3JAWB

Atomic model of a microtubule seam based on a cryo-em reconstruction of the eb3-bound microtubule (merged dataset containing tubulin bound to gtpgammas, gmpcpp, and gdp)
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
429
structure length
429
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 145
structure length 429
sequence length 429
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jawB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jawB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jawB01
3WGMA 4M8IA 4ZHQA 5EYPB 4X1KB 5JVDB 5IYZB 5KMGB 1RQ2A 4ZI7A 4X20A 3HKDA 4IIJB 4TUYB 4I50A 5LXTA 1SA0A 1SA0B 5EZYB 5GONA 2RHOA 2VXYA 4X1YB 4X1YA 2VAPA 4O4LB 1RQ7A 5FNVA 3RB8A 2RHLA 3JAKB 3JALB 5LA6B 3VOBA 3JASA 5C8YB 2Q1XA 1W5EA 4ZOLA 3RYHB 4X20B 4ZI7B 4O2AB 3HKEB 3HKEA 4I55A 5CA1B 3E22B 4EB6B 3VOAA 4EI8A 5LP6A 3C8LA 3JAWA 1Z5WA 3N2KA 4IHJB 3UT5A 2XKBA 4O4HA 5IJ9A 4F6RA 2R6R1 4XCQA 5C8YA 4U3JA 5J2TB 5EIBC 1RLUA 5JH7B 5CA0A 5EIBD 4O4LA 4KWEA 5JQGA 4LNUA 1W5FA 2Q1YA 4X1IA 3ZIDA 4EI7A 4DRXA 5GONB 5EYPA 4U3JB 5CB4B 2VAWA 4E6EA 1FFXB 4O4JB 3HKDB 4HNAA 5JCOA 3CB2A 5ITZA 1W5BA 4O4HB 4I55B 3VPAA 4B45A 5IJ0A 5LOVA 4ZHQB 5J2UB 3WGJA 5LP6B 3RYHA 1TUBB 3RYFA 5JCOC 4B46A 4DXDA 3HKBA 4WBNB 5LYJA 4YJ3A 3N2GA 4YJ2B 4EI9A 5BMVA 5IJ0B 5LOVB 4O2AA 3VO9A 4X1IB 2BTQB 3WGNA 3HKCB 5KX5A 5CB4A 4O4IA 4TV9A 3JATA 5FNVB 4LNUB 4TUYA 4F6RB 4I4TB 2BTQA 3V3TA 2BTOA 5EZYA 3JATB 5J2TA 1W5AA 5KX5B 4YJ3B 3RYIA 4WBNA 2RHJA 4IIJA 3JARB 4TV8B 3RYCA 5MN4A 5IJ9B 5CA1A 5MN6A 3WGLA 3JAWB 5M7EA 1TVKA 5LYJB 5ITZB 3HKBB 4O4JA 4TV8A 3RYCB 3VO8A 1JFFB 4FFBA 1Z5VA 3JALA 4DRXB 1W581 4I4TA 4O2BA 4ZOLB 5JQGB 1FFXA 3RYIB 3ZBQA 3JAKA 5LA6A 1W59A 3HKCA 2GVIA 2VAMA 3ZBPA 4O2BB 5CA0B 3M89A 5JH7A 3UT5B 4TV9B 4O4IB 4YJ2A 4I50B 5LXTB 1OFUA 5MN5A 3R4VA 4FFBB 3M8KA 2RHHA 3WGKA 3E22A 4EB6A 5LP6C 1TUBA 3RYFB 2R751 1TVKB 4U39A 3N2KB 4IHJA 4X1KA 5BMVB 5IYZA 5JVDA 3N2GB 5KMGA 2XKAA 4HNAB 1JFFA 3JARA 1FSZA 3JASB 5J2UA
chains in the Genus database with same CATH superfamily
2NV0A 3MJDA 2FUG1 3H9QA 4OA5A 2YXHA 1P6QA 1U2PA 4C0SA 4ABTA 1ETHA 1OAOA 2P75A 2WV9A 1X0XA 4H1WA 1HQKA 4NONA 4N6NA 2B5OA 1V16A 1AQUA 2GOYA 2BCGY 1H0HA 1RWXA 1UJCA 1Z35A 3LUHA 2VP9A 3PX3A 4N49A 5ESDA 2IWRA 5A5VA 2Y0PA 1PW7A 6REQA 3TIIA 1VF6C 3AK3A 3AW8A 1N5RA 4G2KA 5HCIA 4NHEA 3GGSA 4JBWA 4LDJA 4LWZA 4D6PA 3OEEA 5A1TA 5BSUA 5IABA 3O8DA 1U7UA 2IVZA 3AI2A 3NVAA 1P7VA 2CXHA 3I0NA 4WE3A 2P6OA 1XD2B 1K8YB 3B6NA 2QA5A 2YY5A 4WNIA 3RRZA 3UV7A 5KWSA 4RFLA 1B6QA 4HQ0A 3OGIB 2BMEA 2G06A 3PUIA 1IIRA 1PGOA 3KKZA 3U17A 1UPUA 3M83A 2LXNA 1IHDA 1QFZA 2Z08A 3FTQA 3F5TA 2HWYA 3ZVKA 1O9BA 4FDTA 5K3EA 3B85A 5FJ4C 4BO1A 1WUYA 1Y6XA 5ILOA 5AHKA 2ZZMA 4R31A 1F5SA 2CZGA 4WCVA 1FXWA 4HDRA 3GRAA 3LHDA 4YDSA 3W4IA 3M4YA 1MPTA 1S2NA 1NASA 1X80A 1W0KA 4H7DA 2ACKA 4KE9A 4LRSB 2HB6A 2IPOA 4EGCB 2D59A 2OCHA 1W35A 1BS3A 3AHFA 3NDJA 3K0FA 4KBFA 5JMWA 5K05A 2EL7A 3W79A 3E5RA 2Y1FA 3CZ5A 4NMHA 2J33A 2Q3CA 4URHA 5TEVA 4YUXA 1MW9X 2VGMA 1C7QA 3GD5A 3GVXA 2DY0A 2G1UA 2OKGA 4M7OA 4BIIA 4JY7A 2V9YA 1O94C 1G3RA 1OVMA 1KOLA 3AM4A 2JLZA 1JILA 2AOWA 4H6XA 4IOJA 4FM2A 1GITA 4MW9A 4EW1A 3DOEA 4B3MO 2WTMA 1XMOO 2I7CA 1S8FA 4ND2A 3VHXA 3V1NA 3WLPA 4CKBA 5CXXA 4EY7A 4TUYA 1V2HE 3E8MA 3ICXA 4L4YA 1ZUNB 2WHEA 3SR4A 3IQDB 3KOUA 1KUQA 2A9VA 4KGDA 2BGRA 3UCEA 4BZZA 1Q0TA 3EEYA 3DGEC 3WLEA 4C20A 1QU2A 3RWBA 4Q9KA 4IIJA 2DFVA 4KCGA 1JLSA 4HVLA 5MFPA 1NXQA 1QKJA 1ISIA 5HVNA 3GG2A 1YR2A 2IHVA 3PQCA 4S1TA 1BOFA 2ZUUA 3O82A 1P5ZB 3I37X 3TX6A 4MVJI 1U4SA 4HAYA 2BOBC 1KYQA 2I1LA 2QE7A 2YHIA 3HB9A 2F8SA 2WHQA 4H4EA 2R70A 4N21A 3PHCA 4P3YA 4S0ZA 4UFOA 4B62A 2BMWA 5REQB 2EP5A 2O3UA 4MJLA 1A4XA 1R4NB 2RI0A 1GN4A 1TXGA 3NI2A 4TROA 5DGTA 3T12A 1E1CB 4TTPA 2LQTA 1W59A 2EWMA 1EGMB 2FHSA 4K9QA 4PQEA 5J47A 2VAMA 1REQA 2QUIA 4ESEA 5HRUA 2BISA 1GNVA 5D3ZA 5TS3A 4DLRA 2EBWA 5LMNB 2H48A 2VDRB 2UXBB 1BEZA 1NM5C 3A9SA 3RIMA 3ZBUA 4EA6A 3IQXA 4TMZA 3DG9A 3WG7B 2REOA 4Q3NA 1ZR2A 2BFOA 1NNSA 1KKMA 1G8GA 2EP7A 2P27A 5FUYA 1Q2UA 4JEIA 5F4ZA 4NCHA 4UHHA 3VR5A 1BGXT 2WUEA 1I2MA 4YRQA 4CQLB 3IJ5A 2CN1A 1XEFA 3HYNA 4XR9A 3BA1A 4Q18A 4CMBA 3KVVA 4HFRA 4Q02A 9GPBA 1QG0A 5JEEA 4J1QA 2JGFA 3DKKA 2WM3A 1MG1A 2FLVA 3MTAA 5IC6A 2JBAA 3CYFA 4BY9E 2FZ5A 4YXFA 1SA0B 4AYWA 1R6DA 1XXHB 2Q9UA 4FBLA 4KMOA 2NO1A 3O2QB 7ADHA 4F4CA 1NXOA 3TD2A 2RI1A 2Z95A 3AL3A 1ACJA 1Z18A 3L46A 3MCAA 2PUEA 4A4DA 1H42A 3NPAA 2FW8A 2ZR8A 1NJ1A 2HTEA 2VOEA 3NX4A 3FY4A 4R0NA 1F23A 3CC2F 3U0BA 1Z8DA 4RUEA 3GQVA 1BAPA 3IJRA 4YRZA 5KQRA 2KSDA 2C8JA 1CHDA 3H5NA 3L5KA 2FW1A 1YBAA 3U0ZA 3O8BA 3KYBA 1SQXH 4P4SB 4ZCSA 1Z34A 5JC8A 5MFZA 1NLMA 4RUKA 1T6XA 2ZRNA 4CTJA 1BYIA 4MR9B 2Y1DA 3LUFA 4DIKA 3FCUB 4FK5C 3STZC 3BGIA 2ZQZA 4IQ8A 1AURA 1A2OA 1OT3A 1MQAA 4TLDA 5I7OA 2V96A 5AXAA 5K01A 4I1RA 3CCVF 4RKEA 3WLNA 4HX9A 5IT5A 2CSLA 5IXYA 1J90A 5CD1A 1HG0A 4FGJA 2X41A 3AJDA 4JT9A 4GR9A 5BOSB 4W7HA 1HURA 1SBTA 2OE2A 3WYNA 1TVMA 2W2NA 4F8JA 2QGNA 4H0CA 3V7QA 2ID9A 2HRCA 3K71B 5CK4A 3EZXA 3GRYA 2QTCA 3KSRA 3GJQA 5JT1A 4IYIA 4GOND 4GPIB 3I62A 3CFYA 4KSCA 4R1UA 1Q7TA 3CVJA 3K0FB 4NSNA 4RVFA 3UOAB 1QF7A 3M4ZA 1XUQA 5IDWA 3WMWA 4QDZA 4YXWD 1HLDA 1ONSA 1ZNQO 2R8ZA 3GHHA 3LC7O 4JLVA 3ICCA 2BL4A 3VNUA 3C3JA 4O4IA 3F3SA 4TYQA 4XOUA 1I7DA 1K08A 3NJ8A 1CZHA 4LOKA 3TXSA 5I8ZA 2UYCA 1QOQB 3KQMA 3RASA 3ZC3A 1S96A 3SICE 1J0EA 5BSWA 2P1DA 4R05A 2P8SA 1EE2A 2HCTA 1WWKA 2AI2A 5JIBA 1B2RA 2FAXA 1U8EA 4NR1A 2ZM6O 1I7SB 1H1TA 2VPWA 3U60B 2VI5A 3R5XA 3TD5A 2WLSA 2Z5FA 3ETDA 1JA9A 2OK8A 2ZYRA 2HVJC 5K0CA 2OP0A 2RK6A 1K4KA 4X6YA 1G6OA 5CRIA 2OG2A 3QELA 4AD8A 2IYNA 3DXFA 3ISVA 4MEAA 5F21A 4DR2O 5C8VA 3C5VA 4LGYA 1E3WA 3FOEC 1DQZA 1FNSA 3E9QA 4HNGA 4Q20A 1UXOA 3L06A 4BASA 1YITF 3HFGA 1JHRA 4EBFA 1KARA 2MSWA 2PL3A 5CA0B 4G4SO 2EWWA 3QG1A 5E8JA 1A4UA 3C6XA 3FRJA 3SF8B 3L8CA 5EC8A 2YN4A 2QWQB 3IR9A 1NZJA 3LM8A 2H08A 5T6MA 3U4QB 1RKBA 1VP7A 4R9SA 4FC7A 2AMTA 3DLIA 4YMWA 1YULA 2XMCA 3R20A 4JJFA 3CPWF 4HWPA 3NKVA 4YJ2F 1TVEA 3ZY3A 3DSRA 3G8CA 4QOJA 1M6YA 2Z2KA 3TMKA 5LJLA 2XCSB 3KOWA 1VSQA 2FEKA 3D4NA 3PF9A 5T41A 4GCZA 1GXSB 2HOQA 4LVCA 1TD9A 1G6UA 1O96B 1O3YA 4IDGA 4YBRA 1C4XA 1MN6A 4MO2A 1SCUB 3RU9A 1S2MA 3FZYA 1G5PA 2VRCD 4WFKA 3WFJA 5IPFA 1SGWA 2WIFA 3AWDA 4HAZA 1OB2A 4J94A 1NVDA 1RXEA 4DV4O 4ZZ2A 1K6IA 3RVPA 1AGXA 3MWEA 3RB8A 3NALA 1DNPA 4ZKIA 1J97A 3U6KA 4LZPA 1IUNA 1L5ZA 2XRZA 3TQIA 2B82A 5LZ7A 4ZI7F 5J23A 1BDIA 2HU7A 4JI5B 2CYAA 2F8TA 1CY4A 4N0QA 2CUGA 1ZM2A 4PLPA 3QTLA 4W1PA 2NPIA 3HN6A 1FVFA 3ZHSA 2JZNA 1OKKD 1CB7A 1BVRA 3K5MA 1C3XA 4LJKA 2IUSA 2O1XA 2P9EA 1LBHA 3DR5A 3N0TA 4YWHA 1ZX1A 2QSJA 5BQ3A 1TVCA 1XZJA 3ZCSA 4FOPA 3OESA 2XXAA 1I13A 2G9IA 4X66B 1UBJS 2SECE 1BE0A 2CBXA 3E9DA 4FZ5A 2BH9A 1DV1A 2P9JA 3E27A 3QPDA 4JD5A 4LJ6A 4PC2A 4BNMA 4X3PA 5EIFA 1JAIA 1NVMB 2X9GA 3QVOA 3ZDDA 3ZCVA 5L51A 2AVNA 4LHEA 4ES6A 2ZLBA 4XEUA 3GDHA 2RHBA 2QEQA 4KUEA 2R7NA 3OD4A 1CFZA 3MJHA 5DU2A 3I39X 4RIHA 4X65B 5H68A 5CYPA 3U9SA 5HR5A 1JHMA 2YDEA 1PM9A 1SRRA 3DTYA 5CVCA 3NETA 4KFSA 3A32A 1Z22A 3OE1A 4P35A 5EXEA 1C50A 2PLNA 3G1UA 5KHGA 4XUCA 4HATA 1AS3A 1U3FA 1P61B 2PWPA 3WP0A 4A2PA 1Y48E 2ZB3A 3L4JA 4O33A 3R5HA 4G25A 4RZHA 4WOPA 4FXOA 1SKAA 1R88A 1XPUA 4R8CA 4KE8A 5AKXA 4L74A 1GO2A 2C1ZA 3S1AB 1M34A 1N33O 3PCXA 1NHGA 4IMRA 3PQ7A 1UXJA 3VSAA 1V8FA 2GVNA 1D6SA 3O1IC 4M36A 4LF8B 3SPHA 2ZIWB 4L95C 1P17A 4URYR 1X92A 3G9TA 3L8EA 2QJWA 4Y7DA 5J2TA 4EY8A 1GZ7A 4ZI3A 1LGYA 1F4NA 1U1DA 5T3YA 2OT5A 3GFVA 2E18A 3PPYA 1OIVA 3R0VA 4RY2A 3ESXA 1JZTA 4EQ6B 3KR1A 1NSYA 3O03A 4OQMA 1EGQA 1AXGA 4RLHA 4UULA 4N3CA 2QRMA 3VO8A 4FGWA 1EUYA 3G2JA 1W0KD 4JI1B 1IDN1 2J45A 3KE8A 1JWLA 4MPTA 1ZMOA 3WMRA 5EMNA 5IAEA 2NZ2A 1VQVA 3DNPA 5BXQC 1KNJA 3MTEA 1W7AA 4DNQA 1CS0A 4RH0A 4QYWA 1VQMV 3GLUA 4KYVA 3AL0C 3FCCA 1JG7A 3A05A 4PLHA 1ZUNA 4KIFA 1KYXA 1YIDA 3HJFA 4I6EA 1QRUA 2BN4A 2V3VA 1EFAA 2IUEA 1JDJA 1F4PA 1M1NB 1YDEA 1AH2A 4LF8O 3ZWYA 4ASUD 1EFUA 2R1VB 2ZJ5A 3BHIA 4H1TA 4MUMA 4AULA 4CLOA 3A26A 1J1UA 2UXXA 1XMXA 1E4OA 1SVKA 5DTIA 2QUZA 3ROTA 2GWRA 3BJZA 1RHQA 4MO9A 4IIJB 2ECFA 2XUGA 3AB7A 1BX1A 2PMDA 5EZYB 2WMYA 2XD4A 2ADMA 3UTDA 1MRZA 2AN3A 3N9IA 3UYLA 5F9MA 1BMFA 2NG1A 3WLIA 5JSZA 4GI5A 5CT8A 4L6IA 4KRFA 2WC1A 1XQVA 1ZQ9A 1BD3A 3QE2A 3PPXA 2WJZB 1YFZA 3A37A 1W5EA 1C1XB 1EDEA 3WVNA 2W6IG 1C4KA 2OCGA 1C7JA 3CRMA 1BMFG 2P7IA 5KPJA 1AGNA 2CVPA 4RKYA 4QEZA 4U7NA 4Q01A 1U28C 2QRZA 1VCNA 3FPFA 4IH4A 4M8NE 1OXBB 4DV6B 3CUTA 4RDIA 2DUMA 3QMPA 4MV8A 3GX1A 5FPQA 3TPFA 1AQNA 1XNGA 1HPLA 3ABZA 4J8PA 4PAMA 2HL6A 3GF4A 1P4JA 4GWKA 4RA9B 5HQJA 3U3OA 1XD8A 1KVTA 2J3JA 3BILA 4Q66C 1T5SA 3WB9A 1GGNA 3FTFA 2GZ3A 1XXHA 2IIBA 1NRXA 2ZVPX 3KPUA 1FNMA 1TMKA 1XE3A 1Z0SA 2GMWA 1LDNA 4YRBA 3H1BA 2AGVA 3VA7A 5IAJA 3TLMA 3W7XA 2GFHA 4LV6A 2CDCA 5AKHA 2AE1A 2X1HA 1SELA 1VE5A 3QLVC 3ZEAA 2Q3EA 4MUHA 2ERXA 3DE2X 1ZTEA 5D5PA 2YIBD 1FP7A 2WRZA 4UBMA 5AJWA 5IULC 3CB2A 1TDJA 1EDZA 4FGSA 3CEHA 4LXYA 1LSUA 5F2OA 3RCBA 1T0IA 5KTKA 3BC1A 4UMEA 3K70D 1I5XA 5J2UB 1T5DX 2NPFA 2AQHA 1V3UA 1TA0A 3OO1A 1ISGA 2YZGA 3PL5A 1PEAA 1S0UA 1Z47A 4H44B 3QVKA 4H37A 1NHWA 1ZD1A 2DEUA 4CODB 2YVLA 3OUUA 3O3NB 5FL7D 2FW6A 3MDOA 3RRNA 4F91B 2DYYA 5KNCH 4LBWA 4JLPA 3TVTA 4I8DA 3NOQA 5HWSA 3U61B 1TD1A 3LKZA 4MRVA 1ZWZA 3SQLA 3OUTA 4DPMA 3EXIA 5CNMA 3LNCA 3K79A 1PYGA 3PGLA 4EUEA 3AO0B 5A5GA 5GM1A 2QV0A 1EVLA 1SRQA 3FFAA 2GI4A 4IF4A 4LX8A 3IEUA 4A0RA 3I09A 2WQ7A 1FSGA 4GM1A 5I47A 3ZEIA 1ID8A 2C2GA 2ZDIC 3NHUA 4PRKA 2RHJA 3DZBA 4E2YA 3IOEA 4K86A 1J7KA 1Z7GA 2M6YA 1E2LA 3DD5A 3EWAA 1JI3A 5CEEA 3ZMTA 4GGMX 4KAJA 3T1YO 3G0DA 3ZV4A 2H6EA 2W00A 3P9ZA 4BMNA 5FPYA 3ZGYA 3LY8A 3KZXA 4GH5A 1HEYA 3GFTA 4CEIA 2ALEA 4AW9A 1CV2A 2VUUA 3A3OA 1TMYA 1LLQA 3H2BA 4XAQA 1QAQA 5A2QA 4GICA 3UUGA 4CIXA 2H7CA 4ZT6A 1RXYA 1QCYA 1KYIA 2ON6A 4B0OA 2LBTA 3LPNA 1HDIA 2JEOA 4IZ6A 4R7ZA 3W6UA 2QUKA 2YS7A 3WB0A 2IELA 4GS5A 4PCVA 4BWAA 1OHHD 2NSJA 2YMMA 1RWBA 3AFIA 1GD1O 1L0NH 3KOMA 2VZ9A 2GAOA 4TQGA 4DT1A 2WM9B 1DIGA 2Q45A 1JXQA 1SC6A 3UHJA 4CM6A 2CXPA 2G38A 1M2VB 2IYFA 1DJQA 5FH9A 3I9OA 1YKSA 1ODEA 2YV2A 4LHWA 4CWAA 4JHXA 2H59A 3FOCA 3M49A 2Q9LA 1GN8A 1U3WA 2ODBA 5A3SA 3TKAA 1SD5A 1VBKA 2ZRPA 1UJNA 1TJ5A 4KQ6A 4GGPA 5LJIA 1FNKA 2BDTA 3I7TA 2LGWA 1X1RA 3CE9A 4V0SA 4RS3A 2VTBB 5G53C 1Z73A 2HDWA 3PEFA 4BP8A 4KR9A 3GLGB 3DCJA 3M6AA 2Y48A 2ZCEA 3LNNA 4UBKA 4TQFA 1NQXA 2R8RA 2VXYA 4B17A 2LGQA 3BORA 3OEWA 1Y74A 5ALDA 4KQXA 2F1RA 1CF2O 1U7ZA 2FQ1A 1N3LA 5HHTA 1TZKA 5FLXM 3PDIA 1ZNYA 3P9SA 4BJ3A 2XCRB 4PSVA 2HS0A 2B8NA 4NDNE 2HY7A 2YHUA 4DM4A 5CFQA 2BFEA 2XADA 3CWCA 4ZC8A 3NB0A 4G23A 4LMPA 5KOIA 4ZN6A 2W6CX 4R1SA 1GA6A 4EI8A 4HAOA 2G70A 3EFBA 3P0IA 2X8BA 1U0BB 1FP4B 3KTOA 3LU1A 1YVEI 2HRDA 3C8ZA 3MCUA 4QVGA 2ZI4A 4AT1A 2FSHA 3D5TA 2DN9A 5L9AA 2PUCA 1EQUA 1M74A 4TQDA 3CYOA 3U37A 1ADJA 1OV6A 1EKXA 2B9ZA 4PLCA 4AN1A 3K6RA 4DYVA 4YY3O 1CUBA 3FZQA 4O1IA 4IRXA 2OXFA 1X0VA 1XTSA 1DI0A 1N8RW 3O8NA 4IH9A 3I55F 3QXXA 1SXJD 2OAEA 1GIAA 3QUSA 3S40A 3VDXA 4YDQA 2P6RA 2NTYC 4TT3D 3M1YA 5FX2A 1L4FA 2PAAA 5HWEA 4O4JB 3UXYA 4WY5A 4B75A 3VPAA 3SC2B 4TV8F 1TT5A 2B98A 2XZDA 3CUKA 1NXSA 3EZ9A 3F4KA 4EHAA 1G38A 3TF5A 1L5MA 2IAFA 3VKHA 2H8PC 2C2BA 1QWOA 2J9GA 3ED5A 3ZYCA 4RAQA 4B76A 2PUSA 4H17A 4GPZA 3U56A 2NUBA 4BN4A 3BH7A 4DMRA 4LBEC 4Z0PA 1TGVA 4CKZA 1LV8A 5J2TF 3FMFA 3QPCA 4WN9A 1OCRC 4XJXA 1VMKA 1BDMA 1TUEA 1DAHA 4GBMA 4DNFA 5KO2A 4CT5A 2QJ1A 4YRMA 1ZR4A 2ZREA 3JZMA 4HQKA 3BSYA 4L9AA 1ZCJA 1V55C 4QGBA 3R6LA 4MKIA 4D5EA 2CTPA 5LA6F 3S81A 2WDZA 3B20A 2FMXA 1I10A 3D5QA 1R1MA 3QV1A 8ATCA 1TIBA 3EORA 1IHPA 1XV2A 2M6RA 2W6IA 2DCMA 5DOVA 1NVPB 3ZWWA 4MWZA 2H7VA 1E79A 1BA3A 5FOTA 3X1JA 3H1JH 5DX8A 4C7VA 2X4IA 3E05A 4HAVA 4IOLA 2QTSA 4URVR 3B82A 3DKIA 3FTDA 3EMDA 3GC6A 3TJMA 1N33B 3ZMSA 1UPBA 1H8EA 3AT1A 3HO8A 1ZXXA 4JYMA 2GUZA 1AD2A 2XZTA 4GEGA 2QTNA 2NMVA 2DE0X 1YJBA 4P0PB 2OFOA 2E5LO 3J80A 5EJ6A 3ZVRA 1OCOB 2POCA 4LJLA 3INTA 1FXKA 1VCIA 2ZQ5A 1ZK4A 3WFVA 1LPAB 5KSPA 2DYSB 5K6RA 3DCNA 2DPXA 2WPDA 4JLAA 4XIIA 4JUFA 1D0SA 3I1IA 2WWWA 1Z6QA 4JI3B 3DYVA 4AZVA 3RIGA 1FNBA 1K97A 4R6WA 1GP2A 4DMUB 1UZUA 3UJNA 1J49A 3BIFA 2RGRA 2VP4A 3GPLA 4OF4A 2IU3A 3C8HA 2VYNA 3NEYA 4LAFA 4BXOB 3A9VA 3NG1A 1LZKA 1O57A 3W2HA 1VMAA 1GWNA 4X1OA 3B53X 1XL1A 4BFCA 3GLKA 5KIAA 1P91A 2H9AA 2WYIA 3CVXA 3H1EA 3FNRA 2WJYA 2GT1A 1MDBA 1DTEA 1YI0A 1BW9B 1J5EO 1XRNA 2N04A 1HDCA 4Q7MB 3KUXA 2VGNA 1E0JA 1GR0A 1QHHB 2I78A 4W8GA 4R7GA 2EULA 2JLUA 2ZR2A 2BFMA 4NCBA 3X1KA 3ON1A 1MKYA 1PL7A 1DRUA 3D2AA 1XQ6A 4JQSA 1GYPA 2HKIA 5E2IA 4ILEA 4FHGA 4BN0A 4M99A 3U4HA 1P72A 4B3CA 2A7WA 2AZ0A 4PX9A 3KTAA 1CIJA 1KI6A 3NGMA 2QKSA 1UANA 1JJ2U 1HUQA 1YB2A 2GTIA 3EC1A 4MYCA 5K0FA 1A7JA 3LKBA 4J0KA 2AXPA 3OZ7A 3ADBA 2DYKA 4IOMA 3REQA 1TCUA 3MGGA 2R86A 1OAKA 1X13A 3GNLA 4Q7JB 1CBUA 1UBHS 3S0YA 4BV3A 3K5HA 2Q99A 3IRUA 5KNLA 2AMVA 2H5LA 4RSMA 5HZMA 1QJ4A 5LHIA 3FD5A 3N8HA 4LHZA 1NV9A 2PSSA 3BSWA 4OK6A 3JRXA 1NGSA 1YH3A 4P80A 3NWOA 4R54A 3ZXSA 1GPBA 1OAPA 3QXHA 3VH3A 1S3IA 1DOHA 1SN7A 2P9FA 3NVKE 3FNHA 3KKKA 4X8OA 2BWJA 5JG7A 1N1GA 1QONA 2R6FA 3TAXA 2JEUA 3LPCA 1A82A 5F5LA 2CE7A 1PAUA 2OAQ1 4BO7A 5I7WA 5JH7F 5DLPA 4CM9A 1GLGA 4I5IA 2GRAA 3A06A 4MVJH 1P62B 3L7CA 4O4HF 4COKA 5AVRA 3DEFA 5JSUA 1EJ6A 1PR6A 2H4FA 4TSFG 2C78A 1TUBB 2QJRA 3QX7A 2XDQA 4G0ZA 3CO0S 4IILA 1OZHA 4KR3A 1YR9A 3OMAB 7MHTA 3DZKA 1UFKA 2Q69A 3L49A 4NJMB 3L2OB 1I51A 2EV9A 2QF7A 3UAXA 5T4EA 1G7SA 2OO7A 1ZIPA 2PO5A 2WVAA 3OTOO 4XASA 1LS1A 1JJFA 1YITV 1XELA 3MD9A 2VXOA 4R2XA 4C0WA 5I7SA 2Z2JA 3QEMA 5BT9A 2BV3A 5LYJF 4DVJA 3TXYA 4OD0A 2B1QA 4CHTA 4I4TB 1WN7A 4X7PA 1T5IA 5J3JA 2AS0A 3DYIA 4CV2A 1GAJA 1CTQA 1SQFA 3UPDA 4MICA 3CKYA 4BVEA 4OP1A 4R3WA 1C3VA 1EB9A 1HDXA 4MVMA 4PCLA 4RZSA 4M1WA 4EW6A 2Q7EA 1DBFA 3WLQA 3ZK9A 1ZJZA 3D8RA 4GYJA 2D1TA 4YJFA 4HMOA 3K06A 1WA5A 2Y66A 4Q7EA 4NB5A 3M7IA 1JR3A 3H75A 1WU8A 4QQNA 1IV1A 5KQGA 3T5MA 2DQ4A 5IG2A 2G77B 3O1JC 5IWAO 1JAXA 3HTXA 3B09A 4IDPA 2OV2A 4OI2A 1FFHA 1PDOA 2C0CA 1W2BU 2C9MA 3ANLA 3F7MA 4H35A 5EEHA 1WE2A 1Y42X 3D01A 1RPJA 3LNMB 1P5RA 2CNWA 3R3VA 3D1VA 4IVNA 4OXYA 1XYGA 3TFQA 1USIA 5AJVB 3V46A 1G5FA 3QBTA 2FP3A 1DRKA 5JW6A 4V0NA 4O63O 3HM9A 3HCCA 1OWOA 4GUAA 4CV1A 1A1VA 2FVXA 2UKDA 2HVKC 1YKGA 5IANA 2ZVJA 5DGDA 3DEIA 4BLRA 3NATA 4WK4B 1KMQA 1RU3A 2FSVC 3MUFA 1M2OA 4X8LA 3MBKA 4HNQA 2Q2NA 2O19A 2FN3A 1PNKA 3KOZA 3CZMA 2QM7A 1E64A 2GDZA 2GYVA 2X4DA 1NJ6A 4QE3A 2YV1A 3Q8WA 1CEEA 3CC7F 2PAFA 3K09A 3ZZTA 3B3GA 1PJSA 3ZOZA 3JAKB 5KNCD 1KSJA 2ARHA 1JHXA 1YHYA 2JHAA 5THXA 3WMGA 3TH5A 5JYDA 4LWQA 3U0VA 3JZDA 1KR5A 2P2DA 4M76B 1B74A 3AF3A 5KVQA 4V1CA 4PWZA 3L74H 5FUXA 3ZDFA 2NN4A 1TYDE 1PGJA 1BZKA 3IBCA 4QELA 1CWUA 2F1OA 2H2IA 2H2WA 4Y9TA 4M3NA 1GM8A 4NS1A 4UKDA 3CGWA 2MTBA 2AG5A 3FGOA 1GM5A 3JQAA 5J9FA 4BVRA 1T3GA 4UCSA 3RIHA 3VYUB 5KNBH 3AK2A 3O65A 1Z08A 3CLSC 4JOBA 1H3NA 4OI1A 3H97A 2D2IA 3JVUA 3NT4A 5CLIA 2DTDA 5LGTA 4QTYA 3PJRA 4G0UA 2VRWA 3KL4A 1SVUA 3JYLA 3FUCA 5G4UC 2AOUB 5HF6A 2PH7A 3C0KA 1G98A 1RWNA 2QXTA 2VJMA 4CMCA 3OM1A 3NYQA 2IEBA 3P45A 4RAOA 3ELCA 1ZN8A 2EIKB 2HJHA 2JLQA 3NRCA 3WG7C 2ST1A 3RC3A 1QNLA 2JGAA 4CLRA 3X3HA 3CPEA 3VO2A 1L4BA 2CUZA 2MMCA 3GRKA 4JB8A 4JDUA 4QA9A 1LLFA 5AT1A 3GGCA 3RT9A 2C4TA 3UGQA 4F3NA 1E3QA 4ICGA 4J4TA 2DFDA 3F9CA 4HSGA 5CAEB 3ZJZA 4DL9A 3OO0A 2XRYA 2AWNA 2RIPA 2FI1A 5F1OA 4AL4A 3SIXA 5JJBA 4D26A 1ZESA 4PLYA 3NAQA 2PTGA 4CG3A 1Z4NA 1YRHA 3ZZNA 4OJYA 1S4MA 1O4WA 1ZIOA 4FLZA 3F3YA 2BTQA 1B6GA 2ENWA 2QN8A 4G4GA 3UK1A 1M8JA 5EZYA 4EYOA 2VPPA 3INRA 4ZAZA 1EFCA 1JEQA 2I4OA 2NTEA 4JBNA 3U11A 4BOYA 4IEIA 1GUBA 4PWYA 2QAIA 1XLWA 5JYCA 4H0LB 1DWUA 1EFDN 2ANCA 4HQFA 4MB2A 3WGLA 2HA7A 3TW6A 4F9EA 3VTZA 1RRVA 5BN5A 3STLC 3FKSD 3T4XA 2FE1A 1TT7A 4QPZA 5FBHA 1KQOA 2A0UA 5A1JA 2PNJA 4TMVA 5TNXA 3T95A 4MV0A 1OMOA 4H16A 3UJ9A 2OHXA 3ETEA 3GZTB 2E85A 3DEJA 3SLRA 3MAQA 1P8AA 1YR3A 2VJBA 3NWBA 4RU1A 1E6KA 1Z83A 3UK7A 2WR8A 2LVBA 1GU1A 2RHCA 3LWBA 1P9WA 3WHKA 1XHFA 4U9UA 4LF7B 1JHVA 4NYKA 3PC8A 5H6QA 1V1RA 1Z5UA 2EKPA 3HK2A 2WLIB 2IDKA 2OHVA 1CQJB 4ZU1X 3KDSE 2PUWA 5KU1A 5L3SB 2HLHA 1G8KA 2JI6A 4GYWA 4LVOA 1VQ8V 4LWPA 4ZQEA 3SSMA 3T8YA 3QVTA 4NI5A 3O9VA 2JGIA 1PT6A 1JHDA 4HNAB 4Z86A 3PEYA 4L5BA 2UUAB 4QSMA 1CDEA 4BMXA 3KSDO 4J1TC 3Q7TA 3RS5A 1WZIA 3D6HA 3OICA 2DPYA 3TM4A 2VBIA 3ISJA 4C01A 3ANTA 1YJNF 5ER9A 5I6DA 1YOBA 3VH1A 1HK7A 1J42A 4UTZA 4HRAA 3K9FC 1K9MW 3EIEA 1URPA 1BSMA 3QU9A 4TPKA 4U2EA 4URFA 4B82A 4I46A 3UKJA 3EGWA 2H94A 3TXAA 3K32A 1R6NA 1H05A 2NTNA 1ZK2A 1GL6A 3N6VA 3OA0A 1JA8A 2I76A 1NI8A 1XMJA 4U1RA 1ZL8A 2ODMA 2VCHA 2QG6A 1THGA 2XUZA 3FTNA 1YZFA 2A3QA 4P3OA 5DK4A 3OJFA 1KPIA 4FCVA 2E21A 4OUDB 4Q0MA 5E7MA 4ZI5A 1GL9B 4IUYA 4PYIA 1XA3A 4QQ8A 4I55A 4WOCA 3H2YA 4DDMA 1UZAA 2IHJA 4BXOA 1E94E 1VGRA 3KDAA 1JNXX 4FFOA 4KX3A 4OLFA 1X7WB 2ZPAA 1DINA 3BXXA 5LP6A 3SHVA 2JJYA 3F47A 2C3YA 4NZOA 3RSFA 1KMMA 3JQFA 5CDFE 2NU8A 2LFRA 1AU9A 1WZUA 3LC2O 2JDIG 2FXIA 1ND5A 3EZGA 2UZ1A 5H70A 3OZCA 1K5PA 2FR0A 1N5KA 1KVUA 4L9WA 4X60A 1P9OA 4PG7A 2IUUA 3CJHB 4NQ3A 3TI7A 3WV5A 2JFBA 3JSAA 5B58C 1AJEA 4NBWA 3OGCC 1D9ZA 2I7TA 3KZNA 1QLHA 1QVWA 1M0TA 4WHMA 5FPRA 2GLZA 2QR4A 3ASVA 3PD7A 3MW8A 1Q90D 2H3EA 4N6OA 4E12A 3KLOA 1JIKA 2GPSA 2HRBA 2VNAA 4ZQHA 5GZ1A 4ZHQB 5ESRA 4KDEA 1XR3A 4KQWA 5JAIA 4BW9A 1N3IA 3MDSA 1YTFB 4PE5B 4LQ4A 1CF9A 3TPCA 1FW6A 3BD7A 5LYJA 1NRJB 1TAGA 3NTQA 1NY5A 1UKEA 2O0KA 3V8PA 4B47A 5E3JA 2V1XA 2JKZA 2VWPA 3CURA 4C89A 1T4DA 1J09A 1YHQV 1UF9A 2VQEB 1V5IA 1JALA 1HI9A 2CHGA 2FZEA 2IHNA 2X0IA 3ZGLA 2B9EA 2XA2A 3HCWA 5M3BA 4BKUA 5B7QA 1RZUA 2CZWA 2DTXA 2G0AA 2RKBA 3AG1C 3GXOA 3Q7SA 3W8EA 3S27A 3GEDA 1NV8A 3AQIA 5K3AA 1TYEB 1CFJA 1VTKA 1ZD3A 2KGWA 3IXLA 4FUQA 4IAOA 8ADHA 3CCUF 1M34B 3F8TA 1UPTA 2IBMA 1HF3A 3PQ4A 3RTBA 2QRKA 2X40A 3U39A 4IGEA 1SO8A 3QEKA 4KVZA 1MJFA 4MIYA 2VJKA 4KREA 2P35A 2PGGA 3KQVA 5LD2C 1UZMA 4OQFA 3OEYA 5EGSA 4ENVA 2PIDA 3ZHYA 3NVKI 1N5MA 1GG9A 1T9GR 2C9BA 2IZ0A 2R6JA 1V8DA 5C1IA 4PC1A 5KWEA 1IY2A 3RYIB 1VQNF 1B8OA 2WINI 2X15A 3I04A 3AIOA 5HQ3A 1VCHA 3COZA 4FE4A 4MQFA 5I9NA 1J06A 2FZLA 3HCNA 4GLFA 4HDKB 2ZBUA 5CLGA 1T9BA 1BE8A 1FJGO 3FR7A 4IDQA 1FPMA 2GV9A 3USZA 4DPKA 2LE0A 3DMNA 2EEZA 3EVDA 1ZI8A 1E9VA 5JWHA 2DOSA 4FLMA 2BR4A 4O8CA 2V9ZA 1F4VA 1EFTA 3FVVA 4J0GA 1N57A 3QOWA 4M37A 3J81A 2QORA 2OC4A 4L7QA 1IOLA 1CE8B 4YJFB 2CFRA 4WY2A 5FWXA 1N2BA 4ZD6A 5DNYB 3GOQA 5AM2A 5HRCA 4C0JA 4EJ6A 3GDWA 1T3TA 4S12A 1XZPA 4E30A 3CIFA 2VJOA 1J20A 3IUMA 1FDRA 3R74A 3U4IA 4ME6A 3COPA 1SA0A 1XTBA 3LF2A 1QFYA 3AILA 1T0AA 1BHQ1 2FMFA 2YJGA 2XQGA 2HV9A 3NANA 1KJNA 3A7DA 1M66A 4NECA 3RVNA 3L77A 1ORQC 4O4LB 1ONPA 4IGIA 3ZDQA 1K9VF 3TQCA 1FMJA 2BFFB 1O77A 4J7ZA 3RHSA 4MWBA 2FPLA 4XLLA 2XQKA 3AMVA 3T7CA 3UMRA 5K4HA 4RMHA 4DJFC 4C2AA 2RCVA 4QUIA 5EINA 1K63A 4M4SA 4MGYR 1ZLXA 5BSFA 2ZS7A 1NW8A 4GMKA 2F9LA 3KCNA 3Q3CA 4FMCF 2X1LA 4KAAA 4XB1A 4O0MA 5EIOA 3V7YA 2J30A 4G4SP 4Y9UA 1XVAA 4CFSA 1C0IA 4PICA 3RS0A 3OLYA 3ODPA 5JROA 3GLTA 2GAAA 5AVWA 4E6PA 4RGYA 5EFOA 4P2BA 1LK0A 1YXMA 4O59O 4RPLA 3DH0A 5DM2A 3S44A 4X64O 4TLLB 1Q0RA 1WIWA 4NV3A 4ENUA 4G0NA 4BVKA 3K6KA 1KZYC 4S05A 1RI5A 2QZJA 4J29A 2Z04A 1WY7A 1RI4A 4L3OA 2VQFB 1LBSA 1M8FA 4FMDB 1RZRA 2DERA 2LP7A 1ULSA 1P6XA 4MGHA 4OK5A 1GTL1 1X3LA 2NZWA 2PHNA 3K16A 1DC5A 2RH5A 2UAGA 3M4NA 3LH5A 4FC6A 4MRMB 4V0KA 4ZO6A 5TF0A 3ROGA 3UWPA 2CF5A 2J9FB 3JD0A 1P8JA 3SYKA 4DYHA 5AW3A 1TKRA 3W8RA 3TD3A 2R79A 3NFYA 3OFJA 4BLUA 3VGPA 4GI1A 3GRVA 1Q1ZA 3K0GA 2NVWA 3K70B 4LZOA 4OGQB 3FJ1A 4FFSA 2UU9O 4D8YA 1GN9A 1UEXC 1V3VA 2C98A 3G0BA 1YCGA 3D4BA 3R24A 5FRDA 4IG4A 1H2SB 2JHFA 2Z3VA 3CKMA 3SVTA 5D6OA 3AUTA 4UTNA 3GLIE 1K8RA 1H5UA 3HJHA 4RPGA 1K0FA 4E13A 4RXTA 3ZBHA 4BO6A 2H7YA 3OG9A 2CV1A 2NXEA 1U2GC 2QTBA 2OCCC 2W6ID 4X6UA 5HG0A 4Q3CA 4ENSA 1HEIA 1I32A 1PVDA 1XDWA 1WMDA 3AINA 3MWJA 4QO8A 3UA4A 3VR0A 3K9WA 5LHHA 2ZVYA 3GDOA 3AHJA 4I19A 2ZRBA 1JHYA 2J7PA 3OAAG 5EQTA 3DMHA 4IX9A 1BROA 1EE9A 1VA5A 1GRVA 1Y4DE 2VJMB 3KQQA 4HFJA 4OP3A 3SX4A 2A78A 5H59A 4LP8A 2CLSA 2OT3B 3MAGA 1KI1A 3F5WC 4IIBA 1PU2A 3Q1KA 2X6AA 2NVBA 4Q7LA 1M8PA 1ZC3A 3AJAA 5EJMA 3K8ZA 2R44A 3E2PA 3IOBA 1H2AS 3AUKA 3BWBA 3RS8A 1ATZA 4AILC 3LSSA 2P6NA 4RNDB 1BG6A 5EVJA 2QTFA 5H80A 4IJMA 5LXTF 1Z3IX 4Y9SA 2W2KA 3LOPA 1ZM9A 2PBZA 3DJFA 4JL5A 1Z26A 4P1ZA 4P9NA 5CBFA 1TJNA 2TMDA 3GEIA 4RX1A 4WK6A 4OHOA 5BN5B 4ALKA 5JFGA 2ZSKA 1EXMA 1GTMA 1RS0A 1TKCA 1K5SA 3BEDA 2YVAA 3QYFA 1YBMA 4B6GA 1IHUA 4ARAA 2JGNA 4IZHA 3ZWVA 5HBGA 4O4IF 4J7KA 4QU9A 5B1BB 4DCJA 4W9NA 1YZLA 1YDHA 4FI3F 4POAA 1H2XA 2I9KA 1G6KA 1SHUX 1Q16A 1P3JA 2VNIA 3L01A 3PQFA 4R9NA 1YRYE 1IQUA 2X76A 3FYUA 4BO0A 5IARA 4BQQA 5A0FA 2I2WA 2VAPA 3QBJA 3S2YA 5MGNA 3GLHB 3F49S 3R3UA 3C9SA 2HHJA 3DULA 2VHWA 2DMXA 1KZ6A 1U7DA 3B6KA 1P60A 3DYBA 1OH7A 3F8WA 1UXKA 3EARA 4ALNA 1OD6A 3ABKC 1NUTA 1WMEA 3EXEB 3P9YA 4KN6A 1KU0A 4L8WB 4QBFA 4UNPA 5TLSA 3AVUA 4IQ4A 4BB9A 2Q1WA 3O8LA 5SYMA 3K0BA 5ALGA 1T34A 4DV4B 2G04A 1NVEA 3AETA 4LXXA 3S2UA 3CVOA 2Z3WA 1KEEB 2ODPA 3H83A 5C2JB 3BB1A 3H1TA 3ZMVA 2XE8A 4RPKA 3WO1A 4Q47A 1DSSG 4ZZ3A 1X7OA 2A59A 1GZHB 1L8AA 1SY7A 3DNMA 3ABLC 1GILA 1N2CA 2FWIA 1LTKA 4BMDA 2AUNA 5IYBO 1WHSA 3H9BA 3UK6A 3FYSA 3IP7A 3NTOA 4DV7O 1XEWY 3Q1LA 1VB5A 3FDZB 3MT8A 4MK4A 2BM8A 1IN5A 1WXDA 1HH4A 2WHPB 4R5MA 4WLOA 4OYHA 2FFBA 2ZIAA 1YTUA 2GK6A 1KH3A 4HI0E 1D6MA 1OI3A 3C1OA 1W76A 1IC6A 4MUYA 1XAIA 2M2IA 5JCOC 3NTLA 5HK8A 3FUXA 1Q43A 2ONJA 4NJEB 3V7WA 5BPFA 1AHIA 1T26A 1EN4A 2V9CA 3DVAA 3E9CA 3ELUA 4GZ6A 5C81A 2ANBA 3NTVA 3SQOA 4CF4A 4YUYA 1SCQA 5C4IA 2CNKA 2NT3A 2YMLA 5ENZA 4JDPA 3KCXA 2HR3A 3T7JA 4ZBMA 3O5AA 3BDAA 3M6VA 2VN8A 4QG7A 5CPBA 1EP1B 4OH1A 1FQOA 2GK4A 5FTKA 5H8WA 4ENTA 4LCEA 4NZNA 1Q1AA 1RRPA 1Q82W 1LNSA 1XKTA 2PQ0A 4TMFA 5JO0A 1U8CB 1YTLA 1HDYA 2QQ5A 4C0QC 2ZIFA 2BHLA 1A77A 2GJSA 4X61A 3LPMA 4FLVA 5EJAA 5J5AA 1H4VB 2LCFA 3HWWA 2B3TA 4F4JA 5K8IA 1FJXA 3MT7A 4NE7A 5D51S 1E2UA 2BUAA 5CNIA 4BBPA 4DV3O 4IQGA 3QKTA 4LI3X 3DLTA 4H7PA 1ZUQA 3BL8A 2ZJZA 4UDOA 1OA0A 3MGBA 3UFXA 4DA7A 2OZEA 3N8GA 2J0EA 2LV8A 4KQ1A 3RREA 4WNYA 5KQSA 4A6EA 1F17A 4HGYA 4ZQBA 5JSFA 2XTZA 4MTCA 1UBOS 4PINA 2G72A 3LGAA 3OWHA 3LF1A 1F60A 5I7VA 1NT2A 3TFWA 2EKDA 1HNNA 1A3CA 4WZBE 2QI2A 2VR1A 3HR8A 2EILC 4KGZA 1PBTA 2W98A 2H1SA 4DQLA 3G8AA 4JI1O 4IL6Z 1HL7A 1T2CA 4QJIA 1JR6A 1YCHA 3SNHA 1CJUC 2FYUH 2R751 2VYVD 4XW2A 4W6QA 3OZTA 3TSYA 3DXYA 1WB7A 2H1HA 3QELB 4OL9A 2LIVA 2PJDA 1JXMA 3LZCA 5IW8A 3T5BA 3TIVA 3M5CA 5HKKD 5LZ8A 2HA4A 4AJKA 4BDTA 1ZL0A 1K98A 4RL6A 4TRJA 2VNKA 1NWHA 1N2OA 4LQDA 4TTIA 4C6HA 4ZGBA 1FE8A 4IJKA 2CMGA 3IVRA 4RFSB 5ALEA 3AGKA 3ZW8A 3S2EA 4RYDA 3RSHA 2G7MC 4EGJA 1OWMA 1DIBA 4UD6A 2OM2A 3SZMA 2AMYA 2VAXA 3VSBA 1OY1A 1XVUA 1ZJJA 4ZREA 1EU1A 3O4JA 5LBUA 4JYPA 4NZMA 4F4IA 1V2GA 1QIGA 4Y6PA 5GGXA 3ZXIA 4QM7A 3U44A 3A04A 1ORVA 4MCHA 4IVQA 3R7SA 3GLFB 3ADOA 4L7VA 2FMIA 3Q40A 3GHYA 3ICQB 2K1SA 1PUJA 1Z8NA 3QXSA 4LXIA 4YJHB 1M6EX 3OFVA 2M6KA 3RHZA 3LLVA 3KYJB 5TSDA 3CZCA 5FBVB 1YACA 3GJ4A 3ND7A 5FOSA 3KZMA 3SE0A 3DKRA 2D7JA 4EYKA 3KXIA 2I6SA 3UMYA 3A3NA 2A57A 4HDQB 1B3RA 3V7UA 1K1EA 3LBHA 1CCWA 3P96A 1IOVA 3VH4A 1OX4A 2GPAA 3WK4A 2JCYA 1TAUA 2PFKA 3DWFA 2DUUA 2AJBA 3QVMA 4DCOA 1KORA 3I61A 3UJAA 5LMUO 3FBWA 1A50B 3JV7A 1M1KW 4BVQA 4HXEB 5CH3A 3LL4A 2Q5QA 3DC6A 2DULA 1DTWA 1I9CA 4UVHA 2XEDA 4PTZA 2WYHA 1TQ4A 4AHCA 1ZGBA 2DWEC 2CZCA 1DFGA 2W2QA 4BQIA 2C3OA 4OGGA 3SWWA 1DE0A 1Y9EA 4BAGA 4BVSA 1LPMA 2IV7A 4R1LA 5B3JC 4A2CA 3A4YA 1UEJA 4UBLA 1UMCB 2VLBA 2B8EA 2AC2A 2XDAA 3OT7A 1U3PA 2FOXA 2K7ZA 3IMKA 4G8JA 4HH3C 2SKEA 3MGCA 4O5AA 4XGIA 4DBZA 4E08A 4Z51A 5CDGA 4YCNA 2XUHA 3KSAC 5FWAA 1DJNA 4EB8A 1VG8A 4YJ2B 3JS5A 1W4ZA 4RJLA 2VG8A 4QIHA 2ZJ1A 4MYSA 4OHWA 3EQ2A 1OCCC 4FFLA 2VS1A 1YVDA 1AKTA 1BXRB 3A6LA 5LLSA 1N77A 4JI4B 2VF2A 4TS3A 3TK1A 1SXQA 2RAFA 2CDYA 1VLMA 4OBEA 1K06A 1PR5A 4CL2A 4HL6A 4XUEA 3BPSA 4R3UC 1L7MA 3QPVA 4YHBA 5JNLA 3STWA 1YKFA 3NOXA 4HDRB 4CMKA 5B30A 4P3PA 4X8AA 5AO9A 2V7QD 4KN5A 2HGSA 4P53A 4Y2PA 1BJKA 4FONA 2W70A 2PT6A 2IH4A 2DBZA 3MLAA 1W93A 1YJQA 4M1QA 3WK8A 4UJ5A 1R3LC 3V4SA 4I0XA 4H0FA 2VHTA 3BICA 3H4MA 3RE1A 3NBUA 3UJBA 1WZNA 3GEBA 1ZA1A 2V7PA 1JI0A 2FU5C 5CN0A 1AZTA 2FPIA 4EX6A 3W0LB 4DUYB 3CRW1 3RVOA 3KB6A 2CLEB 2QL6A 2PJUA 5ECWA 1X59A 2H3OA 1ODSA 4ZFNA 2OUIA 2YV3A 1NI4A 3OIDA 3BKXA 1VMIA 2DQKA 4M87A 2WPNA 4HNVA 5FBKA 1HFKA 4ALIA 2Q6LA 1EXWA 3R5JA 1KYYA 1MVLA 1OBVA 2BGMA 4M54A 5KAMA 3TKLA 2HS3A 4NV1A 1P75A 1TADA 3DMDA 3ET4A 4I50B 2Y92A 1Q82H 2H5JA 3FVQA 3LWZA 2VBFA 1M2FA 5AOAA 1U7TA 1N5DA 3U16A 5KMGA 4W63A 3BRCA 3N2GB 3QOYA 3UKDA 3ZY4A 1E6MA 5ELXA 4Y2YA 2LW1A 2Q6AA 1D8AA 1QOPB 4ARZA 1XU4A 1IJFA 4UARA 3EGIA 1EWTA 3WBKA 3DAGA 2AB0A 1J99A 3HPRA 5CDYA 2C77A 4ZRNA 3AEKA 2P2YA 4CCSA 1NNI1 2RC5A 1KK3A 3PXAA 2UUCB 1W42A 4QVKA 1FLNA 3ZTYA 1W6RA 3OAAD 4L2IA 4RXUA 1IEXA 4RGQA 5BSGA 3LBFA 3KD3A 2B92A 4JP2A 1D9XA 4GC9A 4JLJA 1P0CA 5EESA 4IHKA 3LWQC 1QCZA 4RGBA 4JVOA 1J39A 3OQIA 3M99B 1H0KA 1THZA 2NX2A 5JXJA 3R5SA 1XZFA 3RROA 3T4UA 3EQ8A 1ORWA 3W90A 1CQWA 2I2BA 4HDNB 3P9RA 1O7JA 3G6BA 3I3FA 4MQLA 5FD8A 3QUBA 2X0FA 2A5LA 3CIOA 3BMXA 3KV1A 4OQXA 3SZ3A 3BXZA 2PYIA 1LBIA 4MHTA 2PRKA 1I0HA 2XUJA 5DFAA 4HBZA 1P7YA 4XQGA 2MIIA 4UQPA 1Q7RA 3CPQA 3DFKA 4CZ2A 3TIXB 3WS7A 2BEUA 4QREA 2W2KB 5BQPA 3O3MB 3UB3A 4CTKA 4MITA 1SBYA 1QHXA 1W2WB 3RTGA 3SPIA 3HGMA 4QVIA 2QVYX 2LCQA 1LBTA 4KWEA 4MS4A 3DV2A 1JLRA 1E2JA 1ZNZA 2WP8J 3DE3X 3CLRC 3P2KA 2PX6A 3L41A 4BN5A 5BQXA 2C3UA 4P86A 1KHHA 2Z5GA 3QSGA 2C03A 4MPRA 4ZYTA 4OK3A 4FI3C 2Y1LA 4HTFA 3ZJUA 3HDHA 4DIBA 2BONA 1PQYA 1ZIDA 3JQ6A 2OM6A 2QG4A 1XZNA 2I9PA 4DARA 5F35A 1GR1A 3KT8A 4Q4HA 1U6JA 2YDXA 4H9GA 1P0MA 3M6IA 4OQPA 1FJHA 2QMZA 5FOXA 3GFSA 5GP1A 2YX1A 1NSFA 1CIPA 1CNMA 4M60A 2GBFA 1EFVA 3GAFA 1L5VA 3CXUA 1FTYA 4MYUA 5DBOA 1MA3A 1SVIA 2ECPA 2GRJA 1NQ5A 3KHKA 3WQQA 1IMJA 2AYXA 1XXLA 5FTJA 3VYWA 4I3FA 3WOVA 2H07A 1UAAA 3KJGA 3DF9A 2IH1C 2DPLA 3HWSA 1X7PA 1DKRA 2PVCA 2MR5A 2AK2A 2HHAA 4MUGA 4XARA 3ENNA 2OZKA 5B1IA 1NQ3A 4AJOA 1EHCA 1E77A 2EXXA 4FLTA 3IERA 4J2HA 3ZWBA 3CMEV 3EFOA 5AWFC 1KAMA 2D5CA 1LC0A 3O4VA 1TA8A 2ZYDA 4IVPA 3PGA1 3W5HA 3IXMA 2AVDA 1X94A 5DGCA 2QA4V 1NIJA 1WKVA 4JVNA 5KTYA 5LVAA 1DEKA 2ZT5A 3DF7A 4R68A 3JQ9A 4U3FH 3PD0A 4KO8A 2Q1SA 2J09A 4ZAGA 1YMQA 3D2BA 3BMOB 1WOYA 4FQ8A 3WV4A 1EUZA 1B76A 1BN6A 1DAEA 2J0VA 3JY6A 4D6XA 5JD5A 4DR3O 2UYHA 4FBMA 3WMEA 3ITDA 5JQGB 3PYXA 2Q29A 4EGQA 1U0NA 3EAFA 2ZRQA 4XEHA 3U1BA 5CDSA 2WTNA 4AROA 3HB4X 4OX9B 1XZQA 2D5IA 3CCUV 3TNLA 3OEED 3Q9NA 4BVBA 4PV1B 3O91A 4EJFA 3TWOA 4WJZA 1WUKS 1S3GA 4MDYA 1SPXA 4QPJC 3QKRB 1Q8RA 1YCDA 2CH7B 5HUQA 3SOPA 4B80A 3IBTA 1MDFA 2YXLA 3V34A 2QZZA 5K09A 3MUNA 3L40A 4WINA 3I76A 1Q1EA 3L5OA 3PUKA 3RKSA 4DXAA 4X1KA 5D7NA 3CEIA 4OFBA 4Q4AB 1RC8A 3CN9A 3W9UA 4U7JA 4ETIA 2CLLB 2I8LA 1WXFA 4RDHA 1JYEA 2A9HA 4R8RA 3X2FA 4G1UC 2I2CA 1B3QA 1IDSA 5KYNA 5KMGB 3WRWA 4IINA 5ER6A 3VU0A 1XL6A 4RIEA 4YRPA 3NEJA 3TSZA 4ZTZB 5I9IA 1OFTA 1BCRA 1JRLA 5CM9C 1RHUA 3K08A 2ATIA 4D0NA 5CBPA 1P49A 1BW9A 1QPBA 1DTOA 2FUG6 1ES9A 2QPTA 2M98A 3CZRA 3I5UA 5KNDD 1J2YA 2VQ6A 2YC4C 4KFRA 3LQ4A 1P1BA 1I1QB 1IBCA 1X2BA 1I4EB 2VHCA 2QKYA 2XWQA 4KU4A 4BWVA 2YJ6A 3RD5A 3ORSA 4HS9A 4MS1B 3R0XA 2K4MA 5HXZA 3BERA 4AG5A 1Z9BA 1CZKA 4J4BA 2R2GA 1KK2A 2BFBA 3TD4A 1P1FA 2F43A 2F48A 2IYSA 3P20A 4H7FA 4KYIB 4OHBA 4PA4A 1SOWA 3A4VA 1COMA 2JVDA 1RE0A 3H9JA 3L7OA 4C4XA 4X00A 2E74B 3EX7C 2B78A 1QP7A 4FGKA 4JHLA 1BX3A 2H31A 2NZJA 2XBLA 4OUDA 1HKUA 2JIRA 3I92A 2QP3A 2XAGA 1GDHA 1T6YA 1Z75A 2QLLA 2W90A 2Z4RA 3E03A 4ENQA 3ZVNA 5I7HA 5AXCA 5EJFA 3IQFA 4TXHA 2EINC 1JEQB 1T5LA 2XUFA 3S06A 1JXOA 3FKSG 4KVAA 2IU0A 3O8OA 3FNEA 3KJJA 4WOBA 2JH8A 1BGYH 4Z2WA 4RHFA 3IVAA 1QWSA 1IONA 1XMVA 1Z6GA 4EI7A 3HS3A 4KJZA 4UU8A 1FK8A 3BGSA 4L27A 4N7JA 2GJ8A 2PWAA 3W78A 3EIWA 4XVUA 3C4VA 4QYMA 3IAM6 5ELMA 3QBEA 3N7UA 1ESZA 4E5UA 3EDRA 4DCUA 1TEXA 4RNCA 4A8JC 1E1LA 4O4HB 1A88A 4QRIA 5B1DA 1FZQA 1CUVA 3AUFA 3LS2A 3NM5A 3O84A 5B66Z 4XIGS 5H9VA 1Z8HA 1AO0A 4LBVA 1YK0A 1LPOA 1DMSA 1W48A 1C9MA 2H4ZA 2O0JA 3INNA 4L57A 4LJSA 3FZNA 3R3JA 2CUNA 4KDFA 5DGXA 5C52B 3SPJA 3CMCO 4F3CA 1ZAYA 2AFRA 1OFUX 2VPZA 2PMFA 2FF5A 4V3CA 1KE2A 3VHLB 4C88A 4OGLA 5BXYA 5EPEA 1O2DA 2DX7A 4QPDA 3H8JA 2L35A 2I1QA 1RWMA 4CNBA 2Z9DA 4MZDA 2HN9A 3ZU2A 4K9DA 3PNLA 1KP3A 1F6DA 2H11A 4BNGA 1OA1A 1UXIA 1R6XA 2P5SA 1P7ZA 4WDQA 1KU9A 3S3TA 1KNQA 3G88A 2GGSA 2R7KA 1NP6A 1UL1X 1TUIA 2DLNA 3B40A 2PRIA 3GUUA 2ZE5A 4DWWA 1DGQA 2V45A 3LUGA 5AHWA 1CZOA 1Z3CA 3PUHA 4I81A 1W88B 5H3HA 4LF6B 2V6FA 3QHDA 2IBZH 1A97A 3EGDA 3KOOA 2XA1A 2YIVX 1M5IA 1M1YB 1WPRA 1AGYA 4BO8A 2Z6UA 3TBHA 3WJAA 3ZVLA 1YJ9F 1RKXA 3BCCH 1XNHA 2AMJA 2Y1GA 1G4AE 1QZ3A 2Q5IA 2X2OA 3BS4A 3IP6A 2PKXA 4YJ3F 3WGTA 1AVMA 4FFVA 4P5DA 4R8KA 5BMVF 4LG1A 4NBVA 1FS6A 3IAAA 3GBVA 4G1BA 3UENA 3KQUA 3AVTA 3HJCA 2VT2A 1BFUA 3KC2A 3PUYA 5CT6A 1N6LA 5LP1A 4BQOA 1QVFF 3FR8A 3HI6A 2ASEA 4Q9IA 5KYXA 3G85A 2FPPA 2IOQA 4MNTA 4B3SO 1FRQA 1H3FA 5JMTA 4YP5A 1PUXA 3B5EA 3EGCA 3QW4B 3IE1A 4MUEA 1CF4A 1Z5PA 3NORA 3QMWA 1GZVA 1I0ZA 4Z0HO 4DBLE 4E2LA 3BHPA 1R9MA 3KAKA 2DYRC 3H1FA 4AP9A 5IM4A 2B34A 4JBIA 4XB2A 3OT1A 4RKRA 2DUJA 2VJAA 4JSTA 3R7AA 1V5WA 2JS5A 1BX0A 1IY8A 2MU1A 5I7UA 3OM3B 4IIDA 1GZ4A 4X1KB 1IL0A 4GZLA 1F2TB 1SR8A 1RQNA 3A3KA 1GPKA 1FXKB 5BR7A 2IYZA 3NONA 4MRAA 3HYLA 2B61A 2PN1A 3FD9A 2AIRA 1FC0A 4LZJA 4PHFA 1HQDA 4XGKA 2PGIA 2QIPA 3VZCA 5KC8A 3IDFA 1YS1X 3VPFA 4TZ6A 3IEQA 1XBTA 2EF1A 3LUJA 2WD9A 3HYRA 4JKOA 2FEXA 4M9XA 4D3YA 2I4NA 2ISQA 3CS3A 4K8RB 5DBGA 2FPIB 5GJCA 2MYNA 4D74A 2O8DB 1IH8A 3PLAE 1ZGAA 3ZU4A 4R9RA 4BTEA 3ESRA 4E5PA 4YLYA 3JQEA 4U5XA 3MOGA 3TTVA 3DBLA 5TISZ 1F38A 4F2PA 3JYQA 1P2VA 1YC5A 4NEGA 3FPJA 5FPHA 2HYIC 1VQPF 5C5EA 1V7ZA 2ZSAA 5AM4A 1SRYA 5LYYA 4MKGA 4B4OA 3U5ZB 2G28A 3G5AA 3QLUA 3DDZX 5LNK6 3ROQA 4TYNA 2K87A 4GVLA 5TT1A 1OYWA 1EWVA 2P8JA 1IATA 1EMDA 4XB6B 1UINA 3COWA 1TIKA 3E7DA 3JZAA 3OOSA 3P0RA 4LZAA 3TM5A 2ZAIA 4TXNA 3W6ZA 3UPTA 2Z6AA 2AOUA 3H9VA 1OXSC 4IIUA 5J59A 4D3ZA 4LHSA 4AU1A 4KWIA 2I87A 1Z16A 4F60A 1GKIA 1T36B 3FWPA 3FAVB 5ENVA 1TMGE 2QTMA 1X7GA 2BDUA 2ZIXB 4UNQA 1PVVA 4A5OA 4PBTA 3VC2A 3WJ7A 4UUAA 5C5DA 1E32A 1H5QA 3L79A 3QK7A 1VDZA 4XM0A 1GGHA 3I6ZA 5LU8A 2QJOA 4W8HA 1NWCA 2EBHX 4A3SA 2J48A 3HCBA 4DC0A 5I3ZA 1DZ3A 2WIAA 1OZFA 2ZIZA 3BCRA 3QKUA 1MJGA 2WHYA 1UP4A 3FRHA 3A6ZA 4MV6A 1CX9B 1QO0D 3NIWA 3F5FA 3UKOA 4RJTA 3GLVA 2CXNA 3DTVA 3U9TA 5D85A 4EAQA 2JI8A 1CLUA 1GYRA 5ICMA 2AXQA 2EEPA 2PX5A 4Y6LA 5I7EA 3MWEB 1FFAA 1I5EA 1PG5A 3VISA 4F96A 3MINA 1FMCA 2HA6A 3L0CA 3CHXA 3ZTTA 1Q1NA 1ZCBA 1X2EA 4ISCA 3TXQA 1GXSA 1RDFA 4WN9B 1GN3A 1VF5B 4JOQA 3H5AA 4L4SA 4PDVA 2OQ2A 5FOQA 4KFMA 1XKLA 2C2WA 3VKWA 3WNBA 2VA9A 2HVYD 2NAPA 3MXTA 2FKXA 1R7RA 5IT9M 1RJ9B 1EUCB 3GLIB 3OEEG 3JQBA 1JOYA 3JWEA 4KNVA 3LWOC 1O95C 4JU9A 1T43A 2BO1A 3L7KA 4W5OA 1P2SA 4F8YA 3A4NA 1JKIA 1R9JA 2X8LA 2Q5CA 1XPJA 2QU8A 1OU0A 2XE7A 2Y67A 2LBPA 2I6XA 3OJ0A 1KYOF 1GNLA 2OWEA 2UZ3A 4C43A 4FFWA 1APBA 3RUDA 1IZ3A 2ZULA 2KTUA 3U4CA 2LBXA 4Y6QA 3VX4A 4LMBA 3ACBA 2H2FA 5F1YA 1GQ2A 3AY6A 5JSYA 4D43A 3EZNA 1KJIA 3K9SA 2XSZD 3NIFB 4U2CA 4BO9A 4QOSA 5CIQA 1U40A 1QTIA 1G0NA 3EXIB 1UJ4A 3HDYA 4I99A 4YQZA 2OIGA 2EWCA 2WKSA 1NJ8A 1Z45A 4FZVA 3WGKA 2IG8A 1W0CA 3I9NA 4FYMA 2J07A 4K3VA 1ZU5A 4A8TA 4A1OA 1FXKC 4LSMA 1T5HX 5KHJA 2P69A 1PR0A 2SKCA 3KSZO 4UCXA 5A62A 3SFVA 2YJTD 4GXRA 4YRLA 1R64A 2YVQA 2D8MA 5IZCC 3TW8A 3BGVA 2OCYC 3KZCA 4NBLA 1ONBA 3QUWA 5E38A 1ZX3A 1SG9A 1W87A 5G4KB 3EF3A 4YPOA 2ZXUA 1N2IA 2EZOA 2A0FA 4BNHA 4AJ4A 1KI9A 4MR8B 1WA8B 4BAUA 3K9QO 5WRFA 3EFOB 4CU2A 5ICFA 3OBBA 2XCTB 5HA5A 2QT0A 2EINB 2C7GA 1UOEA 5A3JA 3Q2IA 5G0TA 1CLIA 3DM9B 4L0DA 4ZCPA 3V8NA 3KKYA 2IDZA 5F9HA 1C9KA 4WXYB 3F0GA 3WTBA 2QQEA 4G2NA 1XN1A 3AEQA 3NR2A 1H9AA 4N9QA 1NW6A 1HOXA 1OWNA 3C6BA 5DHPA 5HDQA 3G9QA 3M6WA 3EXHC 3HG7A 3PQ3A 1E2GA 3RYHB 2HA0A 1KL7A 2ZI3A 2ZUCA 2PYJA 3CF2A 3IEPA 3V1TC 3WYCA 3SYLA 5H4HA 4QASA 3SN6A 3VU3A 3L75H 1YR6A 1M6VB 4TQUS 1JTFA 1T5BA 3WKAA 4CG2A 4YAGA 4EB6B 1FBNA 4AKSA 2FZ4A 2WB2A 3QFRA 2IHKA 1Z5WA 1U8ZA 3K1JA 1WP8A 1HP8A 3F3KA 4MDHA 4N0PA 4MTXA 1GPH1 4IIEA 3MUEA 2YSUB 1MJGM 4HRVA 2JRIA 3T80A 2BEVA 2HZBA 2Q6KA 3LY9A 2CVLA 4XLZA 4KMRA 3CXHF 1TF2A 1WMAA 4A8PA 1H9BA 3AF2A 2UV8A 2HSEA 2QW8A 4U7GA 1E7MA 1W1IA 5FWDA 4JOCA 2OTMA 2AEMA 1B8NA 4HGPA 2AV6A 1RWKA 3WYAA 3K0KA 5JU6A 3CNLA 1CUEA 4G8CA 4JNKA 1GKUB 4RWEA 2E87A 1DCTA 4ZVVA 2WIKA 1IXRC 1U2ZA 1VF7A 2CJWB 4GUNA 5JJEB 1JG6A 2YTZA 1GPJA 2ZYVX 4YXWA 1TM2A 4X3MA 1N2ZA 1MV8A 1TCBA 1YNOA 2DT8A 2IKQA 2QUJA 2I99A 5E79Z 4W7SA 4ZCMA 4JI6B 1BXKA 2HDNB 3T7AA 4JC4A 3OSUA 3V7NA 3WBFA 4G88A 3L8FA 2C9DA 2V4UA 4NYIQ 2WMOB 4MLZA 4RIFA 4DEYA 5CH5A 2C4VA 4A8JB 4E4EA 3AG7A 4ETWA 2JGUA 2YNMD 3ESQA 2QPAA 5EHQA 4JSYA 1R15A 1R5JA 3URKA 1HDJA 4LW8A 1Y1LA 4ZCTA 3DL2A 3AEKB 3HNRA 2GPYA 3HGTA 3N2ZB 4WKGA 3WIVA 1RPNA 2HQSA 2OV4A 1T6ZA 1NBWB 1OUMA 1WF3A 2RAUA 2W43A 5FAXA 3ZOKA 4R8VA 3FVRA 4DY6A 4WV3A 3RYCA 4GKKO 2O4UX 4DR1O 2IGBA 4C82A 1GNQA 3PA6A 3ZHRA 1VHWA 2VHXA 4NARA 4ND4A 4QWWA 2VRBA 2WZCA 3WWOA 3ROZA 3I52A 4NEHB 3BA9A 1AO3A 2NWQA 4A2WA 1Z5VA 4KPYA 1P1HA 1MAWA 2GEDA 2XUQA 3KYCB 4U7FA 2GBOA 3ZE6A 4K6KA 4FYHA 1YB5A 4MVRA 2XHEA 4B2PA 3IEWA 2GBGA 4MS3B 1MAAA 5L4LA 2GASA 4UUOA 1S2IA 1UK7A 2CNBA 1MG5A 2EFCB 5TGTA 3RQIA 4D3FA 4CKEB 1T0UA 2ILTA 1FF9A 4NR0A 3K7EA 2HFKA 2UYGA 3QEJA 5EQJB 1ACMA 1CIVA 2WFZA 1T1IA 4IT5A 3I9JA 5T3UA 4E5DA 5IY5B 3USCS 1T8SA 3B51X 3P9QA 2FMLA 3C3SA 4FW8A 3RPEA 4J80A 1H47A 3CYQA 4KDRA 4ZCLA 3L7MA 4DY4A 3T1QA 4P0QB 1BU8A 3KB1A 3NHSA 1WNTA 3IUEA 2JS3A 1VQ4F 1YR1A 1TQ6A 1Z7BA 2G25A 1OCZC 2CWWA 2DFKB 3G3EA 3W2FA 3LQFA 2B3DA 4OLJA 3WZMA 2PUVA 4FZRA 4HWKA 2OHOA 4INZA 1EP9A 5T4FA 5AOBA 3A1NA 3JCMM 2ETXA 4TTSA 3K92A 2C9CA 4H33A 1S5LZ 5CT4A 3UQZA 4YPVA 3SYMA 1G9TA 2YY6A 4MP3A 1JD1A 1RYHA 3LX5A 1AUQA 3RVSA 1SQGA 1VQ9F 2ZBDA 3DBOB 4IIGA 1PZEA 1ADFA 5DBEX 2X9QA 4Z3DA 3LKVA 2XHZA 2RHLA 3HNPA 4UUBA 3LSQA 1P73A 1TQDA 2HBRA 2V8OA 4D41A 3ZJTA 4MHSA 4MCJA 5JNUA 2J3QA 4LR3A 2B37A 3HB0A 4WFGA 2VWHA 1AQYA 1X9HA 2CVFA 3QE3A 3VO1A 1XTQA 1IRXA 4FMCB 4F06A 3D36C 2HNBA 4G63A 3A0RA 1B0AA 1R6KA 1J2EA 1DLIA 1VQ5V 1XGKA 2CD9A 2ZE8A 2PCJA 1XCPA 4MYTA 1A71A 1TU0A 1GCIA 2C4MA 3GH1A 1NOIA 3TSCA 4ALLA 4IW3B 2GK3A 4L8LA 5GINE 1M93A 3CCJF 2D74A 3R9IA 1F2VA 3L8MA 3QA9A 4BO2A 4HN2A 5IF3A 5LUAA 4N5IX 3P9KA 3E82A 5EIBD 3MCWA 5JQGA 2I6TA 3WFZA 3C1AA 4D3DA 2Q1YA 2PVSA 5I4KA 4OLBA 1AZLA 4BMZA 4IJUA 2ZRIA 5CB4B 4ZYVA 1OH5A 3K5LA 4F6EA 3ESAA 4NYJR 5DNUA 2DQZA 4RUFA 4W5NA 1BCCH 1CR6A 2R6GA 1H22A 5C7LO 3TIFA 3TUZC 2OBNA 1FLVA 1Y4UA 2OOSA 3HKBA 1YCFA 4V0OA 1H38A 4EFLA 2IV2X 3GLRA 2IPLA 2IUTA 2HFJA 3KPJA 1H8HG 1CQIA 1W4AA 1IU9A 2R6HA 3N07A 3OLQA 1IEVA 2CXUA 3MMPA 4I14A 4EY3A 2GZMA 3SSAA 5BYKA 1O8BA 4LMRA 3WLKX 4MWSA 3FPEA 2QSZA 1AUVA 1KC3A 4DUGD 4M7WA 1ECPA 3VC7A 5B3LA 3V3TA 3TLYA 1G7RA 2A2ZA 3KLMX 4OB6A 4URXR 1DFIA 3F9RA 3VM6A 5H5NA 1RI3A 3FYUC 5BV7A 3DC7A 3T4ZA 2VBGA 5EZ6B 5IHXA 2VTBA 2NYRA 2V7QG 3SYTA 4GI3A 3VSDA 4L8JA 4P58A 2V5UA 2G1PA 1Q2XA 5BR4A 4MR7B 2CGOA 3NXKA 4XRGA 2IF0A 2HJVA 2ABWA 1SHTX 4TL9A 3RYCB 1AKVA 1WW2A 5JWRA 1ENOA 2P9ZA 4W5QA 1NVWQ 1HWYA 1SXGA 2GR9A 4RA6B 3FMIA 4YEDA 4ZOLB 2PZEA 3AG2C 4CC6A 1CJSA 1J8QA 2B9VA 2FKAA 1OZ0A 3A36A 4ZOQI 5ADHA 1M3SA 2WFLB 3NXSA 3E8BA 3SDLA 2YFKA 3Q8KA 4C7OA 1LX7A 4JLSA 2XTAA 3CTPA 2WYVA 3LFOA 3D64A 3V3KA 1TNDA 3E2MA 5IRCD 4I2NA 2JFNA 1M4UA 4JMLA 4GDFA 1EX9A 4HADA 1D2CA 5JD4A 5BW5A 1OFUA 3F4LA 1QH0A 1WEHA 3OTFA 3MN1A 5AW8A 1CLEA 2HO4A 4NU0A 2OTLV 3KBOA 4L85A 3QUTA 3PRKE 1RHMA 1QGDA 2FN4A 2WD8A 2XKAA 4BDSA 5EHXA 4JELA 3H6KA 3WKDA 2ZZKA 1DS6A 2WY2D 2YXDA 3WGQA 1E2NA 1Q50A 2BY4A 4E94A 1E7WA 1NE7A 2H29A 2CXQA 4X88A 3RBZA 2RH8A 4CH5A 2OD2A 3NR7A 3B7WA 3NOVA 1NKDA 2CXRA 3G6WA 4FT2A 5EWJA 3WKCA 2CGEA 3ZLUA 4M0FA 3WDKA 3WLHA 2CHFA 2W71A 1AN0A 4KZPA 3U4QA 3FFTA 3NWPA 2IW3A 2V59A 4M46A 3H2SA 5CJ2A 4KWHA 5LWHA 4E0BA 4A03A 5B5SA 1EJ2A 2XAHA 1N8TA 2FEWB 2O5EA 3DEKA 2QPLA 1WDKA 2QN3A 2OG1A 3L7JA 4JC0A 4BO3A 2E4YA 4F6LA 4CQMD 4WSOA 4O2AB 4N12A 1UIRA 3ITEA 1KEWA 2N74A 2C5LA 3SIWA 1XOIA 2HF2A 3A1WA 4H6VA 3SS8A 2H2DA 2VPQA 4BFVA 2BRUC 3WGIA 1JPJA 1AR4A 1EWKA 4AVYA 2YZ7A 1GGMA 2I2AA 2O9JA 1JJ2F 1YHNA 1E98A 2A1UA 2OO5C 3D8UA 3GT7A 3EXFA 3TSOA 3ZCUA 5E9JA 2OOKA 1KNXA 1U0HC 4OPAA 3AIMA 2Q49A 3MWFA 5LB2A 4EMBA 4DLBA 1IXZA 5I7AA 2MINA 2WTAA 3MSXA 2GCOA 3CONA 1YZBA 3TN7A 4BJ5A 3H5LA 4JTDB 2W6JA 5JTTA 3H2HA 2Q8PA 1EBOA 1VI5A 3G59A 3QJYA 4J16C 3CX8A 1PWHA 1GN2A 5EC2C 4RHTA 2VSFA 1KEPA 4LOIA 1EHYA 4ZHVA 4PHTA 3H13A 4XWGA 1OCCB 1VDMA 1VSBA 2ACVA 4Y0NA 5IJ0A 5AM5A 1GU0A 3SHTA 3V55A 4AXXA 1LPNA 4GVPA 3CRZA 1ZBQA 121PA 4YA6A 1IY9A 4GD3Q 2P67A 3GU3A 1B26A 1L3BA 2PEZA 4WBNF 1ZCFA 3S8MA 5DTQA 3DTNA 4DN6A 4YPFA 4FEEA 4FCTA 5CFRA 4DB2A 5K9ZA 1RBQA 3QTYA 1GEEA 3RFRA 2PXAA 1NPYA 2F3TA 1QHHA 1XCOA 2Q46A 4E14A 2VZEA 3I56F 4EHKA 1P18A 1A7KA 3PHIA 4YAOA 5EP1A 2AD5A 3K73O 2XCOA 5A05A 5CB8A 5TARA 5LM3A 1XD9A 2CUKA 1ODFA 4M0KA 4BO4A 5AG2A 1L7OA 1S9HA 2C04A 1NX6A 2ZNJA 1YB6A 2OZLB 2VDMB 2P9QA 2XR1A 4Q6GA 1TIPA 3MRXA 1KC8W 4RHCA 4CKCA 3GGGA 1KBZA 3UJ7A 4D9HA 1ZJ6A 3DVLA 3W9BA 1OLSB 1V7PC 4OXQA 4D0GA 5CTJA 1WP4A 3VPGA 1AKRA 2AI3A 4D8TA 2OCDA 4L4ZA 1ISSA 1XZBA 4PXAA 4WXPA 3VOUA 1FAFA 4YACA 1BU5A 1OGJA 2FSGA 4PWTA 1VG0B 2P2SA 1EZJA 4K35A 1ZD9A 1YXBA 1KFBB 2C2OA 1VQ4V 2MSNA 1GTOA 1QX4A 3H9CA 1MOQA 3IIKA 3N6XA 3UC5A 3QP9A 4RMJA 5AW5A 5DTRA 3F1LA 2ADFA 1LRKA 3O38A 3T15A 4B4WA 3E3AA 4A5SA 4U2FA 4FJCC 3BMNB 1R0KA 1SC3A 3OU2A 4XX1A 2GJ9A 1G16A 3KU1A 5EXSA 2FEPA 5K2MA 3CH4B 1F8GA 3F8SA 4NYMR 3RBVA 3WJ1A 4LNHA 1EH5A 1QO7A 5LDGA 1TK2A 1TPYA 2ASVA 3AVQA 4R40B 3EPRA 3IDAA 4KKXB 3SHFA 1XTPA 4ZDKA 1WB6A 4I1UA 1UBRS 4KZKA 2H18A 5LZ4A 1VJ5A 1X7XA 2OGSA 3JR7A 4XUGB 3S2ZA 3GLQA 1XKXA 2W2OA 4N4AA 1XCJA 5U4XA 4P4LA 1XCLA 1NMEA 1RLOA 1A69A 3D0KA 3SC6A 3T1HO 3TOSA 4UXJA 2C00A 4GKJO 5FNZA 1WCIB 2UXNA 1FNNA 1E1RG 4U9IS 2E82A 4J3NA 3GIDA 3IIEA 3NLLA 4KL1A 3QITA 3A2FA 2VC2B 3ORYA 2IYEA 3P2OA 3BG5A 1C2TA 1SHJA 2D8AA 3JVIA 4QYIB 3I5AA 2GXQA 2F3PA 3KXKA 1GFIA 3IAS1 3QEOA 4PO9A 5DXFA 5TV2A 2H85A 2CFCA 2QVGA 4AJ1A 3ZZUA 5F1PA 4BEBA 2JFHA 1EN5A 1JAZA 1V26A 1XKQA 2JEYA 2QTVA 3DGFC 4FPXA 4AKTA 3QI2A 1QGED 3RNLA 1ZIXA 5K8LA 4M0DA 4R2LA 1A7AA 3V4RA 3I01M 1KS2A 4ZZ0A 2QBYA 3WPXA 3BQNB 3WJRA 3AGQA 4KXLA 2G40A 2Z1FA 3CMMA 3N53A 2G83A 3JAMA 3VQTA 3D4LA 3ABKB 5DX0A 5AKIA 1U2DC 3NGXA 4CGZA 4X7RA 4ESHA 3AGPA 1JJIA 2WBLC 1WBBA 4ZICA 1ONNA 2P65A 3QRWA 3ZCRA 1RQRA 5E7QA 1EUCA 1FCJA 3GLIA 3IEVA 1FZTA 1N0NA 1K5QA 3MSCA 2ZT6A 5DRYA 5IH3A 4CL0A 4QDKA 4FOTA 1E7SA 3NMUF 3PVZA 1D2DA 1E2FA 1HDOA 1NQWA 3PC6A 4DA6A 3D5EA 2W6JG 1XA0A 2O2JA 1XPOA 5B1BC 1CUDA 3FE2A 3ILHA 4OM8A 4OIFA 2AN1A 4NH4A 2CNNA 2WJIA 3HB1A 3D8NA 2EJTA 4RORA 3CW8X 4JAAA 2CXTA 1WY5A 1AJNA 2IS2A 4UE6A 4GOXA 4EKGA 1MB2A 4RK6A 4UD2A 3ZGOA 5TXGA 2PFGA 4DR3B 4A5UB 1USUA 2V97A 2X19A 5GW7A 2X6RA 1V5FA 4FOSA 4FVTA 4RCYA 1FP6A 4JT4A 4KLNA 5DLYA 1HLPA 3R5TA 4CMEA 3DJYA 3DDSA 4OX9O 2QB5A 2E6UX 3OONA 2C2KA 4ERXA 2JLYA 2QYTA 4LYHA 1XHLA 4FXPA 3BZBA 3G2NA 4V2UA 2JAPA 2BMVA 1IMOA 5FBLB 4YMTA 2I1VB 4LY3A 4W8OA 1UK8A 3QKRA 4DIMA 4LGMA 1SURA 2IE0A 5LZ2A 3IP1A 3Q8XB 4MQUA 4OMUA 3RR2A 3HEBA 1PLKA 2FYTA 3ICOA 4MUIA 4BCDA 4L75A 5C46F 3I4CA 2XVZA 2WMDA 1LPBB 5HIKA 4A26A 1AY0A 5ETJA 3KD2A 2Q5LA 1V1JA 3N0XA 5IMSA 1IUOA 1OXKB 3U7IA 4FYXA 3L6DA 4IDOA 3IHTA 3ER6A 4OAPA 4OHVA 1CE8A 5E3IA 5JS1A 4UVGA 2A5GA 1MH1A 4UREA 4EEZA 5I9TA 4O2BF 1AG9A 2HWUA 5F3DA 2XBUA 5G2OA 3IS3A 1PHRA 1U9CA 2CWJA 3B1FA 3E3MA 2OYCA 3H0CA 3P4EA 3DC5A 5IYDO 1JSLA 2L17A 3TEFA 2DU8A 3HWX1 3SGLA 2P40A 3T7RA 3ZDRA 1BHAA 1GQQA 4ESVA 4WXEA 1XU7A 5F7ZA 2ZZNA 4NWIA 4E1AA 3TD6A 3DLCA 3ZWKA 3GGOA 1KOJA 3M70A 4LX0A 2CEAA 4NK4A 4X3OA 2JFZA 3GJ0A 1A76A 2V6JA 1IQ0A 1RYNA 4TUYF 3AOEC 2C5BA 4EA9A 4K0KO 3K09C 5CH8A 2P77A 4EJSB 3GTZA 2HPAA 3EHBB 5KHAA 2DC1A 1YL6A 3JAMM 3CWQA 3D59A 4RKWA 3RV3A 3KQTA 5JASA 2A14A 5K03A 1P9NA 5KWJA 5HOEA 1L1FA 1ENPA 1A5SB 4G1FA 3WLJA 3OPYA 2O2ZA 3MWKA 4L0CA 4GNRA 3WI7A 4U8GA 1U9IA 4TSFA 3AFNA 4KN9S 3TIGA 3W7SA 3FPLA 2FJ0A 2GEFA 4RK4A 5EUMA 1LW7A 4CXMA 1SQ6A 4GFDA 3NHPA 3KALA 1PNLA 3FX7A 3RRMA 4C7OB 3HM2A 2PZLA 1T1JA 3KELA 5E2AA 1F9EA 1EQ2A 2HHLA 4BZXA 5J4HA 3CLUD 2Z30A 1DPGA 3ZRWA 3GY0A 1NPTO 2J08A 3OZUA 2CY0A 2FRXA 2SKDA 2RGBA 4HEJA 1XLTA 4UCQA 4ZOBA 5E1MA 4BE9A 4LHVA 1VRWA 3DV0B 4NBRA 1X42A 2VPTA 3I4FA 3QFTA 4X20B 1UMKA 2NLJC 3VQWA 1DQRA 2G76A 2R2AA 3RJZA 3NC1C 3GLGE 4CS2A 4HNUA 5C53B 2P4UA 5BZBA 3BFRA 4FLXA 1ABEA 1ADCA 2IEGA 5CW1A 3T4EA 3DKVA 4REOA 2ZIVB 2VFAA 3SBXA 2O0HA 2WSSA 4HEHA 5BQOA 3UG6A 3UJHA 3VZBA 3R66A 1YI2V 4KQGA 4YY3B 3S5JA 1A2BA 1UBFA 4N5HX 2OXIA 2ZAOA 1G2OA 5LR6A 2F1IA 3P9NA 4JQYA 5FR2A 2J0SA 1L4YA 1V8BA 2N05A 1CZNA 2L2QA 2OCCB 1T0BA 3E6AA 5B2FA 3HSYA 3JQCA 3TQHA 3C7TA 1ZL2A 2J5XA 3GOHA 4IYRA 3ZIDA 1XNRO 2CL6X 4K88A 3GRFA 2A67A 2X0RA 4QFDA 1D7OA 4XQEA 3ND8A 5K99A 1CEQA 1IZYA 2D3TA 5LN1A 3JQDA 4FSDA 2C54A 3SPXA 2OTJV 1U3CA 3H2JA 1L5KA 2RHRA 4BPRA 1BIFA 5EE9A 3RRXA 5FHQA 3QSYA