4C8EA

Ispf (burkholderia cenocepacia) 2cmp complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
161
structure length
161
Chain Sequence
MDVRIGQGYDVHQLVEGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDAAFKGADSRVLLRACAERVKAAGFTIQNVDSTVIAQAPKLAPHIDGMRANIAADLGLPLERVNVKAKTNEKLGYLGRGEGIEAQAAALLVKQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-METHYL-D-ERYTHRITOL 2,4-CYCLODIPHOSPHATE SYNTHASE
publication title Crystal Structures of Ispf from Plasmodium Falciparum and Burkholderia Cenocepacia: Comparisons Inform Antimicrobial Drug Target Assessment.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Lyase
total genus 49
structure length 161
sequence length 161
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 4c8eA00
3F0GA 3FBAA 2UZHA 1JY8A 1KNJA 1T0AA 3IEWA 3F0DA 3P10A 1IV3A 3ELCA 1JN1A 3QHDA 3K2XA 5B8FA 1GX1A 1W57A 3ESJA 3GHZA 1H47A 4C8IA 1W55A 1IV2A 3JVHA 2GZLA 3B6NA 3FPIA 1IV1A 3IKFA 3RE3A 3ERNA 2AMTA 2PMPA 3P0ZA 3F0EA 3EORA 4C81A 4C82A 4C8GA 3K14A 1H48A 3KE1A 1U3LA 1IV4A 1U3PA 1U40A 1VHAA 3F6MA 3MBMA 3Q8HA 3T80A 1YQNA 1KNKA 1U43A 4C8EA 3F0FA 3IEQA 1VH8A 3IKEA
chains in the Genus database with same CATH superfamily
2CWJA 4ZI7B 2H8CA 2R6R1 4FFBB 1CK2A 2HP0B 3K2XA 2HX0A 3JAWA 3LYBA 4BT6A 3CCUF 3GHZA 1VQKF 4F6RA 2VXYA 3G71F 3CC4F 3AGKA 2LBWA 4G4ZA 2VAMA 3M4SA 3P4EA 1H48A 3C8LA 3LWOC 1W5EA 1Q7YH 2Z1EA 1VHAA 3F6MA 3J80M 1YITF 1S72F 1YGYA 5HWEA 5LA6B 1KNKA 3DDNA 4G88A 5HP7A 1YIJF 5FLXM 3VYSC 1W5FA 1M90H 1FFXA 1PXWA 1JJ2F 1ONIA 1RLGA 4O4JB 1W41A 3VYTC 1X52A 5CB4A 1YJNF 3E20B 1Q8RA 3RYFA 2RHJA 1XBIA 1QVGF 4I55B 2HS0A 4IHJA 1VQPF 4G4YA 4DRXB 2RHLA 4BT4A 4BVQA 3CCMF 4BT2A 3WPWA 2FC3A 5AVMA 5LP6A 2P6YA 3G4SF 4O4IB 5KX5B 1K8AH 1RLUA 3S02A 4O4LB 1VQMF 5BMVA 3KHNA 2YYEA 3RE3A 3K0TA 3C9RA 5EZYB 1Z5VA 3CCSF 4X1IB 4LNUB 4ZK7A 1YHQF 2FGYA 2H6LA 5HY1A 2QA4F 3VTIC 3UT5B 3T80A 1RQ7A 3DC2A 3N2KA 4I4TB 3E22A 1VQ6F 3C9TA 3WGKA 4X20A 5C8YA 5IJ9B 5IJ0A 1W3EX 2CHSA 3ZP4A 3ZO8A 2R751 3ZOPA 5B8FA 5MN6A 4G4XA 2CVLA 4IIJB 3NK6A 5FNVA 1W55A 1IPAA 2K1SA 1RA4A 1RQ2A 1FSZA 2GZLA 3CPQA 4ERHA 4KWEA 2CSLA 2OTJF 1X25A 3WGJA 1SDSA 4X1KA 3SIVA 5GONB 3HKEA 3OONA 5G4VC 3HKDA 4O4HA 5LXTA 1TVKB 3CXCF 3WJQA 1JY8A 3N2GA 3CG6A 4LCKA 4O2BB 4NUTA 1JN1A 5HXZA 4X3MA 4TUYA 4C8IA 2ZAUA 4YJ2B 5J2UB 3JASA 2LBTA 1JD1A 3V7QA 3HKCB 5MN5A 2LCAA 4TV9B 3F0EA 3WGMA 5LOVB 3JATA 1XHOA 2ALEA 2L26A 3Q8HA 3JARB 3N4ZA 5G4UC 5JVDA 4EB6A 3LWRC 1KNJA 3WJPA 3S0YA 3JAKA 3JALB 3S06A 5GIPC 1W59A 4YJ3A 2Z01A 2QEXF 3RYIB 4NQ3A 3VI6A 1VQ7F 2UYNA 3CPWF 4O2AA 1SA0B 5HY4A 5LYJB 1IV1A 1QU9A 2RHOA 5CA1B 2I6RA 5IYZA 1KD1H 1ZWZA 5EYPB 2CHTA 4BT3A 2I6DA 1VQVA 1X7OA 4ZHQB 3CYPB 3RYHB 3HKBB 2AIFA 2BO1A 4U3JA 5JQGA 5GIOC 1VH8A 3JCMM 1PF5A 2UYKA 3HAXD 3P10A 3MCAB 3CD6F 4TV8A 1W40A 4BT5A 2VAWA 4C4WC 1H47A 2BTOA 1IV2A 3ZP7A 3C9UA 3B6NA 1CLIA 3N2KB 5JCOA 1TUBA 5GINC 3MDOA 3CCJF 3TD5A 2LBXA 4TZZA 3P0ZA 1GO0A 5C8YB 3K14A 4WBNA 2ZODA 1YI2F 4HNAA 2N48A 3S0WA 5ITZA 3HJWC 3QUWA 4B5CA 1Z5WA 1W5BA 4I50B 2V9YA 1W581 2ZVYA 1OFUA 5JH7A 5KMGA 3ELCA 1J7HA 3C9SA 1W57A 5EB1B 5J2TB 2KG4A 2OHWA 2DYYA 4ZI7A 1KQSF 2AMTA 5EAZA 4ZOLB 5MN4A 2Z1UA 2HP0A 2VGMA 5GANK 4TUYB 2JNBA 3CCRF 1YJ9F 3NVKE 3IR9A 3OBWA 3CC2F 1YQNA 5FJ4C 5CA0B 2CZWA 1K9MH 4X1YB 1VQ8F 3IKEA 3VO8A 4BY9D 1VQ5F 4B45A 3NK7A 4RQOA 5HY0A 5LA6A 3LWQC 3HTNA 4EB6B 2UYJA 2IQQA 3JAKB 4B46A 1ODEA 4O4JA 3OBYA 1FNKA 3WJRA 1U40A 5JCOC 1Q81H 2RHHA 3OW2F 3JAWB 3S0HA 4ZHWA 1JFFA 4EI7A 4F6RB 1CN7A 2MQEA 5HP8A 2Q1YA 1H7MA 2KGWA 3PAFA 3G6EF 1VQ9F 3SIUA 5IYZB 4I55A 3IMPA 1NQ3A 4BT7A 3VIUA 3GTZA 2HS4A 3CCQF 3GYQA 1VQLF 5LP6C 3VCZA 2W8BC 3VOBA 3ERNA 1VQOF 1SZQA 3E1YA 4C8GA 4O4IA 1FFXB 2WALA 1IV4A 4TV8B 5KX5A 1Q86H 4O4LA 5CB4B 1NJIH 5HY2A 3RYFB 3TD3A 1QD9A 5EB0A 3S03A 3HWUA 4X1IA 4LNUA 5EIBC 1K73H 2OTMA 5HXUA 4IHJB 4G4WA 1X7PA 1E7KA 3UT5A 3VMFB 3I7TA 1M1KH 4R40B 3TD4A 4I4TA 1W2BF 3FPIA 1XV2A 2YXZA 2ZF8A 4M8IA 3V4DA 4C81A 5IJ9A 3J7AR 2HS3A 5LP6B 1XRGA 3LWPC 5IT9M 2RB9A 2QTPA 1NMUB 4C8EA 4C82A 4ZHVA 5BMVB 4XCQA 2UZHA 3CMAF 2DT4A 5EO3A 2B33A 2GVIA 1IV3A 5GONA 1GX1A 3VOAA 1QAHA 3ESJA 3FD6A 3D54A 2UYPA 1FNJA 1TVKA 1N8RH 3IKFA 3E22B 4O2BA 4U39A 4BVRA 3JAMM 3KJKA 3KE1A 4X20B 5IJ0B 2HRUA 1U3PA 2ZOVA 2NMUA 4YJ2A 5J2UA 3D00A 5FNVB 3FFMA 3M1XA 2HVYD 3HKCA 3MCQA 1R1MA 2BTUA 4TV9A 3RYCA 3I55F 2AIZP 5LOVA 3FD5A 3KJJA 2IAFA 4X1KB 3WGNA 3CMEF 3D01A 3LFOA 4BVSA 3HKEB 3JARA 3L7QA 1JFFB 3JVHA 3HKDB 4O4HB 1GZ0A 4BVTA 2G9IA 5LXTB 4DXDA 4E6EA 2F9ZC 3JALA 3N2GB 2EWCA 2Q1XA 4FFBA 1U3LA 1W5AA 1YJWF 3RYIA 3K12A 1W42A 1GO1A 3CYQA 2BTQB 1SA0A 5LYJA 3F0FA 3WXMB 3JASB 5CA1A 3F0GA 2VAPA 2VGNA 3CCVF 5EYPA 1KC8H 4ZHQA 3JATB 3RYHA 3HKBA 3WGLA 4RHAA 1Q82H 5DCVA 5JVDB 2ZVZA 3NVIB 3PLAC 3MQWA 2IG8A 5EIBD 1OAPA 3J81M 4YJ3B 4EI9A 3RA6A 3LDTA 3KIZA 2UYNB 3IEQA 4O2AB 3VYUC 1QVFF 5GAPK 3IEWA 3I56F 3ON1A 4ZHYB 2KTUA 2CW4A 4DRXA 1T0KB 2Z1FA 2QI2A 4NWOB 4U3JB 5JQGB 4I50A 1VQNF 2Z1TA 4B62A 3CCEF 3N4YA 3V3TA 3NMUC 1DT9A 1VK3A 5J2TA 3WPXA 2H8EA 3V7EA 5A2QM 2PHNA 3O85A 1UFYA 3FBAA 4X3LA 1TUBB 4ZOLA 5EZYA 1COMA 3U0OA 1T0AA 3QTYA 3LWVC 3F0DA 2GLZA 5EWRA 3QHDA 2HQSC 4PWTA 4EI8A 4WBNB 3LMEA 3CCLF 3RA5A 4HNAB 4G4VA 5CA0A 4X1YA 3CC7F 2OZBA 1DBFA 2HP3A 5ITZB 3M84A 2HRYA 3RYCB 2KTVA 1UI9A 2PMPA 3EORA 5JH7B 5KMGB 3I3FA 3R0PA 3MBMA 1VQ4F 4IIJA 3CB2A 2OTLF 1U43A 3BYQA 4BW0B
chains in the Genus database with same CATH topology
3F0GA 3FBAA 2UZHA 1JY8A 1KNJA 1T0AA 3IEWA 3F0DA 3P10A 1IV3A 3ELCA 1JN1A 3QHDA 3K2XA 5B8FA 1GX1A 1W57A 3ESJA 3GHZA 1H47A 4C8IA 1W55A 1IV2A 3JVHA 2GZLA 3B6NA 3FPIA 1IV1A 3IKFA 3RE3A 3ERNA 2AMTA 2PMPA 3P0ZA 3F0EA 3EORA 4C81A 4C82A 4C8GA 3K14A 1H48A 3KE1A 1U3LA 1IV4A 1U3PA 1U40A 1VHAA 3F6MA 3MBMA 3Q8HA 3T80A 1YQNA 1KNKA 1U43A 4C8EA 3F0FA 3IEQA 1VH8A 3IKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0G A;  3FBA A;  2UZH A;  1JY8 A;  1KNJ A;  1T0A A;  3IEW A;  3F0D A;  3P10 A;  1IV3 A;  3ELC A;  1JN1 A;  3QHD A;  3K2X A;  5B8F A;  1GX1 A;  1W57 A;  3ESJ A;  3GHZ A;  1H47 A;  4C8I A;  1W55 A;  1IV2 A;  3JVH A;  2GZL A;  3B6N A;  3FPI A;  1IV1 A;  3IKF A;  3RE3 A;  3ERN A;  2AMT A;  2PMP A;  3P0Z A;  3F0E A;  3EOR A;  4C81 A;  4C82 A;  4C8G A;  3K14 A;  1H48 A;  3KE1 A;  1U3L A;  1IV4 A;  1U3P A;  1U40 A;  1VHA A;  3F6M A;  3MBM A;  3Q8H A;  3T80 A;  1YQN A;  1KNK A;  1U43 A;  4C8E A;  3F0F A;  3IEQ A;  1VH8 A;  3IKE A; 
#chains in the Genus database with same CATH topology
 2CWJ A;  4ZI7 B;  2H8C A;  2R6R 1;  4FFB B;  1CK2 A;  2HP0 B;  3K2X A;  2HX0 A;  3JAW A;  3LYB A;  4BT6 A;  3CCU F;  3GHZ A;  1VQK F;  4F6R A;  2VXY A;  3G71 F;  3CC4 F;  3AGK A;  2LBW A;  4G4Z A;  2VAM A;  3M4S A;  3P4E A;  1H48 A;  3C8L A;  3LWO C;  1W5E A;  1Q7Y H;  2Z1E A;  1VHA A;  3F6M A;  3J80 M;  1YIT F;  1S72 F;  1YGY A;  5HWE A;  5LA6 B;  1KNK A;  3DDN A;  4G88 A;  5HP7 A;  1YIJ F;  5FLX M;  3VYS C;  1W5F A;  1M90 H;  1FFX A;  1PXW A;  1JJ2 F;  1ONI A;  1RLG A;  4O4J B;  1W41 A;  3VYT C;  1X52 A;  5CB4 A;  1YJN F;  3E20 B;  1Q8R A;  3RYF A;  2RHJ A;  1XBI A;  1QVG F;  4I55 B;  2HS0 A;  4IHJ A;  1VQP F;  4G4Y A;  4DRX B;  2RHL A;  4BT4 A;  4BVQ A;  3CCM F;  4BT2 A;  3WPW A;  2FC3 A;  5AVM A;  5LP6 A;  2P6Y A;  3G4S F;  4O4I B;  5KX5 B;  1K8A H;  1RLU A;  3S02 A;  4O4L B;  1VQM F;  5BMV A;  3KHN A;  2YYE A;  3RE3 A;  3K0T A;  3C9R A;  5EZY B;  1Z5V A;  3CCS F;  4X1I B;  4LNU B;  4ZK7 A;  1YHQ F;  2FGY A;  2H6L A;  5HY1 A;  2QA4 F;  3VTI C;  3UT5 B;  3T80 A;  1RQ7 A;  3DC2 A;  3N2K A;  4I4T B;  3E22 A;  1VQ6 F;  3C9T A;  3WGK A;  4X20 A;  5C8Y A;  5IJ9 B;  5IJ0 A;  1W3E X;  2CHS A;  3ZP4 A;  3ZO8 A;  2R75 1;  3ZOP A;  5B8F A;  5MN6 A;  4G4X A;  2CVL A;  4IIJ B;  3NK6 A;  5FNV A;  1W55 A;  1IPA A;  2K1S A;  1RA4 A;  1RQ2 A;  1FSZ A;  2GZL A;  3CPQ A;  4ERH A;  4KWE A;  2CSL A;  2OTJ F;  1X25 A;  3WGJ A;  1SDS A;  4X1K A;  3SIV A;  5GON B;  3HKE A;  3OON A;  5G4V C;  3HKD A;  4O4H A;  5LXT A;  1TVK B;  3CXC F;  3WJQ A;  1JY8 A;  3N2G A;  3CG6 A;  4LCK A;  4O2B B;  4NUT A;  1JN1 A;  5HXZ A;  4X3M A;  4TUY A;  4C8I A;  2ZAU A;  4YJ2 B;  5J2U B;  3JAS A;  2LBT A;  1JD1 A;  3V7Q A;  3HKC B;  5MN5 A;  2LCA A;  4TV9 B;  3F0E A;  3WGM A;  5LOV B;  3JAT A;  1XHO A;  2ALE A;  2L26 A;  3Q8H A;  3JAR B;  3N4Z A;  5G4U C;  5JVD A;  4EB6 A;  3LWR C;  1KNJ A;  3WJP A;  3S0Y A;  3JAK A;  3JAL B;  3S06 A;  5GIP C;  1W59 A;  4YJ3 A;  2Z01 A;  2QEX F;  3RYI B;  4NQ3 A;  3VI6 A;  1VQ7 F;  2UYN A;  3CPW F;  4O2A A;  1SA0 B;  5HY4 A;  5LYJ B;  1IV1 A;  1QU9 A;  2RHO A;  5CA1 B;  2I6R A;  5IYZ A;  1KD1 H;  1ZWZ A;  5EYP B;  2CHT A;  4BT3 A;  2I6D A;  1VQV A;  1X7O A;  4ZHQ B;  3CYP B;  3RYH B;  3HKB B;  2AIF A;  2BO1 A;  4U3J A;  5JQG A;  5GIO C;  1VH8 A;  3JCM M;  1PF5 A;  2UYK A;  3HAX D;  3P10 A;  3MCA B;  3CD6 F;  4TV8 A;  1W40 A;  4BT5 A;  2VAW A;  4C4W C;  1H47 A;  2BTO A;  1IV2 A;  3ZP7 A;  3C9U A;  3B6N A;  1CLI A;  3N2K B;  5JCO A;  1TUB A;  5GIN C;  3MDO A;  3CCJ F;  3TD5 A;  2LBX A;  4TZZ A;  3P0Z A;  1GO0 A;  5C8Y B;  3K14 A;  4WBN A;  2ZOD A;  1YI2 F;  4HNA A;  2N48 A;  3S0W A;  5ITZ A;  3HJW C;  3QUW A;  4B5C A;  1Z5W A;  1W5B A;  4I50 B;  2V9Y A;  1W58 1;  2ZVY A;  1OFU A;  5JH7 A;  5KMG A;  3ELC A;  1J7H A;  3C9S A;  1W57 A;  5EB1 B;  5J2T B;  2KG4 A;  2OHW A;  2DYY A;  4ZI7 A;  1KQS F;  2AMT A;  5EAZ A;  4ZOL B;  5MN4 A;  2Z1U A;  2HP0 A;  2VGM A;  5GAN K;  4TUY B;  2JNB A;  3CCR F;  1YJ9 F;  3NVK E;  3IR9 A;  3OBW A;  3CC2 F;  1YQN A;  5FJ4 C;  5CA0 B;  2CZW A;  1K9M H;  4X1Y B;  1VQ8 F;  3IKE A;  3VO8 A;  4BY9 D;  1VQ5 F;  4B45 A;  3NK7 A;  4RQO A;  5HY0 A;  5LA6 A;  3LWQ C;  3HTN A;  4EB6 B;  2UYJ A;  2IQQ A;  3JAK B;  4B46 A;  1ODE A;  4O4J A;  3OBY A;  1FNK A;  3WJR A;  1U40 A;  5JCO C;  1Q81 H;  2RHH A;  3OW2 F;  3JAW B;  3S0H A;  4ZHW A;  1JFF A;  4EI7 A;  4F6R B;  1CN7 A;  2MQE A;  5HP8 A;  2Q1Y A;  1H7M A;  2KGW A;  3PAF A;  3G6E F;  1VQ9 F;  3SIU A;  5IYZ B;  4I55 A;  3IMP A;  1NQ3 A;  4BT7 A;  3VIU A;  3GTZ A;  2HS4 A;  3CCQ F;  3GYQ A;  1VQL F;  5LP6 C;  3VCZ A;  2W8B C;  3VOB A;  3ERN A;  1VQO F;  1SZQ A;  3E1Y A;  4C8G A;  4O4I A;  1FFX B;  2WAL A;  1IV4 A;  4TV8 B;  5KX5 A;  1Q86 H;  4O4L A;  5CB4 B;  1NJI H;  5HY2 A;  3RYF B;  3TD3 A;  1QD9 A;  5EB0 A;  3S03 A;  3HWU A;  4X1I A;  4LNU A;  5EIB C;  1K73 H;  2OTM A;  5HXU A;  4IHJ B;  4G4W A;  1X7P A;  1E7K A;  3UT5 A;  3VMF B;  3I7T A;  1M1K H;  4R40 B;  3TD4 A;  4I4T A;  1W2B F;  3FPI A;  1XV2 A;  2YXZ A;  2ZF8 A;  4M8I A;  3V4D A;  4C81 A;  5IJ9 A;  3J7A R;  2HS3 A;  5LP6 B;  1XRG A;  3LWP C;  5IT9 M;  2RB9 A;  2QTP A;  1NMU B;  4C8E A;  4C82 A;  4ZHV A;  5BMV B;  4XCQ A;  2UZH A;  3CMA F;  2DT4 A;  5EO3 A;  2B33 A;  2GVI A;  1IV3 A;  5GON A;  1GX1 A;  3VOA A;  1QAH A;  3ESJ A;  3FD6 A;  3D54 A;  2UYP A;  1FNJ A;  1TVK A;  1N8R H;  3IKF A;  3E22 B;  4O2B A;  4U39 A;  4BVR A;  3JAM M;  3KJK A;  3KE1 A;  4X20 B;  5IJ0 B;  2HRU A;  1U3P A;  2ZOV A;  2NMU A;  4YJ2 A;  5J2U A;  3D00 A;  5FNV B;  3FFM A;  3M1X A;  2HVY D;  3HKC A;  3MCQ A;  1R1M A;  2BTU A;  4TV9 A;  3RYC A;  3I55 F;  2AIZ P;  5LOV A;  3FD5 A;  3KJJ A;  2IAF A;  4X1K B;  3WGN A;  3CME F;  3D01 A;  3LFO A;  4BVS A;  3HKE B;  3JAR A;  3L7Q A;  1JFF B;  3JVH A;  3HKD B;  4O4H B;  1GZ0 A;  4BVT A;  2G9I A;  5LXT B;  4DXD A;  4E6E A;  2F9Z C;  3JAL A;  3N2G B;  2EWC A;  2Q1X A;  4FFB A;  1U3L A;  1W5A A;  1YJW F;  3RYI A;  3K12 A;  1W42 A;  1GO1 A;  3CYQ A;  2BTQ B;  1SA0 A;  5LYJ A;  3F0F A;  3WXM B;  3JAS B;  5CA1 A;  3F0G A;  2VAP A;  2VGN A;  3CCV F;  5EYP A;  1KC8 H;  4ZHQ A;  3JAT B;  3RYH A;  3HKB A;  3WGL A;  4RHA A;  1Q82 H;  5DCV A;  5JVD B;  2ZVZ A;  3NVI B;  3PLA C;  3MQW A;  2IG8 A;  5EIB D;  1OAP A;  3J81 M;  4YJ3 B;  4EI9 A;  3RA6 A;  3LDT A;  3KIZ A;  2UYN B;  3IEQ A;  4O2A B;  3VYU C;  1QVF F;  5GAP K;  3IEW A;  3I56 F;  3ON1 A;  4ZHY B;  2KTU A;  2CW4 A;  4DRX A;  1T0K B;  2Z1F A;  2QI2 A;  4NWO B;  4U3J B;  5JQG B;  4I50 A;  1VQN F;  2Z1T A;  4B62 A;  3CCE F;  3N4Y A;  3V3T A;  3NMU C;  1DT9 A;  1VK3 A;  5J2T A;  3WPX A;  2H8E A;  3V7E A;  5A2Q M;  2PHN A;  3O85 A;  1UFY A;  3FBA A;  4X3L A;  1TUB B;  4ZOL A;  5EZY A;  1COM A;  3U0O A;  1T0A A;  3QTY A;  3LWV C;  3F0D A;  2GLZ A;  5EWR A;  3QHD A;  2HQS C;  4PWT A;  4EI8 A;  4WBN B;  3LME A;  3CCL F;  3RA5 A;  4HNA B;  4G4V A;  5CA0 A;  4X1Y A;  3CC7 F;  2OZB A;  1DBF A;  2HP3 A;  5ITZ B;  3M84 A;  2HRY A;  3RYC B;  2KTV A;  1UI9 A;  2PMP A;  3EOR A;  5JH7 B;  5KMG B;  3I3F A;  3R0P A;  3MBM A;  1VQ4 F;  4IIJ A;  3CB2 A;  2OTL F;  1U43 A;  3BYQ A;  4BW0 B; 
#chains in the Genus database with same CATH homology
 3F0G A;  3FBA A;  2UZH A;  1JY8 A;  1KNJ A;  1T0A A;  3IEW A;  3F0D A;  3P10 A;  1IV3 A;  3ELC A;  1JN1 A;  3QHD A;  3K2X A;  5B8F A;  1GX1 A;  1W57 A;  3ESJ A;  3GHZ A;  1H47 A;  4C8I A;  1W55 A;  1IV2 A;  3JVH A;  2GZL A;  3B6N A;  3FPI A;  1IV1 A;  3IKF A;  3RE3 A;  3ERN A;  2AMT A;  2PMP A;  3P0Z A;  3F0E A;  3EOR A;  4C81 A;  4C82 A;  4C8G A;  3K14 A;  1H48 A;  3KE1 A;  1U3L A;  1IV4 A;  1U3P A;  1U40 A;  1VHA A;  3F6M A;  3MBM A;  3Q8H A;  3T80 A;  1YQN A;  1KNK A;  1U43 A;  4C8E A;  3F0F A;  3IEQ A;  1VH8 A;  3IKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...