4C8EA

Ispf (burkholderia cenocepacia) 2cmp complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
161
structure length
161
Chain Sequence
b'MDVRIGQGYDVHQLVEGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDAAFKGADSRVLLRACAERVKAAGFTIQNVDSTVIAQAPKLAPHIDGMRANIAADLGLPLERVNVKAKTNEKLGYLGRGEGIEAQAAALLVKQGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-METHYL-D-ERYTHRITOL 2,4-CYCLODIPHOSPHATE SYNTHASE
molecule tags Lyase
source organism Burkholderia cenocepacia
publication title Crystal Structures of Ispf from Plasmodium Falciparum and Burkholderia Cenocepacia: Comparisons Inform Antimicrobial Drug Target Assessment.
pubmed doi rcsb
total genus 49
structure length 161
sequence length 161
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 4c8eA00
3F0EA 3KE1A 3K14A 1YQNA 3FPIA 3F0FA 1JY8A 3IEQA 1IV1A 1W55A 3P0ZA 3ELCA 3B6NA 4C8EA 4C8IA 1W57A 1JN1A 1U3LA 1IV3A 3F0DA 3IEWA 1VHAA 1GX1A 3K2XA 1VH8A 2GZLA 3FBAA 5B8FA 3T80A 2PMPA 1KNKA 2UZHA 3Q8HA 3P10A 1U43A 1IV2A 1H48A 3IKFA 3RE3A 4C82A 1T0AA 1IV4A 3IKEA 1KNJA 3EORA 4C81A 3ERNA 3GHZA 3QHDA 4C8GA 3JVHA 1H47A 2AMTA 3MBMA 1U40A 3F0GA 3ESJA 1U3PA 3F6MA
chains in the Genus database with same CATH superfamily
1R1MA 1RLUA 3E22B 3JAWA 5AVMA 2RHOA 4ZI7A 4IHJA 3OBYA 3RYIA 2I6RA 3F0DA 4TUYB 5JQGB 2VAWA 3I55F 2PHNA 4BVRA 2ZODA 1PF5A 3Q8HA 3S0HA 1YGYA 5CA0B 3VYSC 3CCJF 4G4WA 2VGMA 3JASA 3K12A 2ZAUA 3E1YA 2KG4A 5KMGA 3HAXD 3M4SA 3WXMB 1KQSF 3WPWA 3IR9A 2K1SA 5G4UC 4U39A 1W42A 5HY0A 4I55A 2YYEA 3L7QA 2BTOA 5EB1B 5JCOA 1YJNF 2RB9A 1FNJA 1YITF 2OTLF 4TUYA 5HXUA 4RQOA 5EAZA 3LDTA 4YJ2A 4LCKA 3RA5A 1K9MH 4O4JA 3HKEA 3I3FA 1Q82H 2UYKA 5EWRA 3G4SF 1X7PA 5J2UB 2I6DA 3QHDA 4R40B 3VYUC 1H47A 1SDSA 3HKBB 2CHSA 4B45A 2VXYA 4M8IA 1S72F 3N2GB 3M84A 3CYPB 3CC4F 1W3EX 3G6EF 1ONIA 1X52A 3NVIB 2KTUA 1Q81H 1KD1H 3GYQA 2KTVA 3S03A 5JH7A 1U43A 5LXTB 3CCSF 4C82A 3SIVA 4X1IB 4DRXB 3FD5A 1XV2A 3D01A 3CPWF 3RYFA 2Z1UA 1N8RH 1VQ4F 1QU9A 4EI8A 4O4LA 3HJWC 3JATB 1XHOA 5EO3A 3LYBA 1W55A 4C8EA 1W57A 2FGYA 5ITZA 4HNAA 2CZWA 4TZZA 2Z1FA 2HS4A 4G4VA 2KGWA 2CVLA 5EZYB 2H8CA 4ZHYB 3HKDA 1OFUA 1XBIA 3U0OA 5GONB 3HKEB 4BVQA 5HXZA 5GONA 2HP3A 5IJ0A 4PWTA 3WGNA 3JAKA 1RQ7A 2JNBA 5BMVA 1NQ3A 4HNAB 3VMFB 4I4TB 1IV1A 1T0KB 2BTQB 3M1XA 5CA1B 3VOAA 3LWQC 2OHWA 3R0PA 5MN5A 4IIJA 5JVDB 3P10A 2Z01A 1QVGF 1W5BA 2DYYA 3SIUA 1FFXA 2QA4F 2ALEA 2HQSC 4X1IA 1QD9A 1VQ8F 2OZBA 3WGKA 5CA0A 4BT4A 4BY9D 3LFOA 5C8YB 4ZOLA 4EB6B 5JH7B 5LXTA 3CG6A 3N2KA 1U3PA 3ZO8A 4ZOLB 4EB6A 5JQGA 2Q1XA 5LP6B 1SZQA 1W41A 4O2BA 5LOVB 3LWRC 3C9TA 3J7AR 1SA0A 1COMA 5EZYA 3T80A 1KNKA 2ZF8A 4O2AB 3AGKA 3C9SA 3D00A 4YJ3B 1IV2A 5IT9M 2V9YA 3TD3A 5J2TA 4G4YA 4BW0B 3CCEF 1KNJA 5J2TB 4O4JB 5FLXM 3MBMA 1JD1A 3ZP7A 3CCRF 4X1YB 4ZHWA 1VQ5F 2VAPA 5HP7A 3B6NA 3VO8A 2HRUA 3CCVF 4FFBB 1GX1A 3S02A 2CWJA 3KHNA 3FBAA 2P6YA 1TUBB 5KX5A 1W40A 5GAPK 1FFXB 2CSLA 1VQPF 3JASB 1K73H 4I50B 1OAPA 5C8YA 2AMTA 4X3LA 4O4LB 2LCAA 3JARB 3ESJA 3JCMM 3RYFB 2ZVYA 4X1KA 4LNUA 5JCOC 3IMPA 3VCZA 5LYJA 3NK6A 2Z1EA 5CA1A 3FFMA 1GO0A 4B62A 5GIOC 3CCLF 3ZOPA 1VH8A 1M90H 4RHAA 2HRYA 1QAHA 3CPQA 4NUTA 1H48A 3IKFA 5KX5B 3C9RA 5IYZA 1YIJF 3N2GA 3ERNA 5EB0A 4B5CA 5A2QM 3J80M 3LWVC 3QUWA 1VQNF 5GINC 1W5FA 3CCMF 1VQ7F 2UYPA 3OBWA 3V7QA 2UYNA 4BVSA 1FSZA 1IPAA 3F0EA 5KMGB 5LP6C 1Z5VA 1RLGA 3RYCA 2RHHA 1VQMF 4YJ2B 4ZHQA 3CMEF 4G4XA 4BVTA 4O4HA 5FNVA 3CC2F 2HVYD 3JAKB 1CLIA 3EORA 3HKCA 2QEXF 4E6EA 2HP0A 1X7OA 3JVHA 3WJPA 4EI7A 3GTZA 3PLAC 3CXCF 3J81M 3F0GA 3HTNA 3K14A 2OTJF 3RYHB 3JALA 1PXWA 3LWOC 3V7EA 5ITZB 1QVFF 2DT4A 3VIUA 1W2BF 1DT9A 2PMPA 2UZHA 1J7HA 3D54A 3I56F 3N4ZA 4X20A 1Q86H 1VK3A 4BT6A 3E20B 2BTUA 2HS3A 4BT2A 3JAMM 1UI9A 2R6R1 5HY2A 3ON1A 1U40A 5HWEA 3CCUF 1X25A 3BYQA 4ZK7A 4BT3A 1JY8A 2ZOVA 5GANK 3CYQA 3WGLA 3UT5B 5CB4B 4I55B 3VI6A 1IV3A 1CK2A 1KC8H 2RHLA 3HWUA 3RYCB 1CN7A 2AIZP 4TV8A 2VAMA 2CHTA 3LMEA 5EIBD 2OTMA 4TV9B 3CCQF 3MCAB 1NMUB 2B33A 3TD4A 1VQVA 2Z1TA 3MDOA 5J2UA 4KWEA 5LOVA 3KJKA 2UYNB 5IYZB 5LP6A 1M1KH 4O4IA 4NQ3A 2IG8A 1JFFA 1FNKA 1GZ0A 1W581 2VGNA 5IJ9B 3OW2F 3S0WA 3CC7F 2ZVZA 5FNVB 1XRGA 3E22A 3JAWB 3TD5A 3V4DA 1W59A 3C9UA 4O4HB 3VTIC 3RE3A 2H8EA 3MQWA 3S0YA 4F6RA 4ZHQB 1Z5WA 1RQ2A 1E7KA 2LBTA 4ZHVA 4I50A 4X1KB 4YJ3A 4U3JB 3G71F 1YJWF 3F6MA 5HY4A 5IJ9A 3FPIA 2LBXA 3JALB 3NMUC 3CD6F 3RYHA 3HKBA 1U3LA 3FD6A 1VHAA 2N48A 4FFBA 3RYIB 3KIZA 4BT7A 1VQOF 2HP0B 4WBNB 2CW4A 2GLZA 2RHJA 1W5AA 3C8LA 2W8BC 2Q1YA 3N2KB 4NWOB 4LNUB 4C8GA 2NMUA 3JARA 2EWCA 2AIFA 5EYPA 1ODEA 3DDNA 3RA6A 1VQ9F 3CB2A 3DC2A 3IEQA 3P0ZA 3ELCA 3UT5A 5CB4A 5EYPB 1SA0B 3S06A 4I4TA 4WBNA 4O2BB 2GZLA 4G88A 4O2AA 5B8FA 3K0TA 5DCVA 5LA6B 1H7MA 3PAFA 5MN4A 1DBFA 1JFFB 1IV4A 1GO1A 1TUBA 2G9IA 3IKEA 3VYTC 1YHQF 1Q7YH 4C81A 1JJ2F 4G4ZA 3N4YA 1ZWZA 5LA6A 5MN6A 3MCQA 5IJ0B 4IHJB 2IAFA 4U3JA 5GIPC 3WGJA 3F0FA 5LYJB 4X1YA 1VQLF 1W5EA 4C4WC 2L26A 2WALA 5HY1A 2BO1A 3IEWA 3ZP4A 3WJQA 3K2XA 3JATA 3WPXA 4DXDA 4IIJB 5JVDA 3LWPC 5FJ4C 2R751 5G4VC 3P4EA 4TV8B 1VQKF 3QTYA 2QI2A 1T0AA 2HS0A 1TVKA 3HKCB 3I7TA 3WGMA 1YJ9F 2IQQA 4DRXA 1Q8RA 3CMAF 4O4IB 2YXZA 4XCQA 3KE1A 1YQNA 3NVKE 2HX0A 2LBWA 4BT5A 3V3TA 4C8IA 4X3MA 2FC3A 1JN1A 3OONA 3VOBA 4X20B 3O85A 2QTPA 4TV9A 1K8AH 3HKDB 3KJJA 1YI2F 5EIBC 1TVKB 1UFYA 2UYJA 5HP8A 2F9ZC 2GVIA 4ERHA 4EI9A 2MQEA 1RA4A 3GHZA 1VQ6F 5BMVB 1NJIH 3WJRA 3NK7A 4B46A 4F6RB 4ZI7B 2H6LA
chains in the Genus database with same CATH topology
3F0EA 3KE1A 3K14A 1YQNA 3FPIA 3F0FA 1JY8A 3IEQA 1IV1A 1W55A 3P0ZA 3ELCA 3B6NA 4C8EA 4C8IA 1W57A 1JN1A 1U3LA 1IV3A 3F0DA 3IEWA 1VHAA 1GX1A 3K2XA 1VH8A 2GZLA 3FBAA 5B8FA 3T80A 2PMPA 1KNKA 2UZHA 3Q8HA 3P10A 1U43A 1IV2A 1H48A 3IKFA 3RE3A 4C82A 1T0AA 1IV4A 3IKEA 1KNJA 3EORA 4C81A 3ERNA 3GHZA 3QHDA 4C8GA 3JVHA 1H47A 2AMTA 3MBMA 1U40A 3F0GA 3ESJA 1U3PA 3F6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0E A;  3KE1 A;  3K14 A;  1YQN A;  3FPI A;  3F0F A;  1JY8 A;  3IEQ A;  1IV1 A;  1W55 A;  3P0Z A;  3ELC A;  3B6N A;  4C8E A;  4C8I A;  1W57 A;  1JN1 A;  1U3L A;  1IV3 A;  3F0D A;  3IEW A;  1VHA A;  1GX1 A;  3K2X A;  1VH8 A;  2GZL A;  3FBA A;  5B8F A;  3T80 A;  2PMP A;  1KNK A;  2UZH A;  3Q8H A;  3P10 A;  1U43 A;  1IV2 A;  1H48 A;  3IKF A;  3RE3 A;  4C82 A;  1T0A A;  1IV4 A;  3IKE A;  1KNJ A;  3EOR A;  4C81 A;  3ERN A;  3GHZ A;  3QHD A;  4C8G A;  3JVH A;  1H47 A;  2AMT A;  3MBM A;  1U40 A;  3F0G A;  3ESJ A;  1U3P A;  3F6M A; 
#chains in the Genus database with same CATH topology
 1R1M A;  1RLU A;  3E22 B;  3JAW A;  5AVM A;  2RHO A;  4ZI7 A;  4IHJ A;  3OBY A;  3RYI A;  2I6R A;  3F0D A;  4TUY B;  5JQG B;  2VAW A;  3I55 F;  2PHN A;  4BVR A;  2ZOD A;  1PF5 A;  3Q8H A;  3S0H A;  1YGY A;  5CA0 B;  3VYS C;  3CCJ F;  4G4W A;  2VGM A;  3JAS A;  3K12 A;  2ZAU A;  3E1Y A;  2KG4 A;  5KMG A;  3HAX D;  3M4S A;  3WXM B;  1KQS F;  3WPW A;  3IR9 A;  2K1S A;  5G4U C;  4U39 A;  1W42 A;  5HY0 A;  4I55 A;  2YYE A;  3L7Q A;  2BTO A;  5EB1 B;  5JCO A;  1YJN F;  2RB9 A;  1FNJ A;  1YIT F;  2OTL F;  4TUY A;  5HXU A;  4RQO A;  5EAZ A;  3LDT A;  4YJ2 A;  4LCK A;  3RA5 A;  1K9M H;  4O4J A;  3HKE A;  3I3F A;  1Q82 H;  2UYK A;  5EWR A;  3G4S F;  1X7P A;  5J2U B;  2I6D A;  3QHD A;  4R40 B;  3VYU C;  1H47 A;  1SDS A;  3HKB B;  2CHS A;  4B45 A;  2VXY A;  4M8I A;  1S72 F;  3N2G B;  3M84 A;  3CYP B;  3CC4 F;  1W3E X;  3G6E F;  1ONI A;  1X52 A;  3NVI B;  2KTU A;  1Q81 H;  1KD1 H;  3GYQ A;  2KTV A;  3S03 A;  5JH7 A;  1U43 A;  5LXT B;  3CCS F;  4C82 A;  3SIV A;  4X1I B;  4DRX B;  3FD5 A;  1XV2 A;  3D01 A;  3CPW F;  3RYF A;  2Z1U A;  1N8R H;  1VQ4 F;  1QU9 A;  4EI8 A;  4O4L A;  3HJW C;  3JAT B;  1XHO A;  5EO3 A;  3LYB A;  1W55 A;  4C8E A;  1W57 A;  2FGY A;  5ITZ A;  4HNA A;  2CZW A;  4TZZ A;  2Z1F A;  2HS4 A;  4G4V A;  2KGW A;  2CVL A;  5EZY B;  2H8C A;  4ZHY B;  3HKD A;  1OFU A;  1XBI A;  3U0O A;  5GON B;  3HKE B;  4BVQ A;  5HXZ A;  5GON A;  2HP3 A;  5IJ0 A;  4PWT A;  3WGN A;  3JAK A;  1RQ7 A;  2JNB A;  5BMV A;  1NQ3 A;  4HNA B;  3VMF B;  4I4T B;  1IV1 A;  1T0K B;  2BTQ B;  3M1X A;  5CA1 B;  3VOA A;  3LWQ C;  2OHW A;  3R0P A;  5MN5 A;  4IIJ A;  5JVD B;  3P10 A;  2Z01 A;  1QVG F;  1W5B A;  2DYY A;  3SIU A;  1FFX A;  2QA4 F;  2ALE A;  2HQS C;  4X1I A;  1QD9 A;  1VQ8 F;  2OZB A;  3WGK A;  5CA0 A;  4BT4 A;  4BY9 D;  3LFO A;  5C8Y B;  4ZOL A;  4EB6 B;  5JH7 B;  5LXT A;  3CG6 A;  3N2K A;  1U3P A;  3ZO8 A;  4ZOL B;  4EB6 A;  5JQG A;  2Q1X A;  5LP6 B;  1SZQ A;  1W41 A;  4O2B A;  5LOV B;  3LWR C;  3C9T A;  3J7A R;  1SA0 A;  1COM A;  5EZY A;  3T80 A;  1KNK A;  2ZF8 A;  4O2A B;  3AGK A;  3C9S A;  3D00 A;  4YJ3 B;  1IV2 A;  5IT9 M;  2V9Y A;  3TD3 A;  5J2T A;  4G4Y A;  4BW0 B;  3CCE F;  1KNJ A;  5J2T B;  4O4J B;  5FLX M;  3MBM A;  1JD1 A;  3ZP7 A;  3CCR F;  4X1Y B;  4ZHW A;  1VQ5 F;  2VAP A;  5HP7 A;  3B6N A;  3VO8 A;  2HRU A;  3CCV F;  4FFB B;  1GX1 A;  3S02 A;  2CWJ A;  3KHN A;  3FBA A;  2P6Y A;  1TUB B;  5KX5 A;  1W40 A;  5GAP K;  1FFX B;  2CSL A;  1VQP F;  3JAS B;  1K73 H;  4I50 B;  1OAP A;  5C8Y A;  2AMT A;  4X3L A;  4O4L B;  2LCA A;  3JAR B;  3ESJ A;  3JCM M;  3RYF B;  2ZVY A;  4X1K A;  4LNU A;  5JCO C;  3IMP A;  3VCZ A;  5LYJ A;  3NK6 A;  2Z1E A;  5CA1 A;  3FFM A;  1GO0 A;  4B62 A;  5GIO C;  3CCL F;  3ZOP A;  1VH8 A;  1M90 H;  4RHA A;  2HRY A;  1QAH A;  3CPQ A;  4NUT A;  1H48 A;  3IKF A;  5KX5 B;  3C9R A;  5IYZ A;  1YIJ F;  3N2G A;  3ERN A;  5EB0 A;  4B5C A;  5A2Q M;  3J80 M;  3LWV C;  3QUW A;  1VQN F;  5GIN C;  1W5F A;  3CCM F;  1VQ7 F;  2UYP A;  3OBW A;  3V7Q A;  2UYN A;  4BVS A;  1FSZ A;  1IPA A;  3F0E A;  5KMG B;  5LP6 C;  1Z5V A;  1RLG A;  3RYC A;  2RHH A;  1VQM F;  4YJ2 B;  4ZHQ A;  3CME F;  4G4X A;  4BVT A;  4O4H A;  5FNV A;  3CC2 F;  2HVY D;  3JAK B;  1CLI A;  3EOR A;  3HKC A;  2QEX F;  4E6E A;  2HP0 A;  1X7O A;  3JVH A;  3WJP A;  4EI7 A;  3GTZ A;  3PLA C;  3CXC F;  3J81 M;  3F0G A;  3HTN A;  3K14 A;  2OTJ F;  3RYH B;  3JAL A;  1PXW A;  3LWO C;  3V7E A;  5ITZ B;  1QVF F;  2DT4 A;  3VIU A;  1W2B F;  1DT9 A;  2PMP A;  2UZH A;  1J7H A;  3D54 A;  3I56 F;  3N4Z A;  4X20 A;  1Q86 H;  1VK3 A;  4BT6 A;  3E20 B;  2BTU A;  2HS3 A;  4BT2 A;  3JAM M;  1UI9 A;  2R6R 1;  5HY2 A;  3ON1 A;  1U40 A;  5HWE A;  3CCU F;  1X25 A;  3BYQ A;  4ZK7 A;  4BT3 A;  1JY8 A;  2ZOV A;  5GAN K;  3CYQ A;  3WGL A;  3UT5 B;  5CB4 B;  4I55 B;  3VI6 A;  1IV3 A;  1CK2 A;  1KC8 H;  2RHL A;  3HWU A;  3RYC B;  1CN7 A;  2AIZ P;  4TV8 A;  2VAM A;  2CHT A;  3LME A;  5EIB D;  2OTM A;  4TV9 B;  3CCQ F;  3MCA B;  1NMU B;  2B33 A;  3TD4 A;  1VQV A;  2Z1T A;  3MDO A;  5J2U A;  4KWE A;  5LOV A;  3KJK A;  2UYN B;  5IYZ B;  5LP6 A;  1M1K H;  4O4I A;  4NQ3 A;  2IG8 A;  1JFF A;  1FNK A;  1GZ0 A;  1W58 1;  2VGN A;  5IJ9 B;  3OW2 F;  3S0W A;  3CC7 F;  2ZVZ A;  5FNV B;  1XRG A;  3E22 A;  3JAW B;  3TD5 A;  3V4D A;  1W59 A;  3C9U A;  4O4H B;  3VTI C;  3RE3 A;  2H8E A;  3MQW A;  3S0Y A;  4F6R A;  4ZHQ B;  1Z5W A;  1RQ2 A;  1E7K A;  2LBT A;  4ZHV A;  4I50 A;  4X1K B;  4YJ3 A;  4U3J B;  3G71 F;  1YJW F;  3F6M A;  5HY4 A;  5IJ9 A;  3FPI A;  2LBX A;  3JAL B;  3NMU C;  3CD6 F;  3RYH A;  3HKB A;  1U3L A;  3FD6 A;  1VHA A;  2N48 A;  4FFB A;  3RYI B;  3KIZ A;  4BT7 A;  1VQO F;  2HP0 B;  4WBN B;  2CW4 A;  2GLZ A;  2RHJ A;  1W5A A;  3C8L A;  2W8B C;  2Q1Y A;  3N2K B;  4NWO B;  4LNU B;  4C8G A;  2NMU A;  3JAR A;  2EWC A;  2AIF A;  5EYP A;  1ODE A;  3DDN A;  3RA6 A;  1VQ9 F;  3CB2 A;  3DC2 A;  3IEQ A;  3P0Z A;  3ELC A;  3UT5 A;  5CB4 A;  5EYP B;  1SA0 B;  3S06 A;  4I4T A;  4WBN A;  4O2B B;  2GZL A;  4G88 A;  4O2A A;  5B8F A;  3K0T A;  5DCV A;  5LA6 B;  1H7M A;  3PAF A;  5MN4 A;  1DBF A;  1JFF B;  1IV4 A;  1GO1 A;  1TUB A;  2G9I A;  3IKE A;  3VYT C;  1YHQ F;  1Q7Y H;  4C81 A;  1JJ2 F;  4G4Z A;  3N4Y A;  1ZWZ A;  5LA6 A;  5MN6 A;  3MCQ A;  5IJ0 B;  4IHJ B;  2IAF A;  4U3J A;  5GIP C;  3WGJ A;  3F0F A;  5LYJ B;  4X1Y A;  1VQL F;  1W5E A;  4C4W C;  2L26 A;  2WAL A;  5HY1 A;  2BO1 A;  3IEW A;  3ZP4 A;  3WJQ A;  3K2X A;  3JAT A;  3WPX A;  4DXD A;  4IIJ B;  5JVD A;  3LWP C;  5FJ4 C;  2R75 1;  5G4V C;  3P4E A;  4TV8 B;  1VQK F;  3QTY A;  2QI2 A;  1T0A A;  2HS0 A;  1TVK A;  3HKC B;  3I7T A;  3WGM A;  1YJ9 F;  2IQQ A;  4DRX A;  1Q8R A;  3CMA F;  4O4I B;  2YXZ A;  4XCQ A;  3KE1 A;  1YQN A;  3NVK E;  2HX0 A;  2LBW A;  4BT5 A;  3V3T A;  4C8I A;  4X3M A;  2FC3 A;  1JN1 A;  3OON A;  3VOB A;  4X20 B;  3O85 A;  2QTP A;  4TV9 A;  1K8A H;  3HKD B;  3KJJ A;  1YI2 F;  5EIB C;  1TVK B;  1UFY A;  2UYJ A;  5HP8 A;  2F9Z C;  2GVI A;  4ERH A;  4EI9 A;  2MQE A;  1RA4 A;  3GHZ A;  1VQ6 F;  5BMV B;  1NJI H;  3WJR A;  3NK7 A;  4B46 A;  4F6R B;  4ZI7 B;  2H6L A; 
#chains in the Genus database with same CATH homology
 3F0E A;  3KE1 A;  3K14 A;  1YQN A;  3FPI A;  3F0F A;  1JY8 A;  3IEQ A;  1IV1 A;  1W55 A;  3P0Z A;  3ELC A;  3B6N A;  4C8E A;  4C8I A;  1W57 A;  1JN1 A;  1U3L A;  1IV3 A;  3F0D A;  3IEW A;  1VHA A;  1GX1 A;  3K2X A;  1VH8 A;  2GZL A;  3FBA A;  5B8F A;  3T80 A;  2PMP A;  1KNK A;  2UZH A;  3Q8H A;  3P10 A;  1U43 A;  1IV2 A;  1H48 A;  3IKF A;  3RE3 A;  4C82 A;  1T0A A;  1IV4 A;  3IKE A;  1KNJ A;  3EOR A;  4C81 A;  3ERN A;  3GHZ A;  3QHD A;  4C8G A;  3JVH A;  1H47 A;  2AMT A;  3MBM A;  1U40 A;  3F0G A;  3ESJ A;  1U3P A;  3F6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...