5KMGB 5GIOC 1W55A 4O4IB 4O2AA 4B62A 3VO8A 1IV2A 3IKFA 4KWEA 2G9IA 1VQ6F 3J7AR 3VOAA 2ZVZA 5EB0A 3K12A 5GONA 1YGYA 4F6RB 1DBFA 3EORA 3CCLF 1W42A 2OTMA 4YJ2B 2HP3A 3HTNA 1VQVA 3IMPA 3QTYA 3QUWA 4C81A 1U3PA 2UZHA 3LWQC 2NMUA 4FFBB 5FNVA 2HX0A 3JAWB 1X7PA 3FBAA 5J2UB 4E6EA 1TUBB 5BMVB 3WPXA 1VQ5F 3R0PA 4TV8B 2HP0A 4IHJB 5EB1B 4X1IB 1W59A 4ZHQB 2CW4A 3CCUF 2GVIA 3G4SF 2UYJA 4DRXB 4ZI7B 1CLIA 3S0HA 4I4TB 1H47A 4O4JA 3LYBA 2CVLA 5EZYA 5JCOA 5LP6C 1W41A 1PF5A 5JQGA 1FNKA 4O2BA 4X1KA 4BVQA 3S03A 3WGNA 5HP8A 3UT5A 5IJ9A 3JAMM 2UYNB 1W3EX 3OONA 1T0AA 3JVHA 1U3LA 1VQLF 4X3LA 5CA0A 4EI9A 3RA5A 4G88A 2Z1EA 3ZO8A 1KD1H 4IIJB 1IV1A 3PAFA 3RYIB 4ZOLA 2HRYA 5MN5A 5LXTA 5IJ0A 1SDSA 3MDOA 3N2GA 2UYPA 4BVTA 1COMA 1W5AA 3WGMA 2Z1FA 3VYSC 4HNAA 1XV2A 3CYQA 3O85A 4TZZA 3CCSF 2CHSA 4X20A 2Q1XA 4X3MA 5EAZA 3J80M 4TUYA 3P0ZA 2UYKA 2HQSC 2MQEA 3MBMA 3Q8HA 2BTQB 2FC3A 3CXCF 3V4DA 5LA6A 1E7KA 3WJRA 1W5EA 1X52A 1K8AH 5EYPB 1KNJA 2LBXA 3OBYA 4TV9B 1NMUB 2L26A 3OBWA 2R6R1 4BT2A 2HS0A 1KQSF 5CA1A 1TVKA 1VHAA 3NK7A 5GONB 2CWJA 3ELCA 4BT4A 3CCVF 1VQPF 1YI2F 1CK2A 4EB6B 2N48A 3RE3A 3ZOPA 2QI2A 4WBNB 4C8IA 2RHJA 5LYJA 2RHHA 1T0KB 3K14A 3HAXD 3F0FA 3CD6F 2ALEA 1UFYA 3CG6A 3ERNA 2BO1A 4YJ3B 3V7QA 4ZK7A 1Q81H 1NJIH 5HY4A 5HY0A 5GAPK 4G4VA 5FNVB 3D54A 2IQQA 3CC4F 3HKBA 2DYYA 1W40A 4M8IA 4O4HA 3WXMB 3RA6A 3MCAB 2V9YA 3LWPC 5JH7A 4BY9D 2HP0B 3NVKE 5DCVA 3RYHB 4BVRA 1YIJF 4X1YB 3OW2F 4G4XA 3KHNA 1J7HA 5FJ4C 4O4JB 5EWRA 1ODEA 3CC7F 3F0DA 1VQ7F 3JAKA 3D01A 4NWOB 3CCMF 3I3FA 3UT5B 3GYQA 2DT4A 5J2TA 1K9MH 3J81M 3K0TA 1YHQF 4O4LA 3LFOA 2ZVYA 3RYFA 3CC2F 3JASA 1IV3A 2CZWA 4BVSA 4ZOLB 3E22B 3N2KB 3LWRC 5LXTB 3CCRF 5LOVB 3P10A 5IT9M 1XRGA 3N2GB 3G6EF 2VAMA 4C4WC 1RQ7A 1R1MA 4B46A 3IR9A 4C8EA 3KIZA 2K1SA 3CPQA 3JARA 4BT7A 2PMPA 4LNUA 5GANK 3JATA 3LWVC 3LWOC 2KGWA 3QHDA 3VYUC 5FLXM 4R40B 2LCAA 1K73H 3U0OA 4EI8A 5LA6B 5HY1A 3BYQA 3NVIB 1W2BF 4BT3A 3VMFB 4ERHA 2CSLA 3CMAF 5KMGA 2OTLF 1U43A 4I55B 4NUTA 4BT6A 1QAHA 4O4IA 2VAWA 5CB4A 1W5BA 3WPWA 1Z5VA 1QU9A 3AGKA 3LMEA 3HJWC 3NMUC 1ZWZA 3FFMA 3WGJA 5IYZA 5CA1B 3HKEA 4I50B 3RYCA 1X7OA 1JJ2F 4F6RA 2OZBA 3E20B 5C8YB 3WGKA 1JY8A 2HRUA 5G4VC 4BW0B 3MCQA 2YYEA 1QVFF 4B45A 1Q82H 5KX5B 1Z5WA 2VAPA 5EIBC 2P6YA 3ZP4A 3JAWA 1YJNF 1VK3A 3SIVA 3CMEF 1TUBA 3K2XA 1IV4A
chains in the Genus database with same CATH topology
5EB0A 4B5CA 3S0HA 2ZOVA 2LBTA 4G4VA 4G4WA 3CYPB 2W8BC 2L26A 3CYQA 4ZHWA 4G4ZA 2KGWA 3IMPA 2ZVYA 4R40B 2LCAA 3TD5A 2ZF8A 3TD4A 3S03A 5EAZA 4PWTA 4ZHYB 3S0YA 3TD3A 3OONA 2HQSC 4G4XA 4B62A 2MQEA 3WPXA 3KHNA 4ERHA 3S0WA 2AIZP 4G88A 2N48A 3S06A 4RHAA 4ZHVA 3S02A 3LDTA 1R1MA 5EB1B 1OAPA 4G4YA 2K1SA 3WPWA 2ZVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EB0 A;  4B5C A;  3S0H A;  2ZOV A;  2LBT A;  4G4V A;  4G4W A;  3CYP B;  2W8B C;  2L26 A;  3CYQ A;  4ZHW A;  4G4Z A;  2KGW A;  3IMP A;  2ZVY A;  4R40 B;  2LCA A;  3TD5 A;  2ZF8 A;  3TD4 A;  3S03 A;  5EAZ A;  4PWT A;  4ZHY B;  3S0Y A;  3TD3 A;  3OON A;  2HQS C;  4G4X A;  4B62 A;  2MQE A;  3WPX A;  3KHN A;  4ERH A;  3S0W A;  2AIZ P;  4G88 A;  2N48 A;  3S06 A;  4RHA A;  4ZHV A;  3S02 A;  3LDT A;  1R1M A;  5EB1 B;  1OAP A;  4G4Y A;  2K1S A;  3WPW A;  2ZVZ A; 
#chains in the Genus database with same CATH topology
 3F6M A;  5MN6 A;  5JVD A;  2B33 A;  1RQ2 A;  3DC2 A;  4LCK A;  3V3T A;  3CYP B;  2W8B C;  3G71 F;  4O2A B;  3C9U A;  4PWT A;  2EWC A;  3WJP A;  3TD3 A;  1VQN F;  1QD9 A;  4U3J A;  5ITZ A;  4RHA A;  3HKC A;  2UYN A;  5J2T B;  2AMT A;  4G4Y A;  1GX1 A;  1JFF A;  3JAS B;  5A2Q M;  1VQM F;  1OFU A;  3VIU A;  1N8R H;  2IG8 A;  4IIJ A;  1Q86 H;  3RYI A;  3F0G A;  4EI7 A;  3P4E A;  3CB2 A;  4G4W A;  4ZHW A;  3DDN A;  1GO1 A;  5LP6 A;  1KC8 H;  3IEQ A;  3L7Q A;  2H6L A;  3NK6 A;  1YIT F;  4DXD A;  2Q1Y A;  3GHZ A;  3VI6 A;  5AVM A;  3VYT C;  1FNJ A;  4C82 A;  3KJJ A;  2VXY A;  1M1K H;  1IPA A;  3JAR B;  3S0W A;  2AIZ P;  2IAF A;  3HKD A;  3C9S A;  3S06 A;  5EIB D;  3C9T A;  4U39 A;  5EZY B;  3FD5 A;  2PHN A;  4NQ3 A;  5JQG B;  5MN4 A;  4O2B B;  1VQO F;  4X1K B;  1W58 1;  2HS3 A;  1S72 F;  5IJ9 B;  5HP7 A;  5HWE A;  5GIP C;  1Q7Y H;  1M90 H;  4RQO A;  2ZF8 A;  5CA0 B;  3JCM M;  2Z1T A;  5CB4 B;  1GO0 A;  4XCQ A;  1QVG F;  3B6N A;  5IJ0 B;  2QTP A;  3WJQ A;  1Q8R A;  2KTV A;  1VQK F;  5IYZ B;  3JAL A;  3CCE F;  3HKE B;  1JN1 A;  3RYC B;  4HNA B;  2LBW A;  2JNB A;  4EB6 A;  2GLZ A;  3M4S A;  3SIU A;  2H8E A;  4X20 B;  4WBN A;  1FFX A;  1RA4 A;  3C9R A;  3PLA C;  4TUY B;  4YJ3 A;  1JD1 A;  1H7M A;  2RHO A;  2H8C A;  1SA0 A;  4G4Z A;  4C8G A;  2OTJ F;  1UI9 A;  1W5F A;  1VQ8 F;  3T80 A;  1ONI A;  1FSZ A;  2OHW A;  3F0E A;  1YJ9 F;  3ZP7 A;  3RYH A;  5JVD B;  1KNK A;  4X1Y A;  2GZL A;  1W57 A;  5G4U C;  1RLU A;  2QEX F;  3FD6 A;  3KJK A;  4B5C A;  1H48 A;  2KTU A;  2Z01 A;  2LBT A;  1TVK B;  4U3J B;  3I55 F;  5ITZ B;  1VH8 A;  1VQ4 F;  3HKC B;  2Z1U A;  1X25 A;  4YJ2 A;  3S0Y A;  2R75 1;  3C8L A;  5LYJ B;  4BT5 A;  1YQN A;  5B8F A;  1JFF B;  1U40 A;  4ZHV A;  3ESJ A;  2YXZ A;  1XHO A;  3FPI A;  3E22 A;  3N2K A;  4FFB A;  1RLG A;  3D00 A;  5LOV A;  5J2U A;  1PXW A;  5BMV A;  5LP6 B;  3HKB B;  2I6D A;  4TV8 A;  4O4H B;  5HY2 A;  4IHJ A;  3CPW F;  3CCQ F;  4X1I A;  4ZHQ A;  5JH7 B;  3VCZ A;  3M1X A;  3I7T A;  5GIN C;  2ZAU A;  4DRX A;  4ZI7 A;  2AIF A;  3TD5 A;  3HKD B;  4I4T A;  1YJW F;  3TD4 A;  2ZOD A;  2RHL A;  1GZ0 A;  3N4Y A;  3V7E A;  2WAL A;  3N4Z A;  3JAK B;  2KG4 A;  2F9Z C;  3ON1 A;  2QA4 F;  3S02 A;  1OAP A;  5HXZ A;  4O4L B;  3I56 F;  3KE1 A;  5JCO C;  4I55 A;  3RYF B;  2VGM A;  5HXU A;  1XBI A;  2RB9 A;  3VTI C;  1NQ3 A;  2HVY D;  3MQW A;  3HWU A;  2HS4 A;  2FGY A;  3JAL B;  4I50 A;  1SZQ A;  5EO3 A;  3IEW A;  3GTZ A;  3E1Y A;  1VQ9 F;  5C8Y A;  4LNU B;  3LDT A;  1FFX B;  1DT9 A;  3JAT B;  1SA0 B;  3IKE A;  2VGN A;  5KX5 A;  2I6R A;  2ZOV A;  2CHT A;  5EYP A;  2BTO A;  3M84 A;  3VOB A;  3CCJ F;  2BTU A;  3WGL A;  4TV9 A;  1CN7 A;  4ZHY B;  5KMG B;  5GIO C;  1W55 A;  4O4I B;  4O2A A;  4B62 A;  3VO8 A;  1IV2 A;  3IKF A;  4KWE A;  2G9I A;  1VQ6 F;  3J7A R;  3VOA A;  2ZVZ A;  5EB0 A;  3K12 A;  5GON A;  1YGY A;  4F6R B;  1DBF A;  3EOR A;  3CCL F;  1W42 A;  2OTM A;  4YJ2 B;  2HP3 A;  3HTN A;  1VQV A;  3IMP A;  3QTY A;  3QUW A;  4C81 A;  1U3P A;  2UZH A;  3LWQ C;  2NMU A;  4FFB B;  5FNV A;  2HX0 A;  3JAW B;  1X7P A;  3FBA A;  5J2U B;  4E6E A;  1TUB B;  5BMV B;  3WPX A;  1VQ5 F;  3R0P A;  4TV8 B;  2HP0 A;  4IHJ B;  5EB1 B;  4X1I B;  1W59 A;  4ZHQ B;  2CW4 A;  3CCU F;  2GVI A;  3G4S F;  2UYJ A;  4DRX B;  4ZI7 B;  1CLI A;  3S0H A;  4I4T B;  1H47 A;  4O4J A;  3LYB A;  2CVL A;  5EZY A;  5JCO A;  5LP6 C;  1W41 A;  1PF5 A;  5JQG A;  1FNK A;  4O2B A;  4X1K A;  4BVQ A;  3S03 A;  3WGN A;  5HP8 A;  3UT5 A;  5IJ9 A;  3JAM M;  2UYN B;  1W3E X;  3OON A;  1T0A A;  3JVH A;  1U3L A;  1VQL F;  4X3L A;  5CA0 A;  4EI9 A;  3RA5 A;  4G88 A;  2Z1E A;  3ZO8 A;  1KD1 H;  4IIJ B;  1IV1 A;  3PAF A;  3RYI B;  4ZOL A;  2HRY A;  5MN5 A;  5LXT A;  5IJ0 A;  1SDS A;  3MDO A;  3N2G A;  2UYP A;  4BVT A;  1COM A;  1W5A A;  3WGM A;  2Z1F A;  3VYS C;  4HNA A;  1XV2 A;  3CYQ A;  3O85 A;  4TZZ A;  3CCS F;  2CHS A;  4X20 A;  2Q1X A;  4X3M A;  5EAZ A;  3J80 M;  4TUY A;  3P0Z A;  2UYK A;  2HQS C;  2MQE A;  3MBM A;  3Q8H A;  2BTQ B;  2FC3 A;  3CXC F;  3V4D A;  5LA6 A;  1E7K A;  3WJR A;  1W5E A;  1X52 A;  1K8A H;  5EYP B;  1KNJ A;  2LBX A;  3OBY A;  4TV9 B;  1NMU B;  2L26 A;  3OBW A;  2R6R 1;  4BT2 A;  2HS0 A;  1KQS F;  5CA1 A;  1TVK A;  1VHA A;  3NK7 A;  5GON B;  2CWJ A;  3ELC A;  4BT4 A;  3CCV F;  1VQP F;  1YI2 F;  1CK2 A;  4EB6 B;  2N48 A;  3RE3 A;  3ZOP A;  2QI2 A;  4WBN B;  4C8I A;  2RHJ A;  5LYJ A;  2RHH A;  1T0K B;  3K14 A;  3HAX D;  3F0F A;  3CD6 F;  2ALE A;  1UFY A;  3CG6 A;  3ERN A;  2BO1 A;  4YJ3 B;  3V7Q A;  4ZK7 A;  1Q81 H;  1NJI H;  5HY4 A;  5HY0 A;  5GAP K;  4G4V A;  5FNV B;  3D54 A;  2IQQ A;  3CC4 F;  3HKB A;  2DYY A;  1W40 A;  4M8I A;  4O4H A;  3WXM B;  3RA6 A;  3MCA B;  2V9Y A;  3LWP C;  5JH7 A;  4BY9 D;  2HP0 B;  3NVK E;  5DCV A;  3RYH B;  4BVR A;  1YIJ F;  4X1Y B;  3OW2 F;  4G4X A;  3KHN A;  1J7H A;  5FJ4 C;  4O4J B;  5EWR A;  1ODE A;  3CC7 F;  3F0D A;  1VQ7 F;  3JAK A;  3D01 A;  4NWO B;  3CCM F;  3I3F A;  3UT5 B;  3GYQ A;  2DT4 A;  5J2T A;  1K9M H;  3J81 M;  3K0T A;  1YHQ F;  4O4L A;  3LFO A;  2ZVY A;  3RYF A;  3CC2 F;  3JAS A;  1IV3 A;  2CZW A;  4BVS A;  4ZOL B;  3E22 B;  3N2K B;  3LWR C;  5LXT B;  3CCR F;  5LOV B;  3P10 A;  5IT9 M;  1XRG A;  3N2G B;  3G6E F;  2VAM A;  4C4W C;  1RQ7 A;  1R1M A;  4B46 A;  3IR9 A;  4C8E A;  3KIZ A;  2K1S A;  3CPQ A;  3JAR A;  4BT7 A;  2PMP A;  4LNU A;  5GAN K;  3JAT A;  3LWV C;  3LWO C;  2KGW A;  3QHD A;  3VYU C;  5FLX M;  4R40 B;  2LCA A;  1K73 H;  3U0O A;  4EI8 A;  5LA6 B;  5HY1 A;  3BYQ A;  3NVI B;  1W2B F;  4BT3 A;  3VMF B;  4ERH A;  2CSL A;  3CMA F;  5KMG A;  2OTL F;  1U43 A;  4I55 B;  4NUT A;  4BT6 A;  1QAH A;  4O4I A;  2VAW A;  5CB4 A;  1W5B A;  3WPW A;  1Z5V A;  1QU9 A;  3AGK A;  3LME A;  3HJW C;  3NMU C;  1ZWZ A;  3FFM A;  3WGJ A;  5IYZ A;  5CA1 B;  3HKE A;  4I50 B;  3RYC A;  1X7O A;  1JJ2 F;  4F6R A;  2OZB A;  3E20 B;  5C8Y B;  3WGK A;  1JY8 A;  2HRU A;  5G4V C;  4BW0 B;  3MCQ A;  2YYE A;  1QVF F;  4B45 A;  1Q82 H;  5KX5 B;  1Z5W A;  2VAP A;  5EIB C;  2P6Y A;  3ZP4 A;  3JAW A;  1YJN F;  1VK3 A;  3SIV A;  3CME F;  1TUB A;  3K2X A;  1IV4 A; 
#chains in the Genus database with same CATH homology
 5EB0 A;  4B5C A;  3S0H A;  2ZOV A;  2LBT A;  4G4V A;  4G4W A;  3CYP B;  2W8B C;  2L26 A;  3CYQ A;  4ZHW A;  4G4Z A;  2KGW A;  3IMP A;  2ZVY A;  4R40 B;  2LCA A;  3TD5 A;  2ZF8 A;  3TD4 A;  3S03 A;  5EAZ A;  4PWT A;  4ZHY B;  3S0Y A;  3TD3 A;  3OON A;  2HQS C;  4G4X A;  4B62 A;  2MQE A;  3WPX A;  3KHN A;  4ERH A;  3S0W A;  2AIZ P;  4G88 A;  2N48 A;  3S06 A;  4RHA A;  4ZHV A;  3S02 A;  3LDT A;  1R1M A;  5EB1 B;  1OAP A;  4G4Y A;  2K1S A;  3WPW A;  2ZVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...