1R1MA

Structure of the ompa-like domain of rmpm from neisseria meningitidis
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
PQYVDETISLSAKTLFGFDKDSLRAEAQDNLKVLAQRLSRTNIQSVRVEGHTDFMGSDKYNQALSERRAYVVANNLVSNGVPVSRISAVGLGESQAQMTQVCEAEVAKLGAKVSKAKKREALIACIEPDRRVDVKIRSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein class 4
publication title Structure of the OmpA-like domain of RmpM from Neisseria meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Membrane protein
total genus 51
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2003-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 1r1mA00
2AIZP 4B5CA 2ZOVA 2LCAA 3S0WA 4ERHA 3S0YA 4G4YA 3LDTA 3KHNA 3S02A 4G88A 3OONA 4ZHWA 1R1MA 2K1SA 2ZVZA 3WPXA 5EAZA 4G4XA 4R40B 3TD3A 4PWTA 3IMPA 2KGWA 5EB0A 5EB1B 2MQEA 3CYQA 4G4VA 1OAPA 3S06A 2L26A 2N48A 2W8BC 2LBTA 4ZHYB 3TD4A 4G4ZA 3S03A 4B62A 4RHAA 3S0HA 2ZF8A 3CYPB 2ZVYA 4G4WA 3TD5A 2HQSC 3WPWA 4ZHVA
chains in the Genus database with same CATH superfamily
4B5CA 2ZOVA 3WXMB 1YHQF 4X1IB 3LDTA 3HJWC 2CZWA 3JALB 1ONIA 3VTIC 3CCRF 5LA6B 1KNKA 3VI6A 3JVHA 5HY4A 3CG6A 4TV9B 3QTYA 5IYZA 1U3PA 1Q82H 1QVFF 4BW0B 2LBWA 5LP6A 3CCLF 2UZHA 4U3JA 5KMGA 3QHDA 1FFXA 1PXWA 2HRYA 5IYZB 5FJ4C 5JH7B 2Q1XA 2H8CA 4BVTA 5LP6B 3D54A 4O4JA 1RQ2A 2RHHA 2IAFA 3AGKA 3JAKA 5KMGB 1FFXB 1X7OA 5A2QM 3CCQF 3LWVC 1X52A 2JNBA 3K12A 4X3LA 2OTMA 3OW2F 4O4JB 4BT6A 4RQOA 3CC2F 3JAKB 1U43A 5LP6C 3HAXD 2Z1EA 2BTUA 5LOVA 3D01A 2W8BC 1IV3A 3CCJF 1FSZA 5MN6A 3S0HA 3ZP4A 3IKEA 4DRXA 5LOVB 3Q8HA 3FFMA 1DBFA 3J81M 1VK3A 2YYEA 3FBAA 3RA5A 2CWJA 4FFBA 3VYTC 5J2TB 1W581 3M1XA 1XBIA 1W5FA 1YIJF 3CD6F 4FFBB 1R1MA 3WGJA 3WPXA 4BVSA 3ON1A 1H47A 3KJJA 3N4ZA 5JCOA 5EB1B 1CLIA 3JARA 3S06A 2BTOA 4ZHQA 3CCMF 3M4SA 3RA6A 3O85A 3N2GA 2ZVYA 2CVLA 1QAHA 3WPWA 4ZHVA 2QTPA 3VOAA 2UYNA 3LFOA 5GIOC 3LWOC 2HP0B 3HKCA 5BMVA 1VHAA 2R6R1 2UYNB 5HWEA 5MN5A 4O2BA 2VXYA 3MDOA 1XV2A 4X20A 3MCAB 3HKCB 5BMVB 4YJ3B 2BTQB 5IJ0B 3RYCA 5GONA 2DT4A 2MQEA 2VAMA 3RYIA 2KTVA 2VGNA 3C9UA 1S72F 3SIVA 4O4HA 3RYCB 1U40A 3SIUA 3RYIB 2PMPA 2EWCA 4I50A 3CPWF 3HKDA 4O4HB 1W3EX 1XHOA 3BYQA 4XCQA 1W5EA 5G4UC 3IEQA 4I50B 1TVKA 5HY1A 3S02A 3HKDB 3JATA 1RLGA 3C9SA 2P6YA 1K8AH 2VGMA 1M90H 4IIJA 1VQNF 2Z1TA 5ITZB 1TVKB 5EO3A 2KGWA 3JATB 3G6EF 1GZ0A 3B6NA 3DDNA 4IIJB 1NQ3A 5CA0A 4B62A 4G4WA 5AVMA 3V4DA 4BY9D 5EIBD 1E7KA 3CB2A 1YGYA 4ERHA 3J80M 1Q81H 2KTUA 4BT4A 1TUBB 4B46A 2B33A 4EI7A 2RHOA 2ZVZA 4KWEA 4G4XA 4EB6A 3LWPC 3VIUA 5GINC 5EB0A 1W57A 3M84A 3QUWA 1YI2F 5HY2A 5EYPA 1JY8A 1QVGF 2HX0A 3VMFB 4TUYA 5GAPK 4I4TA 2UYPA 4B45A 5EYPB 1JD1A 2RHLA 3WJPA 1DT9A 4X1KA 3R0PA 1CK2A 2QI2A 3HWUA 4U3JB 4NUTA 3JASA 4BVQA 3WGNA 3HTNA 3V7EA 3U0OA 2GZLA 3LYBA 3NVIB 2H6LA 3JASB 1IV4A 2GLZA 5JQGA 3CCSF 1IPAA 3NVKE 4C81A 1YQNA 3F0FA 1W5BA 2L26A 1VH8A 3I56F 3F0DA 1VQ4F 3LMEA 3FD5A 5JQGB 3TD5A 3VOBA 2CHSA 2H8EA 3DC2A 1W5AA 5B8FA 3N2KA 4EI8A 4DRXB 3N2KB 4TZZA 4DXDA 1COMA 4O4LA 3ERNA 4BT3A 2IQQA 5GIPC 1RQ7A 4C8GA 4O4IA 3NK7A 5EZYA 4O4LB 1T0KB 3ZOPA 3PAFA 1OAPA 2VAWA 2OTLF 3MCQA 3J7AR 1XRGA 1W41A 1Z5VA 2OHWA 1FNJA 2IG8A 4EI9A 4O4IB 4RHAA 1W59A 1X25A 5EZYB 2BO1A 5LXTA 1FNKA 3JARB 3E20B 1Q86H 4ZHQB 3F0EA 3VYUC 3N2GB 5JVDA 3CXCF 1SDSA 1GO1A 2UYKA 5LXTB 3D00A 2I6DA 3KHNA 3RYFA 4G88A 1VQ6F 3GYQA 4IHJA 5JCOC 3I3FA 3P0ZA 4HNAA 3GHZA 3TD3A 3F6MA 4C4WC 3RYFB 3PLAC 4IHJB 3WGMA 4O2BB 4X3MA 4X20B 3CCUF 2HS3A 2Q1YA 3K0TA 1T0AA 5GONB 2FC3A 3G4SF 5CB4A 1KNJA 5G4VC 1H7MA 1W42A 4ZOLA 2ZODA 1VQLF 5EIBC 1VQKF 1SA0A 1W55A 3G71F 4ZOLB 1SA0B 3K14A 4F6RA 1K73H 4M8IA 3OBYA 1X7PA 2N48A 2LBTA 3CMAF 2FGYA 4I55A 4F6RB 1VQ7F 2V9YA 3V3TA 5KX5A 5CA0B 4I55B 1M1KH 1U3LA 2Z01A 3OONA 1YJ9F 4LCKA 5KX5B 1ZWZA 1IV2A 2RB9A 1RLUA 2HRUA 3C9RA 3VO8A 3UT5A 3IMPA 2DYYA 3VCZA 5IT9M 3FPIA 2QEXF 3CYQA 5HXUA 2CHTA 5FLXM 1NJIH 5J2UA 4EB6B 3UT5B 1VQVA 4E6EA 2ZF8A 3N4YA 3L7QA 2HS4A 2HVYD 3P4EA 5J2UB 2YXZA 3JALA 2KG4A 1IV1A 5LA6A 4TUYB 2RHJA 3I7TA 1PF5A 1OFUA 4TV9A 3V7QA 4I4TB 1VQMF 1VQ9F 2K1SA 1W40A 4X1KB 4X1YA 2VAPA 1VQ5F 3JCMM 1Q8RA 2QA4F 3T80A 5JH7A 2AIFA 3TD4A 1VQPF 2Z1UA 4X1YB 3MBMA 3CYPB 4BT5A 2HP3A 4O2AA 4LNUA 3K2XA 1SZQA 3JAMM 1KC8H 3NK6A 4G4YA 5EWRA 4BT7A 3CMEF 3LWQC 4O2AB 4LNUB 1Q7YH 4C8IA 3CPQA 5MN4A 3HKEA 4ZI7A 2F9ZC 1N8RH 2GVIA 2I6RA 1GX1A 3HKEB 4ZI7B 4WBNA 3E1YA 4G4VA 1KQSF 2UYJA 3JAWA 4ZHYB 5GANK 1W2BF 5J2TA 3CC4F 3KE1A 1Z5WA 4TV8A 4WBNB 3OBWA 3JAWB 5HXZA 2OTJF 3CCVF 3FD6A 1K9MH 2HS0A 4BT2A 3NMUC 5IJ9A 4TV8B 3I55F 1GO0A 3LWRC 1VQ8F 1NMUB 5IJ9B 2LBXA 5JVDB 2G9IA 4PWTA 1ODEA 1JN1A 2CSLA 2OZBA 4HNAB 1QD9A 2ZAUA 1QU9A 5FNVA 2HP0A 1JJ2F 3ESJA 2PHNA 2WALA 3WJRA 5FNVB 1VQOF 3S0WA 3EORA 2Z1FA 4U39A 3IEWA 4YJ3A 5IJ0A 1UFYA 3C9TA 3VYSC 5CB4B 3ZO8A 4YJ2A 4NQ3A 2NMUA 5HY0A 5DCVA 3IR9A 3GTZA 4C82A 1YJNF 4YJ2B 3C8LA 2ALEA 3HKBA 3IKFA 3S03A 5HP8A 3WJQA 3ELCA 1YJWF 2HQSC 3E22A 5CA1A 1RA4A 3KIZA 2CW4A 3HKBB 5C8YA 2AIZP 5HP7A 1KD1H 2LCAA 1CN7A 3S0YA 3MQWA 3WGKA 3E22B 4BVRA 5CA1B 5ITZA 3WGLA 3CC7F 4ZK7A 1JFFA 5LYJA 3KJKA 4NWOB 5C8YB 4ZHWA 3RYHA 5EAZA 3CCEF 4R40B 1YITF 1JFFB 5LYJB 3P10A 3ZP7A 3RYHB 3F0GA 1J7HA 1H48A 2R751 4G4ZA 2AMTA 4C8EA 1TUBA 1UI9A 4X1IA 3RE3A
chains in the Genus database with same CATH topology
2AIZP 4B5CA 2ZOVA 2LCAA 3S0WA 4ERHA 3S0YA 4G4YA 3LDTA 3KHNA 3S02A 4G88A 3OONA 4ZHWA 1R1MA 2K1SA 2ZVZA 3WPXA 5EAZA 4G4XA 4R40B 3TD3A 4PWTA 3IMPA 2KGWA 5EB0A 5EB1B 2MQEA 3CYQA 4G4VA 1OAPA 3S06A 2L26A 2N48A 2W8BC 2LBTA 4ZHYB 3TD4A 4G4ZA 3S03A 4B62A 4RHAA 3S0HA 2ZF8A 3CYPB 2ZVYA 4G4WA 3TD5A 2HQSC 3WPWA 4ZHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AIZ P;  4B5C A;  2ZOV A;  2LCA A;  3S0W A;  4ERH A;  3S0Y A;  4G4Y A;  3LDT A;  3KHN A;  3S02 A;  4G88 A;  3OON A;  4ZHW A;  1R1M A;  2K1S A;  2ZVZ A;  3WPX A;  5EAZ A;  4G4X A;  4R40 B;  3TD3 A;  4PWT A;  3IMP A;  2KGW A;  5EB0 A;  5EB1 B;  2MQE A;  3CYQ A;  4G4V A;  1OAP A;  3S06 A;  2L26 A;  2N48 A;  2W8B C;  2LBT A;  4ZHY B;  3TD4 A;  4G4Z A;  3S03 A;  4B62 A;  4RHA A;  3S0H A;  2ZF8 A;  3CYP B;  2ZVY A;  4G4W A;  3TD5 A;  2HQS C;  3WPW A;  4ZHV A; 
#chains in the Genus database with same CATH topology
 4B5C A;  2ZOV A;  3WXM B;  1YHQ F;  4X1I B;  3LDT A;  3HJW C;  2CZW A;  3JAL B;  1ONI A;  3VTI C;  3CCR F;  5LA6 B;  1KNK A;  3VI6 A;  3JVH A;  5HY4 A;  3CG6 A;  4TV9 B;  3QTY A;  5IYZ A;  1U3P A;  1Q82 H;  1QVF F;  4BW0 B;  2LBW A;  5LP6 A;  3CCL F;  2UZH A;  4U3J A;  5KMG A;  3QHD A;  1FFX A;  1PXW A;  2HRY A;  5IYZ B;  5FJ4 C;  5JH7 B;  2Q1X A;  2H8C A;  4BVT A;  5LP6 B;  3D54 A;  4O4J A;  1RQ2 A;  2RHH A;  2IAF A;  3AGK A;  3JAK A;  5KMG B;  1FFX B;  1X7O A;  5A2Q M;  3CCQ F;  3LWV C;  1X52 A;  2JNB A;  3K12 A;  4X3L A;  2OTM A;  3OW2 F;  4O4J B;  4BT6 A;  4RQO A;  3CC2 F;  3JAK B;  1U43 A;  5LP6 C;  3HAX D;  2Z1E A;  2BTU A;  5LOV A;  3D01 A;  2W8B C;  1IV3 A;  3CCJ F;  1FSZ A;  5MN6 A;  3S0H A;  3ZP4 A;  3IKE A;  4DRX A;  5LOV B;  3Q8H A;  3FFM A;  1DBF A;  3J81 M;  1VK3 A;  2YYE A;  3FBA A;  3RA5 A;  2CWJ A;  4FFB A;  3VYT C;  5J2T B;  1W58 1;  3M1X A;  1XBI A;  1W5F A;  1YIJ F;  3CD6 F;  4FFB B;  1R1M A;  3WGJ A;  3WPX A;  4BVS A;  3ON1 A;  1H47 A;  3KJJ A;  3N4Z A;  5JCO A;  5EB1 B;  1CLI A;  3JAR A;  3S06 A;  2BTO A;  4ZHQ A;  3CCM F;  3M4S A;  3RA6 A;  3O85 A;  3N2G A;  2ZVY A;  2CVL A;  1QAH A;  3WPW A;  4ZHV A;  2QTP A;  3VOA A;  2UYN A;  3LFO A;  5GIO C;  3LWO C;  2HP0 B;  3HKC A;  5BMV A;  1VHA A;  2R6R 1;  2UYN B;  5HWE A;  5MN5 A;  4O2B A;  2VXY A;  3MDO A;  1XV2 A;  4X20 A;  3MCA B;  3HKC B;  5BMV B;  4YJ3 B;  2BTQ B;  5IJ0 B;  3RYC A;  5GON A;  2DT4 A;  2MQE A;  2VAM A;  3RYI A;  2KTV A;  2VGN A;  3C9U A;  1S72 F;  3SIV A;  4O4H A;  3RYC B;  1U40 A;  3SIU A;  3RYI B;  2PMP A;  2EWC A;  4I50 A;  3CPW F;  3HKD A;  4O4H B;  1W3E X;  1XHO A;  3BYQ A;  4XCQ A;  1W5E A;  5G4U C;  3IEQ A;  4I50 B;  1TVK A;  5HY1 A;  3S02 A;  3HKD B;  3JAT A;  1RLG A;  3C9S A;  2P6Y A;  1K8A H;  2VGM A;  1M90 H;  4IIJ A;  1VQN F;  2Z1T A;  5ITZ B;  1TVK B;  5EO3 A;  2KGW A;  3JAT B;  3G6E F;  1GZ0 A;  3B6N A;  3DDN A;  4IIJ B;  1NQ3 A;  5CA0 A;  4B62 A;  4G4W A;  5AVM A;  3V4D A;  4BY9 D;  5EIB D;  1E7K A;  3CB2 A;  1YGY A;  4ERH A;  3J80 M;  1Q81 H;  2KTU A;  4BT4 A;  1TUB B;  4B46 A;  2B33 A;  4EI7 A;  2RHO A;  2ZVZ A;  4KWE A;  4G4X A;  4EB6 A;  3LWP C;  3VIU A;  5GIN C;  5EB0 A;  1W57 A;  3M84 A;  3QUW A;  1YI2 F;  5HY2 A;  5EYP A;  1JY8 A;  1QVG F;  2HX0 A;  3VMF B;  4TUY A;  5GAP K;  4I4T A;  2UYP A;  4B45 A;  5EYP B;  1JD1 A;  2RHL A;  3WJP A;  1DT9 A;  4X1K A;  3R0P A;  1CK2 A;  2QI2 A;  3HWU A;  4U3J B;  4NUT A;  3JAS A;  4BVQ A;  3WGN A;  3HTN A;  3V7E A;  3U0O A;  2GZL A;  3LYB A;  3NVI B;  2H6L A;  3JAS B;  1IV4 A;  2GLZ A;  5JQG A;  3CCS F;  1IPA A;  3NVK E;  4C81 A;  1YQN A;  3F0F A;  1W5B A;  2L26 A;  1VH8 A;  3I56 F;  3F0D A;  1VQ4 F;  3LME A;  3FD5 A;  5JQG B;  3TD5 A;  3VOB A;  2CHS A;  2H8E A;  3DC2 A;  1W5A A;  5B8F A;  3N2K A;  4EI8 A;  4DRX B;  3N2K B;  4TZZ A;  4DXD A;  1COM A;  4O4L A;  3ERN A;  4BT3 A;  2IQQ A;  5GIP C;  1RQ7 A;  4C8G A;  4O4I A;  3NK7 A;  5EZY A;  4O4L B;  1T0K B;  3ZOP A;  3PAF A;  1OAP A;  2VAW A;  2OTL F;  3MCQ A;  3J7A R;  1XRG A;  1W41 A;  1Z5V A;  2OHW A;  1FNJ A;  2IG8 A;  4EI9 A;  4O4I B;  4RHA A;  1W59 A;  1X25 A;  5EZY B;  2BO1 A;  5LXT A;  1FNK A;  3JAR B;  3E20 B;  1Q86 H;  4ZHQ B;  3F0E A;  3VYU C;  3N2G B;  5JVD A;  3CXC F;  1SDS A;  1GO1 A;  2UYK A;  5LXT B;  3D00 A;  2I6D A;  3KHN A;  3RYF A;  4G88 A;  1VQ6 F;  3GYQ A;  4IHJ A;  5JCO C;  3I3F A;  3P0Z A;  4HNA A;  3GHZ A;  3TD3 A;  3F6M A;  4C4W C;  3RYF B;  3PLA C;  4IHJ B;  3WGM A;  4O2B B;  4X3M A;  4X20 B;  3CCU F;  2HS3 A;  2Q1Y A;  3K0T A;  1T0A A;  5GON B;  2FC3 A;  3G4S F;  5CB4 A;  1KNJ A;  5G4V C;  1H7M A;  1W42 A;  4ZOL A;  2ZOD A;  1VQL F;  5EIB C;  1VQK F;  1SA0 A;  1W55 A;  3G71 F;  4ZOL B;  1SA0 B;  3K14 A;  4F6R A;  1K73 H;  4M8I A;  3OBY A;  1X7P A;  2N48 A;  2LBT A;  3CMA F;  2FGY A;  4I55 A;  4F6R B;  1VQ7 F;  2V9Y A;  3V3T A;  5KX5 A;  5CA0 B;  4I55 B;  1M1K H;  1U3L A;  2Z01 A;  3OON A;  1YJ9 F;  4LCK A;  5KX5 B;  1ZWZ A;  1IV2 A;  2RB9 A;  1RLU A;  2HRU A;  3C9R A;  3VO8 A;  3UT5 A;  3IMP A;  2DYY A;  3VCZ A;  5IT9 M;  3FPI A;  2QEX F;  3CYQ A;  5HXU A;  2CHT A;  5FLX M;  1NJI H;  5J2U A;  4EB6 B;  3UT5 B;  1VQV A;  4E6E A;  2ZF8 A;  3N4Y A;  3L7Q A;  2HS4 A;  2HVY D;  3P4E A;  5J2U B;  2YXZ A;  3JAL A;  2KG4 A;  1IV1 A;  5LA6 A;  4TUY B;  2RHJ A;  3I7T A;  1PF5 A;  1OFU A;  4TV9 A;  3V7Q A;  4I4T B;  1VQM F;  1VQ9 F;  2K1S A;  1W40 A;  4X1K B;  4X1Y A;  2VAP A;  1VQ5 F;  3JCM M;  1Q8R A;  2QA4 F;  3T80 A;  5JH7 A;  2AIF A;  3TD4 A;  1VQP F;  2Z1U A;  4X1Y B;  3MBM A;  3CYP B;  4BT5 A;  2HP3 A;  4O2A A;  4LNU A;  3K2X A;  1SZQ A;  3JAM M;  1KC8 H;  3NK6 A;  4G4Y A;  5EWR A;  4BT7 A;  3CME F;  3LWQ C;  4O2A B;  4LNU B;  1Q7Y H;  4C8I A;  3CPQ A;  5MN4 A;  3HKE A;  4ZI7 A;  2F9Z C;  1N8R H;  2GVI A;  2I6R A;  1GX1 A;  3HKE B;  4ZI7 B;  4WBN A;  3E1Y A;  4G4V A;  1KQS F;  2UYJ A;  3JAW A;  4ZHY B;  5GAN K;  1W2B F;  5J2T A;  3CC4 F;  3KE1 A;  1Z5W A;  4TV8 A;  4WBN B;  3OBW A;  3JAW B;  5HXZ A;  2OTJ F;  3CCV F;  3FD6 A;  1K9M H;  2HS0 A;  4BT2 A;  3NMU C;  5IJ9 A;  4TV8 B;  3I55 F;  1GO0 A;  3LWR C;  1VQ8 F;  1NMU B;  5IJ9 B;  2LBX A;  5JVD B;  2G9I A;  4PWT A;  1ODE A;  1JN1 A;  2CSL A;  2OZB A;  4HNA B;  1QD9 A;  2ZAU A;  1QU9 A;  5FNV A;  2HP0 A;  1JJ2 F;  3ESJ A;  2PHN A;  2WAL A;  3WJR A;  5FNV B;  1VQO F;  3S0W A;  3EOR A;  2Z1F A;  4U39 A;  3IEW A;  4YJ3 A;  5IJ0 A;  1UFY A;  3C9T A;  3VYS C;  5CB4 B;  3ZO8 A;  4YJ2 A;  4NQ3 A;  2NMU A;  5HY0 A;  5DCV A;  3IR9 A;  3GTZ A;  4C82 A;  1YJN F;  4YJ2 B;  3C8L A;  2ALE A;  3HKB A;  3IKF A;  3S03 A;  5HP8 A;  3WJQ A;  3ELC A;  1YJW F;  2HQS C;  3E22 A;  5CA1 A;  1RA4 A;  3KIZ A;  2CW4 A;  3HKB B;  5C8Y A;  2AIZ P;  5HP7 A;  1KD1 H;  2LCA A;  1CN7 A;  3S0Y A;  3MQW A;  3WGK A;  3E22 B;  4BVR A;  5CA1 B;  5ITZ A;  3WGL A;  3CC7 F;  4ZK7 A;  1JFF A;  5LYJ A;  3KJK A;  4NWO B;  5C8Y B;  4ZHW A;  3RYH A;  5EAZ A;  3CCE F;  4R40 B;  1YIT F;  1JFF B;  5LYJ B;  3P10 A;  3ZP7 A;  3RYH B;  3F0G A;  1J7H A;  1H48 A;  2R75 1;  4G4Z A;  2AMT A;  4C8E A;  1TUB A;  1UI9 A;  4X1I A;  3RE3 A; 
#chains in the Genus database with same CATH homology
 2AIZ P;  4B5C A;  2ZOV A;  2LCA A;  3S0W A;  4ERH A;  3S0Y A;  4G4Y A;  3LDT A;  3KHN A;  3S02 A;  4G88 A;  3OON A;  4ZHW A;  1R1M A;  2K1S A;  2ZVZ A;  3WPX A;  5EAZ A;  4G4X A;  4R40 B;  3TD3 A;  4PWT A;  3IMP A;  2KGW A;  5EB0 A;  5EB1 B;  2MQE A;  3CYQ A;  4G4V A;  1OAP A;  3S06 A;  2L26 A;  2N48 A;  2W8B C;  2LBT A;  4ZHY B;  3TD4 A;  4G4Z A;  3S03 A;  4B62 A;  4RHA A;  3S0H A;  2ZF8 A;  3CYP B;  2ZVY A;  4G4W A;  3TD5 A;  2HQS C;  3WPW A;  4ZHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...