4C8EA

Ispf (burkholderia cenocepacia) 2cmp complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
161
structure length
161
Chain Sequence
MDVRIGQGYDVHQLVEGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDAAFKGADSRVLLRACAERVKAAGFTIQNVDSTVIAQAPKLAPHIDGMRANIAADLGLPLERVNVKAKTNEKLGYLGRGEGIEAQAAALLVKQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-METHYL-D-ERYTHRITOL 2,4-CYCLODIPHOSPHATE SYNTHASE
publication title Crystal Structures of Ispf from Plasmodium Falciparum and Burkholderia Cenocepacia: Comparisons Inform Antimicrobial Drug Target Assessment.
pubmed doi rcsb
source organism Burkholderia cenocepacia
total genus 49
structure length 161
sequence length 161
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 4c8eA00
2PMPA 2GZLA 3Q8HA 2UZHA 3B6NA 3KE1A 1U3PA 1W55A 3F0GA 3MBMA 4C81A 3F0EA 4C8GA 3JVHA 1H48A 3ESJA 3P10A 1IV4A 3K2XA 1VH8A 1VHAA 1H47A 1JY8A 3RE3A 3IKEA 3IKFA 4C82A 1IV1A 3F0FA 3F6MA 3FPIA 1GX1A 3QHDA 1U40A 3T80A 3K14A 1KNJA 1U43A 3ERNA 2AMTA 1KNKA 1IV2A 3FBAA 5B8FA 1IV3A 1YQNA 3ELCA 3EORA 1U3LA 3GHZA 1W57A 3IEQA 3P0ZA 1T0AA 4C8EA 3F0DA 4C8IA 1JN1A 3IEWA
chains in the Genus database with same CATH superfamily
1JFFA 2PMPA 3C9SA 1SA0A 3PAFA 4WBNB 3S0YA 4X1YB 1KQSF 5HXZA 4I55B 5EYPB 1FNKA 5J2UB 4I50A 1W5FA 1Z5VA 4E6EA 5J2TA 5GAPK 2UYPA 4O4LA 5FNVB 1DBFA 3L7QA 3CCUF 1YJNF 3LDTA 4BVTA 3CCEF 4X1IB 1YITF 1VQ7F 4ZOLA 2HRUA 3ERNA 3CCSF 3C9UA 5LXTA 2OZBA 4BT7A 4O2BB 3EORA 2Z1TA 5G4UC 3HAXD 3CCMF 4G4YA 5HY2A 1GO1A 4X3MA 4TUYA 5FNVA 3RYCB 4EB6B 5EO3A 3WGMA 2HP0B 5KMGA 3F0EA 4FFBB 4NWOB 3P10A 4LCKA 4DXDA 3M4SA 3ON1A 3RE3A 2CW4A 5JCOC 3LWPC 1Q86H 5IYZA 3VYSC 5GIPC 2ALEA 4YJ2A 1J7HA 5ITZB 3RYCA 2JNBA 3M84A 3O85A 4RHAA 3VYTC 2KGWA 1VQVA 2Q1XA 3WGNA 5KX5B 1X25A 2DYYA 4DRXA 3S02A 1K9MH 5GONA 4C8EA 1DT9A 1RQ2A 3CB2A 2CSLA 1NQ3A 3CCRF 4BVRA 3V7QA 5LOVB 3G71F 1XHOA 3JAWB 3CCVF 3CC4F 3JATA 2K1SA 3N2GA 5ITZA 3JALB 5C8YB 1KD1H 2Q1YA 4TV8B 1FFXA 1RQ7A 2F9ZC 3V3TA 2LBTA 3V7EA 3SIVA 3E22B 3WGLA 3HWUA 3FD6A 3JAWA 2GVIA 1VQOF 1RLGA 3JALA 5C8YA 2CWJA 5LYJA 3HTNA 3CYPB 2QI2A 3JARA 1W5AA 4TV8A 3VMFB 3QUWA 4O4IB 1YI2F 2ZOVA 3M1XA 3KIZA 3WGKA 4F6RB 1E7KA 2OTMA 1X52A 5MN6A 1W41A 3S0WA 3UT5A 2KTUA 4IHJA 3HKDB 3VCZA 5HY0A 3T80A 2FGYA 3WJQA 1KNKA 2EWCA 4HNAA 3GHZA 1W57A 4PWTA 1JD1A 3WXMB 4BVSA 4O4HB 1VQ5F 5HY4A 3VTIC 2OTLF 2LCAA 3HKBA 3KHNA 3HJWC 3LWRC 3C9RA 1Q8RA 1S72F 1ZWZA 1H47A 4ZK7A 4RQOA 1IV1A 2RHJA 4I4TA 5IT9M 3E20B 1QU9A 5EZYA 3RYIB 2QTPA 1YJ9F 4G4XA 4EI7A 4BY9D 4U39A 4TZZA 1TVKA 1IV3A 2ZVYA 1H7MA 1UFYA 5BMVB 4KWEA 3N2KB 4YJ3A 1T0AA 1TUBB 4IIJA 5LP6C 5HWEA 4ZHVA 4B5CA 2HRYA 4X20A 1OAPA 3WJRA 4LNUB 1M90H 4EI9A 4C8GA 5LA6A 1VHAA 2IAFA 5BMVA 4TV9A 3F6MA 3VOAA 3K14A 3LYBA 3WPWA 5B8FA 3CMAF 3S0HA 4WBNA 3BYQA 4X1YA 1RLUA 5IJ0B 1NMUB 3HKCB 2VAPA 3IEQA 1Q7YH 3HKEB 4O2AB 1K8AH 4I55A 4G4ZA 3JAKB 5EYPA 1YJWF 1XRGA 3D00A 5J2UA 3VI6A 2HS3A 1ONIA 2CHSA 3I55F 4X1IA 3G4SF 1W59A 3MDOA 1W2BF 1M1KH 5IJ0A 3OBWA 5IJ9B 4O2BA 3CD6F 3E1YA 2CHTA 3CXCF 4BVQA 1W3EX 3C8LA 3NMUC 4X3LA 1CN7A 1IV2A 4EB6A 3QTYA 3ELCA 4ZHQB 2HP0A 4FFBA 4BT6A 2B33A 5IJ9A 3JAMM 1FSZA 1VK3A 2ZVZA 3WPXA 2ZODA 3F0GA 3LMEA 3JCMM 2LBWA 1XV2A 1IV4A 3I56F 2HP3A 4G4WA 5EWRA 5KX5A 3OW2F 3RYHB 3F0FA 3ZP4A 2CZWA 1W5BA 3R0PA 3KJKA 4XCQA 3K12A 5A2QM 1QVFF 3ZO8A 1U43A 3S06A 3RYFB 2KG4A 5LOVA 5EAZA 2IQQA 5FJ4C 3C9TA 4X1KB 5JH7B 2BTQB 2Z01A 3VYUC 1PF5A 1KC8H 1W581 2ZF8A 3JASB 3VIUA 1T0KB 3RYFA 3U0OA 3VO8A 3E22A 2NMUA 3TD5A 3MQWA 4U3JB 2I6DA 5LP6B 1Q81H 3OBYA 3CC2F 1W42A 4O4IA 3I3FA 1K73H 4F6RA 3P0ZA 3IR9A 3CPQA 1RA4A 2VGNA 1U3PA 3HKDA 3NVIB 3D01A 1VQ4F 3SIUA 3ESJA 1SDSA 4ERHA 5MN4A 5MN5A 5JQGB 2UYNB 5CA1B 3GYQA 4O4HA 1JJ2F 1FNJA 3CPWF 2OHWA 1U3LA 5FLXM 3ZOPA 3VOBA 5HXUA 4BT2A 1W55A 2OTJF 3MBMA 3J80M 1H48A 1XBIA 2N48A 3RYIA 3TD4A 3LFOA 4O4JB 2BTUA 3KJJA 3N2KA 4NUTA 1TUBA 4ZHWA 5JCOA 2QA4F 4I50B 2IG8A 1YQNA 4LNUA 4O4LB 1QVGF 1VQ6F 3F0DA 4ZOLB 3RA6A 3CC7F 3FFMA 2RHOA 3WJPA 5LXTB 2HQSC 1SZQA 4C81A 2VAWA 3JVHA 3S03A 3NK7A 4ZI7B 5DCVA 2W8BC 1JY8A 3NVKE 4TUYB 2H8EA 3J81M 3HKCA 2VXYA 1CLIA 3N4YA 4C82A 5KMGB 2QEXF 3HKEA 3CYQA 4O2AA 1U40A 3JAKA 1Q82H 1PXWA 1KNJA 4M8IA 2I6RA 5IYZB 2G9IA 3CCJF 2H6LA 4ZI7A 4G88A 3NK6A 2ZAUA 4B45A 4YJ2B 1COMA 2GZLA 3LWOC 2YXZA 5EB1B 4DRXB 5GONB 3LWVC 1VQPF 2V9YA 3PLAC 3D54A 1X7OA 4ZHQA 5HY1A 2LBXA 5HP7A 3JATB 3N2GB 3MCAB 1VQMF 1FFXB 1VQKF 1OFUA 3CMEF 2CVLA 5CB4B 3IMPA 1NJIH 2RHHA 5CA0B 1GO0A 3Q8HA 3KE1A 3P4EA 1Z5WA 1YHQF 3RYHA 2L26A 2FC3A 3DDNA 1VQLF 5JVDB 5LYJB 3K2XA 1VH8A 2VAMA 4B46A 3JARB 2UYKA 1W5EA 1CK2A 3IKEA 3IKFA 2RHLA 5EIBC 2MQEA 4BT3A 5CB4A 1X7PA 2HVYD 3AGKA 1UI9A 5G4VC 4X1KA 5JH7A 5CA0A 3UT5B 3N4ZA 3CCLF 3J7AR 4IHJB 2KTVA 1VQ8F 5JVDA 2HX0A 3JASA 3DC2A 3RA5A 4ZHYB 1R1MA 4BT5A 2HS4A 1JN1A 2UZHA 3B6NA 2VGMA 2H8CA 4U3JA 1YGYA 2AIZP 4HNAB 5AVMA 5GIOC 5LP6A 4R40B 5HP8A 2Z1FA 2HS0A 4G4VA 2WALA 3K0TA 3CG6A 4C4WC 3HKBB 1IPAA 2BTOA 5GINC 3FPIA 3QHDA 5GANK 4BW0B 2AMTA 5EIBD 1QAHA 1N8RH 1QD9A 3I7TA 1VQ9F 3TD3A 2Z1EA 4I4TB 2YYEA 2P6YA 3MCQA 5EZYB 1GZ0A 2R751 2RB9A 2UYJA 2PHNA 4NQ3A 1ODEA 1TVKB 2AIFA 2UYNA 3GTZA 5EB0A 5JQGA 3G6EF 3CCQF 5CA1A 4YJ3B 1W40A 4IIJB 1JFFB 4X20B 1SA0B 3FD5A 1VQNF 4BT4A 4EI8A 1GX1A 5LA6B 2DT4A 3LWQC 2BO1A 3FBAA 2R6R1 4TV9B 3OONA 2GLZA 3ZP7A 3WGJA 3V4DA 5J2TB 4C8IA 1YIJF 3IEWA 4O4JA 2Z1UA 4B62A
chains in the Genus database with same CATH topology
2PMPA 2GZLA 3Q8HA 2UZHA 3B6NA 3KE1A 1U3PA 1W55A 3F0GA 3MBMA 4C81A 3F0EA 4C8GA 3JVHA 1H48A 3ESJA 3P10A 1IV4A 3K2XA 1VH8A 1VHAA 1H47A 1JY8A 3RE3A 3IKEA 3IKFA 4C82A 1IV1A 3F0FA 3F6MA 3FPIA 1GX1A 3QHDA 1U40A 3T80A 3K14A 1KNJA 1U43A 3ERNA 2AMTA 1KNKA 1IV2A 3FBAA 5B8FA 1IV3A 1YQNA 3ELCA 3EORA 1U3LA 3GHZA 1W57A 3IEQA 3P0ZA 1T0AA 4C8EA 3F0DA 4C8IA 1JN1A 3IEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMP A;  2GZL A;  3Q8H A;  2UZH A;  3B6N A;  3KE1 A;  1U3P A;  1W55 A;  3F0G A;  3MBM A;  4C81 A;  3F0E A;  4C8G A;  3JVH A;  1H48 A;  3ESJ A;  3P10 A;  1IV4 A;  3K2X A;  1VH8 A;  1VHA A;  1H47 A;  1JY8 A;  3RE3 A;  3IKE A;  3IKF A;  4C82 A;  1IV1 A;  3F0F A;  3F6M A;  3FPI A;  1GX1 A;  3QHD A;  1U40 A;  3T80 A;  3K14 A;  1KNJ A;  1U43 A;  3ERN A;  2AMT A;  1KNK A;  1IV2 A;  3FBA A;  5B8F A;  1IV3 A;  1YQN A;  3ELC A;  3EOR A;  1U3L A;  3GHZ A;  1W57 A;  3IEQ A;  3P0Z A;  1T0A A;  4C8E A;  3F0D A;  4C8I A;  1JN1 A;  3IEW A; 
#chains in the Genus database with same CATH topology
 1JFF A;  2PMP A;  3C9S A;  1SA0 A;  3PAF A;  4WBN B;  3S0Y A;  4X1Y B;  1KQS F;  5HXZ A;  4I55 B;  5EYP B;  1FNK A;  5J2U B;  4I50 A;  1W5F A;  1Z5V A;  4E6E A;  5J2T A;  5GAP K;  2UYP A;  4O4L A;  5FNV B;  1DBF A;  3L7Q A;  3CCU F;  1YJN F;  3LDT A;  4BVT A;  3CCE F;  4X1I B;  1YIT F;  1VQ7 F;  4ZOL A;  2HRU A;  3ERN A;  3CCS F;  3C9U A;  5LXT A;  2OZB A;  4BT7 A;  4O2B B;  3EOR A;  2Z1T A;  5G4U C;  3HAX D;  3CCM F;  4G4Y A;  5HY2 A;  1GO1 A;  4X3M A;  4TUY A;  5FNV A;  3RYC B;  4EB6 B;  5EO3 A;  3WGM A;  2HP0 B;  5KMG A;  3F0E A;  4FFB B;  4NWO B;  3P10 A;  4LCK A;  4DXD A;  3M4S A;  3ON1 A;  3RE3 A;  2CW4 A;  5JCO C;  3LWP C;  1Q86 H;  5IYZ A;  3VYS C;  5GIP C;  2ALE A;  4YJ2 A;  1J7H A;  5ITZ B;  3RYC A;  2JNB A;  3M84 A;  3O85 A;  4RHA A;  3VYT C;  2KGW A;  1VQV A;  2Q1X A;  3WGN A;  5KX5 B;  1X25 A;  2DYY A;  4DRX A;  3S02 A;  1K9M H;  5GON A;  4C8E A;  1DT9 A;  1RQ2 A;  3CB2 A;  2CSL A;  1NQ3 A;  3CCR F;  4BVR A;  3V7Q A;  5LOV B;  3G71 F;  1XHO A;  3JAW B;  3CCV F;  3CC4 F;  3JAT A;  2K1S A;  3N2G A;  5ITZ A;  3JAL B;  5C8Y B;  1KD1 H;  2Q1Y A;  4TV8 B;  1FFX A;  1RQ7 A;  2F9Z C;  3V3T A;  2LBT A;  3V7E A;  3SIV A;  3E22 B;  3WGL A;  3HWU A;  3FD6 A;  3JAW A;  2GVI A;  1VQO F;  1RLG A;  3JAL A;  5C8Y A;  2CWJ A;  5LYJ A;  3HTN A;  3CYP B;  2QI2 A;  3JAR A;  1W5A A;  4TV8 A;  3VMF B;  3QUW A;  4O4I B;  1YI2 F;  2ZOV A;  3M1X A;  3KIZ A;  3WGK A;  4F6R B;  1E7K A;  2OTM A;  1X52 A;  5MN6 A;  1W41 A;  3S0W A;  3UT5 A;  2KTU A;  4IHJ A;  3HKD B;  3VCZ A;  5HY0 A;  3T80 A;  2FGY A;  3WJQ A;  1KNK A;  2EWC A;  4HNA A;  3GHZ A;  1W57 A;  4PWT A;  1JD1 A;  3WXM B;  4BVS A;  4O4H B;  1VQ5 F;  5HY4 A;  3VTI C;  2OTL F;  2LCA A;  3HKB A;  3KHN A;  3HJW C;  3LWR C;  3C9R A;  1Q8R A;  1S72 F;  1ZWZ A;  1H47 A;  4ZK7 A;  4RQO A;  1IV1 A;  2RHJ A;  4I4T A;  5IT9 M;  3E20 B;  1QU9 A;  5EZY A;  3RYI B;  2QTP A;  1YJ9 F;  4G4X A;  4EI7 A;  4BY9 D;  4U39 A;  4TZZ A;  1TVK A;  1IV3 A;  2ZVY A;  1H7M A;  1UFY A;  5BMV B;  4KWE A;  3N2K B;  4YJ3 A;  1T0A A;  1TUB B;  4IIJ A;  5LP6 C;  5HWE A;  4ZHV A;  4B5C A;  2HRY A;  4X20 A;  1OAP A;  3WJR A;  4LNU B;  1M90 H;  4EI9 A;  4C8G A;  5LA6 A;  1VHA A;  2IAF A;  5BMV A;  4TV9 A;  3F6M A;  3VOA A;  3K14 A;  3LYB A;  3WPW A;  5B8F A;  3CMA F;  3S0H A;  4WBN A;  3BYQ A;  4X1Y A;  1RLU A;  5IJ0 B;  1NMU B;  3HKC B;  2VAP A;  3IEQ A;  1Q7Y H;  3HKE B;  4O2A B;  1K8A H;  4I55 A;  4G4Z A;  3JAK B;  5EYP A;  1YJW F;  1XRG A;  3D00 A;  5J2U A;  3VI6 A;  2HS3 A;  1ONI A;  2CHS A;  3I55 F;  4X1I A;  3G4S F;  1W59 A;  3MDO A;  1W2B F;  1M1K H;  5IJ0 A;  3OBW A;  5IJ9 B;  4O2B A;  3CD6 F;  3E1Y A;  2CHT A;  3CXC F;  4BVQ A;  1W3E X;  3C8L A;  3NMU C;  4X3L A;  1CN7 A;  1IV2 A;  4EB6 A;  3QTY A;  3ELC A;  4ZHQ B;  2HP0 A;  4FFB A;  4BT6 A;  2B33 A;  5IJ9 A;  3JAM M;  1FSZ A;  1VK3 A;  2ZVZ A;  3WPX A;  2ZOD A;  3F0G A;  3LME A;  3JCM M;  2LBW A;  1XV2 A;  1IV4 A;  3I56 F;  2HP3 A;  4G4W A;  5EWR A;  5KX5 A;  3OW2 F;  3RYH B;  3F0F A;  3ZP4 A;  2CZW A;  1W5B A;  3R0P A;  3KJK A;  4XCQ A;  3K12 A;  5A2Q M;  1QVF F;  3ZO8 A;  1U43 A;  3S06 A;  3RYF B;  2KG4 A;  5LOV A;  5EAZ A;  2IQQ A;  5FJ4 C;  3C9T A;  4X1K B;  5JH7 B;  2BTQ B;  2Z01 A;  3VYU C;  1PF5 A;  1KC8 H;  1W58 1;  2ZF8 A;  3JAS B;  3VIU A;  1T0K B;  3RYF A;  3U0O A;  3VO8 A;  3E22 A;  2NMU A;  3TD5 A;  3MQW A;  4U3J B;  2I6D A;  5LP6 B;  1Q81 H;  3OBY A;  3CC2 F;  1W42 A;  4O4I A;  3I3F A;  1K73 H;  4F6R A;  3P0Z A;  3IR9 A;  3CPQ A;  1RA4 A;  2VGN A;  1U3P A;  3HKD A;  3NVI B;  3D01 A;  1VQ4 F;  3SIU A;  3ESJ A;  1SDS A;  4ERH A;  5MN4 A;  5MN5 A;  5JQG B;  2UYN B;  5CA1 B;  3GYQ A;  4O4H A;  1JJ2 F;  1FNJ A;  3CPW F;  2OHW A;  1U3L A;  5FLX M;  3ZOP A;  3VOB A;  5HXU A;  4BT2 A;  1W55 A;  2OTJ F;  3MBM A;  3J80 M;  1H48 A;  1XBI A;  2N48 A;  3RYI A;  3TD4 A;  3LFO A;  4O4J B;  2BTU A;  3KJJ A;  3N2K A;  4NUT A;  1TUB A;  4ZHW A;  5JCO A;  2QA4 F;  4I50 B;  2IG8 A;  1YQN A;  4LNU A;  4O4L B;  1QVG F;  1VQ6 F;  3F0D A;  4ZOL B;  3RA6 A;  3CC7 F;  3FFM A;  2RHO A;  3WJP A;  5LXT B;  2HQS C;  1SZQ A;  4C81 A;  2VAW A;  3JVH A;  3S03 A;  3NK7 A;  4ZI7 B;  5DCV A;  2W8B C;  1JY8 A;  3NVK E;  4TUY B;  2H8E A;  3J81 M;  3HKC A;  2VXY A;  1CLI A;  3N4Y A;  4C82 A;  5KMG B;  2QEX F;  3HKE A;  3CYQ A;  4O2A A;  1U40 A;  3JAK A;  1Q82 H;  1PXW A;  1KNJ A;  4M8I A;  2I6R A;  5IYZ B;  2G9I A;  3CCJ F;  2H6L A;  4ZI7 A;  4G88 A;  3NK6 A;  2ZAU A;  4B45 A;  4YJ2 B;  1COM A;  2GZL A;  3LWO C;  2YXZ A;  5EB1 B;  4DRX B;  5GON B;  3LWV C;  1VQP F;  2V9Y A;  3PLA C;  3D54 A;  1X7O A;  4ZHQ A;  5HY1 A;  2LBX A;  5HP7 A;  3JAT B;  3N2G B;  3MCA B;  1VQM F;  1FFX B;  1VQK F;  1OFU A;  3CME F;  2CVL A;  5CB4 B;  3IMP A;  1NJI H;  2RHH A;  5CA0 B;  1GO0 A;  3Q8H A;  3KE1 A;  3P4E A;  1Z5W A;  1YHQ F;  3RYH A;  2L26 A;  2FC3 A;  3DDN A;  1VQL F;  5JVD B;  5LYJ B;  3K2X A;  1VH8 A;  2VAM A;  4B46 A;  3JAR B;  2UYK A;  1W5E A;  1CK2 A;  3IKE A;  3IKF A;  2RHL A;  5EIB C;  2MQE A;  4BT3 A;  5CB4 A;  1X7P A;  2HVY D;  3AGK A;  1UI9 A;  5G4V C;  4X1K A;  5JH7 A;  5CA0 A;  3UT5 B;  3N4Z A;  3CCL F;  3J7A R;  4IHJ B;  2KTV A;  1VQ8 F;  5JVD A;  2HX0 A;  3JAS A;  3DC2 A;  3RA5 A;  4ZHY B;  1R1M A;  4BT5 A;  2HS4 A;  1JN1 A;  2UZH A;  3B6N A;  2VGM A;  2H8C A;  4U3J A;  1YGY A;  2AIZ P;  4HNA B;  5AVM A;  5GIO C;  5LP6 A;  4R40 B;  5HP8 A;  2Z1F A;  2HS0 A;  4G4V A;  2WAL A;  3K0T A;  3CG6 A;  4C4W C;  3HKB B;  1IPA A;  2BTO A;  5GIN C;  3FPI A;  3QHD A;  5GAN K;  4BW0 B;  2AMT A;  5EIB D;  1QAH A;  1N8R H;  1QD9 A;  3I7T A;  1VQ9 F;  3TD3 A;  2Z1E A;  4I4T B;  2YYE A;  2P6Y A;  3MCQ A;  5EZY B;  1GZ0 A;  2R75 1;  2RB9 A;  2UYJ A;  2PHN A;  4NQ3 A;  1ODE A;  1TVK B;  2AIF A;  2UYN A;  3GTZ A;  5EB0 A;  5JQG A;  3G6E F;  3CCQ F;  5CA1 A;  4YJ3 B;  1W40 A;  4IIJ B;  1JFF B;  4X20 B;  1SA0 B;  3FD5 A;  1VQN F;  4BT4 A;  4EI8 A;  1GX1 A;  5LA6 B;  2DT4 A;  3LWQ C;  2BO1 A;  3FBA A;  2R6R 1;  4TV9 B;  3OON A;  2GLZ A;  3ZP7 A;  3WGJ A;  3V4D A;  5J2T B;  4C8I A;  1YIJ F;  3IEW A;  4O4J A;  2Z1U A;  4B62 A; 
#chains in the Genus database with same CATH homology
 2PMP A;  2GZL A;  3Q8H A;  2UZH A;  3B6N A;  3KE1 A;  1U3P A;  1W55 A;  3F0G A;  3MBM A;  4C81 A;  3F0E A;  4C8G A;  3JVH A;  1H48 A;  3ESJ A;  3P10 A;  1IV4 A;  3K2X A;  1VH8 A;  1VHA A;  1H47 A;  1JY8 A;  3RE3 A;  3IKE A;  3IKF A;  4C82 A;  1IV1 A;  3F0F A;  3F6M A;  3FPI A;  1GX1 A;  3QHD A;  1U40 A;  3T80 A;  3K14 A;  1KNJ A;  1U43 A;  3ERN A;  2AMT A;  1KNK A;  1IV2 A;  3FBA A;  5B8F A;  1IV3 A;  1YQN A;  3ELC A;  3EOR A;  1U3L A;  3GHZ A;  1W57 A;  3IEQ A;  3P0Z A;  1T0A A;  4C8E A;  3F0D A;  4C8I A;  1JN1 A;  3IEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...