1R1MA

Structure of the ompa-like domain of rmpm from neisseria meningitidis
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
PQYVDETISLSAKTLFGFDKDSLRAEAQDNLKVLAQRLSRTNIQSVRVEGHTDFMGSDKYNQALSERRAYVVANNLVSNGVPVSRISAVGLGESQAQMTQVCEAEVAKLGAKVSKAKKREALIACIEPDRRVDVKIRSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Outer membrane protein class 4
publication title Structure of the OmpA-like domain of RmpM from Neisseria meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis
total genus 51
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2003-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 1r1mA00
2HQSC 2AIZP 2KGWA 3TD3A 5EB0A 5EAZA 3S0HA 2ZOVA 2N48A 3S03A 2MQEA 5EB1B 2ZVYA 2W8BC 2ZVZA 4G4VA 3TD5A 3TD4A 3KHNA 2K1SA 3S02A 1R1MA 3IMPA 2ZF8A 4ZHWA 2LBTA 4ZHVA 4ZHYB 4G4WA 3WPWA 4B62A 3S06A 4G88A 3OONA 2LCAA 4PWTA 3LDTA 4RHAA 3WPXA 4R40B 4G4ZA 3S0YA 1OAPA 4B5CA 4ERHA 2L26A 3CYQA 4G4YA 4G4XA 3S0WA 3CYPB
chains in the Genus database with same CATH superfamily
2UZHA 3QHDA 1U43A 2WALA 2DT4A 1SZQA 3CCRF 5CA0A 2FGYA 4TV9A 3GHZA 1VQ6F 3C9UA 2OTLF 1RQ7A 4TUYA 3CC4F 2RB9A 5GONB 1YHQF 4C4WC 1SA0B 2PMPA 3JATA 5GANK 1TVKB 1KNJA 4G88A 1VH8A 3VI6A 4BVQA 1UI9A 4EI9A 1W41A 2Q1XA 5EYPA 4PWTA 3LWRC 3JVHA 4ERHA 2L26A 3WJPA 2CZWA 2RHJA 1QVFF 4X1IA 2BTQB 2OTMA 3CCJF 1GZ0A 1VQ5F 1KD1H 3UT5A 3N2KB 1W59A 2OZBA 4FFBB 2OHWA 3WJRA 3CG6A 3TD4A 5JVDB 1JFFB 4O2BB 4C8IA 3JARA 1R1MA 5GIOC 4C8GA 3M84A 4C81A 3ERNA 3CC7F 1RLGA 3WPXA 3ZP4A 4R40B 3D54A 4X20A 5EO3A 3I55F 1IV2A 5LXTA 3RYHB 5CA0B 5FJ4C 3JALA 5LOVA 1KNKA 1Q8RA 1W581 2HP3A 3HKEA 1W40A 2ZVYA 1FFXA 1YQNA 4WBNB 5IYZA 1H48A 2AMTA 3FBAA 1VHAA 4BT4A 2GVIA 4IHJB 4TV8B 5HP7A 1M1KH 4LNUB 1YGYA 3I56F 3FD5A 3ON1A 1VK3A 1S72F 3CPQA 3C9SA 2HVYD 3LDTA 4RHAA 3E22A 4BW0B 4G4ZA 3SIUA 2RHOA 5HY0A 5HY2A 2CW4A 3S0WA 1H7MA 1DT9A 3HKBA 3VCZA 3CXCF 5JCOA 4DXDA 3WGMA 1Q81H 1J7HA 5CA1B 1W2BF 3HWUA 1VQPF 2LBXA 3FFMA 3IKEA 3WGLA 4ZHWA 1QD9A 3P10A 4E6EA 1FNJA 5GONA 4NUTA 5J2UA 3F6MA 1SA0A 4C8EA 2IQQA 3CYQA 3WXMB 3K0TA 3VO8A 5EB0A 3J80M 1XRGA 4U39A 3NK6A 3CCMF 3B6NA 3JASB 2VGMA 1VQLF 3SIVA 4O4HB 4X1KA 5G4VC 3PAFA 4FFBA 3CCSF 2YYEA 3IEQA 1TUBA 3E22B 5EZYB 3CB2A 3VOAA 1JFFA 5JVDA 4O2BA 2LCAA 4U3JA 2R6R1 2GLZA 3D01A 4X1YB 2QTPA 1OAPA 5HP8A 1W5AA 2CWJA 2G9IA 4XCQA 1W5EA 2UYKA 5FNVB 3RYHA 2VAPA 2W8BC 5CB4B 1X7OA 3N4ZA 2ZAUA 5LP6A 3WJQA 4F6RB 5J2UB 3IMPA 2ZF8A 3KJJA 4WBNA 3G71F 4TV8A 4IHJA 5KMGA 4BVTA 4LNUA 1VQ7F 4BT5A 2JNBA 3FD6A 2Z1FA 3QTYA 5FLXM 3VIUA 4B46A 5IJ0B 1SDSA 1VQ8F 3AGKA 2QEXF 4ZK7A 3O85A 1DBFA 3S0HA 1QU9A 2H8EA 2AIFA 2I6DA 3LYBA 4X1KB 2HX0A 3I7TA 4ZHQB 5HY4A 2HP0B 5MN4A 3TD5A 3KHNA 1TUBB 5CA1A 5MN5A 4U3JB 2LBTA 3PLAC 5KX5B 5C8YA 1U40A 3JCMM 3HAXD 3WGJA 1KQSF 4BY9D 1T0KB 3J81M 2IAFA 3BYQA 1CN7A 3CD6F 3N4YA 3RE3A 1GO0A 3TD3A 3LWPC 2V9YA 2ZOVA 2I6RA 5LP6B 3E20B 4IIJB 2YXZA 1YITF 3VYTC 3LWVC 3NK7A 2HS0A 5KMGB 3VYSC 3S02A 3JASA 3VTIC 2KG4A 4O2AB 4G4WA 4O4HA 4BT3A 3WGKA 1VQ9F 4I55B 3CMEF 1ONIA 1K73H 5IT9M 1H47A 4DRXA 3MBMA 3F0DA 2CSLA 5EZYA 4M8IA 2EWCA 2VXYA 3LWQC 4X1YA 2Z01A 3K12A 3RYFA 3G4SF 1YJ9F 3N2GB 2GZLA 1U3PA 2FC3A 3OBYA 3V7EA 1X52A 3P0ZA 3ESJA 4YJ3B 4EB6B 3CCUF 2Q1YA 3OW2F 3GTZA 5FNVA 3JAKB 1Q82H 5C8YB 1QAHA 5CB4A 5EIBC 3RYCB 1XBIA 5IJ9B 1VQ4F 4ZHVA 4BT6A 4YJ2B 3CCLF 3S06A 4F6RA 4X3MA 5JQGA 1FNKA 2KTUA 1U3LA 3S0YA 4NQ3A 3OBWA 2VAWA 1JN1A 3JAMM 3M4SA 3CYPB 5IJ0A 1VQOF 3VMFB 2QI2A 3MQWA 3M1XA 2MQEA 4O4LA 3CCEF 2HS3A 3MCQA 1NJIH 3ZP7A 1GX1A 4O4JA 3VYUC 3DC2A 4ZHQA 5LA6B 2HP0A 4LCKA 2RHLA 4I50B 3WPWA 4DRXB 1CK2A 1X7PA 1N8RH 1M90H 2ZODA 3RYFB 2CHTA 1UFYA 5KX5A 3L7QA 4G4YA 5A2QM 2KTVA 5HY1A 4C82A 4ZOLB 5EAZA 4O4IB 1W55A 1YJNF 3KE1A 3ELCA 2P6YA 3HKCB 3RA5A 5GIPC 3MCAB 2RHHA 4IIJA 5JQGB 1YIJF 3WGNA 1XHOA 1IV1A 1Q7YH 1W3EX 1Z5VA 4O2AA 3FPIA 2BTOA 1PF5A 4I55A 2B33A 1IPAA 2AIZP 4O4LB 1GO1A 2HRYA 1K8AH 5MN6A 5LYJB 4BT7A 3N2GA 3JAWA 4G4VA 4O4JB 2UYPA 5JH7A 4YJ3A 3HJWC 4EB6A 5G4UC 1NMUB 1PXWA 3JAKA 4ZI7B 2CHSA 5EIBD 1IV3A 4BVRA 3RYCA 5IJ9A 2BO1A 2HRUA 5HWEA 4YJ2A 1JJ2F 4TZZA 2H8CA 3IR9A 2UYNB 5AVMA 2KGWA 4RQOA 5JCOC 1COMA 2R751 1W42A 5BMVB 3NMUC 1CLIA 3I3FA 3P4EA 2ALEA 1RQ2A 3K2XA 5HXUA 1QVGF 3ZO8A 3IKFA 3V4DA 5GINC 5GAPK 2VAMA 1IV4A 4B62A 5ITZB 1JD1A 3RYIB 3HKDA 2F9ZC 3HTNA 3KJKA 3V7QA 3CCQF 1NQ3A 5LA6A 3F0GA 2HS4A 4I50A 1KC8H 2HQSC 4TV9B 2UYJA 4KWEA 4TUYB 3JAWB 5EB1B 1VQNF 5JH7B 4ZOLA 2ZVZA 3F0FA 4O4IA 3JATB 5J2TA 3U0OA 2K1SA 4HNAA 2LBWA 3MDOA 1RLUA 2BTUA 5EYPB 2Z1EA 3C9RA 3E1YA 3LWOC 3HKCA 2VGNA 4B45A 1YJWF 2Z1TA 2OTJF 4X1IB 3C8LA 3DDNA 2QA4F 5DCVA 1W5BA 1FSZA 2NMUA 3UT5B 4I4TA 1Q86H 1K9MH 1VQMF 3NVIB 3EORA 3C9TA 2PHNA 2Z1UA 3JARB 5LP6C 1E7KA 4X3LA 2IG8A 5LYJA 3CC2F 1W57A 3HKDB 3J7AR 1X25A 4X20B 3LFOA 3Q8HA 3OONA 3K14A 3ZOPA 4BT2A 5LXTB 5EWRA 1VQKF 1TVKA 1T0AA 3LMEA 3JALB 3KIZA 4ZI7A 5LOVB 3NVKE 3G6EF 1YI2F 3GYQA 3HKEB 3CMAF 3CPWF 1VQVA 2DYYA 1FFXB 5IYZB 2N48A 3F0EA 3S03A 5HXZA 4EI8A 2UYNA 1OFUA 1XV2A 3D00A 3RA6A 3V3TA 5J2TB 4HNAB 3N2KA 4NWOB 2CVLA 5BMVA 3CCVF 1RA4A 3VOBA 3T80A 1ODEA 4ZHYB 5B8FA 3QUWA 3IEWA 3HKBB 2H6LA 1W5FA 1JY8A 4B5CA 1Z5WA 1ZWZA 4EI7A 4G4XA 3RYIA 4I4TB 5ITZA 3R0PA 4BVSA
chains in the Genus database with same CATH topology
2HQSC 2AIZP 2KGWA 3TD3A 5EB0A 5EAZA 3S0HA 2ZOVA 2N48A 3S03A 2MQEA 5EB1B 2ZVYA 2W8BC 2ZVZA 4G4VA 3TD5A 3TD4A 3KHNA 2K1SA 3S02A 1R1MA 3IMPA 2ZF8A 4ZHWA 2LBTA 4ZHVA 4ZHYB 4G4WA 3WPWA 4B62A 3S06A 4G88A 3OONA 2LCAA 4PWTA 3LDTA 4RHAA 3WPXA 4R40B 4G4ZA 3S0YA 1OAPA 4B5CA 4ERHA 2L26A 3CYQA 4G4YA 4G4XA 3S0WA 3CYPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQS C;  2AIZ P;  2KGW A;  3TD3 A;  5EB0 A;  5EAZ A;  3S0H A;  2ZOV A;  2N48 A;  3S03 A;  2MQE A;  5EB1 B;  2ZVY A;  2W8B C;  2ZVZ A;  4G4V A;  3TD5 A;  3TD4 A;  3KHN A;  2K1S A;  3S02 A;  1R1M A;  3IMP A;  2ZF8 A;  4ZHW A;  2LBT A;  4ZHV A;  4ZHY B;  4G4W A;  3WPW A;  4B62 A;  3S06 A;  4G88 A;  3OON A;  2LCA A;  4PWT A;  3LDT A;  4RHA A;  3WPX A;  4R40 B;  4G4Z A;  3S0Y A;  1OAP A;  4B5C A;  4ERH A;  2L26 A;  3CYQ A;  4G4Y A;  4G4X A;  3S0W A;  3CYP B; 
#chains in the Genus database with same CATH topology
 2UZH A;  3QHD A;  1U43 A;  2WAL A;  2DT4 A;  1SZQ A;  3CCR F;  5CA0 A;  2FGY A;  4TV9 A;  3GHZ A;  1VQ6 F;  3C9U A;  2OTL F;  1RQ7 A;  4TUY A;  3CC4 F;  2RB9 A;  5GON B;  1YHQ F;  4C4W C;  1SA0 B;  2PMP A;  3JAT A;  5GAN K;  1TVK B;  1KNJ A;  4G88 A;  1VH8 A;  3VI6 A;  4BVQ A;  1UI9 A;  4EI9 A;  1W41 A;  2Q1X A;  5EYP A;  4PWT A;  3LWR C;  3JVH A;  4ERH A;  2L26 A;  3WJP A;  2CZW A;  2RHJ A;  1QVF F;  4X1I A;  2BTQ B;  2OTM A;  3CCJ F;  1GZ0 A;  1VQ5 F;  1KD1 H;  3UT5 A;  3N2K B;  1W59 A;  2OZB A;  4FFB B;  2OHW A;  3WJR A;  3CG6 A;  3TD4 A;  5JVD B;  1JFF B;  4O2B B;  4C8I A;  3JAR A;  1R1M A;  5GIO C;  4C8G A;  3M84 A;  4C81 A;  3ERN A;  3CC7 F;  1RLG A;  3WPX A;  3ZP4 A;  4R40 B;  3D54 A;  4X20 A;  5EO3 A;  3I55 F;  1IV2 A;  5LXT A;  3RYH B;  5CA0 B;  5FJ4 C;  3JAL A;  5LOV A;  1KNK A;  1Q8R A;  1W58 1;  2HP3 A;  3HKE A;  1W40 A;  2ZVY A;  1FFX A;  1YQN A;  4WBN B;  5IYZ A;  1H48 A;  2AMT A;  3FBA A;  1VHA A;  4BT4 A;  2GVI A;  4IHJ B;  4TV8 B;  5HP7 A;  1M1K H;  4LNU B;  1YGY A;  3I56 F;  3FD5 A;  3ON1 A;  1VK3 A;  1S72 F;  3CPQ A;  3C9S A;  2HVY D;  3LDT A;  4RHA A;  3E22 A;  4BW0 B;  4G4Z A;  3SIU A;  2RHO A;  5HY0 A;  5HY2 A;  2CW4 A;  3S0W A;  1H7M A;  1DT9 A;  3HKB A;  3VCZ A;  3CXC F;  5JCO A;  4DXD A;  3WGM A;  1Q81 H;  1J7H A;  5CA1 B;  1W2B F;  3HWU A;  1VQP F;  2LBX A;  3FFM A;  3IKE A;  3WGL A;  4ZHW A;  1QD9 A;  3P10 A;  4E6E A;  1FNJ A;  5GON A;  4NUT A;  5J2U A;  3F6M A;  1SA0 A;  4C8E A;  2IQQ A;  3CYQ A;  3WXM B;  3K0T A;  3VO8 A;  5EB0 A;  3J80 M;  1XRG A;  4U39 A;  3NK6 A;  3CCM F;  3B6N A;  3JAS B;  2VGM A;  1VQL F;  3SIV A;  4O4H B;  4X1K A;  5G4V C;  3PAF A;  4FFB A;  3CCS F;  2YYE A;  3IEQ A;  1TUB A;  3E22 B;  5EZY B;  3CB2 A;  3VOA A;  1JFF A;  5JVD A;  4O2B A;  2LCA A;  4U3J A;  2R6R 1;  2GLZ A;  3D01 A;  4X1Y B;  2QTP A;  1OAP A;  5HP8 A;  1W5A A;  2CWJ A;  2G9I A;  4XCQ A;  1W5E A;  2UYK A;  5FNV B;  3RYH A;  2VAP A;  2W8B C;  5CB4 B;  1X7O A;  3N4Z A;  2ZAU A;  5LP6 A;  3WJQ A;  4F6R B;  5J2U B;  3IMP A;  2ZF8 A;  3KJJ A;  4WBN A;  3G71 F;  4TV8 A;  4IHJ A;  5KMG A;  4BVT A;  4LNU A;  1VQ7 F;  4BT5 A;  2JNB A;  3FD6 A;  2Z1F A;  3QTY A;  5FLX M;  3VIU A;  4B46 A;  5IJ0 B;  1SDS A;  1VQ8 F;  3AGK A;  2QEX F;  4ZK7 A;  3O85 A;  1DBF A;  3S0H A;  1QU9 A;  2H8E A;  2AIF A;  2I6D A;  3LYB A;  4X1K B;  2HX0 A;  3I7T A;  4ZHQ B;  5HY4 A;  2HP0 B;  5MN4 A;  3TD5 A;  3KHN A;  1TUB B;  5CA1 A;  5MN5 A;  4U3J B;  2LBT A;  3PLA C;  5KX5 B;  5C8Y A;  1U40 A;  3JCM M;  3HAX D;  3WGJ A;  1KQS F;  4BY9 D;  1T0K B;  3J81 M;  2IAF A;  3BYQ A;  1CN7 A;  3CD6 F;  3N4Y A;  3RE3 A;  1GO0 A;  3TD3 A;  3LWP C;  2V9Y A;  2ZOV A;  2I6R A;  5LP6 B;  3E20 B;  4IIJ B;  2YXZ A;  1YIT F;  3VYT C;  3LWV C;  3NK7 A;  2HS0 A;  5KMG B;  3VYS C;  3S02 A;  3JAS A;  3VTI C;  2KG4 A;  4O2A B;  4G4W A;  4O4H A;  4BT3 A;  3WGK A;  1VQ9 F;  4I55 B;  3CME F;  1ONI A;  1K73 H;  5IT9 M;  1H47 A;  4DRX A;  3MBM A;  3F0D A;  2CSL A;  5EZY A;  4M8I A;  2EWC A;  2VXY A;  3LWQ C;  4X1Y A;  2Z01 A;  3K12 A;  3RYF A;  3G4S F;  1YJ9 F;  3N2G B;  2GZL A;  1U3P A;  2FC3 A;  3OBY A;  3V7E A;  1X52 A;  3P0Z A;  3ESJ A;  4YJ3 B;  4EB6 B;  3CCU F;  2Q1Y A;  3OW2 F;  3GTZ A;  5FNV A;  3JAK B;  1Q82 H;  5C8Y B;  1QAH A;  5CB4 A;  5EIB C;  3RYC B;  1XBI A;  5IJ9 B;  1VQ4 F;  4ZHV A;  4BT6 A;  4YJ2 B;  3CCL F;  3S06 A;  4F6R A;  4X3M A;  5JQG A;  1FNK A;  2KTU A;  1U3L A;  3S0Y A;  4NQ3 A;  3OBW A;  2VAW A;  1JN1 A;  3JAM M;  3M4S A;  3CYP B;  5IJ0 A;  1VQO F;  3VMF B;  2QI2 A;  3MQW A;  3M1X A;  2MQE A;  4O4L A;  3CCE F;  2HS3 A;  3MCQ A;  1NJI H;  3ZP7 A;  1GX1 A;  4O4J A;  3VYU C;  3DC2 A;  4ZHQ A;  5LA6 B;  2HP0 A;  4LCK A;  2RHL A;  4I50 B;  3WPW A;  4DRX B;  1CK2 A;  1X7P A;  1N8R H;  1M90 H;  2ZOD A;  3RYF B;  2CHT A;  1UFY A;  5KX5 A;  3L7Q A;  4G4Y A;  5A2Q M;  2KTV A;  5HY1 A;  4C82 A;  4ZOL B;  5EAZ A;  4O4I B;  1W55 A;  1YJN F;  3KE1 A;  3ELC A;  2P6Y A;  3HKC B;  3RA5 A;  5GIP C;  3MCA B;  2RHH A;  4IIJ A;  5JQG B;  1YIJ F;  3WGN A;  1XHO A;  1IV1 A;  1Q7Y H;  1W3E X;  1Z5V A;  4O2A A;  3FPI A;  2BTO A;  1PF5 A;  4I55 A;  2B33 A;  1IPA A;  2AIZ P;  4O4L B;  1GO1 A;  2HRY A;  1K8A H;  5MN6 A;  5LYJ B;  4BT7 A;  3N2G A;  3JAW A;  4G4V A;  4O4J B;  2UYP A;  5JH7 A;  4YJ3 A;  3HJW C;  4EB6 A;  5G4U C;  1NMU B;  1PXW A;  3JAK A;  4ZI7 B;  2CHS A;  5EIB D;  1IV3 A;  4BVR A;  3RYC A;  5IJ9 A;  2BO1 A;  2HRU A;  5HWE A;  4YJ2 A;  1JJ2 F;  4TZZ A;  2H8C A;  3IR9 A;  2UYN B;  5AVM A;  2KGW A;  4RQO A;  5JCO C;  1COM A;  2R75 1;  1W42 A;  5BMV B;  3NMU C;  1CLI A;  3I3F A;  3P4E A;  2ALE A;  1RQ2 A;  3K2X A;  5HXU A;  1QVG F;  3ZO8 A;  3IKF A;  3V4D A;  5GIN C;  5GAP K;  2VAM A;  1IV4 A;  4B62 A;  5ITZ B;  1JD1 A;  3RYI B;  3HKD A;  2F9Z C;  3HTN A;  3KJK A;  3V7Q A;  3CCQ F;  1NQ3 A;  5LA6 A;  3F0G A;  2HS4 A;  4I50 A;  1KC8 H;  2HQS C;  4TV9 B;  2UYJ A;  4KWE A;  4TUY B;  3JAW B;  5EB1 B;  1VQN F;  5JH7 B;  4ZOL A;  2ZVZ A;  3F0F A;  4O4I A;  3JAT B;  5J2T A;  3U0O A;  2K1S A;  4HNA A;  2LBW A;  3MDO A;  1RLU A;  2BTU A;  5EYP B;  2Z1E A;  3C9R A;  3E1Y A;  3LWO C;  3HKC A;  2VGN A;  4B45 A;  1YJW F;  2Z1T A;  2OTJ F;  4X1I B;  3C8L A;  3DDN A;  2QA4 F;  5DCV A;  1W5B A;  1FSZ A;  2NMU A;  3UT5 B;  4I4T A;  1Q86 H;  1K9M H;  1VQM F;  3NVI B;  3EOR A;  3C9T A;  2PHN A;  2Z1U A;  3JAR B;  5LP6 C;  1E7K A;  4X3L A;  2IG8 A;  5LYJ A;  3CC2 F;  1W57 A;  3HKD B;  3J7A R;  1X25 A;  4X20 B;  3LFO A;  3Q8H A;  3OON A;  3K14 A;  3ZOP A;  4BT2 A;  5LXT B;  5EWR A;  1VQK F;  1TVK A;  1T0A A;  3LME A;  3JAL B;  3KIZ A;  4ZI7 A;  5LOV B;  3NVK E;  3G6E F;  1YI2 F;  3GYQ A;  3HKE B;  3CMA F;  3CPW F;  1VQV A;  2DYY A;  1FFX B;  5IYZ B;  2N48 A;  3F0E A;  3S03 A;  5HXZ A;  4EI8 A;  2UYN A;  1OFU A;  1XV2 A;  3D00 A;  3RA6 A;  3V3T A;  5J2T B;  4HNA B;  3N2K A;  4NWO B;  2CVL A;  5BMV A;  3CCV F;  1RA4 A;  3VOB A;  3T80 A;  1ODE A;  4ZHY B;  5B8F A;  3QUW A;  3IEW A;  3HKB B;  2H6L A;  1W5F A;  1JY8 A;  4B5C A;  1Z5W A;  1ZWZ A;  4EI7 A;  4G4X A;  3RYI A;  4I4T B;  5ITZ A;  3R0P A;  4BVS A; 
#chains in the Genus database with same CATH homology
 2HQS C;  2AIZ P;  2KGW A;  3TD3 A;  5EB0 A;  5EAZ A;  3S0H A;  2ZOV A;  2N48 A;  3S03 A;  2MQE A;  5EB1 B;  2ZVY A;  2W8B C;  2ZVZ A;  4G4V A;  3TD5 A;  3TD4 A;  3KHN A;  2K1S A;  3S02 A;  1R1M A;  3IMP A;  2ZF8 A;  4ZHW A;  2LBT A;  4ZHV A;  4ZHY B;  4G4W A;  3WPW A;  4B62 A;  3S06 A;  4G88 A;  3OON A;  2LCA A;  4PWT A;  3LDT A;  4RHA A;  3WPX A;  4R40 B;  4G4Z A;  3S0Y A;  1OAP A;  4B5C A;  4ERH A;  2L26 A;  3CYQ A;  4G4Y A;  4G4X A;  3S0W A;  3CYP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...