4C8EA

Ispf (burkholderia cenocepacia) 2cmp complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
161
structure length
161
Chain Sequence
MDVRIGQGYDVHQLVEGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDAAFKGADSRVLLRACAERVKAAGFTIQNVDSTVIAQAPKLAPHIDGMRANIAADLGLPLERVNVKAKTNEKLGYLGRGEGIEAQAAALLVKQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Ispf from Plasmodium Falciparum and Burkholderia Cenocepacia: Comparisons Inform Antimicrobial Drug Target Assessment.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Lyase
molecule keywords 2-C-METHYL-D-ERYTHRITOL 2,4-CYCLODIPHOSPHATE SYNTHASE
total genus 49
structure length 161
sequence length 161
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 4c8eA00
3T80A 3RE3A 3IEQA 3K14A 3Q8HA 4C82A 3JVHA 3P10A 1IV3A 1U3LA 1YQNA 3KE1A 4C8EA 3EORA 4C81A 1U40A 1H48A 1W55A 1JY8A 1KNJA 1W57A 2AMTA 3ESJA 1IV2A 3QHDA 3F0FA 3F0GA 3FBAA 4C8GA 3IEWA 3B6NA 3MBMA 1KNKA 3IKEA 1IV1A 4C8IA 3FPIA 3IKFA 1H47A 2UZHA 3K2XA 3F0DA 3GHZA 1IV4A 1U3PA 1T0AA 1GX1A 1VHAA 2PMPA 3P0ZA 5B8FA 1JN1A 1VH8A 3ELCA 3F6MA 3ERNA 3F0EA 2GZLA 1U43A
chains in the Genus database with same CATH superfamily
2BO1A 5EIBD 3K14A 2JNBA 3KE1A 3CC2F 4PWTA 4U39A 2OZBA 5GIPC 3JARB 3LWQC 3CPWF 1UI9A 1Q86H 3JAKA 1VQKF 2L26A 3IEWA 4G4WA 3MBMA 3HKCB 3CCUF 3HKEA 2I6DA 4LNUA 3CC7F 2VGMA 4X20B 1YJWF 2QEXF 4YJ2A 3TD3A 1YI2F 1VQ6F 3HTNA 3R0PA 2IG8A 1ZWZA 3AGKA 2Z1FA 5HXUA 5JCOA 2W8BC 1X52A 3C9UA 5CB4A 3ZP4A 1GO0A 3T80A 3P4EA 3N2GA 5JH7B 1Q81H 4O2AA 3JVHA 3JAWA 3D01A 1RA4A 4X1YB 2HVYD 5IT9M 1R1MA 2VXYA 3HKCA 1JFFA 5EZYB 5KX5B 3M84A 4YJ2B 3FD5A 2Z1EA 3NK7A 1H47A 2UZHA 3PAFA 5EIBC 1U3PA 4I50B 1GX1A 1FFXB 2PMPA 2Z1UA 3LFOA 3WJQA 1SA0B 2LBXA 4O2AB 3D00A 3E22A 1JFFB 4LCKA 3TD5A 2AIFA 4C81A 3LWPC 5C8YA 1H48A 4O4IB 5J2UA 3CCSF 4X1KA 4BT5A 1N8RH 2GLZA 1XV2A 5CA0B 3FPIA 3VOAA 3KHNA 2P6YA 4U3JA 3WPWA 3WPXA 2CHTA 3JAKB 5EO3A 3JALB 4G4VA 1W581 3KIZA 1YJ9F 4WBNA 5JVDA 4TUYB 5GINC 5MN5A 1W5FA 3ERNA 3F0EA 3V4DA 2KTUA 5LP6C 1W3EX 3CB2A 2HP0A 5HY1A 5IYZA 1PXWA 1K8AH 5AVMA 3HKDA 3CYPB 3WGKA 4ZHWA 1JJ2F 4X3MA 4EI7A 4DXDA 3QTYA 5EB0A 1QVGF 3JCMM 3DDNA 1TVKA 3S03A 2QI2A 3RYFA 5ITZB 1S72F 1KC8H 2G9IA 1VQPF 3RYHB 3V3TA 5CB4B 1TUBB 4HNAB 2GZLA 1VQ7F 1FNKA 3I56F 2CHSA 3IEQA 1U43A 3TD4A 2IQQA 1GO1A 3E22B 1YIJF 3GYQA 1KNKA 3HAXD 2NMUA 4B46A 3WXMB 1W42A 4X1IB 4NWOB 3VYUC 3SIUA 4ZK7A 4X20A 3ELCA 4I4TA 1VQVA 2ZVYA 5EB1B 4DRXA 1W2BF 5HY4A 4BW0B 5HWEA 1VQ8F 4O4LB 5FNVB 1FNJA 3EORA 1Q82H 5LP6B 1Q8RA 5LYJA 1SZQA 3JATA 2ZOVA 3OBWA 2EWCA 2AMTA 3OONA 4X1YA 2OTMA 4BT7A 4BVQA 2Q1XA 3I3FA 5HP7A 3JARA 1J7HA 3FD6A 2HS0A 5HP8A 5KX5A 3F0DA 2IAFA 3G4SF 4ZHQA 5IJ9A 3WJPA 1H7MA 2AIZP 2LBWA 4O4HA 5HY2A 1PF5A 3VO8A 1NQ3A 3LDTA 3P10A 5J2TB 3ZO8A 2RHHA 1DT9A 3C8LA 4G4ZA 5LXTA 3N2KB 1RQ7A 5MN4A 5LOVB 3CCLF 1W59A 3S0WA 1IV1A 4TV9B 3OBYA 1NMUB 1W5BA 3JASB 2R6R1 1VQ9F 3CD6F 3HKBA 3LYBA 5B8FA 1CLIA 4BY9D 4X3LA 3RYIA 5JH7A 5JVDB 4WBNB 1K73H 1X25A 4ZOLB 2ZODA 3DC2A 4C4WC 3Q8HA 4XCQA 2HP0B 3VIUA 2HRYA 2ZVZA 4TV9A 4G4YA 3B6NA 1KD1H 4X1IA 3ON1A 3J7AR 3GHZA 1IV4A 3WJRA 1TVKB 5CA0A 2PHNA 1GZ0A 1W5EA 5LA6B 4YJ3A 4ZI7B 5EAZA 4ZHQB 3RYCA 2R751 4HNAA 4IIJB 3NMUC 2HQSC 3IMPA 1YITF 1QU9A 1Z5WA 2Q1YA 3S0HA 2HS3A 1VQ4F 3HKEB 4LNUB 3MDOA 3M1XA 1QAHA 1W40A 4O4JB 1VK3A 4BVSA 5IJ0A 3FFMA 5GIOC 4EB6A 3CMAF 4YJ3B 5CA1B 3KJJA 4TV8B 3WGMA 4I50A 1JN1A 2HS4A 4FFBB 3I55F 1CN7A 1CK2A 2UYNA 5HXZA 4RQOA 5EZYA 4BT6A 3CCMF 1Q7YH 2LBTA 3ESJA 1IV2A 3WGJA 1X7PA 3JASA 3U0OA 5KMGA 3UT5A 4C8IA 5CA1A 2UYJA 4X1KB 4TZZA 4F6RB 3S06A 2QTPA 4B5CA 1VQOF 3RYIB 5BMVB 1X7OA 4G88A 2FC3A 3N2GB 1W5AA 2CVLA 2Z1TA 2CWJA 3K0TA 1QD9A 1SA0A 4C82A 3VYTC 1NJIH 1U3LA 5A2QM 1VQLF 3RYCB 1JY8A 3ZOPA 2QA4F 4O4LA 1XHOA 3VCZA 3PLAC 2RB9A 3E1YA 4IHJB 3HKDB 2HX0A 4O2BB 4ZHYB 2N48A 4F6RA 2V9YA 3MCAB 3VI6A 1YJNF 4O4IA 3N2KA 2ZAUA 3JATB 3E20B 3N4ZA 5EWRA 3CG6A 2KGWA 3CPQA 3JALA 5FNVA 3V7QA 3CCRF 2VAMA 4EI8A 1RQ2A 4TV8A 2K1SA 5JQGB 2H6LA 4IHJA 1VQ5F 1XBIA 4FFBA 4O2BA 4EI9A 4ZOLA 2OTJF 2ALEA 5HY0A 4BVRA 3D54A 1DBFA 1M1KH 3QHDA 3F0FA 3F0GA 5IYZB 2CW4A 5EYPA 3IKEA 4BT4A 5IJ0B 5MN6A 2OTLF 4R40B 3LMEA 2BTUA 4TUYA 3LWVC 1ODEA 3WGNA 3O85A 5JCOC 3VOBA 3F6MA 3S0YA 3CMEF 5J2TA 3K12A 4G4XA 3HWUA 5LA6A 4ZI7A 1TUBA 4E6EA 1KQSF 1IV3A 3CCJF 2BTOA 3LWOC 1W57A 5KMGB 3MCQA 2UYPA 5C8YB 1IPAA 2OHWA 5G4VC 2BTQB 3IR9A 2UYKA 5DCVA 4RHAA 1COMA 3CXCF 4I4TB 4NQ3A 3VTIC 3HJWC 5GONB 1E7KA 4EB6B 4B62A 3L7QA 2MQEA 1YHQF 3C9SA 5LP6A 5J2UB 3QUWA 1K9MH 2LCAA 3J81M 2DT4A 1W55A 3CCVF 1T0KB 4ERHA 3CYQA 3S02A 2GVIA 3FBAA 3JAMM 1ONIA 5LXTB 1JD1A 5GONA 5IJ9B 1FFXA 5LOVA 3GTZA 2KTVA 3NVKE 1OFUA 2ZF8A 3MQWA 4O4JA 3RYFB 5ITZA 5FLXM 2WALA 4I55A 3ZP7A 3M4SA 3RA5A 1YGYA 3RE3A 5LYJB 4O4HB 3G6EF 3NK6A 1YQNA 2HRUA 4C8EA 2H8EA 5FJ4C 2UYNB 2VGNA 3KJKA 1VQNF 5G4UC 3NVIB 3C9TA 4C8GA 3G71F 2CSLA 3RYHA 1VQMF 1UFYA 3IKFA 3J80M 3SIVA 3VMFB 2HP3A 4M8IA 4I55B 2F9ZC 1QVFF 3JAWB 3N4YA 3RA6A 3BYQA 3LWRC 3CCQF 3WGLA 5BMVA 4BVTA 1W41A 2CZWA 1XRGA 2I6RA 5JQGA 5GANK 1RLUA 2Z01A 1U40A 4BT3A 4IIJA 1SDSA 2DYYA 1KNJA 2RHLA 2VAWA 3UT5B 4BT2A 2B33A 2RHJA 2YXZA 4ZHVA 4B45A 2YYEA 2VAPA 3CC4F 2RHOA 3HKBB 1RLGA 5EYPB 1Z5VA 3K2XA 3C9RA 3OW2F 3I7TA 1T0AA 1VHAA 4U3JB 1FSZA 3P0ZA 2KG4A 4DRXB 3CCEF 1OAPA 2H8CA 3V7EA 4KWEA 1VH8A 5GAPK 2FGYA 3VYSC 1M90H 4NUTA
chains in the Genus database with same CATH topology
3T80A 3RE3A 3IEQA 3K14A 3Q8HA 4C82A 3JVHA 3P10A 1IV3A 1U3LA 1YQNA 3KE1A 4C8EA 3EORA 4C81A 1U40A 1H48A 1W55A 1JY8A 1KNJA 1W57A 2AMTA 3ESJA 1IV2A 3QHDA 3F0FA 3F0GA 3FBAA 4C8GA 3IEWA 3B6NA 3MBMA 1KNKA 3IKEA 1IV1A 4C8IA 3FPIA 3IKFA 1H47A 2UZHA 3K2XA 3F0DA 3GHZA 1IV4A 1U3PA 1T0AA 1GX1A 1VHAA 2PMPA 3P0ZA 5B8FA 1JN1A 1VH8A 3ELCA 3F6MA 3ERNA 3F0EA 2GZLA 1U43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T80 A;  3RE3 A;  3IEQ A;  3K14 A;  3Q8H A;  4C82 A;  3JVH A;  3P10 A;  1IV3 A;  1U3L A;  1YQN A;  3KE1 A;  4C8E A;  3EOR A;  4C81 A;  1U40 A;  1H48 A;  1W55 A;  1JY8 A;  1KNJ A;  1W57 A;  2AMT A;  3ESJ A;  1IV2 A;  3QHD A;  3F0F A;  3F0G A;  3FBA A;  4C8G A;  3IEW A;  3B6N A;  3MBM A;  1KNK A;  3IKE A;  1IV1 A;  4C8I A;  3FPI A;  3IKF A;  1H47 A;  2UZH A;  3K2X A;  3F0D A;  3GHZ A;  1IV4 A;  1U3P A;  1T0A A;  1GX1 A;  1VHA A;  2PMP A;  3P0Z A;  5B8F A;  1JN1 A;  1VH8 A;  3ELC A;  3F6M A;  3ERN A;  3F0E A;  2GZL A;  1U43 A; 
#chains in the Genus database with same CATH topology
 2BO1 A;  5EIB D;  3K14 A;  2JNB A;  3KE1 A;  3CC2 F;  4PWT A;  4U39 A;  2OZB A;  5GIP C;  3JAR B;  3LWQ C;  3CPW F;  1UI9 A;  1Q86 H;  3JAK A;  1VQK F;  2L26 A;  3IEW A;  4G4W A;  3MBM A;  3HKC B;  3CCU F;  3HKE A;  2I6D A;  4LNU A;  3CC7 F;  2VGM A;  4X20 B;  1YJW F;  2QEX F;  4YJ2 A;  3TD3 A;  1YI2 F;  1VQ6 F;  3HTN A;  3R0P A;  2IG8 A;  1ZWZ A;  3AGK A;  2Z1F A;  5HXU A;  5JCO A;  2W8B C;  1X52 A;  3C9U A;  5CB4 A;  3ZP4 A;  1GO0 A;  3T80 A;  3P4E A;  3N2G A;  5JH7 B;  1Q81 H;  4O2A A;  3JVH A;  3JAW A;  3D01 A;  1RA4 A;  4X1Y B;  2HVY D;  5IT9 M;  1R1M A;  2VXY A;  3HKC A;  1JFF A;  5EZY B;  5KX5 B;  3M84 A;  4YJ2 B;  3FD5 A;  2Z1E A;  3NK7 A;  1H47 A;  2UZH A;  3PAF A;  5EIB C;  1U3P A;  4I50 B;  1GX1 A;  1FFX B;  2PMP A;  2Z1U A;  3LFO A;  3WJQ A;  1SA0 B;  2LBX A;  4O2A B;  3D00 A;  3E22 A;  1JFF B;  4LCK A;  3TD5 A;  2AIF A;  4C81 A;  3LWP C;  5C8Y A;  1H48 A;  4O4I B;  5J2U A;  3CCS F;  4X1K A;  4BT5 A;  1N8R H;  2GLZ A;  1XV2 A;  5CA0 B;  3FPI A;  3VOA A;  3KHN A;  2P6Y A;  4U3J A;  3WPW A;  3WPX A;  2CHT A;  3JAK B;  5EO3 A;  3JAL B;  4G4V A;  1W58 1;  3KIZ A;  1YJ9 F;  4WBN A;  5JVD A;  4TUY B;  5GIN C;  5MN5 A;  1W5F A;  3ERN A;  3F0E A;  3V4D A;  2KTU A;  5LP6 C;  1W3E X;  3CB2 A;  2HP0 A;  5HY1 A;  5IYZ A;  1PXW A;  1K8A H;  5AVM A;  3HKD A;  3CYP B;  3WGK A;  4ZHW A;  1JJ2 F;  4X3M A;  4EI7 A;  4DXD A;  3QTY A;  5EB0 A;  1QVG F;  3JCM M;  3DDN A;  1TVK A;  3S03 A;  2QI2 A;  3RYF A;  5ITZ B;  1S72 F;  1KC8 H;  2G9I A;  1VQP F;  3RYH B;  3V3T A;  5CB4 B;  1TUB B;  4HNA B;  2GZL A;  1VQ7 F;  1FNK A;  3I56 F;  2CHS A;  3IEQ A;  1U43 A;  3TD4 A;  2IQQ A;  1GO1 A;  3E22 B;  1YIJ F;  3GYQ A;  1KNK A;  3HAX D;  2NMU A;  4B46 A;  3WXM B;  1W42 A;  4X1I B;  4NWO B;  3VYU C;  3SIU A;  4ZK7 A;  4X20 A;  3ELC A;  4I4T A;  1VQV A;  2ZVY A;  5EB1 B;  4DRX A;  1W2B F;  5HY4 A;  4BW0 B;  5HWE A;  1VQ8 F;  4O4L B;  5FNV B;  1FNJ A;  3EOR A;  1Q82 H;  5LP6 B;  1Q8R A;  5LYJ A;  1SZQ A;  3JAT A;  2ZOV A;  3OBW A;  2EWC A;  2AMT A;  3OON A;  4X1Y A;  2OTM A;  4BT7 A;  4BVQ A;  2Q1X A;  3I3F A;  5HP7 A;  3JAR A;  1J7H A;  3FD6 A;  2HS0 A;  5HP8 A;  5KX5 A;  3F0D A;  2IAF A;  3G4S F;  4ZHQ A;  5IJ9 A;  3WJP A;  1H7M A;  2AIZ P;  2LBW A;  4O4H A;  5HY2 A;  1PF5 A;  3VO8 A;  1NQ3 A;  3LDT A;  3P10 A;  5J2T B;  3ZO8 A;  2RHH A;  1DT9 A;  3C8L A;  4G4Z A;  5LXT A;  3N2K B;  1RQ7 A;  5MN4 A;  5LOV B;  3CCL F;  1W59 A;  3S0W A;  1IV1 A;  4TV9 B;  3OBY A;  1NMU B;  1W5B A;  3JAS B;  2R6R 1;  1VQ9 F;  3CD6 F;  3HKB A;  3LYB A;  5B8F A;  1CLI A;  4BY9 D;  4X3L A;  3RYI A;  5JH7 A;  5JVD B;  4WBN B;  1K73 H;  1X25 A;  4ZOL B;  2ZOD A;  3DC2 A;  4C4W C;  3Q8H A;  4XCQ A;  2HP0 B;  3VIU A;  2HRY A;  2ZVZ A;  4TV9 A;  4G4Y A;  3B6N A;  1KD1 H;  4X1I A;  3ON1 A;  3J7A R;  3GHZ A;  1IV4 A;  3WJR A;  1TVK B;  5CA0 A;  2PHN A;  1GZ0 A;  1W5E A;  5LA6 B;  4YJ3 A;  4ZI7 B;  5EAZ A;  4ZHQ B;  3RYC A;  2R75 1;  4HNA A;  4IIJ B;  3NMU C;  2HQS C;  3IMP A;  1YIT F;  1QU9 A;  1Z5W A;  2Q1Y A;  3S0H A;  2HS3 A;  1VQ4 F;  3HKE B;  4LNU B;  3MDO A;  3M1X A;  1QAH A;  1W40 A;  4O4J B;  1VK3 A;  4BVS A;  5IJ0 A;  3FFM A;  5GIO C;  4EB6 A;  3CMA F;  4YJ3 B;  5CA1 B;  3KJJ A;  4TV8 B;  3WGM A;  4I50 A;  1JN1 A;  2HS4 A;  4FFB B;  3I55 F;  1CN7 A;  1CK2 A;  2UYN A;  5HXZ A;  4RQO A;  5EZY A;  4BT6 A;  3CCM F;  1Q7Y H;  2LBT A;  3ESJ A;  1IV2 A;  3WGJ A;  1X7P A;  3JAS A;  3U0O A;  5KMG A;  3UT5 A;  4C8I A;  5CA1 A;  2UYJ A;  4X1K B;  4TZZ A;  4F6R B;  3S06 A;  2QTP A;  4B5C A;  1VQO F;  3RYI B;  5BMV B;  1X7O A;  4G88 A;  2FC3 A;  3N2G B;  1W5A A;  2CVL A;  2Z1T A;  2CWJ A;  3K0T A;  1QD9 A;  1SA0 A;  4C82 A;  3VYT C;  1NJI H;  1U3L A;  5A2Q M;  1VQL F;  3RYC B;  1JY8 A;  3ZOP A;  2QA4 F;  4O4L A;  1XHO A;  3VCZ A;  3PLA C;  2RB9 A;  3E1Y A;  4IHJ B;  3HKD B;  2HX0 A;  4O2B B;  4ZHY B;  2N48 A;  4F6R A;  2V9Y A;  3MCA B;  3VI6 A;  1YJN F;  4O4I A;  3N2K A;  2ZAU A;  3JAT B;  3E20 B;  3N4Z A;  5EWR A;  3CG6 A;  2KGW A;  3CPQ A;  3JAL A;  5FNV A;  3V7Q A;  3CCR F;  2VAM A;  4EI8 A;  1RQ2 A;  4TV8 A;  2K1S A;  5JQG B;  2H6L A;  4IHJ A;  1VQ5 F;  1XBI A;  4FFB A;  4O2B A;  4EI9 A;  4ZOL A;  2OTJ F;  2ALE A;  5HY0 A;  4BVR A;  3D54 A;  1DBF A;  1M1K H;  3QHD A;  3F0F A;  3F0G A;  5IYZ B;  2CW4 A;  5EYP A;  3IKE A;  4BT4 A;  5IJ0 B;  5MN6 A;  2OTL F;  4R40 B;  3LME A;  2BTU A;  4TUY A;  3LWV C;  1ODE A;  3WGN A;  3O85 A;  5JCO C;  3VOB A;  3F6M A;  3S0Y A;  3CME F;  5J2T A;  3K12 A;  4G4X A;  3HWU A;  5LA6 A;  4ZI7 A;  1TUB A;  4E6E A;  1KQS F;  1IV3 A;  3CCJ F;  2BTO A;  3LWO C;  1W57 A;  5KMG B;  3MCQ A;  2UYP A;  5C8Y B;  1IPA A;  2OHW A;  5G4V C;  2BTQ B;  3IR9 A;  2UYK A;  5DCV A;  4RHA A;  1COM A;  3CXC F;  4I4T B;  4NQ3 A;  3VTI C;  3HJW C;  5GON B;  1E7K A;  4EB6 B;  4B62 A;  3L7Q A;  2MQE A;  1YHQ F;  3C9S A;  5LP6 A;  5J2U B;  3QUW A;  1K9M H;  2LCA A;  3J81 M;  2DT4 A;  1W55 A;  3CCV F;  1T0K B;  4ERH A;  3CYQ A;  3S02 A;  2GVI A;  3FBA A;  3JAM M;  1ONI A;  5LXT B;  1JD1 A;  5GON A;  5IJ9 B;  1FFX A;  5LOV A;  3GTZ A;  2KTV A;  3NVK E;  1OFU A;  2ZF8 A;  3MQW A;  4O4J A;  3RYF B;  5ITZ A;  5FLX M;  2WAL A;  4I55 A;  3ZP7 A;  3M4S A;  3RA5 A;  1YGY A;  3RE3 A;  5LYJ B;  4O4H B;  3G6E F;  3NK6 A;  1YQN A;  2HRU A;  4C8E A;  2H8E A;  5FJ4 C;  2UYN B;  2VGN A;  3KJK A;  1VQN F;  5G4U C;  3NVI B;  3C9T A;  4C8G A;  3G71 F;  2CSL A;  3RYH A;  1VQM F;  1UFY A;  3IKF A;  3J80 M;  3SIV A;  3VMF B;  2HP3 A;  4M8I A;  4I55 B;  2F9Z C;  1QVF F;  3JAW B;  3N4Y A;  3RA6 A;  3BYQ A;  3LWR C;  3CCQ F;  3WGL A;  5BMV A;  4BVT A;  1W41 A;  2CZW A;  1XRG A;  2I6R A;  5JQG A;  5GAN K;  1RLU A;  2Z01 A;  1U40 A;  4BT3 A;  4IIJ A;  1SDS A;  2DYY A;  1KNJ A;  2RHL A;  2VAW A;  3UT5 B;  4BT2 A;  2B33 A;  2RHJ A;  2YXZ A;  4ZHV A;  4B45 A;  2YYE A;  2VAP A;  3CC4 F;  2RHO A;  3HKB B;  1RLG A;  5EYP B;  1Z5V A;  3K2X A;  3C9R A;  3OW2 F;  3I7T A;  1T0A A;  1VHA A;  4U3J B;  1FSZ A;  3P0Z A;  2KG4 A;  4DRX B;  3CCE F;  1OAP A;  2H8C A;  3V7E A;  4KWE A;  1VH8 A;  5GAP K;  2FGY A;  3VYS C;  1M90 H;  4NUT A; 
#chains in the Genus database with same CATH homology
 3T80 A;  3RE3 A;  3IEQ A;  3K14 A;  3Q8H A;  4C82 A;  3JVH A;  3P10 A;  1IV3 A;  1U3L A;  1YQN A;  3KE1 A;  4C8E A;  3EOR A;  4C81 A;  1U40 A;  1H48 A;  1W55 A;  1JY8 A;  1KNJ A;  1W57 A;  2AMT A;  3ESJ A;  1IV2 A;  3QHD A;  3F0F A;  3F0G A;  3FBA A;  4C8G A;  3IEW A;  3B6N A;  3MBM A;  1KNK A;  3IKE A;  1IV1 A;  4C8I A;  3FPI A;  3IKF A;  1H47 A;  2UZH A;  3K2X A;  3F0D A;  3GHZ A;  1IV4 A;  1U3P A;  1T0A A;  1GX1 A;  1VHA A;  2PMP A;  3P0Z A;  5B8F A;  1JN1 A;  1VH8 A;  3ELC A;  3F6M A;  3ERN A;  3F0E A;  2GZL A;  1U43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...