1R1MA

Structure of the ompa-like domain of rmpm from neisseria meningitidis
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
PQYVDETISLSAKTLFGFDKDSLRAEAQDNLKVLAQRLSRTNIQSVRVEGHTDFMGSDKYNQALSERRAYVVANNLVSNGVPVSRISAVGLGESQAQMTQVCEAEVAKLGAKVSKAKKREALIACIEPDRRVDVKIRSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the OmpA-like domain of RmpM from Neisseria meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Membrane protein
molecule keywords Outer membrane protein class 4
total genus 51
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2003-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 1r1mA00
2AIZP 3CYQA 4G4VA 2N48A 2ZVYA 2K1SA 5EB1B 4ZHWA 3IMPA 4RHAA 4G88A 5EB0A 4ZHVA 3S02A 3S0WA 4ZHYB 2L26A 2ZOVA 4B62A 4PWTA 3S0HA 2MQEA 4G4WA 4B5CA 2LCAA 4G4XA 4ERHA 1OAPA 3WPWA 3LDTA 2LBTA 3S06A 3OONA 3TD5A 2W8BC 3KHNA 3CYPB 1R1MA 3S0YA 2ZF8A 4R40B 3TD3A 3TD4A 4G4ZA 3S03A 2KGWA 2ZVZA 4G4YA 5EAZA 3WPXA 2HQSC
chains in the Genus database with same CATH superfamily
4G4VA 3V3TA 4BT3A 3UT5B 3J7AR 3C9TA 3K2XA 1M1KH 3RA5A 2MQEA 1K9MH 3AGKA 1E7KA 1TUBA 3EORA 3VOBA 3F0DA 2NMUA 5LP6B 5J2TA 3WGKA 3VMFB 1ZWZA 1SA0B 1W5EA 2ZODA 3I55F 5KMGB 4LNUA 1W59A 4RQOA 3D01A 3TD4A 1IV1A 3ERNA 3WGMA 3T80A 2AIZP 3E22B 3F6MA 3FFMA 3M1XA 2RHLA 2CHSA 2Q1YA 4YJ2A 1NQ3A 3VYUC 4O2BA 3CD6F 1ONIA 4I55B 1XBIA 4G4WA 1CK2A 2OTJF 4TV8A 3S06A 3M4SA 4C81A 4I50A 2FGYA 4NQ3A 1VQMF 3S03A 1ODEA 3E22A 3ELCA 1Q81H 1YIJF 3WPXA 2I6RA 3CPQA 5GONA 2QEXF 1XRGA 3P4EA 3I56F 5AVMA 4C4WC 3NMUC 1U40A 2PHNA 2OTLF 5LA6A 4ZHVA 2UYNB 4BW0B 4I4TB 1YJNF 5EWRA 1H7MA 1RQ2A 4G4XA 3OW2F 3KE1A 4IIJA 5LOVB 1QVGF 4IHJB 3HTNA 4ZOLB 3HKBB 3ZO8A 1YITF 3NK7A 4O4HA 3N2KB 3LYBA 3BYQA 4U3JA 5JCOA 3CCRF 2BTQB 3HKCB 5G4VC 3F0EA 1IPAA 1VQVA 2AIFA 2JNBA 3MBMA 4ZHQA 2RB9A 4HNAA 3G71F 2H6LA 3CYQA 3DC2A 2I6DA 2OTMA 3LMEA 5EIBD 1KNKA 1NMUB 3JATB 1RQ7A 2HRYA 3UT5A 2H8EA 3K12A 5JH7A 1FFXB 3LWQC 3I7TA 1JN1A 2VGNA 1YHQF 3F0FA 1NJIH 1VQ9F 1TUBB 3K14A 3HKCA 3F0GA 1CLIA 3PAFA 2RHHA 4BY9D 1W57A 4G4ZA 3RE3A 1N8RH 3B6NA 3JARA 3JAWA 2QI2A 5B8FA 1VQNF 1X7OA 5JVDA 4BT4A 5EB1B 3MQWA 3OBYA 3SIVA 4YJ2B 3VTIC 1VQ5F 3NVKE 2BO1A 1TVKB 3GYQA 5ITZB 1VQPF 5FNVA 4X1YA 3FD5A 1COMA 1OFUA 5CA0B 3HKDA 2UYKA 4TV9A 1H48A 5FLXM 4O4IB 3C8LA 4LNUB 1X25A 3I3FA 3QUWA 2Z1FA 4I50B 2Z01A 5MN5A 5HY4A 5EYPB 3VYSC 5EO3A 5A2QM 2CW4A 3WXMB 4ZI7A 1JFFB 5C8YA 4BVSA 4G88A 1TVKA 5ITZA 5LYJB 2BTOA 3CC2F 4EB6B 5LP6C 1U3LA 1W5FA 5HY2A 1W5BA 1W5AA 3CG6A 2UZHA 2H8CA 3HKDB 5JQGA 3CC7F 4ZOLA 1FNJA 3ZP7A 4IIJB 1FNKA 5IJ9A 4O4HB 1IV3A 3IKFA 2Z1EA 1YQNA 4X20A 4WBNA 4HNAB 4X3LA 1W42A 4TUYA 1PXWA 4ZHWA 4FFBA 4LCKA 3JALA 4BVRA 1X7PA 2P6YA 1IV2A 3O85A 1SA0A 5HY1A 5BMVB 5CA0A 2FC3A 2AMTA 3OONA 4IHJA 5DCVA 2Z1TA 5GANK 2HX0A 4DRXB 1GZ0A 2CZWA 4U3JB 1U3PA 1QAHA 3LWVC 2RHOA 1VQKF 2ZVZA 3KJKA 3VIUA 5GINC 3HKEB 2BTUA 3VI6A 4X1KA 3JARB 4YJ3B 4ZK7A 3C9UA 4BT7A 2UYPA 3RA6A 3NVIB 1Q82H 3S0WA 3C9SA 4B62A 1SDSA 1KC8H 3S0HA 3GHZA 5KX5A 1OAPA 4X1YB 3PLAC 3LFOA 1VH8A 1KD1H 3LWOC 3MCAB 2W8BC 3Q8HA 5LXTA 2UYJA 2OZBA 3VO8A 3IEQA 4R40B 4O4IA 2B33A 3RYCA 4NUTA 3RYIB 5IJ0B 3JAMM 3FBAA 3KIZA 5JCOC 3JASB 4O4JA 2KG4A 2DT4A 2VGMA 1QVFF 3CMAF 5EYPA 3ESJA 4NWOB 5EB0A 3CCVF 4EI8A 4BVTA 1JJ2F 2G9IA 1VQ6F 5C8YB 5EZYA 3E1YA 3KJJA 3CMEF 5LP6A 3WPWA 5JQGB 1Q86H 4X1IA 3MDOA 2YXZA 3FD6A 3RYCB 3CCMF 1IV4A 3D54A 4ZHQB 2VAPA 5IJ9B 2HP0A 2ZAUA 4EI9A 2GZLA 2KGWA 5HXUA 4F6RA 1K8AH 4WBNB 1S72F 3CC4F 4X20B 1FFXA 4O2BB 5J2UA 1U43A 5HXZA 3L7QA 2WALA 1RA4A 1RLUA 4FFBB 3U0OA 4EB6A 3IR9A 1W55A 3JALB 4X1IB 3J81M 4B5CA 3GTZA 3LDTA 3WGNA 1JD1A 2IAFA 3RYIA 2HP0B 1VHAA 4XCQA 1XHOA 3R0PA 2PMPA 5KMGA 1VQ8F 1KNJA 1QD9A 1VQOF 5GIPC 2KTVA 5JVDB 4B45A 1W3EX 1SZQA 2ALEA 3WJPA 1UI9A 3IKEA 2DYYA 3IMPA 5FNVB 3V7EA 5FJ4C 3CCSF 1DT9A 1YGYA 4ZHYB 5LA6B 4PWTA 2R751 4B46A 1JY8A 2HRUA 4BT6A 3JCMM 3C9RA 3WGLA 3RYFA 2QA4F 2YYEA 4O2AA 5G4UC 3DDNA 3TD3A 4C8IA 3QTYA 1GO0A 5CB4B 4O4LB 1W40A 5IYZA 3CXCF 1W41A 1JFFA 2OHWA 2VXYA 4E6EA 1Z5VA 1RLGA 3M84A 1J7HA 2HQSC 3J80M 5IJ0A 3HKEA 2R6R1 3JASA 4O4JB 2HS3A 2UYNA 3N4ZA 4I4TA 2ZOVA 2CSLA 3JAKA 4BT2A 2V9YA 1YI2F 4ERHA 3MCQA 3RYFB 5JH7B 3VYTC 5KX5B 1DBFA 5EZYB 3WGJA 3N2GA 1Q7YH 2GVIA 5CB4A 3CYPB 3ZP4A 3ZOPA 5GIOC 2F9ZC 2HS4A 5GAPK 1H47A 3HAXD 3HWUA 3N4YA 5BMVA 3JAKB 3RYHB 3S02A 2CHTA 1PF5A 1M90H 5HY0A 5J2UB 2CWJA 4O2AB 2LCAA 2HP3A 3WJRA 3QHDA 2Q1XA 1X52A 4O4LA 5IYZB 3KHNA 3SIUA 1VQLF 4X3MA 5HP8A 2HVYD 1QU9A 4C82A 4G4YA 5EAZA 2QTPA 4BVQA 1T0KB 3D00A 2VAMA 3G4SF 5CA1B 2K1SA 3WJQA 1YJWF 5HWEA 2CVLA 1KQSF 1VK3A 1K73H 2HS0A 3N2GB 5EIBC 5J2TB 1Z5WA 1VQ7F 4BT5A 4TZZA 1R1MA 1Q8RA 3LWRC 4DRXA 2RHJA 3OBWA 3RYHA 4TUYB 5CA1A 3CPWF 3V7QA 1GX1A 2KTUA 1UFYA 3P10A 4I55A 3JAWB 4RHAA 3V4DA 3VOAA 1VQ4F 1CN7A 5HP7A 3FPIA 2IQQA 4C8EA 4TV8B 1W581 2GLZA 3E20B 3CCJF 1YJ9F 4EI7A 3TD5A 4F6RB 2Z1UA 3S0YA 2ZF8A 3VCZA 3CCUF 2LBXA 4C8GA 3CCLF 5GONB 3JVHA 3LWPC 4TV9B 3K0TA 5MN6A 3G6EF 4X1KB 4YJ3A 3P0ZA 2N48A 3NK6A 1T0AA 2LBWA 2ZVYA 3IEWA 3JATA 1GO1A 5MN4A 1XV2A 5IT9M 2L26A 4DXDA 1W2BF 3HKBA 3ON1A 4U39A 5LYJA 4ZI7B 5LOVA 3N2KA 2EWCA 1FSZA 2LBTA 3HJWC 2IG8A 4M8IA 5LXTB 3CCEF 3CCQF 3CB2A 4KWEA 2VAWA
chains in the Genus database with same CATH topology
2AIZP 3CYQA 4G4VA 2N48A 2ZVYA 2K1SA 5EB1B 4ZHWA 3IMPA 4RHAA 4G88A 5EB0A 4ZHVA 3S02A 3S0WA 4ZHYB 2L26A 2ZOVA 4B62A 4PWTA 3S0HA 2MQEA 4G4WA 4B5CA 2LCAA 4G4XA 4ERHA 1OAPA 3WPWA 3LDTA 2LBTA 3S06A 3OONA 3TD5A 2W8BC 3KHNA 3CYPB 1R1MA 3S0YA 2ZF8A 4R40B 3TD3A 3TD4A 4G4ZA 3S03A 2KGWA 2ZVZA 4G4YA 5EAZA 3WPXA 2HQSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AIZ P;  3CYQ A;  4G4V A;  2N48 A;  2ZVY A;  2K1S A;  5EB1 B;  4ZHW A;  3IMP A;  4RHA A;  4G88 A;  5EB0 A;  4ZHV A;  3S02 A;  3S0W A;  4ZHY B;  2L26 A;  2ZOV A;  4B62 A;  4PWT A;  3S0H A;  2MQE A;  4G4W A;  4B5C A;  2LCA A;  4G4X A;  4ERH A;  1OAP A;  3WPW A;  3LDT A;  2LBT A;  3S06 A;  3OON A;  3TD5 A;  2W8B C;  3KHN A;  3CYP B;  1R1M A;  3S0Y A;  2ZF8 A;  4R40 B;  3TD3 A;  3TD4 A;  4G4Z A;  3S03 A;  2KGW A;  2ZVZ A;  4G4Y A;  5EAZ A;  3WPX A;  2HQS C; 
#chains in the Genus database with same CATH topology
 4G4V A;  3V3T A;  4BT3 A;  3UT5 B;  3J7A R;  3C9T A;  3K2X A;  1M1K H;  3RA5 A;  2MQE A;  1K9M H;  3AGK A;  1E7K A;  1TUB A;  3EOR A;  3VOB A;  3F0D A;  2NMU A;  5LP6 B;  5J2T A;  3WGK A;  3VMF B;  1ZWZ A;  1SA0 B;  1W5E A;  2ZOD A;  3I55 F;  5KMG B;  4LNU A;  1W59 A;  4RQO A;  3D01 A;  3TD4 A;  1IV1 A;  3ERN A;  3WGM A;  3T80 A;  2AIZ P;  3E22 B;  3F6M A;  3FFM A;  3M1X A;  2RHL A;  2CHS A;  2Q1Y A;  4YJ2 A;  1NQ3 A;  3VYU C;  4O2B A;  3CD6 F;  1ONI A;  4I55 B;  1XBI A;  4G4W A;  1CK2 A;  2OTJ F;  4TV8 A;  3S06 A;  3M4S A;  4C81 A;  4I50 A;  2FGY A;  4NQ3 A;  1VQM F;  3S03 A;  1ODE A;  3E22 A;  3ELC A;  1Q81 H;  1YIJ F;  3WPX A;  2I6R A;  3CPQ A;  5GON A;  2QEX F;  1XRG A;  3P4E A;  3I56 F;  5AVM A;  4C4W C;  3NMU C;  1U40 A;  2PHN A;  2OTL F;  5LA6 A;  4ZHV A;  2UYN B;  4BW0 B;  4I4T B;  1YJN F;  5EWR A;  1H7M A;  1RQ2 A;  4G4X A;  3OW2 F;  3KE1 A;  4IIJ A;  5LOV B;  1QVG F;  4IHJ B;  3HTN A;  4ZOL B;  3HKB B;  3ZO8 A;  1YIT F;  3NK7 A;  4O4H A;  3N2K B;  3LYB A;  3BYQ A;  4U3J A;  5JCO A;  3CCR F;  2BTQ B;  3HKC B;  5G4V C;  3F0E A;  1IPA A;  1VQV A;  2AIF A;  2JNB A;  3MBM A;  4ZHQ A;  2RB9 A;  4HNA A;  3G71 F;  2H6L A;  3CYQ A;  3DC2 A;  2I6D A;  2OTM A;  3LME A;  5EIB D;  1KNK A;  1NMU B;  3JAT B;  1RQ7 A;  2HRY A;  3UT5 A;  2H8E A;  3K12 A;  5JH7 A;  1FFX B;  3LWQ C;  3I7T A;  1JN1 A;  2VGN A;  1YHQ F;  3F0F A;  1NJI H;  1VQ9 F;  1TUB B;  3K14 A;  3HKC A;  3F0G A;  1CLI A;  3PAF A;  2RHH A;  4BY9 D;  1W57 A;  4G4Z A;  3RE3 A;  1N8R H;  3B6N A;  3JAR A;  3JAW A;  2QI2 A;  5B8F A;  1VQN F;  1X7O A;  5JVD A;  4BT4 A;  5EB1 B;  3MQW A;  3OBY A;  3SIV A;  4YJ2 B;  3VTI C;  1VQ5 F;  3NVK E;  2BO1 A;  1TVK B;  3GYQ A;  5ITZ B;  1VQP F;  5FNV A;  4X1Y A;  3FD5 A;  1COM A;  1OFU A;  5CA0 B;  3HKD A;  2UYK A;  4TV9 A;  1H48 A;  5FLX M;  4O4I B;  3C8L A;  4LNU B;  1X25 A;  3I3F A;  3QUW A;  2Z1F A;  4I50 B;  2Z01 A;  5MN5 A;  5HY4 A;  5EYP B;  3VYS C;  5EO3 A;  5A2Q M;  2CW4 A;  3WXM B;  4ZI7 A;  1JFF B;  5C8Y A;  4BVS A;  4G88 A;  1TVK A;  5ITZ A;  5LYJ B;  2BTO A;  3CC2 F;  4EB6 B;  5LP6 C;  1U3L A;  1W5F A;  5HY2 A;  1W5B A;  1W5A A;  3CG6 A;  2UZH A;  2H8C A;  3HKD B;  5JQG A;  3CC7 F;  4ZOL A;  1FNJ A;  3ZP7 A;  4IIJ B;  1FNK A;  5IJ9 A;  4O4H B;  1IV3 A;  3IKF A;  2Z1E A;  1YQN A;  4X20 A;  4WBN A;  4HNA B;  4X3L A;  1W42 A;  4TUY A;  1PXW A;  4ZHW A;  4FFB A;  4LCK A;  3JAL A;  4BVR A;  1X7P A;  2P6Y A;  1IV2 A;  3O85 A;  1SA0 A;  5HY1 A;  5BMV B;  5CA0 A;  2FC3 A;  2AMT A;  3OON A;  4IHJ A;  5DCV A;  2Z1T A;  5GAN K;  2HX0 A;  4DRX B;  1GZ0 A;  2CZW A;  4U3J B;  1U3P A;  1QAH A;  3LWV C;  2RHO A;  1VQK F;  2ZVZ A;  3KJK A;  3VIU A;  5GIN C;  3HKE B;  2BTU A;  3VI6 A;  4X1K A;  3JAR B;  4YJ3 B;  4ZK7 A;  3C9U A;  4BT7 A;  2UYP A;  3RA6 A;  3NVI B;  1Q82 H;  3S0W A;  3C9S A;  4B62 A;  1SDS A;  1KC8 H;  3S0H A;  3GHZ A;  5KX5 A;  1OAP A;  4X1Y B;  3PLA C;  3LFO A;  1VH8 A;  1KD1 H;  3LWO C;  3MCA B;  2W8B C;  3Q8H A;  5LXT A;  2UYJ A;  2OZB A;  3VO8 A;  3IEQ A;  4R40 B;  4O4I A;  2B33 A;  3RYC A;  4NUT A;  3RYI B;  5IJ0 B;  3JAM M;  3FBA A;  3KIZ A;  5JCO C;  3JAS B;  4O4J A;  2KG4 A;  2DT4 A;  2VGM A;  1QVF F;  3CMA F;  5EYP A;  3ESJ A;  4NWO B;  5EB0 A;  3CCV F;  4EI8 A;  4BVT A;  1JJ2 F;  2G9I A;  1VQ6 F;  5C8Y B;  5EZY A;  3E1Y A;  3KJJ A;  3CME F;  5LP6 A;  3WPW A;  5JQG B;  1Q86 H;  4X1I A;  3MDO A;  2YXZ A;  3FD6 A;  3RYC B;  3CCM F;  1IV4 A;  3D54 A;  4ZHQ B;  2VAP A;  5IJ9 B;  2HP0 A;  2ZAU A;  4EI9 A;  2GZL A;  2KGW A;  5HXU A;  4F6R A;  1K8A H;  4WBN B;  1S72 F;  3CC4 F;  4X20 B;  1FFX A;  4O2B B;  5J2U A;  1U43 A;  5HXZ A;  3L7Q A;  2WAL A;  1RA4 A;  1RLU A;  4FFB B;  3U0O A;  4EB6 A;  3IR9 A;  1W55 A;  3JAL B;  4X1I B;  3J81 M;  4B5C A;  3GTZ A;  3LDT A;  3WGN A;  1JD1 A;  2IAF A;  3RYI A;  2HP0 B;  1VHA A;  4XCQ A;  1XHO A;  3R0P A;  2PMP A;  5KMG A;  1VQ8 F;  1KNJ A;  1QD9 A;  1VQO F;  5GIP C;  2KTV A;  5JVD B;  4B45 A;  1W3E X;  1SZQ A;  2ALE A;  3WJP A;  1UI9 A;  3IKE A;  2DYY A;  3IMP A;  5FNV B;  3V7E A;  5FJ4 C;  3CCS F;  1DT9 A;  1YGY A;  4ZHY B;  5LA6 B;  4PWT A;  2R75 1;  4B46 A;  1JY8 A;  2HRU A;  4BT6 A;  3JCM M;  3C9R A;  3WGL A;  3RYF A;  2QA4 F;  2YYE A;  4O2A A;  5G4U C;  3DDN A;  3TD3 A;  4C8I A;  3QTY A;  1GO0 A;  5CB4 B;  4O4L B;  1W40 A;  5IYZ A;  3CXC F;  1W41 A;  1JFF A;  2OHW A;  2VXY A;  4E6E A;  1Z5V A;  1RLG A;  3M84 A;  1J7H A;  2HQS C;  3J80 M;  5IJ0 A;  3HKE A;  2R6R 1;  3JAS A;  4O4J B;  2HS3 A;  2UYN A;  3N4Z A;  4I4T A;  2ZOV A;  2CSL A;  3JAK A;  4BT2 A;  2V9Y A;  1YI2 F;  4ERH A;  3MCQ A;  3RYF B;  5JH7 B;  3VYT C;  5KX5 B;  1DBF A;  5EZY B;  3WGJ A;  3N2G A;  1Q7Y H;  2GVI A;  5CB4 A;  3CYP B;  3ZP4 A;  3ZOP A;  5GIO C;  2F9Z C;  2HS4 A;  5GAP K;  1H47 A;  3HAX D;  3HWU A;  3N4Y A;  5BMV A;  3JAK B;  3RYH B;  3S02 A;  2CHT A;  1PF5 A;  1M90 H;  5HY0 A;  5J2U B;  2CWJ A;  4O2A B;  2LCA A;  2HP3 A;  3WJR A;  3QHD A;  2Q1X A;  1X52 A;  4O4L A;  5IYZ B;  3KHN A;  3SIU A;  1VQL F;  4X3M A;  5HP8 A;  2HVY D;  1QU9 A;  4C82 A;  4G4Y A;  5EAZ A;  2QTP A;  4BVQ A;  1T0K B;  3D00 A;  2VAM A;  3G4S F;  5CA1 B;  2K1S A;  3WJQ A;  1YJW F;  5HWE A;  2CVL A;  1KQS F;  1VK3 A;  1K73 H;  2HS0 A;  3N2G B;  5EIB C;  5J2T B;  1Z5W A;  1VQ7 F;  4BT5 A;  4TZZ A;  1R1M A;  1Q8R A;  3LWR C;  4DRX A;  2RHJ A;  3OBW A;  3RYH A;  4TUY B;  5CA1 A;  3CPW F;  3V7Q A;  1GX1 A;  2KTU A;  1UFY A;  3P10 A;  4I55 A;  3JAW B;  4RHA A;  3V4D A;  3VOA A;  1VQ4 F;  1CN7 A;  5HP7 A;  3FPI A;  2IQQ A;  4C8E A;  4TV8 B;  1W58 1;  2GLZ A;  3E20 B;  3CCJ F;  1YJ9 F;  4EI7 A;  3TD5 A;  4F6R B;  2Z1U A;  3S0Y A;  2ZF8 A;  3VCZ A;  3CCU F;  2LBX A;  4C8G A;  3CCL F;  5GON B;  3JVH A;  3LWP C;  4TV9 B;  3K0T A;  5MN6 A;  3G6E F;  4X1K B;  4YJ3 A;  3P0Z A;  2N48 A;  3NK6 A;  1T0A A;  2LBW A;  2ZVY A;  3IEW A;  3JAT A;  1GO1 A;  5MN4 A;  1XV2 A;  5IT9 M;  2L26 A;  4DXD A;  1W2B F;  3HKB A;  3ON1 A;  4U39 A;  5LYJ A;  4ZI7 B;  5LOV A;  3N2K A;  2EWC A;  1FSZ A;  2LBT A;  3HJW C;  2IG8 A;  4M8I A;  5LXT B;  3CCE F;  3CCQ F;  3CB2 A;  4KWE A;  2VAW A; 
#chains in the Genus database with same CATH homology
 2AIZ P;  3CYQ A;  4G4V A;  2N48 A;  2ZVY A;  2K1S A;  5EB1 B;  4ZHW A;  3IMP A;  4RHA A;  4G88 A;  5EB0 A;  4ZHV A;  3S02 A;  3S0W A;  4ZHY B;  2L26 A;  2ZOV A;  4B62 A;  4PWT A;  3S0H A;  2MQE A;  4G4W A;  4B5C A;  2LCA A;  4G4X A;  4ERH A;  1OAP A;  3WPW A;  3LDT A;  2LBT A;  3S06 A;  3OON A;  3TD5 A;  2W8B C;  3KHN A;  3CYP B;  1R1M A;  3S0Y A;  2ZF8 A;  4R40 B;  3TD3 A;  3TD4 A;  4G4Z A;  3S03 A;  2KGW A;  2ZVZ A;  4G4Y A;  5EAZ A;  3WPX A;  2HQS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...