1R1MA

Structure of the ompa-like domain of rmpm from neisseria meningitidis
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
PQYVDETISLSAKTLFGFDKDSLRAEAQDNLKVLAQRLSRTNIQSVRVEGHTDFMGSDKYNQALSERRAYVVANNLVSNGVPVSRISAVGLGESQAQMTQVCEAEVAKLGAKVSKAKKREALIACIEPDRRVDVKIRSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the OmpA-like domain of RmpM from Neisseria meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Membrane protein
molecule keywords Outer membrane protein class 4
total genus 51
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2003-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 1r1mA00
2ZVZA 3S0YA 3S06A 4G4YA 5EB0A 3OONA 2W8BC 4G4ZA 2HQSC 3LDTA 3IMPA 4PWTA 4B62A 4B5CA 2LBTA 3TD3A 2ZVYA 4RHAA 2AIZP 4G4XA 3S0HA 4R40B 5EB1B 3S03A 5EAZA 1R1MA 2KGWA 4ZHYB 3CYQA 3S02A 2K1SA 2L26A 2ZF8A 1OAPA 2MQEA 3CYPB 4G88A 3WPXA 2ZOVA 2LCAA 3S0WA 3KHNA 2N48A 3WPWA 4ZHWA 3TD5A 4G4WA 4G4VA 4ERHA 4ZHVA 3TD4A
chains in the Genus database with same CATH superfamily
3JASA 1VQ9F 2HS0A 3WJRA 3LWOC 3CMAF 3CXCF 1M90H 1IPAA 5EWRA 3CMEF 1W5FA 3FD6A 2HQSC 1VQ6F 2OZBA 1H47A 4B45A 2H6LA 5CA1A 3DDNA 3KJKA 5JH7A 4TUYB 4O2AB 3UT5A 4E6EA 5FJ4C 3EORA 1Q86H 3RYIA 2HRYA 4ZHQA 2CSLA 1IV4A 3GYQA 3ZP4A 2I6DA 2EWCA 3B6NA 3IEWA 3CCMF 3JAMM 4LCKA 3C9RA 1FFXB 4X1YA 3I55F 1SZQA 1W59A 2R751 3KHNA 2QTPA 4O4JA 2LBTA 3TD4A 4X1IA 4WBNA 1YGYA 2ZVZA 2HP3A 4G4ZA 1VH8A 5ITZB 3F0EA 5LYJA 3CB2A 3FFMA 3TD3A 4EB6A 1YIJF 1OFUA 1J7HA 5B8FA 3HKEA 4C8IA 3PLAC 5C8YA 3OBYA 4O4IA 4BVRA 3Q8HA 3RYCB 1VQOF 3N2GB 4BW0B 1IV1A 4BT5A 3G4SF 1JD1A 4FFBA 5J2TA 5LXTA 4XCQA 4O2BA 5JH7B 1SA0B 2OTMA 2BTUA 5JQGA 1JJ2F 3MDOA 3LWQC 1UFYA 4C82A 3WGMA 5C8YB 2ZVYA 1JN1A 3K14A 4C8GA 1KNKA 3QHDA 3HKDB 4O2AA 4X1KA 1U3LA 1QU9A 1ODEA 1FNJA 3ESJA 5JCOA 5EZYA 4DRXA 1XHOA 2LCAA 1VQKF 3ZOPA 4G4WA 5GINC 5EYPA 2WALA 3I56F 5FNVA 3LDTA 2CW4A 2VAPA 4X20B 1W55A 3NK6A 1RQ7A 1W5AA 1T0KB 4I4TB 3C9SA 4RHAA 3RYIB 3I7TA 4TV9B 2KGWA 1K9MH 3CYQA 3E20B 4TUYA 3UT5B 1FNKA 3LMEA 3O85A 5A2QM 3MQWA 3CCUF 2ZODA 1RLUA 2RHJA 4O4IB 5KMGA 3RYCA 5AVMA 4U3JA 2AMTA 2HP0A 2CHSA 2YYEA 5GIOC 4O4LA 3HJWC 3MCAB 1VQMF 3CD6F 3HKCA 3LWVC 5CA0B 5ITZA 4BY9D 3GTZA 4B62A 2IAFA 2BTQB 1W3EX 5EO3A 4R40B 2HS3A 3S03A 1KD1H 1H7MA 3E22B 3E22A 3FPIA 3S02A 1DT9A 4BT4A 5EZYB 4DRXB 3HKBA 2IQQA 3CCVF 4DXDA 4IIJA 1OAPA 5HXZA 1VQNF 2FC3A 5BMVA 4ERHA 1CLIA 1NJIH 3JAWB 3IKFA 5GAPK 5GIPC 5LP6B 1VQ8F 3K0TA 2RHOA 3NMUC 3M4SA 1IV3A 1SA0A 1XBIA 3D54A 1TVKB 2GLZA 2RHLA 1YJ9F 5HY1A 3WGJA 1CN7A 4I4TA 3N2GA 4I50B 4C8EA 2GVIA 1FFXA 3ON1A 3VMFB 5HY4A 3HKCB 2CVLA 5CA0A 3WPWA 5J2TB 1W2BF 3MCQA 3CCSF 1W40A 3HTNA 2KTVA 1QVGF 3IR9A 1KC8H 5LYJB 1VQVA 4I55B 3P0ZA 3JARB 4ZOLA 1VQLF 3C9TA 2HRUA 5LOVB 3CC2F 3M1XA 2VGNA 1Z5WA 3OW2F 2UYNB 3HWUA 2UYNA 3L7QA 1X52A 4NQ3A 3HKBB 2BTOA 4O2BB 3JATA 4HNAA 2LBXA 1W5EA 3MBMA 2V9YA 2RHHA 1PXWA 3VIUA 1QAHA 5CB4A 1YHQF 1T0AA 3G71F 1NMUB 1S72F 3N2KB 5LOVA 5LP6A 3HAXD 3VYUC 3V7EA 3D00A 1R1MA 2UYKA 4TV9A 3VOBA 1VK3A 4EI9A 5IYZB 3VO8A 3NVKE 4BT7A 3PAFA 3KE1A 4IIJB 3CYPB 1SDSA 2R6R1 2Z1FA 1FSZA 1K73H 4X1IB 3GHZA 1RQ2A 3S0YA 3S06A 1UI9A 4X20A 3OBWA 4O4HB 5HP7A 5IJ0B 1Q81H 1CK2A 5MN6A 2QEXF 5LXTB 1PF5A 3WGNA 4G4XA 4BVQA 2CHTA 1N8RH 1H48A 3SIUA 1XV2A 3ZP7A 5IT9M 2AIFA 3F0DA 5HY0A 4O4LB 4LNUB 1K8AH 4C81A 3LWPC 3FD5A 4X3LA 4EI7A 4BT6A 1Q82H 3K12A 4X1KB 3CCRF 2PHNA 3S0WA 3F0GA 5G4VC 5BMVB 4WBNB 5HWEA 3P10A 2VAWA 3CG6A 5IJ9B 4HNAB 4FFBB 5G4UC 2H8EA 3LFOA 4B5CA 5FNVB 2OHWA 3C9UA 1RA4A 3RE3A 2GZLA 1DBFA 1W581 2IG8A 3ELCA 3N4ZA 1Z5VA 3WXMB 1U3PA 4LNUA 5LA6B 4B46A 2OTLF 1W5BA 4G88A 3JAWA 3DC2A 1RLGA 5DCVA 3IEQA 4TV8B 3U0OA 1X25A 5HXUA 4ZHVA 5JVDB 1X7PA 5KMGB 2NMUA 5GONB 3WGKA 2HP0B 2F9ZC 2W8BC 4EB6B 3D01A 3LWRC 5JQGB 3N2KA 2LBWA 4F6RA 4O4HA 3CPQA 4ZK7A 5CB4B 1QD9A 3S0HA 3VCZA 3J80M 4I50A 4ZHYB 1KQSF 5KX5A 2BO1A 2B33A 2MQEA 2Z1EA 1GX1A 5HY2A 4IHJA 3V4DA 2RB9A 1GZ0A 3ERNA 3JAKA 3RYFA 4YJ2B 4YJ3A 3VI6A 4EI8A 2HX0A 3JARA 3OONA 5MN5A 4X3MA 1VQ4F 4C4WC 4PWTA 3IKEA 3T80A 3HKDA 2Z01A 2H8CA 2OTJF 1E7KA 5EB1B 1GO0A 4NWOB 2P6YA 4KWEA 1JFFB 2K1SA 3CCLF 4BT2A 2HVYD 2HS4A 2ZF8A 3NVIB 4BVSA 1ONIA 1YI2F 3SIVA 3KIZA 1VHAA 4ZHWA 4M8IA 3CC4F 1U40A 3JALB 5EYPB 2YXZA 5J2UB 4G4YA 1IV2A 2UYPA 3IMPA 2Q1YA 1QVFF 1GO1A 5CA1B 5IJ9A 3V3TA 3C8LA 3ZO8A 1XRGA 5IYZA 3RYHA 5EIBC 3BYQA 4ZI7A 5LP6C 1COMA 1YJNF 3VYTC 4RQOA 4X1YB 3M84A 3JALA 5J2UA 3JVHA 3F0FA 3G6EF 4NUTA 3FBAA 3TD5A 4O4JB 4U39A 3VOAA 3JATB 1X7OA 5EB0A 1TUBA 1TUBB 2CZWA 4F6RB 1Q7YH 2I6RA 4ZI7B 1M1KH 1JFFA 2DYYA 3K2XA 5EAZA 3HKEB 5EIBD 1W57A 4ZOLB 4BVTA 2KG4A 2L26A 3QUWA 4U3JB 3V7QA 2JNBA 3CC7F 5LA6A 3WPXA 2KTUA 1VQ7F 4YJ2A 2N48A 2ZAUA 1Q8RA 4IHJB 2VXYA 3JAKB 3I3FA 3KJJA 3RYFB 1YQNA 2PMPA 3JCMM 5FLXM 2UZHA 3J7AR 4ZHQB 1KNJA 2CWJA 3AGKA 2QA4F 2AIZP 1TVKA 1ZWZA 3P4EA 2Z1UA 3CCQF 3RYHB 3QTYA 3WJPA 3WJQA 5JVDA 2DT4A 3NK7A 3J81M 3N4YA 4TV8A 4G4VA 3F6MA 4YJ3B 5JCOC 1YITF 3VTIC 3VYSC 2Z1TA 2Q1XA 4I55A 4BT3A 3WGLA 2ALEA 1YJWF 1VQ5F 5IJ0A 5GANK 5KX5B 1NQ3A 2G9IA 3LYBA 1U43A 1W42A 3E1YA 1VQPF 1W41A 2QI2A 2VAMA 2UYJA 1JY8A 4TZZA 5MN4A 2ZOVA 5GONA 3CCEF 3RA5A 2VGMA 3R0PA 3CCJF 3RA6A 5HP8A 3CPWF 2FGYA 3JASB
chains in the Genus database with same CATH topology
2ZVZA 3S0YA 3S06A 4G4YA 5EB0A 3OONA 2W8BC 4G4ZA 2HQSC 3LDTA 3IMPA 4PWTA 4B62A 4B5CA 2LBTA 3TD3A 2ZVYA 4RHAA 2AIZP 4G4XA 3S0HA 4R40B 5EB1B 3S03A 5EAZA 1R1MA 2KGWA 4ZHYB 3CYQA 3S02A 2K1SA 2L26A 2ZF8A 1OAPA 2MQEA 3CYPB 4G88A 3WPXA 2ZOVA 2LCAA 3S0WA 3KHNA 2N48A 3WPWA 4ZHWA 3TD5A 4G4WA 4G4VA 4ERHA 4ZHVA 3TD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZVZ A;  3S0Y A;  3S06 A;  4G4Y A;  5EB0 A;  3OON A;  2W8B C;  4G4Z A;  2HQS C;  3LDT A;  3IMP A;  4PWT A;  4B62 A;  4B5C A;  2LBT A;  3TD3 A;  2ZVY A;  4RHA A;  2AIZ P;  4G4X A;  3S0H A;  4R40 B;  5EB1 B;  3S03 A;  5EAZ A;  1R1M A;  2KGW A;  4ZHY B;  3CYQ A;  3S02 A;  2K1S A;  2L26 A;  2ZF8 A;  1OAP A;  2MQE A;  3CYP B;  4G88 A;  3WPX A;  2ZOV A;  2LCA A;  3S0W A;  3KHN A;  2N48 A;  3WPW A;  4ZHW A;  3TD5 A;  4G4W A;  4G4V A;  4ERH A;  4ZHV A;  3TD4 A; 
#chains in the Genus database with same CATH topology
 3JAS A;  1VQ9 F;  2HS0 A;  3WJR A;  3LWO C;  3CMA F;  3CXC F;  1M90 H;  1IPA A;  5EWR A;  3CME F;  1W5F A;  3FD6 A;  2HQS C;  1VQ6 F;  2OZB A;  1H47 A;  4B45 A;  2H6L A;  5CA1 A;  3DDN A;  3KJK A;  5JH7 A;  4TUY B;  4O2A B;  3UT5 A;  4E6E A;  5FJ4 C;  3EOR A;  1Q86 H;  3RYI A;  2HRY A;  4ZHQ A;  2CSL A;  1IV4 A;  3GYQ A;  3ZP4 A;  2I6D A;  2EWC A;  3B6N A;  3IEW A;  3CCM F;  3JAM M;  4LCK A;  3C9R A;  1FFX B;  4X1Y A;  3I55 F;  1SZQ A;  1W59 A;  2R75 1;  3KHN A;  2QTP A;  4O4J A;  2LBT A;  3TD4 A;  4X1I A;  4WBN A;  1YGY A;  2ZVZ A;  2HP3 A;  4G4Z A;  1VH8 A;  5ITZ B;  3F0E A;  5LYJ A;  3CB2 A;  3FFM A;  3TD3 A;  4EB6 A;  1YIJ F;  1OFU A;  1J7H A;  5B8F A;  3HKE A;  4C8I A;  3PLA C;  5C8Y A;  3OBY A;  4O4I A;  4BVR A;  3Q8H A;  3RYC B;  1VQO F;  3N2G B;  4BW0 B;  1IV1 A;  4BT5 A;  3G4S F;  1JD1 A;  4FFB A;  5J2T A;  5LXT A;  4XCQ A;  4O2B A;  5JH7 B;  1SA0 B;  2OTM A;  2BTU A;  5JQG A;  1JJ2 F;  3MDO A;  3LWQ C;  1UFY A;  4C82 A;  3WGM A;  5C8Y B;  2ZVY A;  1JN1 A;  3K14 A;  4C8G A;  1KNK A;  3QHD A;  3HKD B;  4O2A A;  4X1K A;  1U3L A;  1QU9 A;  1ODE A;  1FNJ A;  3ESJ A;  5JCO A;  5EZY A;  4DRX A;  1XHO A;  2LCA A;  1VQK F;  3ZOP A;  4G4W A;  5GIN C;  5EYP A;  2WAL A;  3I56 F;  5FNV A;  3LDT A;  2CW4 A;  2VAP A;  4X20 B;  1W55 A;  3NK6 A;  1RQ7 A;  1W5A A;  1T0K B;  4I4T B;  3C9S A;  4RHA A;  3RYI B;  3I7T A;  4TV9 B;  2KGW A;  1K9M H;  3CYQ A;  3E20 B;  4TUY A;  3UT5 B;  1FNK A;  3LME A;  3O85 A;  5A2Q M;  3MQW A;  3CCU F;  2ZOD A;  1RLU A;  2RHJ A;  4O4I B;  5KMG A;  3RYC A;  5AVM A;  4U3J A;  2AMT A;  2HP0 A;  2CHS A;  2YYE A;  5GIO C;  4O4L A;  3HJW C;  3MCA B;  1VQM F;  3CD6 F;  3HKC A;  3LWV C;  5CA0 B;  5ITZ A;  4BY9 D;  3GTZ A;  4B62 A;  2IAF A;  2BTQ B;  1W3E X;  5EO3 A;  4R40 B;  2HS3 A;  3S03 A;  1KD1 H;  1H7M A;  3E22 B;  3E22 A;  3FPI A;  3S02 A;  1DT9 A;  4BT4 A;  5EZY B;  4DRX B;  3HKB A;  2IQQ A;  3CCV F;  4DXD A;  4IIJ A;  1OAP A;  5HXZ A;  1VQN F;  2FC3 A;  5BMV A;  4ERH A;  1CLI A;  1NJI H;  3JAW B;  3IKF A;  5GAP K;  5GIP C;  5LP6 B;  1VQ8 F;  3K0T A;  2RHO A;  3NMU C;  3M4S A;  1IV3 A;  1SA0 A;  1XBI A;  3D54 A;  1TVK B;  2GLZ A;  2RHL A;  1YJ9 F;  5HY1 A;  3WGJ A;  1CN7 A;  4I4T A;  3N2G A;  4I50 B;  4C8E A;  2GVI A;  1FFX A;  3ON1 A;  3VMF B;  5HY4 A;  3HKC B;  2CVL A;  5CA0 A;  3WPW A;  5J2T B;  1W2B F;  3MCQ A;  3CCS F;  1W40 A;  3HTN A;  2KTV A;  1QVG F;  3IR9 A;  1KC8 H;  5LYJ B;  1VQV A;  4I55 B;  3P0Z A;  3JAR B;  4ZOL A;  1VQL F;  3C9T A;  2HRU A;  5LOV B;  3CC2 F;  3M1X A;  2VGN A;  1Z5W A;  3OW2 F;  2UYN B;  3HWU A;  2UYN A;  3L7Q A;  1X52 A;  4NQ3 A;  3HKB B;  2BTO A;  4O2B B;  3JAT A;  4HNA A;  2LBX A;  1W5E A;  3MBM A;  2V9Y A;  2RHH A;  1PXW A;  3VIU A;  1QAH A;  5CB4 A;  1YHQ F;  1T0A A;  3G71 F;  1NMU B;  1S72 F;  3N2K B;  5LOV A;  5LP6 A;  3HAX D;  3VYU C;  3V7E A;  3D00 A;  1R1M A;  2UYK A;  4TV9 A;  3VOB A;  1VK3 A;  4EI9 A;  5IYZ B;  3VO8 A;  3NVK E;  4BT7 A;  3PAF A;  3KE1 A;  4IIJ B;  3CYP B;  1SDS A;  2R6R 1;  2Z1F A;  1FSZ A;  1K73 H;  4X1I B;  3GHZ A;  1RQ2 A;  3S0Y A;  3S06 A;  1UI9 A;  4X20 A;  3OBW A;  4O4H B;  5HP7 A;  5IJ0 B;  1Q81 H;  1CK2 A;  5MN6 A;  2QEX F;  5LXT B;  1PF5 A;  3WGN A;  4G4X A;  4BVQ A;  2CHT A;  1N8R H;  1H48 A;  3SIU A;  1XV2 A;  3ZP7 A;  5IT9 M;  2AIF A;  3F0D A;  5HY0 A;  4O4L B;  4LNU B;  1K8A H;  4C81 A;  3LWP C;  3FD5 A;  4X3L A;  4EI7 A;  4BT6 A;  1Q82 H;  3K12 A;  4X1K B;  3CCR F;  2PHN A;  3S0W A;  3F0G A;  5G4V C;  5BMV B;  4WBN B;  5HWE A;  3P10 A;  2VAW A;  3CG6 A;  5IJ9 B;  4HNA B;  4FFB B;  5G4U C;  2H8E A;  3LFO A;  4B5C A;  5FNV B;  2OHW A;  3C9U A;  1RA4 A;  3RE3 A;  2GZL A;  1DBF A;  1W58 1;  2IG8 A;  3ELC A;  3N4Z A;  1Z5V A;  3WXM B;  1U3P A;  4LNU A;  5LA6 B;  4B46 A;  2OTL F;  1W5B A;  4G88 A;  3JAW A;  3DC2 A;  1RLG A;  5DCV A;  3IEQ A;  4TV8 B;  3U0O A;  1X25 A;  5HXU A;  4ZHV A;  5JVD B;  1X7P A;  5KMG B;  2NMU A;  5GON B;  3WGK A;  2HP0 B;  2F9Z C;  2W8B C;  4EB6 B;  3D01 A;  3LWR C;  5JQG B;  3N2K A;  2LBW A;  4F6R A;  4O4H A;  3CPQ A;  4ZK7 A;  5CB4 B;  1QD9 A;  3S0H A;  3VCZ A;  3J80 M;  4I50 A;  4ZHY B;  1KQS F;  5KX5 A;  2BO1 A;  2B33 A;  2MQE A;  2Z1E A;  1GX1 A;  5HY2 A;  4IHJ A;  3V4D A;  2RB9 A;  1GZ0 A;  3ERN A;  3JAK A;  3RYF A;  4YJ2 B;  4YJ3 A;  3VI6 A;  4EI8 A;  2HX0 A;  3JAR A;  3OON A;  5MN5 A;  4X3M A;  1VQ4 F;  4C4W C;  4PWT A;  3IKE A;  3T80 A;  3HKD A;  2Z01 A;  2H8C A;  2OTJ F;  1E7K A;  5EB1 B;  1GO0 A;  4NWO B;  2P6Y A;  4KWE A;  1JFF B;  2K1S A;  3CCL F;  4BT2 A;  2HVY D;  2HS4 A;  2ZF8 A;  3NVI B;  4BVS A;  1ONI A;  1YI2 F;  3SIV A;  3KIZ A;  1VHA A;  4ZHW A;  4M8I A;  3CC4 F;  1U40 A;  3JAL B;  5EYP B;  2YXZ A;  5J2U B;  4G4Y A;  1IV2 A;  2UYP A;  3IMP A;  2Q1Y A;  1QVF F;  1GO1 A;  5CA1 B;  5IJ9 A;  3V3T A;  3C8L A;  3ZO8 A;  1XRG A;  5IYZ A;  3RYH A;  5EIB C;  3BYQ A;  4ZI7 A;  5LP6 C;  1COM A;  1YJN F;  3VYT C;  4RQO A;  4X1Y B;  3M84 A;  3JAL A;  5J2U A;  3JVH A;  3F0F A;  3G6E F;  4NUT A;  3FBA A;  3TD5 A;  4O4J B;  4U39 A;  3VOA A;  3JAT B;  1X7O A;  5EB0 A;  1TUB A;  1TUB B;  2CZW A;  4F6R B;  1Q7Y H;  2I6R A;  4ZI7 B;  1M1K H;  1JFF A;  2DYY A;  3K2X A;  5EAZ A;  3HKE B;  5EIB D;  1W57 A;  4ZOL B;  4BVT A;  2KG4 A;  2L26 A;  3QUW A;  4U3J B;  3V7Q A;  2JNB A;  3CC7 F;  5LA6 A;  3WPX A;  2KTU A;  1VQ7 F;  4YJ2 A;  2N48 A;  2ZAU A;  1Q8R A;  4IHJ B;  2VXY A;  3JAK B;  3I3F A;  3KJJ A;  3RYF B;  1YQN A;  2PMP A;  3JCM M;  5FLX M;  2UZH A;  3J7A R;  4ZHQ B;  1KNJ A;  2CWJ A;  3AGK A;  2QA4 F;  2AIZ P;  1TVK A;  1ZWZ A;  3P4E A;  2Z1U A;  3CCQ F;  3RYH B;  3QTY A;  3WJP A;  3WJQ A;  5JVD A;  2DT4 A;  3NK7 A;  3J81 M;  3N4Y A;  4TV8 A;  4G4V A;  3F6M A;  4YJ3 B;  5JCO C;  1YIT F;  3VTI C;  3VYS C;  2Z1T A;  2Q1X A;  4I55 A;  4BT3 A;  3WGL A;  2ALE A;  1YJW F;  1VQ5 F;  5IJ0 A;  5GAN K;  5KX5 B;  1NQ3 A;  2G9I A;  3LYB A;  1U43 A;  1W42 A;  3E1Y A;  1VQP F;  1W41 A;  2QI2 A;  2VAM A;  2UYJ A;  1JY8 A;  4TZZ A;  5MN4 A;  2ZOV A;  5GON A;  3CCE F;  3RA5 A;  2VGM A;  3R0P A;  3CCJ F;  3RA6 A;  5HP8 A;  3CPW F;  2FGY A;  3JAS B; 
#chains in the Genus database with same CATH homology
 2ZVZ A;  3S0Y A;  3S06 A;  4G4Y A;  5EB0 A;  3OON A;  2W8B C;  4G4Z A;  2HQS C;  3LDT A;  3IMP A;  4PWT A;  4B62 A;  4B5C A;  2LBT A;  3TD3 A;  2ZVY A;  4RHA A;  2AIZ P;  4G4X A;  3S0H A;  4R40 B;  5EB1 B;  3S03 A;  5EAZ A;  1R1M A;  2KGW A;  4ZHY B;  3CYQ A;  3S02 A;  2K1S A;  2L26 A;  2ZF8 A;  1OAP A;  2MQE A;  3CYP B;  4G88 A;  3WPX A;  2ZOV A;  2LCA A;  3S0W A;  3KHN A;  2N48 A;  3WPW A;  4ZHW A;  3TD5 A;  4G4W A;  4G4V A;  4ERH A;  4ZHV A;  3TD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...