3JAWB

Atomic model of a microtubule seam based on a cryo-em reconstruction of the eb3-bound microtubule (merged dataset containing tubulin bound to gtpgammas, gmpcpp, and gdp)
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
429
structure length
429
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
total genus 145
structure length 429
sequence length 429
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jawB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jawB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jawB01
4O2BB 5EYPB 4XCQA 4IIJB 4ZOLA 4U3JA 1TUBB 3JARB 5LYJA 3WGNA 2XKAA 5LP6C 3VOBA 3WGLA 4WBNB 5KMGA 3M8KA 1OFUA 3HKDA 4B45A 4O2AA 4TV8A 5EYPA 5GONB 1TVKB 4IIJA 1Z5WA 4X1KB 1JFFA 2RHJA 4FFBA 3JARA 5C8YA 4LNUB 4WBNA 4X1YA 5LP6A 1RQ7A 3JASB 3N2GA 3HKEB 5LOVB 4E6EA 5JH7A 4TUYB 5EIBC 5EIBD 3JAWB 5GONA 4ZHQA 2BTQB 4X1KA 5J2TA 4M8IA 4I50B 4EB6A 5ITZA 5EZYB 1W581 4EI7A 4IHJB 5BMVB 4LNUA 3V3TA 3ZBPA 5JVDB 3VPAA 1SA0A 5MN6A 3HKCB 4TUYA 4YJ3B 5CB4B 2RHHA 4U39A 2BTQA 4I50A 3HKBB 5EZYA 5BMVA 4O4JB 4DRXA 5CA1A 5JVDA 4X1IB 4O2BA 4ZI7B 5IJ9B 4I4TB 4B46A 3HKCA 2VXYA 3M89A 1FFXB 3RYIB 1TUBA 1W5BA 3WGKA 5JQGB 3JAKB 4O4IB 4HNAB 4O4JA 3VO9A 4X1IA 5KX5B 3RYFB 5MN4A 5LA6B 1TVKA 4F6RB 1RQ2A 4TV9B 1FFXA 3RYIA 5JCOC 5LXTB 3C8LA 3VOAA 4YJ2B 3JASA 3HKEA 5LOVA 4X20B 5CA0B 2RHLA 2R751 4O4HB 5LA6A 1RLUA 3JAWA 4F6RA 2BTOA 3RYHB 5IJ0B 5IYZB 3N2KB 5LXTA 2GVIA 4IHJA 5JCOA 1Z5VA 3UT5B 4YJ2A 5M7EA 5CA0A 4DXDA 3JALB 4YJ3A 4I55B 5CB4A 2Q1XA 2VAWA 1FSZA 3HKBA 5IJ0A 5MN5A 3UT5A 3E22B 5KMGB 3HKDB 4ZI7A 5IJ9A 3JALA 4I4TA 4O2AB 2R6R1 4I55A 3JATB 5JQGA 1JFFB 2VAPA 5FNVB 3WGMA 3RB8A 3JAKA 4O4IA 4O4LB 4FFBB 5C8YB 1W59A 4HNAA 3ZBQA 5KX5A 3E22A 3RYFA 4X1YB 5LP6B 3N2GB 1W5AA 3RYCB 2RHOA 3JATA 5JH7B 4TV9A 5J2TB 4ZHQB 3ZIDA 5FNVA 4O4LA 4EB6B 5ITZB 4EI9A 3R4VA 3CB2A 5J2UB 4X20A 1W5EA 2VAMA 4KWEA 1W5FA 4O4HA 1SA0B 3RYCA 3VO8A 3RYHA 5IYZA 2Q1YA 3N2KA 4ZOLB 4U3JB 5LYJB 4EI8A 5J2UA 4DRXB 5CA1B 2XKBA 4TV8B 3WGJA
chains in the Genus database with same CATH superfamily
1AP5A 5BWNA 4CU5A 1I33A 2OV4A 3ZI7A 3NHFA 2ST1A 3LVBA 2A5JA 1OB5A 4CETA 1X8JA 5HQJA 1EFUA 3GHZA 3T1VA 4EFBA 4CKWB 4LY0A 2ZVQX 3PNKA 2FEAA 1Y5LA 3SHTA 3AYXB 1XZPA 2DYYA 1CB0A 3ZWMA 3BRWA 4XQGA 3D3JA 2RH9B 4LSWA 2VDLB 3RYFB 2DWCA 2I62A 4GBJA 2DG2A 4HBGA 3K0TA 1ZHHA 4MPPA 3WYGA 3TX2A 3T95A 2DWDC 3CSXA 4Y6LA 4RLFA 5JSFA 2GZLA 1NH2B 1V4VA 5ADWA 3RVYA 4KE8A 3EF1A 4B3DA 1VQ8F 3TF5A 4TMKA 3ZCXA 4C14A 2R1VA 1QC5B 2AR7A 1OIVA 5DTQA 1P2GA 1K73H 1HT3A 2GJ4A 2JI9A 1EDDA 4EEQA 5T7BA 2PVCA 1AUXA 3P0IA 1N33B 3OW2U 4MUJA 4HNTA 1FXKC 1ZN2A 4DQ0A 3JD4A 4B4OA 1YS6A 3RG8A 3HLKA 3KJIA 4M0KA 4UFPA 4TV8A 1UAGA 1THZA 3EMBA 3OQHA 2H8KA 2VA8A 3S0HA 1UC8A 1Z6YA 2RH4A 2ONYA 3NHAA 4MULA 1CN7A 1VE1A 5HS4A 5LVAA 4FFLA 3IKFA 2CJWB 3W34A 1NR7A 2GUWA 3EXAA 2F1IA 4MW9A 5BXYA 4UB8Z 5E9WA 5HHTA 2WU1A 2R751 2ZUVA 2HW8A 2OHWA 5JJ5A 2E3JA 3A6FA 4NYMR 4HRVA 1OZHA 3NVIB 3SR4A 4XFKA 4NZMA 4Y6PA 5BW5A 4FR2A 4AP5A 2N42A 3A6ZA 2PY6A 1YZVA 3VH2A 1N5IA 5HBGA 1LUVA 4B79A 2WG2A 1PR4A 2ZJ2A 4W1SA 3GDWA 4J6EA 3VO8A 1SXJE 2QWRB 2WJYA 4JWKA 5LFAA 4XVRA 4PPFA 1N1MA 5JZ9A 1JY8A 3OU6A 4XCQA 2PX8A 1B6RA 1L7QA 1XQ1A 4WLOA 5CFOA 1O7JA 1XEFA 1FUKA 4XPIA 1ITZA 1JHZA 2AW3A 3ZJ5A 2V1UA 1VPWA 2IM9A 2VVTA 3L0DA 1BCRA 3RAPR 4MS2A 3OECA 3PYLA 4JV5O 3SJAC 1FTQA 2FQ1A 3NWOA 3ABUA 3HUDA 3OWOA 1L6RA 2Y4UA 4R9NA 4NE7A 3RFCA 3NBMA 1PJAA 2F43G 4QUKA 3R5SA 4UM5A 3TDMA 4F2WA 3VSBA 1R5BA 4JUDX 5AKKA 3EGDB 2PVPA 5GANK 3T7KA 2FWNA 1K3FA 3U26A 4P2GA 5K4AA 4REOA 4W99A 5KMGB 4TMYA 3LLUA 4WDRA 4CI9A 3FYTA 2PLWA 3BAFA 3LCRA 4FCTA 5ILQA 1H65A 3CJHB 4OLFA 5A4JA 4BMNA 3D4LA 1IWPB 1QU7A 2I7TA 4ALKA 5LBQA 1EK6A 2QU8A 3LKZA 4YP0A 1E3DA 4HZUB 2NV2B 1SIUA 4AZVA 2PRZA 3DYVA 3UVEA 4C4SA 1HMPA 4HDAA 2WYHA 2YVKA 2Q4OA 1SZDA 3KX2A 1Y1RA 3NMUC 1MAUA 5TS3A 4FLYA 1O5TA 1ZQ1A 4B4WA 2VXYA 4AKEA 1BG6A 4J0QA 4LYDA 1GRJA 3QE3A 5E2AA 3WADA 2EBFX 4IQ0A 1GSAA 4QSMA 3OD4A 2JG3A 1T5DX 2AG6A 5FOXA 3RYHB 5F23A 2BSKB 2HJDA 4BLUA 5FOSA 1RLMA 4L9WA 1QO0A 4OHWA 3ZLVA 3AONB 3WJRA 1OZ0A 2TMYA 1Y74B 3I32A 1UBSB 5KYTA 4DCGA 4U2FA 6GPBA 5L3BA 2OA0A 2DYSC 3BM5A 3I04M 1REQB 4TV9A 3SHOA 2WIGA 1KOGA 2H18A 4M8KA 4PC6A 4NVPA 1C1DB 3QKRB 4DL9A 5C81A 2W6ID 4BNZA 2P3OA 3U9TA 1CUUA 3C3PA 2W2LA 3DO6A 3WP0A 4CUKA 4B43A 1A4RA 4FFNA 1U0NA 4FE7A 1CQZA 1GN9A 2IPOA 1E99A 4CQNA 4F6EA 1WTAA 2RSLA 3L41A 4TKVB 3RAEC 3M6UA 1SHJA 1R4ZA 3U7HB 4TL6A 5B12A 1D5CA 2GCGA 1TO6A 5IM5A 1CVIA 4OXRA 4Q5IA 3GJ4A 3WYCA 2ATEA 2CLCX 5JDCC 1WKBA 1KARA 1E3TA 4DPMA 4KITB 1IEQA 3IYLW 3VSCA 3BHNA 2QN7A 4G0OA 1LB1B 2CD9A 5IK2A 3T3DA 4IIGA 4R3NA 4CH4A 5DHUA 2AUNA 4ZALA 2ZKIA 1NVXQ 2JI4A 2QTRA 121PA 2L17A 4A23A 3MGGA 4WK2B 2C99A 4JNKA 4JGIA 1CUSA 4RVSA 4L4XA 5SICE 4D9HA 2VP6A 2JLSA 5JNRA 4MLPA 3QPBA 2VXBA 2JAOA 3FI0A 2OC9A 4I9FA 1CZUA 3CMEF 1XCGB 3ZWXA 1S1CA 2PX3A 5CFLA 3AFHA 1D2AA 3GEMA 4IAOA 1JHQA 5KYYB 1NMUB 4DV2B 3IBGA 2NWQA 4QRDA 2WWRA 2QE7A 3FNHA 5FI3A 2EQAA 3UFXB 5A5DA 2JRCA 5J23A 5EKTA 3VJLA 2EGGA 5EXXA 2VC2B 2RKOA 4PONA 2H8EA 4N41A 2H1WA 3PNQA 2CXTA 1WZEA 1GG8A 4LGMA 5AR1A 2CAZC 1G6KA 4DTCA 1KDVA 2M32A 3MTBA 5K0CA 1Q6YA 4JROA 1LR1A 4RFSA 3JQ6A 3OLWA 4KREA 1VCIA 5J9FA 1QVWA 1UJNA 3ZRSA 1IPHA 1WPGA 4J1TA 1YK0A 1KSHA 3S02A 4UBOA 4NH4A 3T34A 3KXLA 2D2IA 3K8QA 2BD0A 4BNNA 3SC6A 3WK8A 3NXKA 1G2QA 1NLUA 3FMPB 1SJ9A 3E35A 1OXVA 5FBVB 4PO3X 4Q4JB 1NIJA 4N5NA 8LDHA 2HU7A 1O6BA 2OORA 1EWKA 2CLOB 2IQQA 3UENA 3SPHA 3Q6IA 3LFUA 4PLGA 1P19A 4ARVA 3P0JA 2ZIGA 2QXTA 4IDGA 3CRAA 4IKOA 2PTGA 2ZJ4A 1FP7A 1TEZA 3K58A 1BMDA 2IP4A 2SBTA 2DR3A 2I3AA 5FNVF 2PK3A 3KAPA 2PQMA 3VM6A 1CZRA 3DLPX 2HMYB 3LCMA 4R2KA 2QEXV 3HP7A 1FY2A 2HHHO 3VPDA 3VTKA 3T7RA 3U4QB 1LI4A 4WK6A 2HBRA 3DCYA 3I2HA 4MVJD 1Q0ZA 4D0GA 2ZDIA 1V5EA 4DCUA 3S68A 3KEGA 2JIOA 2KSQA 3IHWA 3Q7PA 4WFGA 1P72A 2AZTA 3CRZA 1GTVA 1PEDA 4Q7KA 4WXYB 4Q12A 3JSNA 3H65A 3UMYA 1QDEA 1C0PA 1T9AA 4ZCLA 1PWYE 3KSUA 2BFCB 2ZU0C 3LDTA 1L5WA 3SYPA 1JFFA 1XCMA 3O4RA 3PXGA 1JEYB 3KHKA 4DM3A 4N5MA 5CX1B 5EZYB 3CEHA 4H7FA 5H1YA 4OJQA 1NC1A 5TPZA 2GUZA 4DV5B 1IHPA 4QOSA 3DBLA 3LZCA 4BVFA 2FN3A 1FCJA 4DA8A 1KNKA 4M1SA 4KAXA 5HDQA 3SE7A 2K5UA 1G7RA 2PG3A 4EPRA 2BGIA 3QIVA 3BJIC 4D9CA 2YS8A 1ZH2A 4OY3A 4FZVA 1BW9A 3CYOA 2QGNA 1HG0A 4ETMA 1K9MW 1USKA 1XEWX 3WGGA 2OTCA 2F4NA 3CKMA 4MRNA 1P5HA 1P9OA 1C80A 4XLLA 4CQMD 5KHOC 5FNVA 5JYEA 2Z95A 2EBWA 4H27A 1HP8A 2IGBA 3K5WA 1XXHB 4KQWA 3SYLA 1RSOA 3HA5A 2VCHA 1TL7C 1YJBA 8MHTA 1EFVA 2IGTA 4AYTA 2NLJC 2YBDA 3AF3A 3TSOA 4B48A 5KTNA 3E9CA 2HPZA 4HPXB 4FIPC 3K31A 4DEVA 1PQ4A 3GNQA 2IPLA 3IESA 2AC7A 1Y4AE 4LXQA 2Q4RA 3JRWA 1QCEA 4QYWA 5D3MA 4YIHA 1UT6A 3BD6A 2OO7A 4X45A 5ENVA 1PQYA 3FPAA 2AH5A 4GECA 3IAS1 3IA2A 2WMOB 3I5DA 4CTMA 4BNJA 4ZAFA 5C1DA 1JR9A 1H2YA 2GH1A 3HV2A 1VQOF 1NZJA 4R1PA 3OETA 3PU6A 4CQMB 1N0JA 3B6KA 2P4SA 5BQFA 3H97A 1YDHA 1VRVA 1X7YB 2QRNA 3UO2A 1JSXA 1CLEA 2FW1A 1ESCA 1ETHA 3LVQE 3W5CA 3NORA 4FBGA 4YRNA 2VQSA 1L8DA 1KK2A 2UAGA 4FZJA 3D31A 1ZMXA 3T1CA 4IIJB 1LDBA 2IBZH 2OE2A 3ENVA 5E3HA 3OBBA 1XNQO 2VZ0A 2DUWA 4KQ2A 1QQTA 1N6IA 4OXXA 3L82B 2JAXA 1V1JA 2BHNA 2MMGA 4JBNA 1DC8A 1C4OA 3IKJA 2YVQA 5A04A 1DKPA 4LV6A 5KPJA 4RCZA 3JZIA 3O3CA 2MINB 2QP4A 3TX6A 4D0SA 3EE6A 2JASA 2DUMA 5BN3A 3GUCA 4B4DA 1J22A 3RSQA 1LBEA 1MMMA 3V7YA 4I9UA 2CT8A 3F96A 2FPRA 4QAJA 5B1BB 1JIQA 2UYNB 4F9FA 1S2GA 4NECA 3T8YA 4OV6B 3SNHA 1WA8B 1JF8A 1MQSA 1P45A 1MBZA 3SGIA 3ZMZA 3O03A 2PCJA 4DJAA 3LTNC 3K2IA 2Q4PA 4EB0A 4W9MC 2MYPA 3UJHA 5TF0A 3IILA 3FD6A 1GO1A 2XT9A 4BLOA 5E9QA 2VHJA 3MGKA 5EMLA 5IY5B 4UVIA 3I2GA 4GD3Q 5EIOA 2ZB4A 2JHPA 5DX1A 1PR6A 1RCUA 5JC8A 1DQSA 1E5DA 1JPVA 1B76A 4XSGA 3G2OA 1YZTA 3P0EA 1LVGA 2VGNA 3BK1A 5HX7A 4I1PA 1TOAA 1QRSA 2P9GA 1RTTA 5T64A 2NU9A 3WY9A 4QTXA 4P22A 5J2TF 3LUGA 3F47A 1BE1A 5G3YA 5K3SA 4BJ1A 4YMUA 2J5BA 4C2BA 1H2LA 2UUAB 5E7IA 1GIAA 5CU7A 4G0MA 3W8NA 3HUEA 1HZZA 3V1KA 1W4BA 3ZMVA 4KR7A 4J2HA 5ER9A 2DKFA 1ESDA 4KR0A 2GZ3A 2HKIA 3S0YA 2UZ0A 5KX5A 2H57A 3LK6A 4GMKA 1A71A 2O9JA 3AH8A 3VMMA 3OBWA 4F2HA 4K28A 3ZRVA 1ZMBA 5C80A 1R37A 5CDGA 2EXXA 1SWWA 1R6DA 4OSPA 3OOSA 4AZWA 4WD3A 2SCUB 3ZCUA 2XEDA 1XTQA 1M56C 2J41A 3L46A 4CPDA 1N36O 1W49A 1J09A 1PS0A 1WXQA 4Y2RA 1JDSA 5BRAA 2CYAA 3B6EA 3DGFC 3NKVA 2CTWA 3ZWYA 5EWMA 3PVSA 4QDXA 4Z9AA 1QR2A 3ZIAA 4LNAA 3MSCA 1YHQF 3K9AA 4JJ6A 4QYXA 2N04A 1P9WA 3GB9A 1ATZA 1EP3B 2WHQA 4RQTA 3OX3A 2QVGA 3UWPA 4IF4A 2EEPA 5JCZA 1S4MA 3B3QA 3CO0S 4QDTA 4UVHA 1RQXA 4QBHA 3UCXA 3ADCA 3A1SA 2XAQA 4L51A 3U13A 3TOSA 2FQYA 3G5TA 2QN1A 1EHYA 4TRMA 1CJSA 5DT9A 3LPAA 1JR3E 5K3CA 2EARA 4MNTA 3GCXA 1JHPA 3MJ4A 3S03A 4YRLA 4D02A 4P9NA 2HCTA 3QPCA 4IRXA 1ONPA 1DKMA 4AS3A 1EVYA 3WL4A 4GKAA 2FP3A 5AM4A 4BWVA 2R1VB 1NYLA 5KU1A 1MPXA 4KQIA 4MLCA 2HSEA 4B6PA 1XMIA 2PQ0A 3QLEA 1UAAA 3N0RA 3FZGA 2NSYA 1DBFA 4LW8A 1D8TA 3RC3A 1U1FA 1FFEA 2OVFA 2GDZA 1P5FA 2BMWA 1V71A 1ZNWA 3KZ1E 2XLBA 4F8JA 3DZFA 2BHSA 5EAZA 4Q4CA 4EG5A 2ATVA 3FFBA 1E66A 2A1TS 4HVCA 2QK4A 3CX6A 1Q7RA 4JOBA 4TZZA 2P68A 1WZIA 3ROXA 5AKHA 1U3UA 1PD0A 5EQTA 3PFCA 1YQQA 4R81A 1EFPA 1T25A 3ME5A 4KIGA 1L5GB 2H1CA 3VPSA 2VBCA 2UUCB 3HXKA 3I9LA 2KE5A 4CQJA 4OHBA 4D8WA 1SUIA 1XILA 3KZVA 1PXWA 4U3FH 4IZHA 5K3BA 4MV6A 1GTOA 4LC9A 1HTBA 3IODA 3QRWA 4RQUA 5IFLA 1TYBE 5L3CA 2R84A 2HL6A 1ENZA 2XGMA 1YR3A 4Z53A 4XPIB 4GC5A 4LMBA 1Z4MA 1UKYA 2J6IA 3S27A 1LJ8A 3AF2A 3GO4A 3RSHA 2NXNA 3UAXA 4ZI3A 2QRKA 3P30A 4UD6A 2VHEA 1GZHB 4YWJA 4XGRA 4DR1B 3T80A 1R0LA 1Y8QB 4PI0A 1W0JD 3CX5F 3DHEA 5T6BA 2H1IA 4IS2A 4MS3B 5FUXA 3SHWA 1CU1A 4QPJA 4PG4A 4Q3NA 1WZCA 1Y3CE 1JDUA 1UEJA 3U4HA 3Q8WA 1KQSU 1MVLA 2SHKA 3FTDA 1I51A 3DMTA 1E1RA 1OPXA 4NOLA 5TT1A 2YVLA 1ZN9A 3QVVA 4M1KA 3CZCA 3C8HA 3OTGA 2D0OB 5JMPA 5DGTA 2MOKA 5FWAA 1Z0AA 2CTQA 1FXSA 1M6HA 3V1LA 1WMBA 3I4CA 4QELA 3QVUA 1FX1A 3NP7A 3F4BA 1ZBDA 1N92A 4J3FA 1LBSA 3VC7A 5JROA 3CMMA 5CPBA 4G0VA 3NC4A 2IUSA 1VBMA 4NFYA 2CE7A 1KORA 2PA0A 5T4BA 1ENOA 2VYND 3T5GA 5KC8A 2NU6B 4NTZA 4MKIA 4PRKA 1NS1A 4QDJA 2DWQA 1ZFNA 3N2GA 2E85A 1NOIA 1OHHA 5BVGB 4LJYA 4WQMA 4EDFA 2NPIA 4XYEA 2PF4E 1E1QA 1YU6A 4TN1A 3GJQA 4LYGA 4JLDA 4OM7A 4FZ3A 4CKWA 3FVQA 4JIMA 5CCEA 5ALDA 4NK4A 3E9ZA 1ADCA 5REQB 3HDYA 5FADA 3WLQA 3SHQA 1DUIA 4TV9B 2YV1A 5G0WA 1V39A 4MDYA 1CUCA 1GTL1 2RMKA 4BPBA 2Z2KA 1V45E 1EKXA 1GZ3A 5FPOA 1ZCJA 2C8KA 1ZJ4A 1BEEA 3JPYA 1XVAA 2IF0A 1QLWA 4YWHA 5TMDA 1XALA 2N75A 2LBXA 3A0UA 2VOJA 2CL5A 1QC5A 1YK1A 3OR7C 1MABG 5AVJA 3FNBA 2FK7A 2RHTA 3IDOA 4DSTA 1AKWA 3VQTA 1C7JA 4M36A 4JI1B 3N5KA 3R6TA 3G2HA 3LNNA 4B2LA 1QP4A 1WIWA 3NJ4A 3VAZA 3OQVA 1ZM3A 2EG5A 4BU0A 1M7BA 4KGXA 5AW3A 3A6GA 4D2IA 3VKUA 3ETLA 4XW2A 1QYVA 1IJFA 4ZC1A 1G98A 4G1VA 2F1RA 5A4AA 3W1WA 3RIHA 3H1BA 2UYKA 1OXBB 1HWYA 4PZPA 1K3UB 3CXHF 4XBFA 2CXHA 1WUTA 4Y6SA 5JQWA 2G70A 1NNUA 4M53A 1TX4B 3T0IA 1QV9A 2AZMA 2WK1A 2WV7A 2X5XA 2PXHA 3IP9A 3RIXA 4MWCA 1TNDA 4D9GA 1IJEA 1N9ZA 4M9CA 4I7EA 4NZ9A 3U4AA 1VE7A 2V3VA 1U8EA 3G89A 4V2IA 4UVAA 2XT0A 2CHFA 5A4FS 1EFTA 5GGXA 4I0WB 1VQNF 2PEZA 5DXJA 5EOVA 4PZEA 3ORYA 5ICSA 5CT9A 1XZQA 4UCTA 2WNHA 4CM5A 3PZRA 4FPPA 2BFBA 2ZYRA 3DFFA 3VTAA 4BFWA 3WGKA 4ZRDA 3QJ5A 3EK2A 1Y42X 4KFSA 2VEDA 4C88A 2P0YA 3X1MA 3GJRA 2Z08A 4HLUC 1JQ5A 1JVMA 2KM1A 3VDNB 3GLHA 5KHGA 2B0CA 4ACBA 3NEJA 3P9NA 3WIDA 2ZB8A 4RTPA 3WPWA 3FMVA 3K0SA 5K0NA 1P4RA 5HEKA 4IKPA 5JSZA 3WSWA 1E5XA 2NZVG 3AFGA 4BMZA 1H38A 4WJKB 2PZMA 3GWZA 1ZEMA 1NM5A 3G5MA 2R7KA 4LSZA 3DLTA 1R5NA 1MRZA 3CJHA 1QYDA 2W6ZA 5JJLA 2OD2A 2GILA 1K7DA 1XWFA 1E2PA 3M49A 3F46A 3UGTA 3JQBA 2PHNA 1DRUA 4PPYA 2CLMB 3AIOA 2I2XB 5C1OA 3UGKA 3ZNOA 1FQJA 3DHWC 1TJPB 2O2XA 3TRKA 2C54A 3ZE9A 1RYYA 3TR5A 3TLEA 3ZWKA 1KI6B 2GTIA 1DKUA 1G5TA 3CXCU 4HNSA 5G0TA 3VV2A 4OXNA 4PVDA 3D4IA 2ZANA 2UZ4A 1JFFB 3C3CA 4PC7A 5DCVA 2I29A 1Y74A 3OX2A 1PV0A 1D5AA 1U2GA 4BP9A 3W2TA 2VBGA 4FUQA 1AKYA 1REQA 1N33O 1MRNA 1UBJS 2ONKA 2GUZB 5BSWA 3QKRA 3VZBA 1IATA 1QCDA 4QE9A 3CINA 2FETA 3ZDZB 2ETVA 2GPSA 3JWGA 3C43A 4A2QA 2XYHA 4KN6A 5D7NA 2BFMA 2O54A 1CR1A 4MV8A 4J0JA 2W4IA 1QZTA 4OP3A 4FLTA 1DMRA 5IANA 1BW9B 2WJZB 4TKVA 1IBKB 3T7SA 5ALZA 1J0CA 3PJFA 5EJ8A 2DX7A 1GG9A 3SEZA 1XL0A 3DBRA 2JEZA 4LRTB 3ZO8A 1FJXA 2BEVA 2ONZA 1D6SA 2V0NA 1DDIA 4MIEA 4R8MA 1RSOB 3KQQA 4A26A 1LRKA 4PD4F 4W7IA 1LGYA 1QRAA 2R72A 3CVXA 5I9TA 3GA5A 3FOBA 2VRNA 3PQ5A 2FB5A 2ZDIC 1D0SA 5K3EA 5E7MA 3EXG1 1G5IA 1N36B 2QTVA 3KKOA 5AM2A 4F2DA 5D3MB 1TO2E 2VNKA 4D26A 3DKRA 2ZOVA 4TS3A 1WPXA 3QQPA 2HUNA 4FW8A 2I55A 4AVYA 1PNVA 1WHSB 3L4SO 5C37A 3JD0A 1XAJA 5A2QM 4AXBA 2CBZA 4ENSA 1JDTA 1MJ5A 4ZRMA 5KYYA 2I03A 4PPGA 5DULA 4NAUA 3O9VA 1Y3AA 5KPDA 4O59O 1C7IA 3G3EA 1KYOF 1MLDA 5PGMA 3I6BA 3NCTA 2O3SA 3NS7A 3MQ2A 3UFXA 4G8DA 5KTRA 4YA6A 1BU5A 4EI2A 3U0BA 5DWQA 4R2HA 4JUAA 3GJ7A 3AF5A 1EDBA 1OBOA 4E51A 1CUBA 4ENRA 4FFDA 2ZJ6A 4LSGA 3KUCA 3J81k 3IKTA 3JATB 2H1OA 3GLKA 3ZZTA 4G4IA 2FSPA 1RDFA 2R1ZA 2A0YA 4H31A 2LPMA 5EZYF 1QG6A 2GM9A 4M9XA 2Y1XA 1E2NA 3EORA 4MVJF 1V6CA 3EVBA 1Y3BE 4ERXA 4KVFA 1DF5A 1RBMA 1GFIA 5G4VC 2QWQB 4UQOA 1VQMF 4P3NA 5BN3B 1SETA 4CW7A 3FN4A 4EKNB 2AMTA 4BFZA 1UJ5A 2GV9A 1GU0A 4Q4JA 4UHBA 1BMFA 4PDVA 3CXUA 1GUBA 1BH2A 4EFNA 3BD7A 2AX4A 4NJOA 1V8PA 3RTEA 3OQ1A 1BE0A 3AZPA 4HYTA 3DZ8A 4PGHA 1V8BA 3SM3A 3TCKA 5B7GA 1QIHA 1SVNA 3WDKA 4LV8B 2V7EA 3S2SA 3OX4A 1S2MA 3PFWO 4GC9A 3U4QA 4L9RA 4FYPA 2PM8A 2F7SA 1JPJA 3DDZX 1QVFU 1U9YA 4G27B 2P69A 3M4YA 4N21A 2YI9A 2P35A 4ND4A 2RIRA 1QQAA 4UU8A 2F95B 1NV8A 4K9DA 2W8BC 2R4QA 3TQHA 5JANA 1FL9A 2ILMA 3G17A 4R1OA 4MI3A 3TLJA 3RRFA 3TLCA 3EVNA 4FQ8A 4PNHA 4CU2A 1PNTA 4K9NA 4EB6A 3D4PA 2PMKA 4JP8A 1CD5A 3ICEA 4TXHA 2LXNA 5EZYA 4OHRA 1RI1A 1Q84A 1I1OA 2OBBA 2ZJAA 3DZGA 3PQ3A 4OHMA 1KAEA 3AEXA 2C9OA 4LXGA 3FNQA 4XDYA 5KX5B 3STVA 3ICWA 4YY3O 1ID8A 1ONBA 4CZZA 1BSMA 5DT2A 2Q3JA 3ITKA 4XWAA 4IIJF 3JZFA 5JHHB 2A30A 2AK3A 4JAVC 3BIOA 2BKUA 1VF5B 2YKGA 4Y7DA 2D0DA 5JFGA 5C5CA 3B7GA 3M4JA 4GLLA 2I33A 2ACWA 4ZODA 4JEMA 4II2A 4PR3A 2AR9A 5BYJA 4QNHB 1WDLA 3L1JA 3GNLA 1VYTA 4EW6A 5LBIA 1E3QA 1NONA 1TJ4A 2IKSA 2REBA 2JFOA 2P9JA 5EWMB 5H59A 4L87A 1R6BX 3MQ4A 3Q8HA 1U02A 1HEYA 3FWZA 2IE0A 1PT8A 3RRMA 3SE0A 3D64A 3RS3A 2CLKB 4EFEA 2P1DA 1ZG3A 5TE9A 3LUDA 3P5SA 5DTJA 1SBCA 1XTJA 5EUQB 2FUNB 4DV2O 1M8FA 1RKUA 3RSGA 5F64A 4DMLA 3CU5A 3IAHA 4PZCA 4KK4A 3O8DA 2YZNA 5H83A 3NALA 2JATA 2GXUA 5EZSA 2GZAA 3GVPA 3PD0A 4M21A 4YI3A 1RPZA 1FRZA 1L7VC 5TVGA 3I8SA 2ZT7A 1TZKA 2ZM6B 1SRYA 4CQMA 2EX3A 5DYYA 1OF1A 1Z0ZA 2UZAA 1KDOA 1D2CA 1FRVA 1XZDA 2GFQA 1XJQA 1X7YA 3ADBA 3N8GA 4TQAA 4CLEA 3ENZA 1JKFA 5JTUA 2WU4A 3ICQB 1JQLB 1V6AA 3SR0A 1YH3A 5DM0A 1G1MA 1HL7A 4IIJA 4PG8A 1JEQA 3PUJA 2DB3A 3KUUA 2GUGA 1W2BF 4JEIA 3Q72A 3ZHZA 4Q3DA 3KB2A 4IICA 4K2AA 1ZM4A 3CLSC 1E3EA 3L7IA 5EIWA 4NBKA 4NCJA 3VPCA 4RVUA 1NF2A 3FZYA 4QYTA 3IR9A 2PSHA 2AB0A 1G18A 2MINA 1BXGA 1Z38A 4P30A 4TUYF 1E1MA 2G0AA 4G4ZA 2DR0A 3ABSB 3IOCA 1VK3A 2C1ZA 4A91A 2OCPA 5DBEX 2JGAA 4I55B 4G4YA 4E5UA 1WQ4A 3PUHA 1RKXA 3J7AC 1EFPB 4EG6A 1X7PA 5AXBA 1II9A 1T3TA 3EY9A 5EMHA 1JJOA 5HK9A 1DKLA 1KYIA 1NQXA 1WA8A 3FKSG 3BTVA 4XD7D 5HYVA 1OU0A 1XDBA 3BGOS 2QXUA 4GLBA 1MB0A 2H5EA 2VYFA 2EIMB 2QRGA 2XUIA 2CVFA 1CG6A 4HX5A 2QKCA 2FPLA 4Q9NA 1GG2A 4MX8A 5HK8A 2JCSA 2B20A 1UCFA 1Z18A 3ZVLA 5KJ6A 5K6AA 3HCBA 4QPZA 5JWOA 1T5BA 4LGVA 5EE0A 1JQDA 4UHCA 1Z0DA 4X90A 1O57A 3FETA 3KHTA 2PRIA 1CEXA 3ZE7A 3DE0X 2INGX 1E1RD 5DBOA 4GQIA 3CMAF 4BO6A 4F6RB 3ZC3A 2V5VA 4YXFA 2ZI5A 4BNYA 3LC7O 5IZ4A 4LY3A 1SZJG 2R70A 1Z7EA 3PVCA 1P5JA 1WDWB 3UUGA 2VFAA 5T8KC 2AZXA 2WVAA 4MCAA 2BSAA 1GCAA 5EE3A 3ESAA 3SZOA 3ND5A 4RXTA 2DC1A 5FTLA 3WHIA 4IUYA 3I0ZA 4E14A 1A9YA 1HM5A 5JJCA 2RAVA 1CV2A 1SUPA 1HDRA 3CG0A 1VJDA 2OGWA 3TNJA 1WV0A 5D5HA 1MUUA 1O9BA 4OYYA 3KJGA 4IP0A 4CBCA 4QUDA 3TTWA 2SCUA 3UOWA 3CLTD 1XI1A 1VQ8V 1QVAA 5HIAA 3D36C 2NVBA 1J5XA 1F0YA 4JL6A 2CL6X 1QR9A 4MZXA 4B3BA 4ITUA 4DYHA 4DDWA 2DQYA 1SKYE 4ER6A 2FV8A 4CIWA 3AKDA 2FUG6 4E5PA 2ODEA 1QBKC 4FXOA 4RDIA 4F46A 3LDFA 4JY7A 1Z2PX 4BIMA 3T7JA 3CBGA 1MR3F 4PWYA 4YMHA 3L7YA 5KINB 2V7WA 3LDAA 1Z3IX 1IVYA 4DLLA 3N2GB 2H65A 3LYLA 2RARA 4WH0A 3CE2A 3F8WA 1XIVA 4L8JA 1ICEA 2PKRA 1QH8A 1MX9A 4R01A 1OI2A 3IIMA 2YTZA 3EZXA 3LQRA 3NH9A 4Q66C 3GUVA 5BWOA 1S5LZ 3RSOA 4UZSA 2FZVA 3WGTA 5FOUA 2QGZA 3PSHA 3NRJA 3C6XA 4N23A 1Z8DA 2RMKB 3IS3A 1HA3A 2FW8A 2AKAB 4AX4A 1RPJA 1KAMA 3ZVRA 5EHNA 4FI3F 2OOKA 4QOHA 4R6ZA 3CIFA 2C77A 5FYQA 1TUIA 3J80M 2VBIA 1DXHA 2JAHA 1YR9A 3W6ZA 4ZK7A 5LDDC 5G53C 3OM1A 2XE8A 5ERXA 4QPJC 5EE1A 4YRQA 3EVCA 4UM9D 1YHNA 3IUSA 2OM2A 1HDJA 1YUNA 1V41E 3DMTC 2B2XA 1OMOA 4M7OA 2NX2A 2XCIA 4LRXA 2I34A 2GYWA 3QUSA 2GNAA 2CVPA 1JD1A 1WD5A 1IPEA 3NVKE 5F3WB 3A3YA 2Q62A 4RTNA 5CEJA 3AWDA 1P2BA 5TR9A 5SYMA 4MW6A 1MH9A 2F3TA 3RTAA 4AECA 1YMUA 4D57A 3KB6A 1JR2A 4E5NA 3ZQ4A 4TZ6A 4PLPA 1Y6ZA 3ABOB 3VBBA 2ODWA 2P9TA 1SCBA 3OQOA 2FZKA 2UXNA 2B9ZA 2PMCA 4KRGA 3TTVA 1PR1A 1Q1GA 1RABA 2Q2VA 4LF8B 4UM9B 3P10A 3KKKA 2FE1A 2HA3A 3W0LB 5L51A 1GEGA 1T4GA 1C3XA 2VPTA 3O4HA 3VHRA 3K0EA 2X1MA 3ZRXA 2AQIA 1U90A 2R9IA 4HG2A 1R8SA 4NR1A 1OWNA 3A9VA 1CZKA 3K9SA 4QLOA 2A67A 2UUAO 1FP4B 1NQOA 2DZDA 4G0NA 3KXKA 4BQNA 2B83A 2VUUA 4ZQIA 1NX9A 4BC1A 4IQ4A 1CUEA 2J9XB 2UUBB 2I65A 1KR5A 2IXAA 3R7NA 2BZSA 1YB6A 3FJYA 4QPPA 1F20A 2PAAA 1EDEA 2BFBB 1P0CA 2P9HA 1NSYA 3GZNB 1X1DA 3DR3A 2V5UA 3B4SA 4TV9F 4UARA 1CKEA 3QENA 3O9OA 2IV2X 4D46A 2FG5A 3X1YA 1QB7A 3TZLA 3GLHB 5I3ZA 1R6UA 1Q1QA 4I50B 1JQBA 2OP1A 2C7GA 1HDGO 3HVJA 1H8HD 1RAGA 2GTAA 1NBWB 4M1MA 1Y8QA 1WNTA 2HNKA 2OBXA 4E46A 2QD3A 3ICVA 4MS3A 1JSRA 3KYIB 2J31A 5JSZB 2Y1LA 3T9EA 2QN9A 3ECCA 5JCOC 2VK4A 4OB6A 4R8KA 4YIKA 4IMRA 3C16C 5TPWA 1T5EA 5BPFA 2ZSJA 1ZEJA 3KDPA 3OA0A 3IAFA 1P2UA 3RRYA 4JYYA 2HS0A 2RGEA 1P2VA 1IH8A 1UZNA 2O4UX 2CFIA 3CURA 2EFDB 1NUPA 2R4TA 2AD5A 2BDUA 5CLJA 1JJAA 4DV1B 2YZ7A 4D9EA 1W0JA 4YECA 1MJGM 1F1JA 1MXHA 2FMXA 4S1OA 2NU6A 1L1RA 1OAPA 2HRQA 3VYRB 4DS3A 1YE8A 3IAM1 2BFEA 3ZBPA 2WHRA 1HETA 2QTAA 5IYBO 5BVGA 3QVWA 1CZNA 1YVDA 1RP7A 3BA8A 1WO8A 3COSA 2OFOA 1GGHA 3BA6A 2ZINA 1GZSA 1G64A 2QORA 3JWPA 5REQA 2J07A 3EIEA 3PXUA 3FF4A 4FPXA 1F0PA 1PF7E 5L3GA 1VQ5F 1X7WB 3U56A 4HH3C 1JE1A 3AG3B 4KMMA 2W00A 1MH1A 1GPH1 2PH1A 4AWAA 4DARA 2FWRA 4O2LA 2E5FA 3GLTA 2B34A 4ZOCA 5DEOA 4F8EA 3K70D 3CMEV 4IDPA 1H2AS 4OHXA 4FM1A 5COAA 4TTSA 2E4ZA 3DDHA 5BN1A 2VYNA 3OT5A 4ZCPA 4Y2VA 1MENA 1ZIDA 3GJ0A 5CD9A 1JAYA 4KWHA 1UK9A 1PF5A 3A6LA 2M6SA 4DSNA 4F60A 1A7JA 4J7JA 3DBRB 2EZ8A 2Q0OC 2YDYA 5JAOA 4IDNA 4YY3B 2BEVB 2BZ0A 2O2GA 1MJNA 4ZDWA 2O6HA 3VPAA 3TXYA 4TQUS 1XUQA 1ZOIA 2OUIA 3EDMA 2UUCO 5GIPC 3V9AA 5MGNA 4OSOA 1I7NA 3WMXA 3HEMA 1ODKA 5ENZA 1G8YA 1SOWA 2XBMA 4JYBA 3K70B 5IJWA 3PL1A 1E5VA 1J0BA 3OZBA 1C2YA 3ACDA 2BBTA 2QTVB 4PGMA 3OLQA 3TKLA 5KSYA 3D2BA 1JG6A 4G1EB 3A0HZ 4H1VA 4PHHA 3MB5A 1EEHA 1UKBA 4HAIA 3GQBA 2WTNA 3V46A 3KT6A 2XMZA 4C6HA 3FTFA 4H4DA 2PL3A 4YACA 3OLZA 3ZTYA 1BFUA 1ZITA 4EGSA 1F6DA 2WUGA 3MQFA 2IS1A 2KGWA 4BFXA 1XHLA 1ZIYA 3U5ZB 1VIAA 3K08A 1BMFD 3WFIA 3WLEA 4DR1O 1FSSA 4QT4A 3BXXA 1PR3A 1O6CA 1AGNA 1SQBH 3ETHA 2ECFA 4TLCA 1Z2GA 2V9ZA 3PC7A 2X76A 2G67A 5FP0A 1U65A 1VLVA 5FAKA 1X2EA 3DYBA 1NVVR 4G6ZA 2QGFA 3PGA1 3EMVA 4D8VA 4UHFA 2IXBA 3EUEA 1AQUA 2IITA 1V3UA 3VQVA 1PL6A 5BRJA 2J0QA 5E6SB 3BAAA 3AG6A 1M0WA 2R9AA 3RUCA 4D9JA 1OU4A 1PVOA 4PVCA 4LGYA 4GOOD 1HYBA 4TRRA 4CTNA 1L7EA 1T9BA 3UT0A 1U3TA 3SC3A 4ZO9A 1ZK4A 3GH3A 1DFHA 3RD5A 3A1WA 4F5WA 4BE4A 1Y6FA 4F12A 5DM6V 4M1EA 3L7OA 3AJEA 4LZNA 4DB4A 2KBFA 2HTEA 4QPDA 4GSLA 1QIFA 1VHDA 2GRUA 3AEKB 1AA6A 4WECA 2QM4A 4J43A 3ICPA 5EIAA 3VYUB 4G5OA 3HSYA 2CEAA 4C3VA 2V8OA 3CCJF 5DCWA 3E1GA 4TMFA 4CMIB 3LYBA 2ZYDA 4EW2A 2C7VA 1Z63A 5EB1B 3DLIA 4MDEA 1G21A 4K1LA 4QDKA 3MAGA 1JYFA 3ETDA 1QPZA 2PJUA 5C7OO 3NK6A 1IWBB 5DM70 1GZUA 4OSEA 1KI6A 4DWJA 2GDSA 3Q3GE 2Z2ZA 3H5TA 2JH8A 2BMVA 2HJRA 3HXPA 2O0HA 3K15A 4YGYA 4AU1A 3MS2A 3OCXA 2KYRA 4EB6B 4BAYA 2OFWA 1IFXA 5GZ1A 3EODA 4LOHA 1QH9A 1PT7A 1U0HC 4KNYA 1QPBA 4OLAA 2YJZA 3IAAA 4JI1O 3O1JC 2JANA 3OLXA 2ZR7A 1P81A 4FU0A 1EPUA 1IRIA 4ZO7A 3K71B 4BBAA 2COEA 2I1WA 4LRWA 5I9SA 1XA3A 1QU9A 3D6AA 4EARA 3Q0IA 1VQOV 5A71A 621PA 1ORHA 4ASUA 4LCBA 1GDHA 1XDCA 1HOXA 2VF7A 3RF6A 1NN3A 1IVSA 1MD9A 3P27A 1IYZA 3JQRA 4DUGD 1MIOB 2OV8A 2WSYB 4ALJA 2WQZA 3CRVA 3FVWA 2FGJA 1ORIA 4FGJA 2ODPA 3LX4A 3VNBA 1K8XB 3SYMA 3D3NA 2XNDA 4UD2A 4LF7B 1K86A 2EKZA 4F9TA 5IEBA 3BG5A 1AI5A 4NG5A 2Q9UA 1KFCB 2QVYX 4HXGA 4J4BA 3MJEA 3ESRA 4D45A 3QVXA 4NCHA 4TKUA 4EITA 3CPHA 3IUBA 5AQEA 1WP9A 3BWDD 4NVRA 3GLFB 2LFRA 3WWDA 2IZ6A 4EAAA 5FJIA 3TZEA 5GIOE 3LWPC 3JQ9A 2FSFA 3W5AA 1ZM9A 1MW9X 2P9QA 2O7NA 1WHSA 6LDHA 3DL4A 2I3GA 5DNCA 4AZSA 1N0IA 1R3DA 1M74A 3REGA 4B73A 1X19A 3ENNA 5H6RA 1LEHA 3I9KA 4YRTA 1P29A 1XN1A 1QGDA 1TW3A 3BWCA 1N2IA 2YMMA 3B1JA 3C5EA 2JNBA 2C31A 2WABA 5IVPA 4PXYA 3TLXA 1N6LA 1JEQB 3KZNA 3DDUA 4C2UA 4FHDA 2OMKA 2WJIA 4RZSA 3W78A 5AW4A 5HR5A 3JATA 3F5FA 4YONB 1Q2UA 1NKVA 1ZONA 2RONA 1LUWA 1CUHA 2WFLA 1ZGHA 2OXFA 1E2UA 4GR4A 4YC7A 3DLCA 2IIQA 3H2YA 3IJEB 5KX5F 4HAZA 2OTJF 2QRHA 4B4VA 4DIEA 1RLJA 1T3SA 4IYIA 1BXGB 5U4QA 1ZSYA 2C1EA 1F23A 4QOGA 5AI4A 2L82A 2ZOSA 1Z4QA 1W57A 4MEBA 3IOEA 2QENA 4BT2A 1E2LA 3EN0A 4JQCA 2BGNA 3FMGA 1EN4A 1E7QA 2D7DA 3GFSA 1AN9A 4DWWA 4LRYA 1G0NA 4LWSA 5KZMB 1HE2A 1E4YA 2RIPA 1H4SA 1TC1A 3ILYA 4IOJA 4TLAA 4RMNA 2I80A 1XTUA 1KMIZ 1N9KA 4ODIA 1KB9F 2OLJA 2A0UA 2NXJA 3GXOA 2QTZA 5LC1A 1NULA 3K0AA 3SM9A 3ZQJA 1GFSA 3DB2A 3OI7A 2XUFA 4AQYB 4ZCQA 4LR3A 3F5TA 4Q05A 1NVPD 2C98A 3A7DA 5FQNA 5B8FA 2IKQA 5CYOA 5KSOA 1FUUA 4Z54A 1OH7A 3QFFA 2C4TA 1CR4A 1J2EA 3RWBA 4PO8A 2JEOA 5JW6A 1F3LA 4F04A 3ROFA 2A0XA 1YQXA 2HADA 2B5VA 2AIRA 4EL5A 4E2XA 1U11A 3CM0A 3NH6A 4LF6O 2BRUA 4S1VA 4MVJI 3IC9A 4OXQA 2HY7A 3L8CA 5BMVB 2DFKB 4X41A 1OGJA 2VCYA 3TFWA 2W93A 3SG0A 2VG8A 1YHQV 1RI3A 3FUXA 1D1QA 4D96A 1COMA 5KU7A 1IBKO 1OCOB 1QX3A 4KG7A 1T0PA 1IG0A 2ZDGA 4EH1A 4CL0A 2OM6A 4FLFA 4HN9A 2DLCX 3RU9A 1NVPB 2ZTUA 2IELA 3M1LA 5H5NA 4ZI7A 2BONA 3Q5GA 2BP7B 1J24A 1B06A 1JJVA 1TAUA 2K87A 5LQSA 1M2JA 2E37A 1GAXA 1KNQA 2H06A 2OWOA 5B1BC 4I4IA 2MSKA 3VC3A 3RTCA 3U37A 2YWRA 4PAWA 1G8PA 2QL7A 1Q7CA 4B6EA 1TKCA 3MT9A 1I6KA 2W6QA 1K66A 2HNAA 1JAIA 2P30A 5EHQA 1OC4A 2PR2A 4RGVA 4RZ2A 4KP7A 3TNFA 3U40A 2VJLA 2Y99A 3GFVA 4XR4A 4YCMA 4BV9A 1QHGA 5K6AC 1V43A 5IY5C 3E82A 1Q3TA 3MN1A 2Q49A 2D54A 2DFVA 4GOJA 1II0A 2GPYA 4UVBA 4XYLA 2I54A 4WCFB 4R7CA 2NXEA 3F90A 3REFA 3NBZC 1QH8B 1D2NA 5I9LA 1AMUA 2Z4RA 2LDXA 4Z5XA 3H5LA 1OTXA 4X64B 3RC7A 3ZV5A 3STLC 1WB8A 3KOOA 2XQFA 1IXBA 3H3XA 2G07A 3I42A 4OQQA 2OZLA 3OIGA 3SSAA 1C81A 3SVTA 3UHJA 2X0IA 3LBNA 2H4JA 4Q1BA 4REMA 3GEIA 4N7RA 5I7HA 2CGEA 2O8EA 3SBDA 3RCBA 5HM6A 3R20A 4LRSB 4UMEA 2X6AA 5DE3A 4PLYA 1PWXA 4X24A 4MYCA 1F4NA 1A95A 2RH5A 2VK8A 4B46A 2Q6TA 2Y2UA 2XWSA 1ZLXA 2CXOA 4NWIA 1NBOA 1DG1G 4OH1A 4QXPA 1FS4A 2E7ZA 3MCQA 1QTIA 4AJ2A 5AI5A 1GPBA 3R7BA 4QT0A 3C1AA 2GSWA 1Q0TA 2WP0A 1CK4A 2N0SA 1SB9A 3KSZO 1X2BA 1U8UA 4I55A 5BSKA 3Q3JB 4FM0A 4Q24A 3FDZB 1MHTA 4EKYA 1NNEA 3BK7A 2RGYA 1NHWA 2A9PA 2XTAA 2EG9A 1PWZA 4EECA 2OYSA 4W5TA 1JDBC 2H5IA 3MCVA 4CLXA 1CS4C 2DVMA 3ELUA 3VR1A 5C93A 4BQEA 5IT9A 3TVYA 4C81A 1KE2A 4R16A 1ZWZA 4K05A 5AVTA 3PDCA 4MT8A 5CFRA 5FBWB 5JT1A 3FWPA 5E4FA 1N3IA 1GMGA 1YCDA 4MGKR 3DOOA 1NVMB 4ZCIA 3SYRA 5M5BA 2A86A 4YAKA 1J0XO 2WHXA 5IJAA 2GBIA 4BNIA 3M4ZA 4F6RA 2PS1A 1A9TA 3LT2A 3BMCB 1J8VA 1Q8RA 3IFSA 1XLUA 4XD7A 4E33A 2CGOA 5FRDA 5FNZA 4OIMA 2VP3A 1YONA 1T6XA 3II6X 4UW9A 1IIRA 4HVTA 1YHYA 2IHKA 1L5FA 1R10A 3CEAA 4CNBA 3A6KA 1UKZA 1L6IA 2FN9A 3QPDA 1Y7TA 3TTUA 1V26A 4ZK6A 4X93A 5HUJA 3WWYA 4ZQBA 4TT3D 2OHVA 2ET6A 4M1TA 3AMVA 2FN7A 5HJ7A 3A04A 1EHIA 1YMVA 3BDIA 3E5MA 5JJEB 2WBLC 3ZS8A 2QRLA 4GOKA 2OGUA 4C1BA 5TPWB 5CPFA 4DIDA 1UPGA 1OD6A 3LKBA 4I7ZB 1XTTA 5JECA 1HFEL 4CS2A 1AMNA 3HU1A 1EDOA 2RI6A 1ODEA 4Y67A 9ATCA 3T9CA 1SD5A 2FZLA 1RWQA 3I3OA 4I6EA 5EC8A 2DW4A 3Q41A 1DKOA 1VCOA 3HSKA 3N1UA 2F90A 3QBTA 1O0BA 1T24A 2P0EA 3MAQA 4BGVA 2ZM6O 1XR3A 1NUSA 3AP2A 3GEGA 2EVWX 2BTEA 2GPBA 4D98A 4BRSA 2X0FA 4UBMA 2X3FA 3EEQA 4AJ4A 4QDUA 3F0DA 2BFEB 4FI3C 4ZYZA 4GU5A 2Y1CA 3T1NA 3T38A 2AYXA 4BLTA 5ALIA 2WLMA 4M0UA 3EISA 1NVAA 4C8GA 2ICAA 4U7TB 1G8JA 2G36A 2HA7A 4H7KA 1U63A 1NR5A 5D01A 4L08A 3CO5A 1R0WA 4C4OA 4MKXA 3BVPA 1MA3A 2PWYA 1FFXB 4A4DA 1S77D 2WAXA 4J7CA 4A2CA 3H1HH 4R8VA 2HF8A 3IUQA 1XZMA 2BM9A 6AT1A 1QYCA 1K3EA 4CCAA 1UT8A 4L0QA 3QXCA 3CLUD 4QUJA 3ES9A 3FHOA 1IMOA 2IZ7A 3A4YA 4OJTA 1AK1A 3N8HA 5IZCA 4K9OA 4P7JA 1VQNV 1FXWF 4I50F 3OTWA 2LCIA 4W5WA 4YMVA 2UKDA 4E4RA 3MC1A 1V54B 4J03A 1TA9A 3IJRA 1ZJWA 3VFDA 4ZQGA 3AJ9A 2XODA 1LDYA 3NIFB 3EZFA 1NDUA 3CF4G 4MIKA 3BJMA 2QWPB 1N5DA 1XTZA 3ZY5A 1ID1A 1SVIA 2HLNA 1RPRA 4TMXA 5ITZA 3UJ7A 4FX2A 2LNDA 1W48A 2FW6A 4UPDA 3FPSA 2DR2A 3BMQB 2H29A 4QHTA 2FL4A 3GQBB 2MYNA 4FJ0A 2RJNA 1QTNA 4C1NA 3LU1A 2BLNA 4CIVA 3IKEA 4F7DA 4IFEA 4AKIA 4HJRA 2WWVD 3WKEA 2GB4A 3ZBUA 1CEZA 1N2BA 4RD3A 1A50B 1HRKA 1FSZA 3VNQA 2FYUH 3UA4A 3SDZA 5ALJA 1FP4A 3P2YA 4B3FX 3TL3A 1V1RA 3OM3B 3FX2A 3WQRA 3SYOA 4RSHA 3A2MA 2Z30A 1CQXA 4BCDA 4M1ZA 2IYWA 2V6JA 3QVJA 3A1TA 4Q4AB 5ALXA 3FSRA 1VB5A 3HB0A 4Y6RA 1A4XA 4ZVUA 2RK3A 2JEUA 1ZISA 4ZEMA 1PTKA 3GZNA 1IHDA 4PQYA 2PWAA 1YI1A 3EG5A 1DAFA 2QMUA 3FR7A 3LDUA 1CE8B 3CCLF 3K7EA 1FXWA 4ZPXA 4I50A 4J49A 1P0PA 3EYWA 3LK7A 3ZTTA 4EUNA 8ATCA 1ULSA 5IFKA 5EUBA 1ML3A 4YMSA 4IXMA 3AXSA 1YGPA 3KKYA 4GRIA 1JAHA 4X66B 4YJDA 4Y2JA 1K4KA 1K5GA 4JD5A 1Z68A 3GFOA 5DYIA 2YUTA 1KQPA 2X8BA 5KJFA 5SV2A 2OQVA 1TYEB 4UULA 2BFFB 5YASA 3SEQA 3WK9A 3AEUB 4M1YA 4LYYA 1OLUA 3P20A 2ESRA 1T8WA 4J7UA 2IC5A 4XWKA 2O2EA 3IALA 4BKQA 5B5EZ 1VHJA 2ID4A 2ZITA 1E79G 5C5EA 3D2LA 5KAPA 1LI5A 1G21B 2QX6A 1G2PA 1H8HA 2ADPA 1E9VA 4KH1A 4ASUD 3M9LA 1Y34E 4TLLB 1TC2A 4FMCB 1RBZA 3VQWA 2RHHA 4G81A 4U0KA 4ARZB 4ZEVA 4RHAA 4KX3A 5GTHZ 3H4VA 2WV9A 3NVAA 1CUZA 2PO5A 4Q3LA 1Q7EA 1EXNA 2ORIA 2VDOB 2X1HA 1K08A 1CFJA 3I1YA 2IU3A 2AVDA 2HFEC 2WA4A 1KZ7B 4HSEA 3UKOA 1ZUHA 5ICGA 2XGGA 3KPJA 6ABPA 2ODAA 4RENA 2XNDD 2C5EA 1X7WA 4K6CA 4J1TC 4RFVA 2E4UA 2MTBA 5L3ZA 4IZIA 4WADA 1J42A 4ROSA 3I6MA 2YN2A 2Y77A 4LF6B 4TLBA 5CLQA 1EAMA 3CLKA 1L5NA 4MUXA 2HRBA 3AGKA 4E07A 1YQEA 3RVDA 3LNCA 2OORC 5TV2A 5K20A 2VPYA 5FAXA 4F6CA 2V7QG 2WOOA 3QZUA 1PFVA 1Z5ZA 4Z1MD 3I37X 4D9MA 2ZRQA 3WGHA 4ND2A 4KSCA 4CH3A 1DTWB 5M2QA 1S2IA 1K0UA 5KAMA 4LF8O 4EUFA 1QUEA 1VI5A 4JT4A 1JXMA 2QWOB 1PRYA 4UE6A 1ZRNA 2OO5A 1E5TA 3MJSA 3DV0A 3ID6C 1SUFA 5T3UA 5G40A 1XO1A 4FR5A 4IZOA 3FX7A 2ZU6A 5KTPA 4FGZA 1RJGA 4TKUB 3JVEA 1A7UA 4EYGA 4OK6A 2JIZG 3IULA 3HYTA 3BXGA 3PDUA 2ZQZA 1FA9A 3SOZA 5JUWA 2O8FA 1NP3A 4BQIA 5CG1A 1VQMV 1GCOA 5C1IA 4KACA 2RAFA 1IOLA 2UUBO 2V7XA 3JSAA 2X9QA 2D2CB 2O5RA 2OPBA 3VU9B 3TW0A 3TL6A 4LHSA 3OM9A 4PO1A 4Q3OA 1N5KA 4YLYA 2QI2A 2XXJA 3E1KA 1TFUA 1YCHA 3NYRA 3QXJA 2GEVA 4LYEA 5FOWA 3BK2A 1G63A 2B78A 2HIAA 4CKBB 1MX1A 2IYYA 1GQ2A 3SSMA 4HLCA 4ZN6A 2IH5A 3CNBA 1NZDA 2A06H 1ZNZA 1VYUA 2F23A 5AVYA 2VA9A 3QYPA 1HO3A 2W37A 1RKBA 1EA5A 3E9MA 2K1SA 5B6JA 1RHJA 2WFLB 1QORA 1YFJA 4QU9A 3MINA 2VUIB 2W7TA 5E6SA 3J7AU 1CRPA 2EBHX 3LUJA 4HEA6 2GFHA 4RJLA 2O3RA 1CP2A 1VLMA 4WZBE 1M2HA 1RLGA 1O5IA 2BIFA 4L5AA 4ZVMA 2ZPAA 2PZSA 1YJQA 4L5YA 4UMFA 1KC8W 1E58A 2XRMA 4DV1O 1QTRA 1YOBA 5JYCA 5DLQC 4UHKA 4GL2A 4URYR 3PUYA 2HB6A 1TYDE 1K4MA 2XGJA 4I4CA 4LWSB 3RE3A 3PE3A 4FB5A 2J5RA 3BMNB 2C2ZA 1B8NA 3AEKA 2C03A 1T8UA 1MX5A 4C3UA 4UV8A 3IPYA 3MMPA 1SQFA 2H4FA 1C3VA 5F1OA 5FXMA 3WLSA 4M37A 5AJHA 3BABA 4FCWA 1ATIA 1T35A 3P9ZA 3K0AB 3WBKA 3UEOA 3ETQA 4ESHA 3W7VA 3EUWA 1Y1QA 3M70A 4H3KB 4CMIA 1H2KA 1PPJH 2IS6A 3FCCA 1NJ1A 4GI1A 2QUHA 1LRLA 5TGZA 1HNWB 1DS6A 2YXHA 4YXWA 3ZLJA 3UAOA 2HD4A 3AM3A 2YWJA 1VBNA 1PDWA 4DRZA 3BE8A 2RB9A 2ZJZA 3OPVA 4R98A 4BZWA 3JAKA 4MGHA 4UQLA 3L93A 3HJCA 3SS7X 4RVGA 2H0QA 4CC5A 2CF5A 4DIOA 4XXHA 2ZSKA 3SJUA 3N9IA 3T7AA 5LQKA 2OK8A 1ZHOA 1LDNA 1KKMA 4F2PA 3DMNA 4RIFA 3VR6A 1GEEA 2ZAMA 5AVZA 1YJ8A 2E48A 2ZTHA 5JAIA 1W6UA 2W2KA 1HUQA 1Q1EA 1GWNA 1NYRA 2QUIA 1OB2A 1P61B 4X0EA 5MN6A 3SC2A 4ZI7B 1J5EB 3B1ZA 1F4VA 2I9PA 3CW2A 4W9NA 3TL2A 2AJDA 4KFUA 1R6TA 1EZ1A 3DHVA 1UZLA 3A6EA 4B7UA 3IVRA 1MIOA 3OY2A 1YIDA 1X1SA 4EY5A 5KUMA 1YUMA 2PWPA 1FP2A 4MP3A 1YVEI 3MAJA 1VKRA 2ZRIA 5LIPA 2PX2A 4P7BA 4RPJA 1U3CA 3DFZA 2K9PA 1YXMA 1NBIA 4O25A 1XTRA 3BORA 5HF8A 3PYMA 2XQJA 2BI7A 3QWIA 2W48A 2QKYA 3HCFA 1EQ2A 1VSBA 1JJFA 5DSTA 2AXPA 4Y3UA 4IIFA 2BELA 1U9IA 3GLFA 1WNFA 2QM8A 4M8IA 1H5QA 4YN3A 4FC6A 5B66Z 1MU0A 2YBEA 4TMZA 4BUZA 8OHMA 2VSFA 3ABRB 3PPWA 3E03A 3L1VA 1UWKA 4DUGA 2TMGA 2ZJ5A 3MT7A 1SN7A 3RYTC 3PICA 1OYOA 4EKIA 1E6WA 2OZLB 4L07A 1Q5OA 5BN4A 5B3SB 1RI4A 4GEKA 2OFFA 2QG4A 3H1KH 3FFAA 5EQDA 1HZZC 1K75A 3MBKA 5JWRA 2XWBF 4U9HS 4GYWA 3CCFA 1XRQA 4EKDA 2XUMA 1PZMA 3JALB 4UUBA 4FYJA 2O8EB 3DEFA 1KPGA 4UCQA 1AS2A 4PYOA 3RTBA 4OPMA 1K27A 4LP8A 6YASA 5ES4B 2DGDA 1W5AA 1WPRA 1BZYA 5BMVF 3WB2A 1MSWD 5CDUA 2YXDA 3E9NA 4KO8A 4CEHA 4WJZA 3EPRA 3RBXA 1JLLB 1I7FA 2X9LA 4YBZA 4IOMA 2D5CA 1K0FA 5CJ2A 1AR5A 1TTPB 3DO8A 3KYBA 2OPHA 3CMAV 3H9QA 5LGTA 3LDEA 3B3AA 4K2HA 4CRWB 4QJIA 3IUMA 3O1IC 5E1DA 1JH9A 13PKA 3BKWA 2RGXA 4DIUA 3IJ5A 3JRNA 3KPUA 2I1VB 3CC8A 4JUCA 4DCPA 4MR9B 5K4HA 3H7IA 4G0UA 1KDYA 4BGDA 2ZSUA 3HZRA 2VDRB 1UBGA 4M0EA 4JEHA 1QIEA 4PYLA 4RD1A 3U17A 3GJ3A 4MTXA 4A0QA 2QVLA 5KHKA 1WXGA 1PZNA 3SLRA 1X3LA 4GM4A 1Z4NA 1W41A 1MNAA 1L4MA 1KBOA 3QWHA 1W2GA 1WZ2A 1YE5A 2E74B 3LOQA 4BMVA 3QW4B 2R97A 3I53A 5FWYA 3NEPX 2D5LA 4X1KB 2J9FA 2QWNB 4X92A 1JSLA 3CS3A 2XV1A 2QP9X 3ZJYA 1NAIA 4AP9A 3UOAB 2GVNA 2NNLD 3OCYA 4UCFA 1KDPA 4Q9KA 3HJFA 5BMVA 1F0NA 3R8XA 2GN2A 4NFSA 1QBZA 4LDPA 2BM8A 2FFBA 2Z9CA 3B7WA 3OTOB 2FFQA 4BOYA 5KTYA 1SQSA 4RQAA 5DN9A 1RYEA 4TXMA 3X1DA 2MK3A 3OIFA 4J16A 4PXSA 4EEZA 2VYQA 5CBKA 5EJEA 5IJ0B 4Z7QB 3WAKA 4E12A 1WXXA 2OHHA 4PBTA 4HQNA 2BUAA 1FU8A 1GP2A 4L15A 4L5IA 1DG9A 4HB0A 4DCTA 4RTLA 3CCUF 2BP7A 2I7DA 3EA4A 2I6QA 4LF7O 4P5EA 3SIXA 2QN3A 3E8FA 3FGPA 3IEIA 3URMA 1RPNA 4RK6A 3HPQA 5EYPB 1UBNA 4Y1GA 2F2TA 2I0FA 4HX2A 1U3LA 5IP5A 4C6RA 3WS7A 3C5WP 5IRCD 3IX7A 2VP0A 1TECE 2EIMC 4XYMA 1KKLA 2P3SA 4JJAA 5FFNA 2PT9A 1TGVA 1V3VA 2R6HA 2Q4EA 3K0KA 2ZWPA 3ETNA 4X60A 5FFFA 4QTTB 2CUKA 3AILA 4YMLA 5KQGA 3U7RA 1ZH0A 2X4DA 1TVMA 1HLDA 2VRCA 4CT5A 4FHZA 5CVVA 4WCFA 3VVBA 5DH9A 5K8TA 2XNHA 4PAMA 3NOOA 4BEJA 1QFMA 3ZK8A 4JLVA 3OZDA 5DLDA 4EUKA 1UEIA 4JLKA 3HV0A 3TGLA 1BEUB 1MA0A 4H3VA 5P8WA 3DTNA 4X9QA 2NUPB 1VF7A 3SYAA 1T6NA 4EHAA 1B1CA 3I9V1 3ABLB 3DOUA 4CODB 3O91A 3K9LA 2XZLA 2X0JA 2JEYA 3IC5A 3QVSA 4MYTA 1WP8A 3PAFA 2PA3A 1NKDA 3M6WA 1GADO 1VPEA 4RZIA 2AIZP 1P73A 3KWFA 1IUKA 3ZS8C 3A6PC 3M5CA 4DMFA 4D0LB 4RJKA 1PFQA 5LQMA 2ZRNA 5AP9A 2HWKA 2ZSFA 4QGFA 3I52A 1IONA 4RVOA 4Y6QA 2AXEA 3BHMA 1H93A 1OWLA 4J2TA 3KDSE 4WV3A 5ITVA 4POAA 3AF0A 1XNHA 3W5SA 1U5AA 1GO0A 4MQFA 1G4AE 4AQYO 5ITZB 2VNAA 3WWOA 5DGXA 2Z0AA 2H1SA 3FDZA 3NKLA 3GVMA 4NHEA 1RM5A 4K86A 1Z8HA 4AKGA 3EVEA 5HP7A 2LFSA 2JC3A 5GOTA 3HABA 2Q50A 3RKUA 4HMQA 3H87A 5JRJA 2PANA 4IL6Z 1GAJA 1N5MA 3KZOA 4JVMA 4DGQA 1MOFA 3VH4A 4U7NA 2Q4TA 4O4JB 2P6MA 3EFBA 4LDNA 4DR3B 4DWOA 3S70A 2HU5A 1V1RB 4INZA 3PXCX 4WBXC 3APQA 1PJSA 1KI1A 1JHMA 3KSDO 2PUCA 1N1GA 3BERA 4BYMA 4YJ2B 3M3PA 1YZYA 2C94A 2A9QA 3DO5A 4X7PA 2VHYA 5JSKA 3QU7A 5EKXA 4B47A 3NI2A 1MNGA 1Z7YA 2IPXA 2GAOA 4N0MA 2IW1A 5CVCA 3BMCA 1RXSA 3FM9A 3M5DA 1C1XB 5DV9A 2W42A 1SKAA 2E4VA 4FHFA 1HNZB 3HBFA 4D41A 1A8UA 2EBUA 1YA4A 3HJGA 4UVGA 2H8GA 4GOMD 1PFGA 2DH6A 2BISA 6Q21A 3UYLA 1P1FA 2Q7HA 1K9MH 3L0IB 1J5PA 2PX4A 4ITVA 3I09A 2HK7A 4JR2A 1PSDA 4MQMA 2G83A 1QR8A 2JI7A 1BCCH 4MW5A 4KN9S 4V02A 5C8ZA 1SCUA 4DXAA 1VQ5V 2EKBA 1S2OA 5ADVA 3L6BA 4JVLA 4BO7A 3GD5A 2VT2A 4BW0B 3UMFA 1Q1AA 1BQ0A 1ZNXA 2Z6VA 1KJQA 3D3EA 4AJ1A 4RF4A 1MPTA 4HC4A 2DFTA 1SOMA 2HLPA 5DSXA 3HKEA 1OLUB 3LS2A 4UCUA 4RJ2A 2PSSA 3HDJA 2DECA 2HK8A 2ZRCA 4IDOA 1UINA 4L6CA 2I8CA 1KKDA 2ZAYA 1WG8A 1LC0A 1E0DA 1DKQA 2FB9A 3G5LA 4PGGA 4LDRA 5EJGA 1XKXA 4X64O 3JYHA 4N8DA 2ZP1A 1PW7A 3E05A 3CEPB 1JIVA 2G0TA 5AJTA 3PFBA 3B7PA 3U7GA 2F9FA 2E75B 2FWIA 3MNFA 2VWQA 4TT3A 1UAYA 4MVJM 4UTRA 3NHSA 4U7WA 3RUEA 4F3KA 2LE0A 1Z9BA 4A03A 4MVWA 5FJJA 1PNRA 1Y76A 2OQIA 4OMDA 5KOHB 5FLXN 3Q0EA 4BZZA 5KNCD 1NVEA 1YQTA 1BA3A 4FD3A 1ZX1A 1A8PA 3N2ZB 2IUUA 1E6UA 3D5QA 3AI7A 4DR6O 2RAUA 2XVMA 5ALLA 3AX6A 4JP5A 2Q9CA 4IIUA 3AHIA 4G8JA 4DIMA 2HP0A 3ONEA 4TWJA 4Z6KA 3UN1A 1FLDA 3OY7A 3FBWA 5JXHA 1VSQA 4LJ4A 1FFXA 2YC0A 3DFUA 3WQBA 3OUFA 2YMPA 3UMRA 1KY5A 3N7TA 1S89A 2P7IA 3K79A 1N8SA 2LGQA 2EEZA 2YZMA 1NBHA 1R6NA 5K8IA 5ALHA 3KSAC 4ZU1X 1A8IA 2MW2B 1NM5C 2VDVE 1VXOA 4FKZA 2VNIA 1Z47A 1W5EA 1ZH4A 3B1WA 1V6SA 5AKJA 1N6OA 1ENPA 4N7BA 3GRFA 2A79B 3IDAA 3DZCA 3JQBC 4JJEA 3DV0B 3CWBH 1I0HA 1U3FA 1UIRA 4Y2QA 2BBOA 4OP1A 1PZEA 2HIMA 1U5CA 3Q7TA 2XASA 4XB6B 5DWDA 4XWYA 2GCPA 3DKKA 4BVAA 1TGYA 2O8FB 3WGOA 1CFZA 3BMQA 1QXSA 4NFLA 3FTCA 4OYRA 3GIDA 4XIFA 4PIMA 2YYZA 1T6ZA 1V37A 3PBKA 2UXXA 5EVJA 2W6JA 3IKLA 4QQFA 4O29A 5NULA 4E6PA 1OZAA 4BWAA 1JKIA 1OAKA 4NCAA 1DTEA 2WB4A 1LKZA 1U2GC 4EX7A 3ZGOA 3ESJA 1AVMA 4KHPO 3LHIA 3AVYA 1P91A 1JSCA 4LHYA 4FMCF 1W8IA 2QAGA 1E1YA 4F85A 3AG3C 3SPGA 4ID3A 1NXXA 3C4QA 2AEEA 4TTJA 1L0LH 2LO1A 2O6LA 2P40A 3CCJV 1P6QA 4TL7A 3LP6A 5COBA 2GBLA 2WW8A 3TH5A 2VJMB 2VATA 4Q4AA 4D4JA 4MMXB 3KPWA 3QWFA 4TTTS 4QGHA 1AR4A 2JZNA 4ILEA 3SQOA 3SOPA 5JZVA 5CRIA 2VWGA 1QVZA 2NSLA 3MINB 3QLJA 4XQ9A 3VOTA 2I2WA 3G6BA 1CE8A 4R54A 5H5JA 3KFLA 5CXUA 4BMDA 2UVDA 2H63A 2JJYA 3STHA 5LA6B 3P9IA 1ONIA 2JIPA 1L4HA 4JBGA 4JXZA 2CZQA 2EIJB 2LIVA 2WPDD 4YXWD 3TRIA 4FQ7A 1H3EA 2DN9A 4UTXA 2ZWAA 4FR0A 4DXDA 3MJTA 3ZHRA 1A2QA 3ZBTA 4PCVA 2FPIB 1X1AA 3WLKX 4BX3A 4BN5A 1U96A 3AJDA 3K70C 1WXDA 1FFBA 5DNAA 3V4ZA 4DG5A 3W5HA 4UHHA 4PZUA 1KYVA 2Y69B 2R96A 3OFKA 3CB2A 2BFFA 1AV7A 4I5EA 3KJJA 3VR6D 3Q9UA 5BWMA 2ZUSA 3AEUA 3G0OA 3KJHA 4DJEC 1Z2EA 3ZD8A 2FSIA 2IHBA 3HLYA 3AVVA 1WKCA 5CTAA 2ISSD 3M5WA 1XPRA 1XD9A 3OAAG 1QQCA 5IE9A 3AW9A 1LLDA 3K8ZA 4Y2UA 3MRXA 2XZPA 3ELBA 2RHDA 3N7AA 3K1TA 3ETEA 2JEXA 3DTUB 4W5QA 4RXMA 2WC1A 1SC5B 4P58A 4ARZA 3JAKB 3DULA 3SX0A 1ACJA 5TJ9A 3FPBA 3B2EA 4OD0A 3QO5A 1PD3A 1KQOA 3H83A 3UM9A 1U2RA 4NS4A 1YIJF 3M9WA 4FE3A 2OCAA 2IEYA 1LH0A 1Q19A 1YKSA 1C9YA 4Q7QA 1K5QA 2Q6IA 1N2CA 4ZTZB 2FFRA 4F4IA 3HWUA 3NATA 3M6LA 2W2KB 1IULA 4KSYA 5GINC 2HDNB 3CHYA 2FPOA 2AS0A 4XH9B 3A58B 1L5SA 3SC2B 1S9DA 3GGPA 3KQLA 1QS0B 3TVDA 4KAFA 5FD8A 2OESA 4P98A 3R3JA 3DBIA 4PS0A 1KRHA 3C39A 4LOKA 1E7WA 4KE7A 5DHSA 5K7SA 1WMSA 1DTWA 4XPZA 1W5BA 1O6GA 5DTEA 2O7QA 3GMDA 5CVEA 4OQYA 3T4XA 3VYUC 4D5EA 3JSLA 1FNBA 3NO4A 3VI4B 5CDFE 4GMDA 2R6AA 2AG8A 4YH1A 4KXXA 3VA7A 3LCVB 1M5UA 2DY0A 5KLVH 3STXA 4G85A 3QH4A 4P35A 4YQYA 1NPDA 4NJEA 2OTJV 4Z8YA 2ZBFA 3TWOA 2H7CA 3D3QA 3D1VA 3IP5A 4F5ZA 2VAVA 3R3SA 1W2BU 3GBPA 4ZA2A 1E6EA 1JTEA 2PFGA 1E60A 4HX9A 3ZOZA 4MDFA 5TB5A 2XDYA 1NVFA 4RYDA 1BDHA 1ZKMA 4Z1MA 3VU9A 5K0FA 1F2TB 4BVKA 2R7NA 1NLZA 2VF8A 3IHLA 4K8XA 1RYHA 2XY4A 1X52A 5BN4B 1QMPA 4ML3A 2PLNA 4CKBA 2AEJA 1U2ZA 3Q40A 4U6SA 2MT9A 2C3UA 2FG6C 4MP6A 2BN4A 3L02A 2YFHA 3UV6A 3I64A 2COUA 3H8SA 1N0NA 2C58A 5IUNC 2GAAA 4QRHA 4CEHB 1H1TA 1YR6A 3L7MA 1PBTA 4G5XA 5HXZA 2K4MA 3IIIA 5B4VA 4X66O 3WFVA 3IMEA 3TCXB 5ALYA 2EZTA 3MOIA 1WETA 1PV2A 5B36A 1SOUA 3IGAC 3ESXA 1HORA 2YV5A 2XMCA 3OIYA 3G1TA 5A9RA 1SHKA 1T4BA 3KO8A 4K6HA 1T15A 2AXQA 2Z04A 4ZI7F 2K1EA 2QM3A 1K6JA 1TZMA 4J0IA 3B6IA 1XDGA 2Z1MA 4BO5A 3QFHA 1QF6A 4NBNA 1Z0JA 1G17A 4CL2A 2P27A 3LIIA 3UAGA 5LP6A 2D1TA 1R1DA 2EFJA 5CM2Z 3BMNA 2PSDA 4GI5A 1Z12A 2HX0A 1T4CA 1DOAA 4PZDA 5ED4A 4EA6A 2QL9A 5DYNA 3Q7RA 3AVQA 4DJ5X 4BMXA 2F67A 5F73A 2ZCVA 3EXIB 1GTMA 1N77A 1N7JA 2EX4A 2VS1A 4KUGA 4YP6A 4WW0A 1SK8A 4Q20A 1LRJA 1F38A 2WILA 3SBXA 1OTYA 5AJVB 5FWYB 2IXGA 2J9FB 3PR2B 2Q99A 2FZGA 2H11A 5HRCA 1RAIA 4N49A 3UIEA 5TRTA 2YJTD 721PA 5K01A 4HTFB 4H13B 4DJDC 1VCMA 3V4PB 1C9KA 3IP7A 1P4HA 1WM1A 3DD1A 3TXAA 2JFQA 1JBKA 3PA8A 2O1XA 4DQUA 2FVYA 1CQWA 4D3YA 4O1IA 2HA5A 1V5IA 1T2VA 4BFTA 3W3ZB 2JLAA 1T13A 3KQNA 3PGXA 1UJ2A 5J9PC 4H9GA 1JU3A 5B3LA 4II7A 1CQPA 4JLPA 1G291 1NJSA 2CJPA 3F0FA 4HQFA 2BH9A 3WLRA 4C30A 2VRCD 3ZEAA 3F1LA 1RQ2A 2AG5A 3PENA 3ET5A 3L8YA 3CZPA 3I01A 3R3HA 5FL7D 2XGOA 3N07A 3CKYA 1OFUX 3WI7A 2G5CA 5JO9A 3MCUA 4V24A 4UOZA 1EBUA 1OLOA 3GP8A 4BB0A 3N8DA 2HV9A 3RC9A 1GCIA 4R2IA 5FO1A 3RV4A 3C6BA 4KR2A 4HGPA 3I2FA 4TQDA 1YBMA 2DHCA 3VBEA 4LC0A 1GLVA 4R69A 1KY3A 2C9BA 4LISA 2H31A 3AKEA 3V7NA 3OJEA 3N2KA 3FWNA 4I55F 4EF4A 1CDDA 2IVFA 2A9RA 5AKYA 3UJ9A 2D2EA 3F4KA 3O31A 3OLCX 1W40A 2X41A 3NDPA 3QELA 3KQUA 2ZUTA 2XYPA 5F2EA 2WJPA 1EGVB 5FPPA 3G0BA 4H6PA 4YYZA 2X6CA 3TSCA 3AR9A 1M75A 4TQGA 4Q48A 1P1IA 1R0YA 1UBUS 4DADA 1GGNA 1IB6A 2GPNA 5H80A 3G68A 5IBRA 5A3SA 3FVVA 2NW6A 2IFTA 2B36A 3FOZA 5BSEA 4JI2B 4PJ0Z 4ZV7A 4YLGA 2QJFA 3PHGA 5EMNA 3BGIA 1Z2CA 1G9TA 3JALA 4UDYX 2GKSA 1G20A 2ETNA 2O0JA 1BDJA 1JOYA 3W05A 5F98A 1V4NA 2ZXUA 4MUHA 4DR6B 4JVSB 4GZLA 4JSTA 2C2WA 3KK0A 2JVJA 4DVGA 1J23A 1JLLA 4Q9IA 4QJ5A 2GETA 3NTVA 4OMCA 4R68A 4YAJA 1P7GA 2SICE 1P60A 1SQ0A 1GNPA 4QU8A 1UH5A 3B1YA 4R4JA 3FD8A 1ZYUA 5COQA 1XZEA 2GBGA 2J6CA 1WF6A 2EP7A 3TLYA 3BL5A 1DTSA 1FFSA 4MQFB 4M54A 3U49A 1QG4A 3G4SF 2YHSA 1NBMD 3GI1A 5CW1A 4PA7A 2A92A 3GAAA 1XOIA 2WM9B 4MR9A 4QGGA 4ZVSA 4MS1B 2UYQA 3OFJA 3IVAA 3ZV7A 3TI7A 3H3FA 3TVTA 2DF8A 4WZAA 1HNWO 4GX1A 3K8OE 2MMCA 1K9SA 1M6VA 2X40A 2GF2A 1UPXA 4OLHA 5IJXA 4BY9D 4ZYLA 4AJKA 1EVIA 3AL2A 3HGQA 5A2GA 2Q7EA 1K88A 2V5AA 2XF8A 3N8KA 3MBMA 5ICFA 3SS9X 4JF3A 1L0NH 4S24A 3EW7A 3B9BA 2YX1A 4BO9A 5KTMA 1VKJA 3RA5A 4YP7A 3KT0A 3HYLA 2DOKA 4P4GA 1B2RA 4X1KA 5JRDS 5IM4F 4YCAA 3TLGB 4BO2A 3NDJA 4IIHA 3IT3A 1XDDA 3R3ZA 3A2KA 1WDKA 3GJSA 4JA0A 1R0RE 2BT4A 2MYUA 5IDXA 1NLYA 3S1SA 1J5EO 3CVWA 4KHPB 4BQQA 1Z26A 1PK7A 3LKVA 1GM7A 3TCNA 4RUFA 1Z5VA 1WSWA 4RUEA 5JS8A 5IJ0A 3IOBA 2O1SA 3L8HA 5HQ3B 1EP1B 2HJWA 1UXHA 4RTJA 1ONOA 1KYTA 4N0PA 1V9SA 3KXIA 1DJLA 3HHPA 4N65A 2HPAA 4KB5A 2BMJA 2GYUA 2WZDA 3ZCVA 4S05A 3GNTA 3IQDB 1SCUB 3JAMN 3D43A 4Z2AA 1YRWA 1X9IA 3PJRA 2H54A 5ECGC 1O94D 5EYPA 5BSHA 3QKWA 3W1EA 3F2VA 4XCVA 3CZ9A 1OX5A 3IR7A 3HKEB 4EB3A 4Y2YA 1XBLA 1T9HA 2C8VA 5AVRA 2V59A 3OIWA 2G7MC 4UMDA 4MWBA 1INLA 3FI9A 1BMQA 3VHXA 1NN0A 1YC2A 5EXEA 3V8NA 4MYUA 4JLWA 4K8ZA 3DPIA 1YDFA 2D5BA 4K8OA 2G09A 1SUWA 4DPKA 3VTIC 2EF0A 3LI2A 4PFSA 5M7EA 3HA3A 4TM7A 1SC4A 3FMIA 4F84A 1Y76B 2JJ1G 2YVUA 1JEAA 4BO1A 2JKZA 4L0DA 5IM4A 3OZIA 1RXUA 1H5NA 1U1IA 3EFOB 4TLDA 1X42A 3S5UA 2FLVA 5AJWA 1VE5A 4LG1A 4QODA 1L7BA 3K35A 1QK5A 2DFNA 4O4JF 2W11A 4RY9A 3RIMA 4ZGWA 1Z6TA 2HP0B 3GLGB 3R0VA 2NUPA 1Z45A 2YV4A 2HT1A 1WF3A 2A3QA 4YJ2F 1C8BA 3C3JA 2FMLA 3Q4HB 4ZD6A 5JU6A 4OU5A 1TPYA 3E81A 4B3IA 3B12A 2PAFA 1CP9A 4JT2A 2IH2A 5FPYA 5I51A 1VQVA 2QTBA 5HM8A 4TMVA 2CNLA 1JZTA 3MT8A 2W6JD 1EM1A 3QKIA 5AW6A 3V2HA 2PHZA 4TTIA 2PXAA 1YHZA 3WLHA 3K0HA 1FMLA 3SYQA 3GFBA 1XELA 1AI4A 2O19A 3NAGA 1TQ4A 3T06B 1Q16A 1CIVA 2ZRAA 3C2QA 1KZGB 3QEBZ 1E8DA 3I3SR 4WZ6A 3HB3B 4HNAA 2Q73A 1W94A 3UATA 3KVOA 1DC3A 2XCLA 4URWR 4EHJA 1I4OA 2BFWA 3CCLV 4PZZA 3GLRA 4YCBA 3RJZA 2YN0A 5KYWA 1Z88A 1Y1LA 4FSDA 5H82A 4MWOA 4XDLA 5KKCA 4HAOA 3WAJA 2XBUA 1A27A 3PV0A 1XFDA 3CJQA 1FPOA 5H9WA 3OTOO 2A5YB 4O4JA 1APBA 5KOYA 5MHTA 4IDHA 4N3GA 1IAQA 3HR8A 2QAGB 1XNRB 3IXMA 4YJ2A 2QZJA 3SF0A 4UNIA 3L7CA 2SNIE 1KO1A 1WXHA 4CJXA 4YEDA 1XP8A 1N6PA 4KGDA 1XTPA 3DP7A 1C1XA 1RLIA 3NC0C 4BW5A 2DBQA 3AIKA 2ZB2A 3A2FA 1XTKA 4OHVA 3ZGXA 3ODPA 4OVKA 2NZ8A 2J3EA 2GZSA 3C9SA 1G4UR 5AVXA 1XYVA 2ZI7A 1V54C 4UNPA 2YJNA 5IWCA 4HNVA 4WA7A 2NSHA 1ZKDA 4EMUA 5SY9A 2QTSA 4MITA 4B6OA 3QKSA 1RW4A 4E5KA 3W8FA 4BVGA 4BDTA 3WBJA 1NJFA 1DRWA 1W4AA 1WY5A 1FU4A 2VHQA 2H1HA 3ESBA 1IOWA 1OKKD 3OPMA 2D1RA 5B58C 4I8IA 4M87A 1NVWQ 1GLGA 1KDZA 4L2IA 3CLUC 5LUAA 2R8ZA 4L1KA 3ENKA 3PSAA 4CDGA 1SCJA 4P38A 4WOCA 3MMNA 2FPSA 2GHIA 2C2MA 4IIYA 3R3YA 1JAZA 1DHTA 4AMUA 4IXTA 1XG5A 1OH8A 5I7OA 4WDQA 4G8BA 4L6AA 2WDZA 3ZU4A 4GQAA 4Q9AA 4YNBA 2QN8A 5AM1A 2XDQA 1YBVA 4QFCA 4G8CA 3FAZA 1GITA 5THQA 1G3MA 1F8YA 4ZQFA 1NG9A 4L8YA 5KOHA 5AUOB 3QG5A 1IMJA 3A9UA 2VQ6A 4RY2A 4L72A 5CURA 3VU3A 1K6MA 1GQRA 3FR8A 1WXFA 4OA5A 4DC1A 3H19A 5IVHA 4X97A 3TUIC 1N2CB 1VFPA 3R9IA 1H0SA 3UCFA 4LMPA 5F5XA 2VNJA 3TQSA 2ZJFA 1I94B 2GEJA 2Z5LA 2QD2A 4EJSA 2PX0A 3VR5H 2BUCA 4YTEA 1B1AA 1M72A 3I39X 1TKAA 2O2IA 3L7KA 4YCCA 4Z1VA 5KUTA 4NBWA 1TM1E 3QEKA 2P1ZA 2VIIA 1R0ZA 1BD3A 4QNRA 1UWCA 5GJVC 2AN5A 1UANA 3W06A 5KNCA 2N1MA 4IJWA 2WIJA 4MS4B 4P33A 3HY3A 3GT3A 3CT6A 2WZBA 3BHIA 4DVJA 1SZPA 3SQMA 3CVUA 2YZKA 1DNPA 2C95A 2LBPA 5LA6F 1FYWA 4JR1A 4RNDB 5BOSB 3GLIE 3QK7A 2C4UA 2HYDA 4BKPA 3HTXA 4XM2A 2KG7A 1A1SA 2OC4A 1W0KD 4Q82A 3FY4A 1WABA 2WJVA 3U61B 2C7PA 1GQFA 3RVOA 3PQEA 4RELA 1S3JA 2I4IA 3L0PA 3IQFA 3UK6A 3RADC 3R0XA 3HADA 1R4MA 4NJEB 4DR3O 1DEKA 1QRRA 1N3LA 4Z1OA 5A02A 3QVLA 3OF3A 1RE1A 4OM8A 5TARA 3V2GA 4D4GA 2OTMA 2YQ5A 2GVIA 2EKQA 3EVTA 2GF9A 1U99A 1WCIA 2EW1A 2CB0A 2P5SA 2VAPA 4LF4B 5ISMA 1HC7A 1EK5A 4JPRA 4JQYA 3GFTA 3QX7A 4FDTA 3M6XA 3K5HA 2H7VA 2PZLA 1HNZO 4X3PA 1GKIA