3JAWB

Atomic model of a microtubule seam based on a cryo-em reconstruction of the eb3-bound microtubule (merged dataset containing tubulin bound to gtpgammas, gmpcpp, and gdp)
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
429
structure length
429
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 145
structure length 429
sequence length 429
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jawB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jawB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jawB01
4YJ3A 4E6EA 3JALB 4EB6B 5CB4B 5CA1A 4O4LA 3WGLA 5JH7A 5IJ9A 4ZI7A 3R4VA 4WBNA 4ZHQA 5LP6A 3HKBA 2VAWA 3HKBB 5LA6A 2XKAA 2XKBA 4I55A 4I55B 4LNUB 5JQGB 4O4IA 4X1YB 2BTQB 4F6RA 3RYFA 4U39A 3JARB 4I4TB 3ZBQA 5IYZA 1W5FA 3JASA 1Z5VA 4TV8B 3JASB 5JCOA 3WGKA 5KX5A 3CB2A 4DXDA 4X1IB 4IHJB 4X1IA 2Q1YA 5EYPB 5JVDA 4TV9A 2Q1XA 3V3TA 4U3JB 3RYHB 3WGJA 3ZBPA 4KWEA 5JH7B 5EIBC 5KMGA 5IJ9B 4EI7A 2VAMA 3N2GA 4ZI7B 2R6R1 5LXTB 5IJ0B 5IJ0A 4O4JB 5GONA 4XCQA 2RHHA 3VPAA 4LNUA 5JQGA 3WGNA 3ZIDA 5ITZA 4I50A 3RYCB 5LOVB 5MN6A 5CB4A 4EB6A 3WGMA 3HKCB 4X1KA 3HKDB 5J2UB 4TV8A 5CA1B 1TVKB 1TVKA 1W5AA 1FSZA 5FNVA 5FNVB 3M89A 3HKEB 3JAKA 1RQ7A 4FFBA 4WBNB 5CA0B 1W5EA 2VAPA 5CA0A 4EI9A 5LA6B 5JCOC 5MN4A 1JFFB 4DRXB 1W5BA 3RYIB 4TUYA 1FFXA 4X1YA 5LP6C 4F6RB 3RYFB 1SA0A 2BTQA 1SA0B 4YJ2B 4YJ2A 1TUBB 3VO8A 1OFUA 5GONB 1RLUA 2BTOA 3JATB 4HNAA 5MN5A 5LYJB 5J2TB 5EZYB 5LYJA 4YJ3B 5J2TA 2GVIA 3RB8A 3JALA 5M7EA 3C8LA 3E22A 1Z5WA 3E22B 5EIBD 4IIJB 2RHJA 4TV9B 4B45A 4O4LB 4U3JA 3JAWA 3JAWB 3JAKB 3RYCA 3N2GB 3UT5B 4FFBB 3VO9A 3UT5A 4O2BB 4ZHQB 5LP6B 4O2BA 4M8IA 3N2KA 4O4JA 4ZOLB 4ZOLA 4O4HA 1W581 4O4IB 5LOVA 5ITZB 5C8YB 3JARA 5C8YA 2VXYA 3HKCA 4I4TA 4EI8A 3HKDA 4X1KB 5J2UA 5KX5B 3JATA 2R751 4B46A 4O2AB 4O2AA 5EZYA 3VOBA 3HKEA 5EYPA 5JVDB 4IIJA 3M8KA 3RYHA 4DRXA 2RHOA 1JFFA 3RYIA 3VOAA 1W59A 1FFXB 5KMGB 1RQ2A 4TUYB 5BMVB 5BMVA 5LXTA 5IYZB 1TUBA 3N2KB 2RHLA 4O4HB 4X20B 4HNAB 4X20A 4I50B 4IHJA
chains in the Genus database with same CATH superfamily
3BL6A 3AMVA 2O2DA 2P9QA 3G1TA 1QM5A 4OB6A 3JQQA 3E9MA 4B62A 1N1EA 3ZRVA 1SXJA 5GV8A 4KNVA 1MMMA 3WYBA 1A5ZA 2IZ1A 2PFKA 4XUGB 3K4HA 3V46A 3ZWCA 4DJFC 2Z09A 4EHBA 2UUCB 1S2MA 4C6TA 2CNKA 2CE2X 3WGYA 3ZWXA 4CLRB 5HQTA 5ICMA 4GDFA 1IAQA 3U7GA 2FN9A 5KHHA 1PV0A 3O9OA 2DTDA 5TS2A 4OQQA 4NDZA 3J80M 2EBOA 1TKAA 4XCVA 1XA3A 1VQOV 4XIFA 3N2YA 2ISSD 5A4JA 1LSOA 5SYMA 4X6LA 2R8EA 5KINB 3T38A 2ZR9A 1NP3A 1GCAA 2C8VA 2QVZX 5G53C 1R6DA 5AHKA 3MWLA 1E2DA 2GXSA 1YJ9F 1A2BA 4MA0A 4I4IA 3EG9A 1U0GA 1S0UA 2ZI5A 1Z5ZA 4BNDA 1W8IA 1VIYA 4JLUA 1ZM2A 1E79A 5IASA 4ZARA 1QF7A 1J2JA 2PGIA 2WKPA 4ID9A 1H3EA 1TO1E 4DMCA 1SOAA 1NT2A 1V55C 1YJAA 4NG5A 1QPBA 1TF7A 3AHEA 4C4TA 2QLFA 4LI3X 2OV4A 2OFXA 1M5TA 4OX9Y 5EXTA 4CLXA 2RHBA 1YIJV 2ES4A 1M72A 3DL2A 4P1ZA 2GCOA 3L7LA 4KLAA 3CXCU 1U99A 1RPJA 4XM2A 1TPZA 4HYQA 5B5EZ 4ECAA 5JLAA 1TA4A 3TFQA 1SUDA 4A8TA 3C3TA 1NVDA 3RVSA 2CMKA 2H2AA 1N3BA 3B78A 3P0IA 2QYSA 4PPNA 2W0XA 4RVOA 3DOJA 4X3CA 2IZ0A 3OLVA 3CN9A 1WU8A 3STWA 4HSGA 2QEQA 5F64A 3TVYA 3W9SA 3OTFA 4UAUA 4DWWA 2D0IA 2WIGA 5EZYB 4RBNA 1S7GA 4H0CA 5M7EA 2B37A 3TXSA 4RTNA 1O94A 1PF7E 5AJWA 4DQLA 4U63A 3ZIAA 3FE2A 1Y74B 3TDNA 3W2FA 3SY8A 1CEXA 1EE2A 2QV0A 3FMGA 4FPPA 4RQOA 3OTGA 1FRFS 4MB6A 4R7ZA 4R5MA 2XVZA 3AKYA 4N6OA 5FL7A 4WZBE 2R7AA 4Z4QA 4ZHQB 4XDKA 1P1JA 1PL8A 2MQEA 1Y42X 1WPXA 2PZEA 4HTFA 3W5VA 2LGWA 5FTWA 1ZUNB 2J32A 2EIKB 3LBFA 1WD5A 1DI0A 5G3ZA 4KXMA 3KWJA 5DX0A 3VXKA 3LU1A 4QT0A 3DV2A 3LBHA 1HZJA 3FOWA 1GZ4A 4C7UA 3G02A 5BR7A 4R41A 2HYDA 3E5NA 4TN5A 5CP8A 4AO8A 2WY2D 1NI3A 2HVYD 1WMFA 4HDAA 1QLEB 1E8MA 2W8BB 2IC5A 1N2EA 4K9PA 2OMKA 4CIYA 1K97A 1M2JA 3IERA 2FJUA 3C3WA 3SEFA 4KTTE 2QWNB 4H1WA 4AMUA 3VI4B 4RDIA 5L3QA 5C31A 4W63A 2NO0A 4L9AA 5F78A 3MWEA 2ZTUA 2PEZA 2ICAA 3FFBA 5CJPA 5A3QA 3HVRA 3O3NB 1JEYB 2EV9A 3A2FA 3ZE2B 3BIJA 5DXJA 3AF4A 2K9PA 2Z8XA 5DYWA 5K2OA 2HOQA 5EJ5A 2WU3A 1AKWA 2XA9A 5J1SB 1DQRA 4NYIQ 4EGFA 1NSTA 2B69A 3QWFA 4LQLA 4C0HA 1BQZA 4ON9A 1JF8A 1R0LA 4MIKA 1J9EA 3T12A 4DEVA 2XCSB 1PGQA 5THQA 3QHDA 1LUWA 3OGCC 4HKTA 3RU2A 4EYQA 1EFPB 1UWCA 2X9QA 5FPRA 3F4KA 4TXLA 2XDYA 4KITB 1NXVA 2QTGA 3EFOA 1QP0A 1N5RA 1UMCB 3ASUA 3U3DA 1TVMA 3Q7TA 4ZBMA 2BL4A 4FMDF 4QOGA 2AOXA 3SDZA 5JHGB 4TRMA 1ATIA 4ZICA 2CD7A 2NTJA 2Z2XA 1T3ZA 1WMAA 3P9CA 3AL3A 2OXTA 4XSHA 3LFUA 3FSRA 3E0QA 4BCCA 4RIFA 1V39A 3FYDA 5ILOA 2JGIA 5DM4A 1RI3A 2BFCA 4JEUA 1JT9A 4V0QA 1UJ4A 4RKYA 3HA3A 4K3AA 3LRTA 3OP1A 3VNAA 4G23A 3GLVA 4KNYA 1EDZA 1I32A 3DE6X 2BJVA 2WZBA 2P9JA 3D43A 5AJVB 1F2VA 1GQYA 5LZ9A 3A9CA 1Z08A 3TD9A 2CDBA 4JCCA 4WXHA 4ZT7A 5HCUA 4H6VA 3STHA 3OEHD 1Y8QB 1JG6A 3W3ZB 2W6NA 3GFFA 1PDWA 5JQGA 1K2WA 2QMHA 1GRRA 5AH0A 5JWHA 4IGGA 2X6TA 4IDNA 3BRQA 5BN1A 4TWBA 1Z6ZA 5J4VA 3RSZA 1IM8A 2WG2A 3IESA 1MC5A 1S1MA 4GX2A 2C5EA 2UZHA 1ZDMA 3L49A 4CHGA 4DIUA 5AVZA 3JSLA 5SICE 3T3EA 4B6RA 4F1JA 1FRZA 3A0UA 3V00A 1Y63A 4WFFA 2BM1A 2L6LA 1M1YA 3MUNA 4QTTB 1KAMA 5F2EA 4AUMA 3ABKB 2HTEA 4YUXA 5JNRA 1EWVA 4UAVA 3S40A 1IMOA 2PMKA 2GTIA 1GUZA 1Y1PA 3C7CB 1RHMA 5B3JC 3X2FA 3QO8A 2YXDA 2R11A 5JG7A 2AQHA 1SHLA 2GEKA 3D2AA 5ALQA 5EWLA 5M2QA 4D79A 1NNSA 4MWBA 4AKGA 1GRQA 2JI7A 4PAWA 1SS3A 1AU9A 1E0DA 4E33A 1P1RA 4D7SA 1IL0A 2LUOA 1NYQA 3PPXA 3RC7A 2HRQA 3WLPA 5LP6F 4U0KA 3I0ZA 4QZVA 4RFLA 4MVJE 2KQXA 2YWJA 3PN1A 2XY4A 1SMKA 1YZGA 4FFBB 4NOLA 3UT6A 3WNQA 4D5EA 3DBLA 2YR0A 2X4IA 4HZGA 4KXFB 4DV7B 3DZ8A 1E96A 3BEOA 4YRGA 4N5HX 3PQ7A 1LQUA 2QWQB 4QUKA 1X80B 2ACKA 2O7RA 3E81A 4M8LA 5AWFC 5KYNA 2C0QA 2FZEA 1IN5A 3K9NA 4CBCA 4BFYA 2CVQA 3U9LA 1PLJA 2QYOA 3LGXA 3DOEA 4JX9A 1IY1A 4PHCA 4TSKA 2XEDA 5BUCA 5G0TA 3W5SA 4LF6O 1E5VA 2UXCB 1SXIA 3R9XB 1WF3A 2PRKA 2C84A 3AR4A 2VO1A 3WB1A 1T5LA 1D2DA 2XJ9A 3R5KA 3E35A 1U0EA 1XQ6A 2W43A 3KJZA 4DV2O 1TOAA 2O2HA 2VJPA 5CGZA 4YQZA 1CQXA 2NUTA 4PFKA 5HYVA 3LXRA 1CS4C 3IJEB 3L6RA 5HDQA 3SWWA 1IK4A 1MO5A 1W55A 1XZJA 3AKCA 1JYSA 4G5GA 5KHAA 4OP1A 5IRCD 1N9KA 2VF4X 1FX0B 3FKSG 2CLKB 1USUA 3KHNA 4FHZA 1D2EA 1XDCA 3EWAA 4XOUA 1BQ0A 3ZZ0A 4BFCA 1ZUD1 3DG9A 2RCVA 5TISZ 1T0JB 4EY4A 4EY7A 1B2LA 1VE9A 1EVKA 4R83A 4NPAA 3SQMA 1PJRA 1QTIA 2X7JA 3L8GA 2E1RA 5BO5A 3C5VA 3CLVA 1K9VF 5JAQA 3L7YA 1EMDA 2JBWA 3PA6A 2XDAA 3GLSA 3CNQS 4PZ9A 1CQWA 2A6PA 3EBPA 3AVWA 4CKXA 3KQNA 1TU0A 2VDVE 1MR3F 1VBFA 3WSVA 5LNK1 3TRDA 3WLEA 3L41A 3F46A 4ZKEA 2I5PO 4AMVA 3INTA 1LDGA 3LYLA 5JSKA 3C97A 4LYEA 1DAKA 1M34A 1TA8A 4NY1A 4I4TF 2VXCA 1S6YA 1GGKA 3PPVA 1L8AA 4DLVA 3OKFA 1NFRA 1JKJA 2GN2A 5FBHA 4FYXA 4AKEA 3TX6A 2WNHA 4OGQB 1RQPA 1U02A 2WTMA 5C80A 5C34B 1D6SA 2OFOA 1JIJA 1XI1A 2GCNA 3WJPA 1N6RA 2WHPB 1VFPA 5GTHZ 2P77A 3B3QA 4FE7A 2PLNA 4M89A 5BXYA 1F2DA 3QMPA 1NXTA 2ABWA 4EY6A 2YHIA 4RQAA 3HR4A 1P6UA 4HDMA 1CE8A 1CRZA 3G68A 1Q0PA 1K8QA 5F4BA 2HLNA 4O63O 1Z47A 2QVYX 2J9XB 4B3DA 2CFCA 1H38A 2Q6KA 1QBZA 4J2TA 4EB6A 3FGOA 2LR0A 3HB4X 3I9JA 4XIJA 5BWCA 5FUYA 2X0RA 3EGCA 4D46A 1V4NA 1BZYA 1GA1A 2FEXA 3QUBA 1J1IA 1E2QA 1YBHA 1EFCA 1QGZA 1UAAA 1V4VA 3TR0A 2G72A 1FNSA 4RA6A 3UXYA 4H60A 1E2PA 4BMZA 1J56A 4Y6OA 4YMTA 3G8CA 3PQ5A 4ZEOA 4NTXA 1CJTC 4BVGA 3NC4A 5DVZA 4U00A 3PX7A 1QGDA 1UBLS 4Q3LA 4XQCA 2BTQA 1EDOA 5IBPA 3LXXA 5KNDH 3A2LA 3S8YA 2Z6AA 1JHQA 1GRVA 1UL1X 4L0CA 4IZHA 3LQYA 2FMUA 3SNHA 2OE2A 4FEGA 5B8FA 1ND5A 1I5RA 5AKXA 4MQLA 3VBBA 4PG7A 1SIWA 1THZA 4MT8A 1O6CA 1XBTA 4TPKA 1KQFA 1OI7A 5AW2A 1ZGBA 3NTLA 4EHDA 2OV6A 2GUZB 1VMAA 4JITA 3ZTWA 3AKZA 3MBOA 3C4VA 2PYLA 1E1QA 3KQQA 5EEHA 2CUTA 2OTLF 1GLNA 1U0TA 4W5WA 3EF3A 3SC2B 3BILA 4KO2S 1KK3A 3OX2A 2ZIFA 1L0LH 2JBAA 3KDSE 3IR5A 4E5UA 3KELA 2E0IA 5E3HA 3K0FB 2QXTA 3AINA 3IBYA 4B3CA 4CMGA 5KKNB 1ONPA 2BR4A 5GADl 1BMTA 2ZI7A 1QFJA 4HH0A 1I08A 3UHJA 2P62A 4FK5C 4CG0A 4DGSA 2PUHA 1T1IA 5E3IA 4AMYA 4P5EA 2X3UA 5HIAA 1PS9A 1NI8A 1GM8A 1DAOA 3W3AH 1PJZA 1YR3A 4UE3S 2BZ1A 4K9RA 2QAGB 3ZK7A 4CMJA 4BT5A 3GJ7A 2P4SA 5TGZA 2IWRA 3NDPA 3F0EA 3JQ8A 2W58A 3LBYA 4DR2O 1GARA 4KL1A 1U7WA 2K7ZA 3MTAA 1R8JA 1TAQA 4L0QA 1YGYA 2PXXA 3PQ4A 2P2SA 4MW8A 1ISPA 4KN5A 1KTVA 3NHLA 3ZI0A 4QJ3A 2ZLBA 1I13A 2HA0A 5CX4A 1T8SA 3S7TA 4F9GA 4UAGA 2R25B 2QRPA 1LW7A 2V59A 2AA3A 3K0GA 3KJGA 2HX1A 3OQ6A 2WUWE 3PQCA 1CUIA 1N1GA 4GHWA 3W0LB 2J0UA 3D02A 3EB9A 1P1KA 3IO5A 1JJ2F 1TKRA 2NO1A 4JUCA 1ZH0A 3PITA 3ERNA 3QTTA 4NFLA 1JE1A 4DCUA 3FMFA 3NHAA 2ZRNA 1IN8A 1EIZA 3SBXA 4ZHQA 3REFA 4ARBA 1TUEB 3V8QA 2FPMA 3T1HB 4LRWA 4HGNA 4IZ6A 2O4CA 4RF5A 3RS0A 2Y77A 3SSOA 4URHA 3UWDA 4D4JA 4ESOA 1B0PA 4TVSA 1AHPA 3CXUA 3CD6V 4MPJA 3DR3A 4I9HA 1J95A 2RGEA 3LKZA 3WLHA 5LN1A 3X3HA 1UMDB 3G4SV 3HJWC 1HQYE 3M7MX 1YZVA 2FMHA 2GM5A 5KLVH 3GJRA 5KNLA 1T2VA 2EBHX 4D2IA 5HKAA 1NJFA 4FLVA 3ANNA 4J4BA 8MHTA 3OZSA 2PIAA 2H06A 4P4NA 5C7OO 3K31A 3RSGA 1XHZA 1ZGJA 1VC2A 1XRMA 4CGYA 2BUAA 4FNOA 5DK6A 3DC6A 3UVEA 2ZSHA 4C29A 1GTRA 4GDMA 3S1AA 2XOKA 2WE7A 1UKCA 1GYQA 3IAS6 5BRAA 1HWYA 1MX3A 3M9XA 3MTJA 3IUPA 5MDHA 5ITZA 1U9CA 4L02A 3REQA 1A4XA 3FUUA 3HP1A 5EC2C 1FJGB 3RF7A 4AMZA 4AFNA 1LQTA 5EAZA 2FE4A 1ULBA 3ZDZB 2BN4A 4XM1A 4CM3A 3AG6A 2G1JA 3DFFA 1G3IA 1LJLA 3K9LA 3QKUA 4GYKA 1ORTA 3ORHA 4TLBA 2A0LA 4M9UA 5IAJA 4CQLA 4TTVA 1SIBE 3QSGA 2PRYA 2BAGA 2W6IG 3QYPA 4KHZA 3GVPA 5C0OE 9ABPA 2ZSKA 4HUTA 2O8EA 4JI4B 3ZV5A 4D02A 2AKEA 2E2WA 5EPOA 3K32A 1TM2A 4AF8A 4TQGA 5TF0A 5DGXA 2NO6A 2G6BA 4BP8A 4EB3A 3K04A 1AUXA 1U3FA 3RSQA 4KUGA 5LM3A 1JN1A 2BSKB 1U81A 1WXDA 1Q81W 2HWUA 2D4AA 2QKYA 3H5LA 1IOVA 2JCXA 2E4AA 4WFKA 2Y05A 4JLJA 1WPGA 5E38A 4IIJB 4IJ6A 4BOYA 4QM6A 2EEZA 4LOHA 4LNAA 3C3BA 2AUMA 3U60B 4BC0A 4YCCA 1EXNA 3OI7A 3TRFA 5TLSA 4UW9A 3FVWA 4RUEA 5LP6B 4HT3B 4HRYA 3NALA 2GAFA 2YHSA 5KDOA 3VH3A 1VQMF 3GLGE 2GOYA 4MI6A 5KYVA 4D4KA 5JCJD 2QGFA 4IXDA 1FXUA 3EEOA 2IOQA 1PXWA 5LB4A 4NSNA 2MINA 2R2GA 3LK6A 3JYQA 4EKDA 4UNIA 2HCFA 1MU0A 1OWMA 1YU9A 4IDOA 4WLNA 3G5LA 4AI6A 3EDYA 3GUYA 4TTQA 4ZCPA 3LUKA 3W8FA 4F06A 2V54A 3NX4A 3QUCA 3U4IA 1EGVB 1RM4A 1E3JA 3IS3A 5DIZA 3PUHA 3ZWBA 3WVNA 3UT0A 3SX2A 5LC1A 1F38A 2A1TR 3W4KA 4S1VA 1C7IA 3ZHUA 3T4XA 5FL7G 3RH0A 1G59A 3IYLW 3DZJA 4KDRA 1DK1A 1GSHA 2R8RA 1RPNA 1QGED 2ROQA 3EXEB 5CM2Z 1NJ5A 2ZM5A 2RHLA 2AEJA 3AVPA 3QW4B 4HDMB 5JIBA 1QF6A 2V5UA 4KR7A 1VBKA 4NFHA 3N4YA 3IAYA 3KOYA 4C0QC 1O6ZA 3BA9A 2QOEA 1PL7A 3H0EA 2ARHA 1SVSA 4DLUA 3P4EA 2OD7A 4UEJA 1PK9A 2CXUA 2G71A 3IUEA 1Y34E 3NJ4A 3PF8A 1BXKA 4IAOA 4RXUA 4F3YA 5AVRA 1QK5A 1KERA 1ONOA 3E9CA 2G5TA 4HLDA 3JAMN 2O0HA 1T1RA 3DEIA 3QY9A 2Z4SA 4Q9NA 4U6SA 5EN4A 4CKCA 5IT5A 1NJ6A 4MARA 4QOFA 1SUCA 4GSYA 1OH8A 2HQOA 3FF1A 4QBGB 4F6LA 3VAZA 3JQ7B 3AFIA 5K3EA 3VJRA 1L7VC 1ABEA 3M6FA 3PWKA 2Z83A 2FPXA 2EJVA 3CNOA 3RYFA 1RJWA 3RRJA 1I7FA 3I45A 3JASB 2Q6TA 1ZSYA 1V16A 1RPAA 4MH0R 2YASA 5FI5A 2YCBA 5GVSA 2SKDA 1QR8A 1D4FA 5DBOA 3I30X 4EA8A 2O3RA 4QPDA 3T5PA 3DVRX 4MUEA 3DLPX 4K6HA 4WZAA 4FIPC 3OTOO 1SVLA 2OLEA 3M3DA 2XMBA 1PGJA 4UATA 2DMXA 4DNOA 1MO6A 3ZCVA 4ZDJA 3LSQA 3U1VA 3P0RA 4FR5A 1HG0A 5HM8A 1EVQA 1V1MB 3DOOA 4YRZA 5IZCA 4JXZA 1LBHA 3DLIA 2PWBA 2C5LA 4DUZO 2BBSA 3MWDB 4KYIB 5EL0A 4A5SA 3AR9A 4EHHA 2WT4A 4EKNB 1SXQA 3VQVA 2VHZA 2P30A 2PUJA 1I6WA 2EGUA 3MWJA 5EJ2A 1Y7PA 4D0LB 1IXKA 1QNFA 2OZPA 3QJYA 4LWQA 1IZZA 6AT1A 5HRCA 5L40A 4OBXA 3U19A 5TC4A 2KG4A 1K7DA 2CHQA 4BX8A 1PO7A 4NOMA 5A7FA 1Z26A 3N6XA 3S55A 2PS1A 1KIAA 3RUCA 5DTRA 3CS5A 3KEMA 1R00A 5J4HA 4ARIA 1FBTA 2B5UA 1X86B 1ISMA 3N3BC 5K99A 1LUVA 1XP5A 1FFBA 4MDEA 1S2NA 3F6YA 1DC7A 4ZVUA 2X0DA 3RSHA 1GILA 5JU6A 2ORWA 3H16A 4CMCA 4D3SA 3QG1A 5EWLB 3Q88A 1FXSA 5LBTA 1L8DA 2VA8A 1ZIXA 1E92A 2GVIA 1A4IA 1FJ2A 2AFHA 2QR3A 2CBXA 3KPVA 3TZCA 1CXZB 4RORA 5HIMA 2ZYRA 4FB4A 1NMZA 3IVMA 4ZHQF 2V6FA 1VLQA 3Q40A 1RD4A 3T7DA 3VZBA 3B82A 4LFBO 2NQTA 3JYOA 3NRJA 4PZPA 3KDPA 2AGVA 1BMFA 4TQDA 4GM1A 3A3PA 3C98A 4ZPJA 5ARBA 1AMOA 5IULC 3LHIA 3OQPA 3UWMA 2DFLA 3SIXA 1FS4A 1EZVH 1LBTA 3EUFA 5HS6A 3JW8A 1ZIPA 1AI7A 3T7IA 4FLMA 4BUJA 4D0GA 4JAVC 5BSUA 1V5GA 1QYCA 2I7XA 4RPIA 4ZDWA 1L5HB 4HDSB 4UTPA 2DYYA 3F49S 1HOXA 4FUTA 4NARA 1OLUA 3STLC 3KJNA 1OLUB 2VAXA 1C3LA 4BW5A 3LDGA 4PAMA 5AJYA 4ZAWA 4CC6A 3TVTA 4BLQA 5C9ZA 3W7AA 2C61A 2PHNA 2OVBA 4MX8A 4KR2A 3ZJ4A 3DAYA 4JF3A 1P2DA 2BKVA 1W75A 2A9QA 4NAVA 2E7ZA 1DQNA 2IV7A 1YZNA 3ML1A 4AX4A 3BCRA 3FCSB 2M9MA 1T36B 1GL6A 1Z28A 3KXDA 1K3EA 1XREA 4L8GA 3VFDA 2YIBD 1JR3A 2NYUA 1P1HA 3AB7A 2AZXA 3CVXA 1EK6A 3LLVA 1FFSA 1MB0A 1QH9A 4I1VA 5HF6A 3U39A 1M90W 4QBFA 4I9UA 3DEFA 3ZGZA 3RIXA 1EHCA 2BELA 1YJWV 4HVAA 4MVRA 3IUMA 4EQ6A 1UPXA 2Q07A 1CZUA 2G0AA 4PTYA 3UN1A 1UCFA 1LBEA 3IALA 4I4LA 3IUSA 1C2YA 4C14A 5T4HA 1NLMA 3I5AA 4BIMA 3SJAC 4KYUA 1DF5A 1QG6A 4URWR 2VXBA 1OXVA 2IW5A 4G0NA 4X3OA 4EO7A 1RI2A 3M9WA 3PUKA 2YW9A 4HUQA 2Q29A 4RL6A 4HQLA 5JSHA 3DDNA 3IR9A 2E4UA 1W4ZA 2XF2A 5AI5A 3INNA 3TI9A 4C5BA 4C7VA 2QBYB 3JYNA 3ZLJA 2C2ZA 1JFSA 3B5EA 2ATIA 4OY3A 3HHEA 3RSSA 4CNBA 4Q4JA 3OIWA 2X7XA 3DH0A 3EVNA 3JQEA 3T4PA 4LMRA 2QLJA 2J6BA 3PFGA 3JQ9A 1VLVA 3BC1A 3QPWA 5DGTA 3RHZA 3RQSA 3VR1A 5JAUA 3D3QA 5CBPB 3GLGA 2J8ZA 3AHCA 1XPRA 3GQBA 4D9KA 1V3UA 3CMAF 5KVAA 2C9DA 1G9TA 4ZVPA 3LHKA 1SXHA 4PRKA 3CCCA 3T7KA 5IWAB 3CG6A 1L5FA 2OHOA 4GT1A 3ZIDA 2CY0A 2YWEA 3OE7G 3EWIA 3WXMB 2VK2A 3THSA 1I1HA 4RKWA 1K7XB 1U9IA 4EG4A 1C7EA 2F3RA 3H5WA 2P7IA 4MI3A 3LT2A 2NTEA 4Q12A 4N18A 1QQBA 1YVUA 1MAHA 2Y9PB 3PHJA 2NN4A 2DN9A 1H05A 2IUYA 4BU0A 1JR2A 4XYMA 1X6VA 5EHIA 5AVSA 3F0DA 1M2KA 1FQWA 3CIFA 1Q82W 1LB1B 1QIKA 3HEAA 4JZYA 4ZQGA 2R70A 2J3KA 2QZ4A 3ZH2A 4DBZA 1W7AA 1GFZA 4BNZA 1LLDA 2C99A 5T5QA 4CCAA 3AI3A 5K3FB 3OZRA 2MK3A 1TUBB 4J6FA 5IC6A 4GM0A 3KZIZ 3ES9A 4L16A 1NQOA 1OKKA 1QAOA 1XV5A 1NWCA 1U7XA 2RHRA 2V55B 3TEMA 1YB7A 2O7VA 3K58A 4BO0A 2XYHA 2ID7A 1LWNA 2IBMA 5K0TA 1ZJJA 1Z62A 1BS3A 2NG1A 1T5DX 2YQZA 1FNKA 1DXHA 1S01A 1T1EA 2X8WA 4P32A 4C0WA 3AVXA 1Z35A 1XAJA 1I01A 2EKPA 2WHRA 5FPOA 3B60A 3ZHVA 1CQJA 2VF2A 3AF2A 1LUAA 4M9XA 1INLA 4FNGA 5FEUA 4AJOA 1RPZA 3RVRA 4CDRA 4J7ZA 1AXRA 4MCIA 4RGQA 2VSNA 3P0ZA 3OECA 5FBLB 1FMFA 1WCV1 2ADPA 2HWWA 3OEYA 1F7YA 3SJ7A 4OP2A 4BN5A 4XQEA 2HP3A 2AR9A 2VJYA 3FPKA 4PRLA 1AT1A 3HJHA 3EZXA 1GL9B 2DYKA 2R4TA 2WU0A 4IFIA 4RM2A 4B71A 4M6WA 5A3RA 3IP8A 1Y5LA 4Y2GA 5GJBA 1E6WA 2WPNA 4YJGA 5G40A 1XZEA 4GI2A 3E82A 4OKIA 3ZDYB 3IPLA 4BS9A 1Z83A 3F9RA 3TXXA 4BQSA 5DFAA 2Q7EA 2Y4OA 3AJRA 1Z8DA 2A78A 1UK6A 1Y4ZA 1TW2A 2OO5C 1PD1A 1CR2A 2YJTD 1YJCA 4Q9AA 4U2BA 5THXA 1PYOA 1QKJA 1E2HA 4KL8S 2H11A 1MZEA 4O2AF 3SS9X 3CZRA 1WZUA 1O77A 3K05A 4FNAA 4HGYA 1QQAA 1B1AA 2FEKA 2AEFA 2DOSA 1NH2D 2ZYSA 3O73A 1ZD3A 1XCLA 2BHNA 4TZTA 5FAXA 3TX2A 1Q19A 3D4IA 3G7UA 4MTLA 2PCJA 2K5UA 3K15A 4LDJA 4RWEA 1UPUA 2Q8VA 4DR3B 5DTEA 3A70A 1QU9A 1KJYA 4KBFA 1KMNA 4ASUA 3DFZA 4GPTA 3SM3A 5LDDC 1C8BA 4JJIA 5KWIA 2YVLA 4BO9A 2IEAA 3I9V1 3D5QA 3CWBH 4P4GA 2WIDA 3NTXA 2PPLA 1CY1A 1RNLA 2JAUA 4J7JA 4NB5A 1QO0D 4PVCA 3TZEA 2B61A 1R6AA 4BMVA 2IYSA 4D4GA 3TF5A 2IZ6A 2LXNA 2WVGA 3DTVA 2XLBA 2J0EA 4OLBA 1MJHA 5CITA 2Z6UA 2QNRA 3BMQB 3RT7A 3A1NA 2GRUA 3ONEA 5SY4A 5L3VA 4X1IB 4TSFA 2DWEC 4X1IA 1FYJA 2VNHA 3G1WA 3PQ8A 2J45A 4WCEV 4HDKA 1G5FA 4ARVA 1CR6A 2PTGA 4A2PA 4Y3UA 1L5OA 3MJTA 1CW2B 4HQ6A 4IVQA 3JWJA 1KVQA 4RSMA 2JATA 2DLCX 4GOOD 4AJKA 4QPNA 4U9IS 4DE5A 3FNGA 2FHPA 1VSQA 4HPWA 2X4DA 4BO8A 821PA 1W5TA 3N27A 3ASOC 2BM9A 3DE5X 2QW8A 4O4JB 2ZYTX 3L46A 4ZCLA 1BXGB 1EVEA 1QO9A 3RN4A 1DWOA 1Z3IX 4R51A 4A5OA 4CCYA 2GVDC 3I8SA 1U8XX 2Q6OA 2IF2A 1J22A 1KI3A 1M2VB 1QVRA 1X7ZA 3EZLA 3HYTA 3BQ9A 1QAMA 2CCJA 3MJ4A 3OIDA 4U02A 5J2UB 4UQOA 4PYJA 4KHPO 4YIKA 1EUCA 5K3CA 3BA8A 2GBOA 1UMDA 4QARA 4UEWA 3H2IA 1KJWA 4ZO7A 1AOXA 4JI8B 1EP1B 3N70A 2QWXA 4WPGA 1TGYA 2P91A 1LBQA 3RG8A 5F9FA 2QKCA 2LP4Y 2DRIA 1YC2A 1X8LA 3MOSA 4MQ6A 3ER8A 5CTJA 4FFNA 4A1OA 4B4UA 2GN8A 4FN4A 4YP6A 2DT4A 4AN4A 3WRYC 4Z8XA 4EVRA 4PIMA 4UVCA 3BQNB 3JQ9C 3M49A 1OCEA 2O0JA 1WE2A 2RGXA 4WGGA 1FDWA 3GLKA 3V1UA 1GZ3A 3CCVF 3HBJA 2R6JA 5LMZA 1FNMA 5FTNA 1M2GA 2WAXA 4GGMX 3O8LA 5FT9A 2W2MA 2V9ZA 1M8GA 4DMHA 5AIAA 1T0PA 3PTAA 1G8AA 1EUQA 2CBGA 3WL5A 4L51A 5F23A 5FX2A 1OXSC 5T57A 1H8HG 3IKVA 3WIOA 4AF6A 2X22A 4HFMA 4V1CI 5KOHA 1V54C 3EYAA 4UU1A 2PV7A 4BKMA 3APOA 2FOIA 3KVRA 1ZNYA 3ORSA 4PC7A 2X5OA 2WDZA 3CRW1 1HA3A 2ZCVA 2B1QA 2J4CA 4XFJA 2LBPA 4IDBA 4IHKA 4MS4A 2B20A 5ALWA 1TQ2A 1ZISA 2ID8A 4MGYR 2O3TA 1ZH8A 3CCSF 1RCTE 3P9PA 4XWAA 1PQWA 3AUSA 5HCNA 3VSAA 1T34A 4PNHA 4CV1A 3F47A 1JDJA 2B7BA 2C3UA 1PNVA 3DBIA 1KD1H 4JJ7A 4YTEA 2WZDA 2AJDA 1Q86W 1T5OA 5B2EA 4ALJA 4PA7A 2H4HA 3F97A 1CERA 1JPUA 1XZKA 3KTAB 4RFSB 2Q0AA 1GXSB 4XPIB 4RZIA 5GGYA 2BYTA 2V7BA 5JATA 2HV9A 3RUDA 5KWVA 1IXBA 4Z1OA 2VP2A 5EVJA 3RVJA 4U6QA 4AJ2A 1L7EA 2BRUA 4MMZB 2VPXA 5GINE 1ZI6A 1P0MA 2B2CA 3G6BA 3GEHA 1EP2B 3PT9A 2CSXA 1RKXA 2BZGA 3FN4A 1RPOA 4FOPA 3OLWA 4N54A 4NHOA 3L0CA 1P9RA 1X8KA 4V2UA 2F8TA 1GN3A 2WUEA 3EISA 3GNTA 4C0LA 2I6QA 1FA9A 1KTIA 3MNFA 1NTRA 4IQ8A 4P53A 5TF4A 2X7HA 4BT7A 3F71A 2VZ9A 1L3CA 1JIVA 3OKCA 4IRXA 4M0PA 4XW2A 1UZNA 1L4BA 1A5AB 4X93A 5E1MA 4ZI7F 5KWSA 3ICXA 1K5QA 3KXLA 4YUVA 5CH5A 2RHGB 3NPAA 2UDPA 1U5AA 1TT5A 4HC4A 1P7YA 4FS3A 2HJGA 4Q34A 4BO2A 2P1DA 3S2SA 5KB3A 4YAEA 1SESA 1OPXA 4D3XA 2EIJC 3LA8A 1B2RA 2VLBA 2OD2A 1ZGZA 2ZZKA 5KYYB 2ZXUA 3UAVA 3ERCA 2Y1WA 5H16A 4PCUA 4I9GA 4RPLA 3CKMA 2QD3A 3IVXA 1JDZA 1HTBA 3TTVA 4K3UA 3O8CA 3A6GA 1R88A 3DUFB 4G0WA 3LI2A 3HPQA 2MYTA 2HMYB 3MCVA 4QJ5A 4RQBA 4K7JA 2DBQA 1SK8A 4WBNF 4AQYB 1W5AA 1H22A 2GUZA 4RUKA 4NCAA 2A0XA 1PIWA 3KLMX 3PE3A 5FI1B 4FGLA 1HT3A 5E1BA 4DUYO 1OH7A 1T5TA 3ESDA 5BN3A 2AEEA 4IHQA 2RGRA 5E7JA 1AI4A 2KTUA 2EL9A 3L8YA 4HEA1 3P5SA 4TLCA 1MLDA 4ZOBA 2X1LA 5F12A 2D3OW 1FP4B 3UG7A 4RM3A 3RIHA 3OSUA 1RLUA 3H9GA 2DUUA 3IEPA 5E9AA 1E5LA 1NJIH 1YVRA 3IQZA 4I1SA 4I19A 1M1ZA 1K7YA 5KYXA 1PL0A 3U7FB 3RFCA 3HCRA 2JEXA 1NUTA 1X7XA 1DNPA 1N8TA 2BCGY 4LSGA 4PLWA 2HKOA 4TMWA 3W9UA 4CQNA 4KI0A 3VC7A 3FOCA 2JEUA 4B3BA 2F1OA 4CH4A 1TZ2A 2Y1OA 4KE7A 1HLFA 5BVHB 5IWAO 1CY7A 5C46F 5KYYA 5EJ8A 1JWLA 3GRPA 2R8XA 3MOGA 1SXJE 3C39A 4H37A 2QW0X 2NW6A 3AR8A 4LTNA 1TYDE 4RWZA 1QRRA 2JI8A 3A25A 3L84A 4NNPA 5ESWA 3CT4A 3MS7A 4JLNA 4UBMA 3KD2A 3T8YA 3TNFA 4BFLA 5LOVA 5HP8A 3M2TA 4LJ5A 1RQLA 3FPSA 5CB6A 3PPIA 5AW3A 4PA4A 4NWOB 2E4ZA 4AWAA 4FLFA 4M2LA 2HC9A 2HEIA 1JHAA 3T9BA 4L6IA 2NO9A 3AUJB 3CURA 5CBHA 3A0BZ 1RKUA 4D9HA 5L7TA 4MW1A 3G0HA 2WLHA 221PA 4CT5A 1P5RA 3X2EA 5U9CA 1GDTA 1M66A 4PDLA 2NO5A 5JFTA 1QRAA 4YVFA 3WQSB 3IUJA 3CXCF 2BFPA 1W2WB 4YAGA 2QLBA 2JLQA 5B3LA 4IX9A 4DIOA 1VPLA 2UZ4A 1W19A 2X23A 2XUOA 3RO7A 4D3DA 4G9GA 1Z4PX 3IMPA 1CR4A 3LDAA 5KBYA 3R6WA 4RFSA 1XL1A 1F48A 2GYWA 3S2EA 3CWQA 1A9XB 4IHJA 3AU9A 2QQ0A 3GA7A 4UBOA 5AW9A 2P06A 1EEHA 5CB4B 2IY8A 1TLLA 2PIDA 5BSVA 5F21A 4G8JA 1KH2A 4JI2B 4H18A 1ZMBA 4XLTA 2BJWA 2OZEA 3WB9A 1IG0A 3D7LA 3ZDEA 3GGDA 5KKCA 1EVLA 1PZHA 1LVGA 1QRTA 4GYCB 3MLBA 3OQJA 4G97A 4E94A 1JVSA 4MS4B 1W46A 2WM9B 3FFTA 3OPMA 4HD8A 4ZCIA 2JEYA 4GIBA 2PZSA 1MENA 3FHOA 3O4RA 5I4CA 3LDDA 5AKLA 1MHPA 3A3OA 1NJ2A 1YQ9A 4GLBA 4DCMA 1J90A 3B6MA 4TYNA 3WMEA 2YRFA 4P2GA 3CYQA 4LDNA 3WP0A 1SUPA 1VP3A 1DBRA 2O06A 3WK5A 3KT3A 4XIYA 4B6JA 1XL6A 1SJ9A 4XVCA 1PUIA 2W2TA 3NBMA 2QM7A 3GLIE 4DREA 3HJUA 3R9XA 1LSUA 3S5JA 3UH1A 2HIGA 3K35A 3ABTA 2CVFA 2CE4A 1NNI1 2O8DB 2Q1UA 3T61A 1RXVA 4I7ZB 2IYVA 3N6VA 4IYJA 2OK7A 2B35A 1VA4A 3PGMA 2CZGA 1VHQA 1T5SA 4II2A 3BSWA 1ENVA 3DXRB 4GBGA 4IFTA 4HS4A 3S6JA 3PIIA 3WL7A 4C06A 8GPBA 4FFPA 2A88A 3RRNA 2EIMC 3VO1A 1GM7A 2FPPB 3WLLA 4DOMA 5L4NA 1LPBB 4NEQA 4QNMA 3CC8A 3FNRA 3I52A 4HDQB 4OCZA 5TT0A 2O8BB 3OMAB 4W4KA 4X9QA 1T91A 2Q1WA 2VWPA 5CYOA 5ECDA 1PJQA 2HVJC 1YTLA 1V41E 3BEDA 4NNOA 3ND7A 4MR7A 2PJRA 3OZXA 4K0KO 4PONA 4P7GA 4IL5A 3LKVA 4YACA 4OJYA 3M6AA 2QE7G 1HI9A 2ZOVA 1VLJA 1M74A 3PI6A 1Q6ZA 1BX1A 1P31A 1QZ3A 1H66A 1GGJA 3PHIA 5LP6C 3UHFA 1UEIA 2BGTA 1ZITA 1FFTB 5IBQA 3OCYA 4Z8YA 1HKHA 5ED0A 3GCGA 1H8HA 2FWAA 3GJYA 2FW1A 3KRTA 2NVBA 5E6RB 1BEEA 5BN5A 1N6LA 4C0BA 3CYFA 1MD9A 2V8BA 1T0IA 2OZVA 2DOKA 4LH6A 1BDJA 1GRNA 1KMIY 2BZ0A 4U9HS 1OTYA 2AZDA 4UNQA 5EWMB 3WKEA 1N1MA 4BKRA 4D9FA 4DJJA 3EEYA 2E21A 4QELA 1KI9A 2LO1A 2P6MA 3QO5A 1IEVA 2OAEA 2YMMA 3DDOA 3GXOA 2XGOA 3EIWA 3QI2A 4FGSA 4TL6A 3ZZNA 2C9OA 4C4RA 5FDFA 1UBFA 1VKRA 4UJ5A 2FP4B 3SCZA 4BV3A 4GPIB 4D0RA 4D9NA 4EW6A 1HH4A 1D7OA 3FHLA 2I6DA 1A88A 4KRGA 5H59A 4N9WA 3WLSA 1MJNA 4G1CA 2Q6VA 1XQ1A 3FUWA 1UMKA 4JUAA 5E9QA 2ZRIA 5F1YA 5E4FA 3UAWA 4YMUA 3BKXA 4RCZA 3HKDA 3AZPA 4ZQFA 3MG9A 2SICE 3NO4A 2Z1MA 1FYWA 2YXHA 3ST7A 1H2AS 1VGVA 3ORYA 3OZBA 4M36A 3AP2A 2FMTA 3GJ0A 3H5NA 1J8FA 1L5MA 3T3PB 1NXPA 2R2AA 2OK8A 4WZZA 4Z7QB 4LQDA 3R7BA 3CONA 4DW1A 4QEKA 4RZUA 1NUPA 1XVLA 3KU1A 1AS0A 5KEIA 3MDOA 4JBNA 4QL3A 4R2IA 4LUCA 2C82A 2ZATA 2VTEA 2O2YA 1GPJA 4W5OA 10MHA 2CDYA 5G4UC 3K06A 2P5OA 1GT6A 1MT0A 2BCJQ 2NZ8A 1B16A 2VKTA 3KTAA 2BFMA 1VHLA 2PT7A 2Z1FA 3FRIA 2CWJA 4WLOA 5KUTA 3BTOA 4QU5A 1MA0A 5DEIA 4GSKA 1NVPB 4NCJA 5CA1A 4H9GA 2QUIA 4ABMA 4PYLA 3CCLF 4HGRA 4WFBV 2NX2A 2VBFA 3WLMA 4N6GA 2DPMA 3AESA 3R4VA 1SDSA 1HFEL 3K0AB 3UC9A 5M04A 5H82A 3KUDA 1QHIA 4PXYA 4JZ2A 4BYMA 4OBEA 2RHWA 3NNDA 4BKPA 4C4AA 2V7PA 4R05A 1E3TA 3R8CA 4BLOA 4UQLA 5F98A 1G0NA 1ST2A 5EKSA 5JRDS 2HAEA 2NVWA 4MYSA 3HDJA 1CZLA 3X1MA 2ZJ3A 4OD0A 2CDCA 3KQPA 1MQSA 3VR6D 3UMCA 5AW4A 3KB1A 2CN1A 2V96A 3GHHA 4C04A 2UVPB 3FSGA 4B84A 2WIAA 1VMEA 5L3FA 1CUHA 3OOSA 4MCJA 4ZIBA 4WOJA 1UQRA 3H5AA 3QW2A 4BQRA 3NAGA 2QKSA 2R00C 4F8YA 3J81A 4W9MC 2N3ZA 5CM9C 3PL1A 2ZOSA 3CIOA 3EC1A 1R73A 1WHTB 2PYIA 4IWYA 3FMIA 4M0LA 5CXUA 4LTMA 2RE8A 3ETCA 5ESRA 4JUBA 4Y1RA 3CZPA 3T3DA 2IX3A 1TUEA 4ZT2A 4JXJA 1BYUA 3OUZA 4Q9DA 4N8DA 3TRHA 1N32O 1JQ5A 4P33A 3VPAA 5KOHB 3T9DA 4J7XA 1YKSA 1J0AA 5KNDA 5BRNA 2C42A 5LU8A 3D6AA 4TTJA 3U0BA 1J9GA 2I3GA 4LYGA 4YROA 4MPRA 4NFSA 3TBFA 1VCIA 1Z25A 1JCHA 1TVKA 2ZR3A 4MYTA 2BFOA 1Z56C 4WCVA 4YJKA 5FPQA 5GM2A 4DBLE 3GLFE 3ON5A 3BWCA 3KUCA 1E94E 3DC2A 3PHBE 1E3WB 4E32A 1XLTA 2EKBA 2JCSA 5HUHA 2DWOA 2GLUA 4AQYO 1YJNF 1EU1A 1JWAB 2I7TA 1NQ3A 2II6A 2QX8A 1CUZA 1QC5B 3AKDA 2P3LA 5JC8A 3QXGA 1Y4AE 3D1VA 1WQ1R 3I6IA 2PU7A 1C1YA 1B6TA 3GP5A 3GCXA 2IHVA 2EKDA 1GFSA 3U49A 4E2XA 4MJLA 2GT1A 1WL8A 4BQOA 3LSSA 2P40A 4IOJA 4V3CA 1BU8A 2RH4A 3JQAB 1SC6A 2HPZA 4BDTA 4Z0TA 5C5CA 3KKMA 2K87A 1QLJA 2EG9A 4KGVA 1DBQA 3GROA 1IJBA 2FTKE 2ZBGA 1C7RA 3DAHA 2YQ4A 3MF4A 3O4JA 4G85A 4U8HA 4BLRA 3CM0A 1E62A 4JV5B 2YYYA 2NGRA 1X8JA 3UYLA 4AU1A 4EVIA 3F73A 4LRSB 4PC3A 4CMEA 4F21A 4LF9O 2OAGA 4TZ0A 3D81A 5T41A 2ODWA 1FRNA 1PGOA 4H2DA 4NR0A 5IVHA 2AW9A 4UEQA 5BV2P 2ZCJA 2EJ7A 5ECYA 3WRXA 4KYVA 1ZX1A 3CRAA 3TG8A 4H7JA 2KB1A 2GO7A 2YVAA 4Z2YA 4MHTA 1SUFA 3MD9A 1YHNA 4HBZA 4AZ3A 1KY3A 4EG8A 4KQ1A 1ZUHA 1QV7A 4EX7A 4LX8A 3FBWA 1QFSA 4CLDA 2PLFA 4JROA 2I1WA 1SKQA 2CLMB 1PFKA 3Q3VA 2AFIA 1XD8A 5FPHA 2J85A 1KJ8A 3CZ5A 4ZI2A 1VHAA 2B2XA 2BEUB 2PVCA 3ZWDA 1XU4A 4RA9A 1V6SA 1IBKB 3OQOA 4YWHA 2EARA 2W71A 2OQ2A 2F2TA 1NJ8A 2A9HA 2G17A 2QN8A 3AKEA 3KNZA 3RASA 3V2IA 1GQOA 3WGTA 3U0OA 2H8EA 3IRUA 3V4FA 2V7VA 4WVFA 4KE8A 5AVUA 5H5JA 2IEIA 2IK8A 3JZDA 3QWAA 2O8DA 3TQCA 4EHFA 5HCIA 2O1WA 1SXJB 4CIVA 3PGLA 5BR1A 1XMQB 1L4FA 4OUKX 1ZEMA 5FA8A 2HIHA 3LWRC 1G7RA 3MCWA 1C9DB 1XYGA 1V25A 3SYOA 3O7MA 2Q5FA 4NZMA 3ZLBA 5ER9A 3BH6A 3ECCA 3GNSA 1L7PA 2WNIA 3O8NA 2IKSA 3O3CA 2SCUA 5DYYA 1Z5PA 5HF5A 3SZMA 5CVCA 3T5BA 2H4WA 4DJDC 4CLRA 2Q4DA 4P92A 5IMSA 4F6RA 1QO0A 2DYSC 2IOYA 2JNWA 3P97A 5FP0A 4F8EA 1POXA 1XTJA 4TQ9A 3FDZA 2A9RA 2ZUSA 3CVOA 4Y2VA 3QVGB 4UCSA 4QEDA 4QYWA 2B9EA 3ET5A 3KYIB 1JAHA 3BL8A 3N0RA 1HE2A 1RSZA 4G1VA 4CT0A 1NJ1A 3G88A 2Q1YA 4YCLA 2NU9B 2AMYA 2O7SA 4OMDA 4C7OB 2IBSA 5AW8A 3UBTA 3INGA 3OZGA 2QMOA 2W6ZA 4ES6A 1U5BA 4C7MA 1WVIA 3LPMA 3A3NA 3VSBA 2XCQA 3MJFA 1J7JA 3IDSA 1J2UA 1VLMA 1YB5A 2RGYA 3OPYI 2FX3A 2ORIA 3WFJA 1AO0A 1P4GA 3QZUA 5CX1B 2EFCB 4BNJA 4BV2A 3EHEA 3HRKA 2QX7A 2C7VA 3TBKA 2P5YA 1IE3A 1S3IA 4I8XA 3K72B 3IIKA 4Q9JA 5CVEA 1VFNA 1GT91 2WD9A 4ZXFA 3Q0EA 1VQKF 1IV3A 2H6LA 2J7PA 2VPWA 1MABB 3MZ0A 2QAIA 2BOCC 2CWDA 1HRKA 4INAA 3SYKA 3RC2A 5ULLA 3PE6A 3T06B 1DBFA 2J0QA 3ENZA 4D6XA 1RVV1 4YHHB 4LRTB 4YAOA 2HX0A 1XP8A 3HVKA 1SXJD 2N42A 4G89A 1QK3A 4L6AA 2J48A 5AK4A 1SCUA 2QTBA 2XWJI 2JEZA 3DE1X 4QAQA 4RQEA 1K0FA 1U2PA 1NE2A 2GZ2A 2O2EA 1CZOA 1Z2DA 1Y3IA 2VOJA 3CUEF 4K26A 3MELA 4WINA 3VKHA 2PAAA 2I4MA 4UBJA 2O3QA 4O0LA 4U7NA 1DEHA 4BZQA 2WD7B 1NUSA 2C3OA 2ZPTX 2LBTA 3C9TA 3C4QA 4CIAA 4FBGA 3D7NA 3QFSA 1B8VA 1Y3AA 4HXYA 4XA8A 4ENPA 4R0MA 2YHAA 2C4HA 3SBEA 3JYCA 3P4YA 8AT1A 1PM9A 4B3SB 2GM9A 2QJWA 1QOPB 4HB2A 1FD9A 2PVPA 1KGSA 3U13A 1NP7A 1U6JA 2UYCA 1KBZA 2JA1A 2WJ6A 3L70H 1XNQB 1IPFA 4BXOA 1KP3A 2LCFA 4NBVA 3DOCA 3JTEA 1OI2A 3RAJA 1WKBA 1WCIB 1ADJA 2Z01A 3HO6A 3TCNA 5KVQA 1MX5A 2A0WA 2C7PA 5AM4A 3GJ3A 4PHZA 1KIMA 3QJGA 1I3MA 1NASA 1U5CA 2V45A 5P8WA 4BMSA 4CR7A 2IH5A 2QLTA 5I6DA 2IOHA 1F8XA 4QA9A 1WD7A 1KNJA 1DL5A 3EMKA 3R4CA 4P0QB 2Y99A 4XIIA 3BXEA 4XTRA 5KWJA 5FJIA 4B5KA 3S29A 4GC5A 4DV3O 1KQPA 2QQEA 4WK2B 3M0EA 1YE3A 1EE1A 4NG4A 3DW1X 1FX1A 1K8XB 4LCKA 1PHPA 2IFTA 2Q8PA 3HCWA 1R1MA 3JPWA 3JYPA 4GI7A 4IW3B 1YZUA 4F60A 3TD4A 1SU7A 1Y98A 2LNDA 1X7GA 2XOEA 3SZGA 2VKQA 2IEDA 5FUVA 5C1BA 1VM6A 5HJ7A 3TK1A 2R86A 1R3LC 2JFXA 2ZBUA 1O58A 1VCNA 1WNFA 1U8FO 2BSAA 3BRWA 1YONA 3CJRA 3B1ZA 4X64O 5JCPA 1N57A 1E3QA 2ZUUA 3WJRA 4KMSA 4MWDA 4L8VA 1QGUB 1OB5A 1FFAA 2QU7A 1XJ0A 2PR7A 1B6QA 4QJ4A 2WWRA 4B85A 1SB8A 1FMJA 2CHTA 2OORA 1U8CB 5DHPA 5JECA 5C81A 4PRYA 4LF4B 4LFAO 1M1YB 1RMQA 3IT1A 3CC2V 3RVBA 5AJZA 2FYTA 2IP1A 4ZAVA 3GIWA 1F51E 1T4DA 2HZBA 1BXZA 3V8PA 3O1LA 3NH6A 1AKEA 4A0QA 4JJAA 1W88B 3HXPA 3M6VA 2OCAA 5IT9M 1OBFO 4KRYA 4MGHA 5C4GB 4D3ZA 2MWMA 3PC8C 4NZNA 4DIBA 4NYJQ 3WI7A 2VJQA 3UXHA 1I1OA 1VQNF 1OI3A 1UFRA 2BMAA 2ZODA 1CR1A 1WZNA 2DKOA 4MQEA 3DZIA 3JRNA 5JANA 2EF0A 1B0AA 2XZTA 1NBIA 4RY8A 2R6GA 5AVOA 2A7XA 3IIEA 4NXMB 3TOCA 1CIPA 1JU4A 2INGX 1Z06A 2QTMA 3KK0A 3O93A 2ALEA 3U4QB 4Q6BA 2BFFA 1RJ9B 4PXSA 4RIGA 1BHAA 1NG1A 3PNKA 4LGCA 5IHXA 3GFVA 3Q5GA 1C1HA 5FPYA 1SPBS 2XAFA 3CNHA 1XZGA 4ZHVA 5HUQA 5NULA 3SLKA 3HN2A 1EUDA 2W4IA 3NXKA 3Q0TA 3T7RA 4B09A 1YI2F 1HE5A 1R74A 2PUWA 1T9BA 2YTZA 1RYHA 1GNPA 3D6MA 4UCUA 2IPAB 4HAYA 4X60A 2IU6A 4YI5A 4JLWA 2V9YA 4LYAA 4GMDA 1ZMRA 3AK4A 1J49A 1YZBA 4X1YA 3AEUB 3TRKA 5EBLC 2O50A 1JQDA 3H4IA 1QANA 1UIMA 2C2OA 1PX2A 1W85A 3ABQB 3D6HA 4J6EA 3JATB 4ND8A 4FIDA 3U17A 4I5DA 1GFIA 1KSJA 3UKMA 2CXPA 2KSDA 1QYRA 3K7EA 2HP0B 1J0EA 3ZVNA 4GS5A 1PUJA 3G59A 3I9FA 1Y1TA 4FZ0A 3IP9A 1VQ5V 1LXCA 5IC4A 3LF2A 2EFEB 3ZWYA 2BFBB 4HUJA 1DV2A 2IU4A 1NVAA 3IMFA 1GPNA 1R9GA 1KK0A 2P9BA 3UPDA 2OHIA 2OCIA 4PDVA 4UB6Z 4F93B 2VYVD 3GVMA 1Q95A 1RYMA 4HAXA 3VOSA 3S03A 4D42A 2GPWA 5BR8B 1F5SA 2AR7A 2EQBA 2I6SA 3LMKA 4H08A 1D5NA 4XEUA 1K4YA 4EI8A 2PYDA 3DKIA 3ZU4A 2F93B 2QWOB 1GPKA 4LECA 4LCBA 3SR2C 3OEHA 1EFVA 2AG1A 4U3FH 2WU4A 4H4EA 5EZYA 1AN9A 1OC2A 3FCCA 5JNSA 3C70A 3DDZX 3CZCA 3NVMB 1KAEA 2BDEA 1JEAA 1F06A 1HNNA 2XYQA 2FMXA 3NHMA 3RGWS 3OLQA 3OURA 3NBXX 4JVOA 3SE7A 4UM9D 2FWMX 3AI1A 4RAOA 2FK7A 1DG3A 1LCIA 5LJIA 5K0NA 4QXPA 4HEHA 4K40A 3T7SA 3ZLUA 4GBED 3W3AA 1AUPA 2G8NA 1ML3A 1QZTA 3CPQA 3R74A 1GUBA 1AZSC 4NE2A 1VQOF 2NZVG 5A3VA 1AP6A 1T2EA 5HF9A 1XD2A 3VRHA 5J3JA 1L7QA 5T67A 1RWPA 1OLSB 1XKLA 4QUJA 1ODCA 3EG5A 5JH7A 1TF5A 1V6AA 2FUKA 3U31A 3X1WA 4ANFA 2NUAA 1NOKA 1KEEA 1HG1A 1GN9A 3DM9B 4JKIA 5CM8B 4O59O 4ERXA 4DV0B 3C7DB 4JP8A 1MW9X 3UJPA 3SEQA 1UJMA 1ACJA 3UTDA 3W5BA 5KAPA 2G3YA 4YT2A 1MFPA 1N78A 4XFKA 1D2RA 1MH9A 1F20A 2GN1A 1DBVO 3HL0A 4LRQA 3TRJA 1U98A 4HO1X 3NEPX 2HHAA 3I04A 1U3PA 1ACMA 2H3OA 1KPGA 2P9YA 1P1FA 1H2GA 2MSWA 5EO3A 2ONYA 2ZDGA 4R1PA 1Y80A 3N8DA 4JDUA 4MV0A 2VYNA 1VE1A 5ELLA 1U8YA 3Q7PA 3EAGA 5ALPA 5B1SA 3RK4A 2VDMB 2NADA 4KXYA 4WLVA 4Q9HA 3SICE 4AG6A 2FQXA 1XU7A 3DDWA 4G1FA 3IJ5A 2QTNA 4WKPA 2CJYA 1Z6XA 3AFOA 4OA5A 4WZAB 2ZCEA 2HRZA 2AG6A 1H2NA 2AN5A 2IYRA 2QTHA 2W6JG 3NYRA 2I3BA 1E4EB 5FNVF 1F17A 2YL2A 5MGNA 2UYJA 1XPOA 5A2QM 4F6CA 4IV0A 3HLYA 5DYGA 4ETIA 3UJNA 3MC1A 3F74A 4Q3CA 1F0PA 4DC1A 3GEEA 3D9QX 4QXRA 4FJ0A 5EHGA 4LNHA 2V58A 1RZRD 2JLWA 1FYDA 1KDPA 4WVLA 4N82A 2Z3YA 2DR0A 4XYEA 1PFVA 3DEHA 4K87A 5IX8A 4LAFA 4LSWA 4PS0A 2L2QA 1AP5A 1DTOA 2A9PA 3NVDA 4X9XA 5ECGC 3ZRXA 3ZX5A 4RIIA 4KMRA 1QVGF 1V5EA 3RFUA 1KPIA 5GGXA 2CTWA 1V54B 3BD9A 1JTVA 4PD4F 2VSOA 1X7WA 3EFOB 2VQDA 5CLQA 3WMFA 3IJRA 2PZFA 3I6BA 3W5UA 2XHBA 2WT8A 3R3JA 3CLRC 3ACDA 5AXCA 4B34A 3P30A 2WP0A 4LHSA 4YLGA 1WB5A 5SY9A 1Y9JA 5B12A 1QHSA 4ENSA 3GEPA 4IFEA 1T9GS 3UJ9A 3ZDCA 3KJEA 1OAKA 4TLDA 1T4CA 3UQYS 4JI1O 1NN3A 5GQSA 3UANA 1F23A 1FPQA 3B9BA 1Q3HA 3IPYA 3ANXA 3JVVA 1YMUA 4A73A 4R6XA 1PNQA 2HMUA 4MP8A 3FCXA 3L43A 5ADUS 4DJEC 1XVVA 1JDVA 5TQ0A 3WG9A 1DT5A 4I6GA 1M57C 2DW4A 2BMEA 2JDIA 3DFKA 4R8MA 2CHVA 4FFLA 3PGXA 4D9CA 2DGDA 4O4HA 3A9TA 4YMIA 1OASA 3GEMA 1WP7A 4ER5A 1Z36A 2MJLA 5F73A 4NCHA 1YRLA 4KQIA 3IP6A 1H42A 3P5BA 6GPBA 3LHSA 4GMHA 5KX5B 1YT5A 2BUBA 5AK3A 3VPDA 1N7JA 4L4XA 2VLIA 4KQEA 5CK4A 4ARSA 3ASNB 4O2BF 4B1FA 3FOBA 3F0FA 4HRVA 1K7CA 1KO4A 3F6RA 2QDXA 2OTJF 3G0GA 2J33A 2KM1A 2QT0A 3DQQA 8ABPA 1QKKA 1HDIA 2NYAA 1YDEA 2V7GA 2PRIA 4I36A 4KLZA 4Y1RB 3VJKA 1W4AA 2OWDA 2ZQYA 2QORA 3I28A 3FX7A 1EFRG 2XI4A 3ANYB 3ENNA 2NSLA 1V9CA 3GPIA 1RLIA 1SRQA 3R7FA 2FWIA 5DNVA 2EP7A 1IBKO 1MP0A 3GIDA 4DR7B 2ZF8A 1JLSA 3GJTA 4NCKA 4BNTA 1PVDA 5KTKA 2PLWA 3OX4A 4JI3O 1SBNE 2OSVA 3H2BA 5EKTA 4H0NA 4RXTA 1N36B 1ORWA 5CN0A 2VJMB 3OLXA 2QP4A 1KO1A 1SOMA 1ZN7A 4BMXA 2BFBA 1N3LA 2H1SA 1P0IA 4PQGA 4WAUA 3W5IA 3RQIA 4CQLB 3EFFK 3VIUA 3SPHA 1M2NA 4V0OA 2OOKA 5D84A 4GECA 5DP1A 2JKVA 3BXFA 3E05A 5IMBA 3BDAA 2ZAOA 2PSFA 3Q8KA 1IRIA 1HL3A 2G09A 3OTQA 1T2UA 3Q10A 2G07A 4TLEA 1L1RA 1NTZH 2CZCA 5AK6A 3UMYA 2HLDD 3MGAA 3Q8HA 2C4WA 1DJMA 1J8QA 1GUAA 1SRRA 1NYTA 4P30A 4GLFA 2TSYB 2JS3A 3PJEA 2DB3A 2EXXA 1QHFA 4PCVA 4W82A 4YO7A 1DMRA 3L04A 1K9MW 4CM8A 1PLLA 1SQ6A 1ENOA 3EZ9A 2QAGA 2CMHA 3FPAA 3HDHA 3O8BA 1F8GA 4C4ZA 2O5RA 5KSOA 1UJ6A 3VYRB 3V1KA 4QPKA 1TIBA 3BGIA 3FSEA 1MRSA 1IIRA 1DCFA 2D5CA 2EGGA 4US1R 5JXJA 2F00A 4FYHA 2BI8A 3A4TA 2CLCX 3FFXA 1RFGE 1ZONA 5DHFA 1ULUA 3V8MA 2QSUA 4BWYA 3U40A 2X5XA 1E64A 4EYSA 4UM7A 3QVXA 2QEXF 3BSFA 1VB5A 4QOEA 1VLHA 3C3SA 4LF8O 2CUZA 3SSNA 4EGQA 5CFNA 1G16A 3C1AA 4BGEA 4EL5A 5K0CA 2ZBFA 1U2TA 2GYVA 2EJRA 3U5TA 5J2UF 2DJ5A 1I7QB 1KXJA 5AYVA 5F77A 1TI7A 2VEOA 2VHYA 3WWCA 2PS0A 4RLFA 1FTQA 2P35A 3CF4G 4QICA 3K8QA 2VOEA 3HBLA 3KM0A 2IKQA 2XNCA 4EFBA 4K9NA 4ZVOA 1YIJF 4OA8A 3WGGA 1M0TA 1XD9A 1M34E 2E76B 1U3VA 2IXGA 4UMFA 4Y2UA 4ZQCB 4YRDA 3GMDA 1LX7A 1NZ6A 1R18A 2WM2A 3MTDA 1P8JA 3SS8A 3SX0A 4DG8A 5K6RA 3LL7A 3CSUA 5DU2A 1GTMA 1L7XA 4C8GA 3MCAA 4PRZA 2O8FA 2C4VA 4J03A 2PAFA 4Z7OB 3QLUA 5T4FA 3SQOA 3E22A 3UHOA 3UHAA 3VNRA 2VHQA 4BPRA 4DLBA 5J2TF 2OQRA 3B85A 7REQB 4ZGWA 3W5HA 2PH7A 1GNVA 2Y1KA 1EG2A 3P7MA 2HA3A 3ZE6A 2XVMA 3FAKA 4MPPA 2Q7DA 2XNDG 3OOHA 4JJ8A 4S12A 5ALNA 3ZCTA 2ZB3A 3B12A 3HCEA 5BR8O 4RIEA 5IBRA 3ZN2A 4GNKA 4NF2A 2OHWA 1PJBA 1YJNV 5I4KA 3A1FA 1CS0A 4F5WA 1XEXB 1EHIA 3DMGA 4LW8A 3FWKA 1IM5A 4YMSA 3J81M 4ZT3A 4JENA 1WTCA 2VXYA 5LQCA 3J7AR 4QPCA 3PV0A 3R7AA 5J9PC 1QU3A 2PLRA 3LP5A 5AFSA 4P4SA 3JVUA 3HJFA 2ZAUA 5LZ5A 2FG7C 2AHYA 2VNKA 2W0SA 4Y6SA 2FY8A 5GANK 2QTCA 4QG3A 4C3OB 2ALJA 2HDHA 3EA5A 2Q46A 1ESDA 1NJIW 3RYHA 1BJRE 2FW6A 4JDPA 4MUGA 2KG7B 1J2TA 1P0QA 2HRRA 1PR2A 2YI8A 4GX1A 3IEKA 3E7WA 4EO9A 1E2MA 1VQVA 1HLPA 3PNSA 4IL6Z 2AJ8A 4UD2A 3I83A 2I29A 1H4SA 3SXUA 3G6EF 1FFYA 2GK6A 2QIOA 4DW8A 4HJXA 4Z2WA 2R72A 3UGJA 2LPMA 3K92A 1KA9H 1WVMA 3EQZA 5B1AC 5ALXA 3N58A 1VQLF 2BE9A 3C2QA 1K8AW 4F3CA 3EFBA 4FGWA 3ZUPA 3EPJA 3H83A 4C4OA 4MEJA 3LUJA 4E22A 1LC0A 4MW5A 4M9QA 1SKUA 5EIHA 3IMCA 3ZHRA 4QXAA 4RZQA 3GYQA 1JA0A 2R87A 4D9EA 1PKEA 3EZ2A 5HFMA 3WSWA 3R0IA 3JQFC 5ISMA 2B4AA 3TCKA 4QGAA 3DVLA 3LFOA 3V48A 5KUKA 1MO4A 1UPFA 2UYNA 4JX8A 3ZYZA 3UH0A 1M3SA 2J30A 2YMLA 4NJOA 2IEBA 3OT5A 1HETA 1V35A 4G4WA 3VCZA 4EW2A 3K03A 1A9PA 3SXUB 4KR0A 1QP4A 3O3MB 3QPBA 2ZRBA 3BREA 4UTZA 5DF1A 1G6KA 1L1FA 2MU1A 3RWRD 1IX9A 3NIWA 4ZZ2A 3QVKA 4WJZA 2VYQA 3H04A 4B83A 4QUAA 5BP7A 3UB2A 1YDGA 4ZTBA 3VUFA 4UBNA 4KR9A 2WSLA 2PX8A 3K70C 4B79A 5LR6A 3F4LA 2OCBA 3F78A 4WN9B 4FVTA 5A3JA 5CFMA 1UINA 5J4LA 5TQJA 5DBHX 2R6FA 4YV0A 3A9UA 1AGYA 2ZT9B 3V4PB 3LGSA 4C2AA 1OFVA 9GPBA 3D3WB 3DCJA 2QRKA 1VG1A 3OZUA 4GL4A 3PF9A 3TO5A 3WLIA 5HWSA 3S02A 2YWBA 4E51A 3CX5F 2ZJ0A 1VKNA 5CLJA 1GN4A 1K3FA 2DCUA 1RYDA 3OIYA 5ITSA 1LVUA 3AR2A 3QFRA 2CGOA 4OHPA 1QV6A 2GD0A 5DISB 4WFEA 3F7NA 3R2JA 1CD5A 1TYBE 5GOTA 1KK1A 1XZBA 2MYPA 4GUNA 1H0SA 3AM4A 5H3HA 3UUEA 5A4KA 3RAEC 1Y7TA 1GTOA 4HX2A 2HA5A 3AVQA 4X6XA 4NU8X 1L5QA 4P22A 4Y9TA 4S2UA 3NJ8A 3SHFA 2B3DA 1D5CA 3DE0X 1FFEA 2OG2A 2QDOA 3AUKA 1HT1E 1UDBA 3LQ2A 4XDZA 2IQIA 3R40A 4G41A 5IJZA 1YXMA 3N2GB 3IUYA 4S0ZA 3ZY3A 4FYJA 1OV9A 1Q57A 1KZYC 1N0HA 2OQVA 4ZOLA 2G9IA 2H1CA 1I8TA 2HEPA 3FMPB 1BWPA 1X0VA 1ZK2A 2NU6A 4NCNA 4HDOB 4P3PA 4QUGA 3VHQA 3HB7A 3ENKA 1N2CA 1IBSA 3NBQA 4ALKA 1D8AA 1M8JA 2ZKOA 3A32A 4TUYF 1PNLA 2X86A 1KAGA 1RJEA 3RC1A 2QMYA 1WTAA 3KJHA 3BMXA 2JASA 3B5JA 4MPDA 2ZBQA 1Y3CE 5ICCA 2IYXA 4EHJA 2A1TS 5KNBD 5KX5F 5L51A 2BFCB 1ZLXA 2PRSA 1TVCA 2WSYB 2YY5A 4MLDA 1Y76A 3OU6A 2FMLA 2QX9A 2A30A 1SCAA 1VHTA 2ZP1A 1EGQA 3F5SA 2SKEA 3IDAA 4FZVA 5BWLA 1RAEA 2PNFA 3Q7QA 4PYNA 2WMOB 2ZUFA 1H1DA 1ZHOA 2FFAA 4XARA 3CNBA 4ZVTA 3F3MA 5DMHA 1CS0B 2PXHA 1U7HA 2GZSA 3QVOA 4QNRA 1BCSA 2R6CA 2HU5A 4A0SA 1P5ZB 3KVNA 4LHWA 4Q18A 1JAZA 1MTOA 4Y6QA 3C3CA 4W5NA 2HDNB 3ELBA 2GB4A 4AROA 4WMLA 1RWXA 2K4MA 2R1TB 4Y2TA 1ZD1A 2ZI6A 3SQWA 1PJLA 1NR7A 4PA9A 5HX7A 4TZ6A 3A6ZA 5B30A 2QROA 4KXXA 5LA6A 1BKYA 3ASOB 3IBCA 4HDNB 1CUVA 3ZXSA 2HSDA 3OM0A 3X2QC 1JD1A 1RC1A 1SUBA 3NKLA 3HK2A 4Q3BA 4ZTUB 2WKSA 4EYOA 5IT9A 4I4CA 3RCBA 4CZ2A 4UHDA 1BMFD 2ILTA 2Q0HA 4LZWA 2YV1A 3QUSA 3KHSA 2BFEB 2PL3A 1NLZA 4UOZA 1MA3A 4OGFA 5FXMA 4C07A 4OSEA 3EQ2A 2DWUA 2C2KA 2O5CA 3E23A 3FUTA 5BUQA 2FV8A 4O5OA 1EFDN 4KLRA 3HCNA 1XUQA 4LCEA 3HB3B 1VSTA 5KMGA 2PMDA 3HZRA 3N0XA 3ZGYA 1V2HE 5ICGA 4H44B 3TPFA 4HDCA 5BUSA 5IJ0A 2IXEA 1P39A 5AVJA 4TKVB 2KBEA 4ZCRA 5M34A 2JLAA 5DN6D 2G28A 5A62A 3VISA 5BWMA 3RYCB 3MJDA 3U0ZA 2VZ8A 3BWMA 4CR6A 4F96A 2WV9A 1NQWA 2HQRA 1JKMA 1TMKA 3CY6A 4JN6B 1IUNA 1OPRA 3URKA 4L28A 5ETJA 3LC1O 4MEBA 1XK6A 2RKWA 1RHRA 5EFOA 3UENA 1N0VC 1YNSA 3DA8A 4FLXA 2RC5A 4JTAB 3DHVA 3NTUA 3OPQA 4WIAA 4ZEXA 3TTYA 1O8CA 3V4DA 2O3UA 3MPOA 3T41A 4DG9A 2XMPA 2ZTVA 2QXUA 4EG3A 2DSNA 3KB6A 2O05A 5BSFA 3EUWA 2F8LA 1JHZA 2RG7A 1K34A 4DR5B 1KJZA 2KPOA 2Y4TA 2FL4A 1W94A 3CH7A 2I22A 1AVTA 1OIVA 1X1BA 1NHGA 1VZ3A 2WB4A 3K9GA 4CEHB 4KVFA 3WGIA 1GLVA 1YULA 4F12A 3R5SA 1OTHA 4J7KA 4NS4A 1RYBA 4CFZA 2D2IA 2ATXA 4JMLA 3W5JA 3GMIA 5A5GA 2DFVA 3ADBA 1AZLA 3MSCA 1C50A 3LS2A 1D2HA 2B9ZA 2VJMA 1LLCA 3PIDA 2JAQA 2DG2A 2YYZA 3OWHA 4X95A 3FMOB 3IAAA 2GHTA 1E2GA 2B8EA 5TPWB 4ZZIA 3QHQA 2MSKA 4M21A 4E5DA 1IVSA 1N6HA 1RWQA 4L72A 4NKRA 5L4SA 4O2LA 3KSAC 3KFVA 4KFRA 4M0KA 4MMYB 5DLYA 2BBTA 2VYVA 1SG6A 2Q2WA 3HPRA 1NJSA 2D5IA 4HN4B 4TWZA 1N25A 2A8YA 4R01A 1TGOA 4UUOA 5FFMA 3SX4A 1NW9B 2UXCO 2OGZA 1HZZA 4JR1A 1FUYB 3QBJA 4IRUB 5ERYA 4RK6A 4O3MA 3L02A 5CFLA 2ZE8A 3T1YB 1QQ7A 4DILA 1I0IA 4OXYA 3CLKA 2FSSA 3IULA 3LX8A 2XYPA 1XV2A 2ZI3A 3M8KA 3OQBA 3PUXA 4LWPA 4BFUA 4D3YA 4BB5A 1PRYA 5BW8A 1P49A 2Q8NA 1G55A 2Q3LA 3EHDA 3DHEA 3LC7O 1VRWA 3KU4A 1ZK0A 3ETHA 1YBMA 4S3MA 4ZCQA 2JGJA 3GCWA 2VATA 2JGUA 4OQYA 1ZVVA 2WKWA 4IUBS 1WLYA 5H02A 5LDHA 1CE8B 3BDIA 2EWVA 5K8IA 1MAAA 1T9GR 1B0ZA 1YDMA 1D1QA 3KYDA 3NTOA 4HAIA 2EZ9A 3IAFA 4L4UA 1HTWA 3JALB 4B3XA 4MQ4A 1IOLA 1PKXA 2C2XA 3OLZA 4M3NA 4YP5A 1CWUA 1CNFA 4IJWA 3TD2A 1J1UA 1Z8FA 3FDJA 4Q7QA 3GHYA 3WLOA 4C82A 3CO0S 3DE2X 4BQQA 3E15A 3WNCA 4NJMA 4FMCF 2IP2A 1NX9A 4GKJO 1EGAA 1NBMA 1X7PA 3BQMB 3RDPA 5KWEA 2R7KA 4ODIA 3H2HA 4YXWD 3UCXA 3NVKE 3FDFA 2FSHA 2ZJ7A 4N23A 1U04A 3OE5A 4Z9YA 5CU7A 5EP2A 3ZHOA 2ISQA 2HRCA 4FJ1A 3WIVA 5LZ7A 4JOQA 1Y4MA 2V6JA 3T3MB 4EJFA 1RYYA 4ZALA 1MB9A 5LUBA 3UBMA 1QQ5A 3PA8A 3VH2A 1FVXA 2N0SA 2ZIUB 3CLHA 5I9IA 3MYYA 4G2TA 1GGFA 3WG7C 3PXGA 4AZTA 2BGWA 1WB8A 1UIRA 1U2QA 2H0RA 2NUPA 4UFOA 1E2BA 3EC7A 1Q77A 2Q41A 3AJ9A 2JD1A 3DLCA 3NRCA 4PSVA 5AI6A 1WKVA 3R3HA 4IUCS 4RACA 3TCXB 3B7PA 4I5FA 1ICIA 3ZEAA 1PT9A 4GKBA 2FG5A 4GW3A 1E1CA 2XF8A 3FTDA 2RI1A 5A9SA 2GWRA 5AW1A 4XKJA 3E8HA 4ABTA 2HLHA 4GPD1 2HWKA 3ECSA 4UMDA 1CEYA 1TRKA 3F6MA 1S8OA 2X1VA 3G13A 1DRWA 4JT9A 4W9RA 1KQGA 1IBMO 2B5OA 1ZUQA 1X15A 2CXTA 1QP8A 2QE7A 1GAJA 2VDNB 3FPEA 3HJGA 4OH7A 4DB4A 4HQKA 4PYIA 3PSAA 3QKIA 1QIIA 3M6WA 3A36A 4S2EA 1GAWA 5FUQA 3D8RA 3NYQA 5FLKA 2DKNA 2JGDB 1SC9A 3B6KA 4HB0A 2XUPA 1EJ0A 3A3KA 3K9WA 2NN3C 3NIGB 4K9SA 4JSRA 1TJ5A 1A9ZA 2YHIB 1U8AA 4FZ5A 4AUKA 2FPOA 3GLIB 4YCNA 4I1PA 3ZDBA 1D1PA 4PDRA 4FDAA 3ZMVA 2XUZA 3V7QA 1E5XA 1W2BF 3PCXA 1TADA 4YK7A 5CW2A 5EZQA 1KOGA 1LRKA 1OXXK 1W0CA 2I2DA 2HSJA 3AO0B 2AX3A 4UQPA 4XJVA 5AQEA 2UZ1A 1WSAA 3ITNA 3ZTYA 3TW6A 5AI9A 2ZSDA 4X63A 3U5ZB 3MBMA 4M55A 3PFKA 1CQIB 4MROA 3QFCA 4XD7A 5HKOA 4ACAA 4UVAA 3BZWA 1I51A 3ZNOA 4G0QA 3NTQA 4JYZA 2QEXV 3LA6A 1T9DA 1Z2CA 2FUG1 2NXJA 3G79A 4NEHB 1PR5A 4G84A 4QGBA 2X2OA 3FCOA 2I2BA 4C4YA 3OTWA 1XI2A 1KEWA 1E9SA 3NPMA 3CRZA 4YRNA 4PR0A 4QE7A 4UCTA 4DMKA 1U28A 4BW9A 1GP2A 4O8CA 2PX5A 1O9HA 2HRBA 3I2HA 3M5PA 3QP9A 4M1ZA 4BMCA 1QO7A 2VDUE 3D6JA 4AP9A 5D1HA 2G0NA 1OGJA 3DHNA 5CLIA 3ZDAA 4ILKA 4HNVA 1LDYA 1K8YB 4DSTA 2X6AA 3NC1C 4NECA 2ZWIA 5SZHB 1YR6A 3T94A 5KOYA 4ZI3A 1BVHA 5FJJA 1KFJB 4MQMA 5BNIA 3DDCA 1L7MA 1A7JA 3SK0A 3UAXA 4AS3A 1SKAA 4XD2A 3QEAZ 1N5IA 1LZLA 1PG0A 3FSJX 4D82A 2SNIE 1QGUA 3K1AA 2ZS7A 3GV0A 3ROEA 2Q3MA 5CLFA 5IAOA 5HWEA 3D3JA 3NFYA 4KQGA 4A2WA 2CE7A 4XVUA 1DGQA 2D13A 3DWGA 3PQ2A 3L5KA 4NATA 2GR9A 2C0CA 4YRFA 4QPPA 4DSOA 2EFGA 2Q9AA 2XE7A 3QVSA 4WFHA 1P60A 1T1JA 4D9BA 2AHOA 2JF0A 3RKUA 4BO1A 1Y7LA 3F9CA 4I4TB 3K2XA 4B5CA 1BH6A 1FS5A 2PSSA 2HLDA 4ZVQA 3ME5A 4EPWA 4E2LA 4F72A 2I03A 3WA7A 3CB2A 3PQDA 4H6WA 1T2DA 1SAYA 2OXCA 3QXCA 4RTPA 1KU9A 2ASEA 2WRZA 3LLSA 4BX3A 4CMBA 1H6DA 5JH7F 5CXQA 2RBGA 3ASYA 2OKGA 1TYEB 3ASVA 3A26A 4XLZA 4MVWA 3BRSA 3DUWA 1KFKB 3INYA 3P71T 4FOSA 4CTNA 2JIOA 2WJJA 3T1CA 3A4NA 1T36A 4QBIA 1PDVA 4RDHA 1ZM3A 4GE3A 4E7OA 4KO1S 3O4HA 1SBIA 1H47A 3OMXA 1M1UA 3UY4A 2QD5A 3G2HA 4RY9A 2Q5ZA 3HJNA 3AH8A 4Y6LA 1JG4A 1O8BA 1AQJA 3SNKA 1NKTA 1YDHA 4X1KA 2F43G 3WKAA 2EFHB 3L0ZA 1P33A 3BH7A 5AW5A 2JZNA 3KSZO 2FMKA 3RTCA 2HMSA 5JCXA 2XRZA 3M89A 2H52A 1ZCAA 2HNKA 4MR9B 3KXPA 3Q7IA 5E0OA 3OM3B 2HS0A 4DCSA 1LRJA 4I1OA 5DBGA 1X87A 1KDYA 4C4SA 1B3BA 2AXPA 3NANA 3IDFA 4EEKA 3CEIA 1ZMTA 1CUCA 2FUCA 1KJQA 1YC5A 2IYZA 1GCGA 1SUIA 2Q0XA 3GCZA 3IMKA 5E9JA 2VDJA 4GWKA 3VO2A 5BUZA 1CVRA 4W5JA 1GO2A 1JNYA 1QFZA 2DUNA 4ESEA 2Q9LA 5J2TB 4KPUB 5GIPC 3F98A 4QT4A 2WLLB 1PGPA 2J3MA 4A23A 4RLSA 1CXZA 4QYIB 1LPMA 2HP8A 2I34A 2Q4EA 4TM8A 1Y74A 2GKGA 4D6PA 2D2XA 4DLKA 3ZX4A 2ZZMA 3BK2A 2P6NA 3AEQA 3VBEA 1E8NA 4OI0A 2GPNA 2CH7B 2MMGA 3RBXA 5IM4A 1UP6A 2QJOA 1P3JA 1XAIA 3VR0A 2QLMA 3HWX1 3VMFA 4F2HA 621PA 5H6QA 1PJ4A 4K1LA 2Z1NA 2Y0DA 3FCEA 2EX0A 2C3YA 4MVYA 4OF4A 5JWRA 2ZNIA 4M9ZA 1Y67A 1VKJA 5K4GA 3WG7B 3E0XA 2G9ZA 3H2KA 4J7AA 4N8EA 1W42A 5CMLA 1K4DC 3FTNA 1S89A 5K8UA 3K70D 1XILA 4IXWA 3KBOA 2OBLA 3GFRA 5EQDA 2WYHA 3QLEA 1SXJC 3UWKA 5HY2A 4DXWA 4XDYA 3UAOA 2IYYA 1PV4A 2XB2A 3VOBA 2KWIA 1PE0A 2FQQA 1MNGA 2IHBA 2PZGA 4AI8A 2VR1A 3IB3A 3MMPA 4IIVA 4L74A 4QYSA 5EZ6B 1TMGE 1D2AA 3VBCA 1R6UA 4YY3O 1FZQA 4G4IA 5FOWA 1ESCA 4YCMA 1XHXA 1K6MA 4G25A 3C7TA 1KH1A 3TM4A 4P36A 5A2GA 2YMPA 1JHOA 1UZAA 2VRCA 5FORA 1DARA 3ICOA 5EAIA 1SVNA 4LKOA 2W00A 3QMMA 4P2ZA 5SZIA 2BGMA 3R7WA 3HDVA 4B2LA 1LX6A 1NNLA 3T5GA 4GBJA 2XZPA 1SO8A 2PKCA 3SF8B 1T1SA 3NCTA 5DBEX 5JSFA 1XTRA 2R7MA 3HY4A 3LVFO 1G21E 4HYEA 1KMHA 4MGZR 1V6CA 3AV0B 5AUNB 2HW8A 4J0JA 3R44A 1DIOB 2WVJA 2QZZA 1M75A 4A26A 3ZV7A 5DGCA 5K8VA 1GPAA 1VBMA 1GG8A 2JDIG 1NGSA 5T3YA 1ZD9A 5A9TA 1U0JA 3D7SA 3JQ7A 4GXNA 1TAEA 3VOUA 2W4QA 3FWYA 4GVPA 4IJMA 1NOJA 4WCFC 3AYZB 4KWTA 3AG7A 4RDXA 5TIIA 1P0FA 3LT0A 2AE2A 1RRMA 2QUZA 2QPLA 1E1KA 3TI7A 2WYIA 3AU8A 4DUGA 3K0CA 1O87A 2ZYVX 1NP6A 1VKHA 4DBVO 1HMPA 2VCEA 4Q3EA 3D31A 2WVHA 2DQYA 5H9WA 3IKTA 2W2QA 4IJUA 5LCXA 2VJNA 1NRIA 2C88A 4RK5A 4FW8A 1U5BB 5HQ3B 2AIZP 3IRVA 4MIOA 2AC2A 3BIOA 3IQHX 4B9AA 1Q8RA 2CEAA 4JASB 4EG1A 2I65A 4F3RA 4BAYA 1R6XA 2PF4E 3EXEA 3E84A 4OQNA 1USGA 3BKWA 4JBGA 3CSXA 3OTOB 2PQ0A 2DUJA 5CX1A 5BN5B 1KDZA 4P7BA 2PM8A 5DTQA 4D8TA 1J42A 4M0CA 2VPQA 3V42A 4R1TA 4BNVA 3M6IA 3QM1A 1P19A 4I3FA 4Q82A 5EHQA 1OCCB 1NVKA 1QRSA 4ZKDA 1L3IA 3WQRA 3TD5A 2HFKA 2BUCA 2R44A 1T6BY 3K0EA 4QLBA 2BEKA 2DULA 3G9TA 1HDZA 1PR1A 2PT5A 3LXUX 4AF7A 4AX8A 2WWTA 5L3SB 1P7BA 5T8KC 3MSXA 4N3AA 1RKBA 4QWMA 3K79A 1HURA 1GFWA 4D8XA 4HX5A 2EDCA 5DI3B 5A7HA 5GJCA 1JR4A 2KGWA 4I81A 1EGHA 5CFPA 3BXZA 2LQTA 1IBMB 4BFXA 3FTEA 2H7CA 1U0OC 4JLSA 6Q21A 1EE9A 2PE5A 1GA4A 3BMNB 1WXEA 1RKQA 2EX3A 1Y8QA 2B92A 4NJEB 3MT7A 1R3JC 1A2KC 8ADHA 2DPXA 1S2DA 3WYAA 4B33A 1NR1A 1DRJA 4MSWC 4P93A 3HVJA 3I09A 1F3LA 4IV5A 5EE3A 4F71A 2X1MA 1V8ZA 1XTIA 4P9NA 3EGDB