3JAWB

Atomic model of a microtubule seam based on a cryo-em reconstruction of the eb3-bound microtubule (merged dataset containing tubulin bound to gtpgammas, gmpcpp, and gdp)
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
429
structure length
429
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
molecule tags Structural protein
total genus 145
structure length 429
sequence length 429
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jawB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jawB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jawB01
5EZYB 4EI7A 3N2GA 4X20B 3RYFA 4ZI7A 5JVDA 4O4IB 3M8KA 3R4VA 3JAWB 3JALB 2BTQA 4I4TB 4O4JB 5CA1B 5FNVA 4EB6B 5LP6A 3HKEB 4WBNB 5J2TA 2RHJA 3JASA 4IIJA 1FFXA 3E22B 3N2GB 3RYFB 4ZI7B 5ITZA 4DXDA 3HKBA 2BTQB 4M8IA 2VXYA 5FNVB 4X20A 3M89A 3HKCB 1W5BA 1W59A 3RYCA 3JASB 4IIJB 5M7EA 1FFXB 3HKEA 4YJ3A 4O4LB 1SA0A 5ITZB 3N2KB 4YJ2A 3UT5A 3E22A 2RHLA 4O2AB 5EIBC 4F6RA 1W581 3WGJA 4XCQA 4I50A 4DRXA 3RYCB 1JFFA 5CA0A 3HKCA 4E6EA 3HKDB 4YJ3B 1SA0B 4YJ2B 2R751 5LA6B 3UT5B 4KWEA 3RYHA 4O4LA 3N2KA 4X1IB 4I55B 4F6RB 5IJ0A 4I50B 3V3TA 1Z5VA 4DRXB 5LXTB 3VO8A 3VOBA 4U3JB 1JFFB 5CA0B 4O2AA 4FFBA 5CB4B 5MN5A 2Q1YA 4B45A 3C8LA 1W5AA 5MN4A 3RYIA 3HKDA 4TUYB 3ZBQA 3RYHB 1FSZA 5IJ0B 3VPAA 3ZIDA 5IYZA 4X1KA 5LA6A 2RHOA 5JH7B 5J2UA 4X1IA 4I55A 4FFBB 1TVKA 5LXTA 5IJ9B 4U3JA 4LNUA 4TV8A 3RYIB 5LOVA 1OFUA 4U39A 5CB4A 5JQGA 4TV9A 4EI8A 5JCOC 5IYZB 4X1KB 3WGMA 2BTOA 4TUYA 2VAMA 3JAKB 5J2UB 4HNAA 1TVKB 3RB8A 5JH7A 4LNUB 4O4HB 4TV8B 5KX5A 5LOVB 5JQGB 4TV9B 5C8YB 3WGLA 5IJ9A 4X1YA 3VOAA 3CB2A 5KMGA 5EYPA 3WGNA 5GONA 2R6R1 5LYJB 3WGKA 1TUBA 4HNAB 2XKBA 3JARA 3JAKA 4O2BA 5LP6C 4ZHQA 5KX5B 2VAPA 1W5FA 1RQ2A 3JATA 4IHJA 5BMVA 2RHHA 1W5EA 2Q1XA 2VAWA 4X1YB 4O4HA 5JVDB 5MN6A 3VO9A 4ZOLA 5KMGB 5EYPB 5JCOA 5GONB 5C8YA 4B46A 5EZYA 4EI9A 1TUBB 4O4IA 2XKAA 3JAWA 3JALA 3JARB 5LP6B 4O2BB 5EIBD 4ZHQB 4I4TA 4O4JA 1Z5WA 5LYJA 5CA1A 5J2TB 3JATB 1RLUA 4IHJB 5BMVB 2GVIA 4EB6A 3ZBPA 4WBNA 3HKBB 4ZOLB 1RQ7A
chains in the Genus database with same CATH superfamily
4F4LA 3O3NB 4TYWA 5E4FA 1VPLA 4UTRA 3Q85A 2A33A 1BU5A 2PYIA 3V4PB 3BZBA 3WWCA 5JXIA 1PVOA 2XAAA 5I7WA 3X44A 4LWQA 4HRYA 3LZCA 2R96A 3HXMA 4G6ZA 4Y9SA 2MYPA 1KO7A 3ZX5A 1YMVA 3G7NA 2ZSBA 4WCFC 1JQ3A 1Z5GA 3NK7A 2C7PA 2IODA 3ORYA 3TSCA 1GXSA 3NJ4A 3VU9B 4YRIA 1JYFA 3WB0A 4XUGB 1T5OA 2ZIVB 2E3CA 1IZ7A 2VSOA 3L02A 2VP6A 1XBLA 4QPNA 4F86A 1T1EA 2JNBA 3I1JA 3FNBA 5I7EA 1UUFA 1LTHR 2VSXA 1K6EA 3KO8A 4YRMA 3U11A 3K92A 1YQWA 4R8SA 5KAIZ 2Q6LA 4D3SA 3BJMA 2FP4B 4EF4A 2CN1A 3NCTA 4EFLA 5FOTA 2RMKA 2CAZC 2PBLA 1EXNA 4OUDB 2E89A 1HNXB 3AV0B 3D3WB 3TO5A 1AG9A 4KGVA 3WIVA 5BWMA 1AKVA 3PQ7A 4CLRB 1B14A 2C99A 2VFAA 4NOMA 1BEZA 1WAMA 4ENRA 2BPOA 3RADC 3A2KA 3HR0A 1QMPA 4EHKA 1VQPF 1LJLA 4MDFA 3RO7A 3PKZA 5YASA 4JPRA 1T25A 3OSZA 1BRTA 5KYGA 4EKWA 3FLAA 2FPKA 4G1CA 4X1KA 3GUVA 2QUBA 3S06A 3GK3A 4KREA 3TOCA 1DAEA 4GXQA 3G2QA 3JD0A 1N2CA 1XPRA 2Q2WA 2H2GA 4BUJA 4URHA 5JNUA 1MRZA 3D6FA 3VPSA 2AYXA 4DIMA 3ZG6A 4R7CA 2R1VB 3HUFA 2QM7A 2R68A 5GJBA 2NQ2C 3FRIA 3VTAA 3JQBC 3UAOA 1YHZA 4F4IA 2YWDA 3P9RA 2QM8A 3DDHA 2I7XA 3O8RA 2H8CA 4HFRA 4X65B 3L0BA 3N9IA 4J42A 5FI1B 4DR3O 3NKFA 1TC1A 5FL3A 4FZ5A 1CZNA 5TMDA 2XTAA 1TIKA 2HCFA 3A32A 1XF9A 4Y2QA 3H6KA 5AJTA 5B1SA 1CTQA 2C2MA 2V7QD 2JI9A 4Y1GA 4O08A 1OLXB 3FPGA 2PQ2A 2GEDA 1NWHA 5F3WB 1I3CA 2ALEA 2QRMA 2OQVA 4G0OA 3KZMA 4NYIQ 1I7DA 4X6UA 1QP0A 4O4HB 2QTPA 1VOTA 4K9PA 2WSSA 3OIWA 4QGPA 1V55B 2NYRA 4M1TA 1TPYA 1UP6A 2CVFA 3BFKA 5FLXN 3NB0A 3G8BA 4BTEA 1DCFA 1CUAA 1BCRB 1Z13A 5DM2A 2VYQA 3HLYA 2Y6UA 3INNA 1FS4A 3SC6A 1GTZA 5IASA 2QMZA 4IDPA 2OC9A 5DB4A 4MCHA 1FMTA 3LWVC 1LNZA 3CEPB 2FETA 3V7QA 2WVHA 4V39A 4J0HA 1YQNA 2WIDA 3H65A 4LKRA 4IGFA 5BR4A 1DCMA 1P0PA 1VQ7F 3SR0A 4P9NA 1PFUA 3U7JA 3AUTA 4CR7A 5F9MA 3LXRA 1NFFA 1CDDA 1XMOO 1GRCA 1KK1A 4JMPA 4TQ9A 3W2IA 4M1YA 1TF5A 2ADQB 1Y3AA 1L7AA 1PG0A 3NEAA 2SCUB 3RS8A 3QA9A 1WMFA 3CM0A 3DKVA 4FC6A 3D3NA 2JCBA 3I9OA 3EQ8A 3UCSC 1EFRA 3ROTA 2LRHA 1K8ZB 1GGJA 2BFDB 3P3NA 2BEUB 4Z6KA 1IPHA 2J33A 4FHCA 3BXXA 1Q0TA 6PFKA 1VL8A 4Q4HA 5AVUA 4HLQB 3PFNA 2IYWA 3FFQA 1XYVA 2NO6A 1L4UA 5CDTA 4M0LA 2PK3A 4UC0A 3PGLA 3GY0A 2ST1A 2IYZA 4ZBMA 3K57A 4GPZA 4ZT7A 2BI4A 4MWSA 2R87A 2NWQA 1A7AA 2SKCA 3E1SA 1ZGGA 3RWBA 2W2VA 4LRSB 1E2NA 4OGWA 5AD1A 3WSWA 3CXCU 2CT8A 3TGPA 4DV3O 2ZJ4A 3TZQA 4BCCA 1KZ9A 1NT2A 1EG2A 3VR6H 2WTAA 3G5AA 1EGMB 3TJRA 1JAXA 2XUDA 5I9BA 3GF4A 3IMKA 2CZWA 2W2PA 1WVIA 1Q6YA 4NBRA 1JFVA 3GD5A 1M2WA 4KHPO 1P5ZB 3SQOA 3K5IA 3SHOA 4DV2B 4MUYA 1BW9A 1S3GA 4JBWA 4FEAA 2MR5A 3QE3A 4MWZA 1MKYA 1TVCA 4RM3A 5EA2A 1NJ1A 3IQZA 2JCVA 4YV0A 3UK1A 3GAFA 1A2BA 1STOA 2EBUA 1WW8A 2WILA 1X13A 3QUAA 1GGEA 4YRTA 5ICGA 3LPDA 3EA4A 1J20A 5LXTB 4RF4A 4ZJPA 2WLLB 3ORHA 4OMDA 2Q1YA 3PGVA 3CCMV 7MHTA 3H0EA 4GBJA 3EPKA 4W1SA 3SG0A 1RE1A 2CVQA 4H7HA 2VAMA 1OX5A 1II8B 2C7BA 1QCDA 3LZDA 5KHAA 1QR6A 1E7RA 1BSMA 2IZ1A 2FMUA 2UZ1A 5HIJA 2C9YA 1KUQA 1DX6A 3H75A 2O4CA 4Q9DA 1I0LA 3AG1C 2O06A 4TV9F 3A6HA 1VF6A 1JIUA 1NLFA 2KBFA 1NBIA 4E51A 5KDOA 5EO3A 4LF5O 2QENA 3BPZA 2BOBC 2WOJA 1TRHA 3B12A 1CJVC 4GX1A 4RFSB 2I66A 4GXRA 1R5NA 4L78A 3JWJA 4BY9E 3P4EA 5EY5B 1UBKS 4ZV7A 1E2MA 1VE7A 1JBEA 3GAMA 3IC5A 3CINA 3COWA 2V7QG 1QZZA 1YFLA 2IVZA 1XMQB 5J5CA 1SWVA 3DZBA 2RHCA 1IZ3A 1T5LA 4RL4A 2IP1A 2KG7A 4F9GA 1EWQA 1SUFA 1HKHA 1ULZA 3FPLA 1LC3A 4Q4JB 3AEKB 3AM3A 2B4AA 1TU3A 1VSQA 1Z6PA 3IUJA 2F43G 5IS2A 1MABG 1SXGA 2WFLA 1ZIYA 3UOAB 2RG7A 3DEIA 3ND5A 2XWQA 3KJNA 4TLDA 1DUSA 3N0XA 3U4DA 4OEHA 3HZZA 1XTVA 3CO0S 4IINA 1Q0HA 3MTGA 1JAYA 2JFYA 4Q1CA 2WABA 1XQ6A 1JXAA 4DXWA 1Y37A 3MWEB 3WMGA 2RAFA 4MVJP 4FT4A 1KYZA 4AT1A 1IM5A 3T4DA 5J1TB 1XHLA 3I62A 2NN3C 4ABTA 2YCLA 3ZRVA 5PGMA 1X9GA 4UEOA 3QOXA 3CF6R 4DAEA 4U2FA 4JLAA 2A0WA 4IHAA 5L51A 4F85A 4HDKB 1X9HA 1O89A 2OHVA 3KB1A 2WNIA 3IVAA 5A6SB 5TXGA 3NX4A 3M6LA 1RVDA 2ODPA 1R3UA 3EXIB 4B7AA 1LRLA 1KMQA 1SEPA 2BL4A 2GHIA 3GJXC 1ZHHA 3BMCA 1E9SA 5KU1A 2P9GA 1W19A 4D9HA 1KYIA 3JVEA 1AS2A 1K6MA 1Z7GA 4JKIA 1VB3A 1DVRA 1CS0A 3FDZB 3WGOA 2ZVQX 1Z37A 3Q7TA 5C4MA 2D6FA 5JMOA 4O4IF 4HGPA 4XGNA 3LLMA 1FC0A 3FGZA 3RT9A 1EHCA 1Y9DA 2YI8A 3NZEA 3VPHA 1PYDA 1THGA 1Q74A 4C0HA 4HTFA 2BP7B 4YRLA 3NCHA 2J30A 3DTTA 3JYOA 3IBFA 2DVMA 1ZUNA 3RC3A 5KPJA 3A26A 5EEHA 5TVKA 4MQBA 5EPUA 3E61A 4FXOA 2JEUA 2H1RA 4G8DA 2ETXA 3IEXA 3MINB 3RUIA 5IZCC 2DR3A 3H18A 1E2GA 4RCVA 1RC8A 3T1QA 4JI2O 3E8BA 2O8EA 3R6TA 2P0YA 2FK7A 3BH6A 4TGLA 2PWAA 4DC0A 1OCCB 1Q1NA 1KI1A 1MUUA 4JA0A 4ANFA 1XEWY 5ER9A 3N7AA 5BSRA 2A1TS 4EPRA 1O4VA 3D6VA 1O94C 3JY6A 4A8JB 4YXFA 2K1SA 4CIAA 1B04A 1K3TA 4LYEA 5CFMA 1TUEB 4E4EA 4CJXA 3W6NA 1ITZA 3KQWA 4M1EA 2C1ZA 2OGUA 3VQXA 4DUYO 4N76A 1FFHA 5LZ2A 1TMKA 3CBQA 3UHAA 5DWQA 1H3FA 1XZJA 4KQEA 1VLMA 2B4RO 1OF1A 3AR4A 2NUTB 2Q68A 3O8OB 2UZ4A 3M49A 2F1OA 1KA9H 4X62O 3QE0A 3S29A 1H94A 4NR0A 3U4CA 4BT5A 3E0QA 2R8RA 1ZH4A 1UPXA 3QYPA 4XYGA 2JIZD 3JQFC 3OZFA 5LQDA 2D59A 1PDOA 2YC4C 3AVPA 1CUVA 2HADA 2JJ8A 4RE6A 3B2EA 5B2EA 4WCFB 1RPZA 1FP4A 4ZHQB 2ZRAA 4F4CA 2WU4A 3J81A 3HBMA 3ANMA 4AZ0B 4RAQA 4JNKA 3SBXA 3R23A 1L7MA 3Q87B 5A2GA 7YASA 4B74A 3QIAA 5KYUB 4HFJA 3EGDA 4G8JA 4C87A 4RWEA 4LYAA 4JSTA 2M6LA 2HGZA 5GPBA 4MUFA 1KC8W 1PD0A 2LIVA 4MDEA 3WWOA 3KEQA 3E2EA 3RE3A 1OR8A 3TXAA 3WMRA 1BOOA 1C9YA 3D3JA 4M37A 1ZVJA 1AMOA 2CW5A 1OJLA 1ST3A 1N32B 2VOJA 4LG1A 2VYND 2N48A 3W7WA 3IFXA 3I39X 1YUBA 2X0JA 2J46A 1XL4A 4F56A 3OQPA 1EX7A 4IXTA 5K51A 1OSNA 2XUHA 2PNFA 4L0MA 3SYOA 1SZCA 4FD2A 3E48A 4RK4A 1QO0D 3DD1A 3N6VA 3IUEA 4AF8A 1DWQA 5IAOA 3U80A 3DVSX 4PTYA 3S5UA 2W6ZA 4ZO9A 3FDIA 1SEVA 2X8JA 3SJBA 3OFJA 4GM0A 2ZWIA 4NJEA 2ZDQA 1DOAA 5T4EA 1IK6A 5IT9M 3FOBA 2BMDA 4JGIA 3G9XA 3QXHA 3NDJA 4MICA 5LJLA 3GFRA 3OQIA 2GF9A 1QH8B 1XQXA 5HKOA 4IX9A 3SDZA 2NZJA 4PBTA 3K59A 1QF9A 2OUKA 1K98A 3D1JA 3PLAE 5I4KA 3J7AC 3BK7A 3BGWA 1RZVA 1D2CA 1M0WA 2LBWA 2X1LA 4PTZA 5EP3A 2C42A 1O5TA 1XFAA 3U1VA 4WVFA 3OT5A 4Q9AA 4KFCA 3U48A 3QBJA 3COPA 1H9BA 4G97A 1JMKC 4IIDA 4S0ZA 3CLUD 4UOEA 5C9ZA 4QELA 4RD1A 5DFAA 4DQVA 4WY2A 1SELA 5U4XA 5LZ7A 1DC7A 2R6FA 2R9RB 2XAHA 2WJPA 3N2GB 5HMMA 1YTFD 4KH1A 5F7ZA 1RWQA 4PICA 1W29A 4PGHA 1QTIA 4YALA 1Z0SA 1C30A 1HC7A 3MWGA 1XMPA 1MH9A 2II6A 2QG4A 3ZIUA 1Q3HA 1RJ9A 3ABQB 4IKEA 1FFSA 5LZ4A 4XASA 2YNMA 4LZPA 4TQFA 4PI2A 1MJGA 2QTFA 2Y1FA 4CQJA 2IUYA 3C5EA 4X95A 3AF0A 4P5DA 1DDGA 1MX5A 3E8XA 2AVDA 5BN4A 3EN0A 5FPRA 2P9EA 2P41A 2AN1A 1ZQ9A 5NLLA 2W2XA 4RZXA 1TT7A 3PGMA 1YMUA 4TROA 1DXQA 3M99B 2P4KA 3NYQA 3WWDA 3SF8B 2J7KA 1GGHA 2PCLA 5D3QA 4QUDA 2VF5X 1BQEA 1L8XA 3HZHA 1H2KA 3SPHA 2MYUA 2WC1A 4R8CA 1A2KC 4YN3A 1OAKA 2BHNA 3UV7A 2GBIA 1KEEB 3F4BA 5D84A 3ZH9B 4DNXA 2BR3A 2E4VA 4YFVA 3UWMA 1UT8A 5FPHA 1XZEA 2UKDA 3MT8A 5A7GA 1NVWQ 1I6WA 1P2SA 2ZE7A 4KVGA 3JQ9C 3OE7G 3ABIA 2MHCA 2D2XA 3B09A 4P7JA 1T0JB 4KO2S 4W99A 1UBHS 3LY8A 5J2UB 4GYYA 3SZRA 2ZT7A 2EJVA 2IH4A 2JJ2A 1LCIA 3AF4A 2G9VA 4P2ZA 2JIZG 3DCJA 2VT6A 2JG3A 4FGUA 1NJIH 2ANCA 3DE4X 1S5PA 4GDFA 2QZZA 4FQ7A 4LX8A 1GGFA 5KJ1A 1SNYA 1W88A 4CKYA 4M99A 2R0QC 4I6EA 1HR0B 3KKLA 2IP4A 5KX5F 2DHDA 1L5MA 2R1UA 1Z2CA 2H9YA 2BM9A 1Y3FE 4FYYA 3WQQA 4FGZA 1KU9A 1DT9A 4DB4A 2ACKA 4QUJA 3REGA 2ADMA 1R9MA 5DNUA 4NYKA 3SKVA 4HXGA 2QAGC 3NUZA 1C9JA 3J80M 2HH9A 3M3PA 4M8SA 4Z9AA 4C08A 4LFBB 4M0MA 2H7YA 4CLEA 1PFYA 2OWDA 2QEQA 1KYWA 1OT5A 3CISA 3FLBA 2WPDD 3AIIA 1HE5A 1U5BB 3EMVA 2XTNA 3ET5A 4DG9A 4EITA 5IEBA 2ZIAA 1WQ4A 1VBFA 3PTLA 4D7TA 4AJLA 3A1CA 4RJKA 1P7WA 5BOSA 4MGKR 4NE2A 4FDVA 5LYJA 2BMFA 4IDBA 1T6BY 1SHJA 3MFQA 3RC7A 3P5BA 3HL0A 1QR2A 3QELA 1PQWA 3FPFA 3O5AA 2FHSA 1WHSB 4WOPA 3Q0TA 4F2WA 4Y2PA 1VCHA 3FIJA 1OXTA 3HVIA 4NBUA 3M4XA 4TMKA 3NAMA 2V7TA 3ESBA 1PR5A 4OHKA 4TKVB 3NJ8A 4BVLA 2DPGA 1USIA 3AG1B 2W2OA 3OLXA 5E4TA 3QLJA 2C82A 4L5AA 3FNEA 4KQFA 2QTWB 2YMQA 3LQQA 3X1DA 3CCSV 1KIFA 4PLCA 1TZ2A 4EJ2A 4WINA 4B84A 1O87A 4IJKA 4UQOA 1SQSA 1SZXA 5AUNB 1RYFA 3NOOA 3G3EA 3TTXA 4NCKA 1DAOA 2RBKA 3OONA 4KE8A 2W2LD 3ZHYA 3JATA 4J0QA 3G7SA 2YIAA 5CD9A 4O2BB 2TSYB 2ZI7A 1JI0A 1QUFA 3T7SA 4JAUA 4MJ3A 1E2DA 3HFGA 4QGAA 3RRXA 1NASA 4GG1A 3B52X 5DWVA 2ZBGA 2L19A 2O59A 1GARA 3NORA 3IALA 3TW6A 5D3MA 2EOAA 4L8FA 3KKPA 3O9MA 5AK6A 3BSFA 3PJGA 2Y1LA 1S2NA 1LZKA 2LW7A 1RZUA 2BCGY 1E4VA 2FSHA 4J3FA 2VHYA 3DOFA 1NE2A 5KUKA 2AIZP 1FDVA 3FNRA 6REQA 4NHEA 1PD3A 4FK5C 1X19A 4DK0A 1E2BA 4PZ0A 3JCZA 4J8PA 3NBQA 2GPBA 4EKIA 1ZJJA 2Y05A 2JFUA 1OTYA 4JELA 2DUNA 4CV0A 4MK4A 4OF4A 4C6SA 2LCQA 3DDOA 1XRGA 4J75A 2OBNA 1DEAA 5M3BA 2YY7A 3AVWA 1IHYA 3ZGOA 4FE7A 2X6CA 1ONNA 2ZE8A 2P40A 1XELA 4OX9Y 2IXAA 5JMWA 4GX2A 4EVQA 4FLFA 4X20B 4ND2A 2C9MA 2IHZA 2BSAA 2PTHA 2GLUA 4DXDA 4BNYA 4CCYB 1YZKA 1QZUA 2Z4SA 1ZH0A 4KQIA 2E4YA 2MTBA 2EZ8A 3BL6A 3R0VA 1J09A 1J2RA 4X8HA 5A1JA 1ORIA 4KO4S 1EGHA 1NYRA 2XYVA 4EJSA 3M4SA 1LBIA 1OWOA 4FONA 5FULA 3GLGA 3ISVA 5T6BA 1V11B 2ZT5A 2VATA 2VPYA 4MW0A 1FLNA 1PT9A 3JPYA 1OFUA 3CEJA 1EM6A 1UAYA 1ZR2A 2YN2A 5K0TA 2FF5A 4LDAA 2C2BA 3WA7A 3VMFB 1P0FA 3K6SA 4JH0A 2ZIXA 3G79A 3TM5A 3VGPA 2PKQO 1D6MA 1V8PA 1PFWA 4QD3A 5F33A 4DMUB 5IXYA 3BIFA 4IQ0A 2N75A 1P19A 1YQXA 3EGIA 3VSAA 3W3AA 3NR7A 2WG1A 3PGJA 1QGZA 2GI4A 4MA4A 3UT0A 4LGCA 3UYLA 5H6RA 1XHZA 1QORA 2BGKA 4JQCA 3LDEA 2CXOA 3SDSA 4QXQA 1YZQA 4WFGA 2A4MA 2IK8A 2WU3A 3TXXA 2YY6A 4AJHA 5FTNA 2HRUA 5ARCA 3KAKA 1OCOC 5JDIC 3K9WA 3HI6A 1U8XX 3BKXA 3ZU3A 1YRQA 1SUAA 3DO6A 1R6DA 4XIFA 4D7SA 1GVNB 2C0CA 3CRNA 2ROQA 2Q4RA 2ZE6A 2WPDG 1K5HA 4I4LA 5DCVA 1IDN1 4CEIB 4DR1B 1YZLA 2YHBA 3DMDA 2OZLA 4EENA 3FB1A 2CUTA 2DUJA 3T4ZA 1IXKA 2BM8A 2PO7A 3OLWA 2NO5A 2XVZA 2J0SA 2AHYA 2YYZA 4QXAA 1OH7A 3CN7A 2EX1A 4M0UA 4EI9A 1JJIA 4Y1FA 1Z83A 2C20A 3M70A 1G6Q1 3KKYA 2OVFA 4C78A 1E66A 1A69A 3AETB 3Q7SA 1K5DA 5KNBA 3GU3A 1XJ0A 5ALZA 3VR4A 5B6IA 3BD8A 2JAXA 4GKAA 4B6RA 2E6UX 3G82C 3JX9A 3I42A 2Z95A 4F5DA 3HXPA 2WMOB 3AERB 3V7UA 2HNKA 3QMPA 4G5GA 4JASA 4YPOA 4I9HA 4D4HA 1B8PA 1NHGA 4L27A 4F8YA 3LT0A 5KHIA 3RJ9A 5IKOA 4P93A 4XVQA 2JEOA 2JFXA 4Z7NB 1PUXA 4LW8A 5JAUA 3D1LA 4NRDA 4HDNA 5ARDA 2YZ7A 4H37A 1IL0A 1OFGA 3FF4A 1QNMA 3EGVA 4D97A 4CIWA 3FUCA 4I7ZB 4JYAB 1QG6A 4QOSA 4CTOA 2WSBA 3SQLA 3I5UA 5LYYA 3L1HA 4C7KA 3N86A 1JBQA 4EKEA 3PFWO 4U3FH 5IYZF 5DM1A 3QVNA 4ZTUB 4DV7O 5AKIA 1CRWG 1YDXA 4C88A 3WRXA 4UPEA 4PC2A 3F2VA 5FOQA 1Y8ZA 1FNMA 2HTEA 4WBNB 1X6VA 1M72A 1GO2A 1V1RA 4PYKA 2AOWA 3TG8A 2D1FA 2QQEA 5LQNA 1CJKC 1P2GA 2LTAA 4FKBA 1N5KA 1S02A 4R1QA 1F4NA 1G8KA 3DHWC 1N4CA 4UMDA 4GLJA 2QQ5A 1QZ3A 4UCOA 1ZGHA 1XZAA 1TK9A 2MSKA 3ASVA 2BH9A 1XVAA 2ZRKA 3ZLBA 2P30A 1DKMA 3RCBA 1VG1A 4ZVTA 4TWIA 3KQPA 4DBZA 3GLHB 4L15A 2VHUA 4EYQA 4YROA 2CCKA 2BR5A 1R74A 4J29A 2H3EA 5IKEA 4C0LA 1HDCA 4RABA 3TRIA 1NRXA 2OFFA 3NWOA 4MV6A 2XAUA 2CZCA 1OXSC 1OC2A 5TQ0A 2RGCA 4FLVA 1T2FA 2PS9A 2QR3A 2CXPA 3EGXB 2H7VA 1CDZA 2EW8A 5AM5A 5IW8A 2IPMA 2R70A 2AZ4A 1NNSA 2PHZA 4J6EA 3EQ2A 2QA4V 2ZPAA 2J5QA 2GZDA 3RUAA 3KUUA 5A3SA 1C1HA 1N0VC 1ZIPA 4UM9D 2HRYA 4RKEA 2RH4A 4MJXA 4DLKA 2CUGA 3ZU6A 1PS0A 5ILOA 5ERYA 2W9XA 3NHWA 3WJPA 2DYSC 4XD2A 4AJKA 3G5LA 5HILA 5E1OA 1HL3A 3E20B 5EJ6A 2ZWMA 4BHTA 1B6RA 2JLAA 1SZDA 3UW3A 1H93A 2FWIA 3B1FA 3HB1A 4Q7KA 1QJ4A 1N36B 1A5TA 3MJVA 3IR7A 2W8BC 1RE0A 5FRDA 4R1NA 1QYVA 4KOEC 4C1NA 2R7MA 3PV0A 2A9HA 3BC1A 3LGSA 5HBRA 2AV6A 3O38A 4ROTA 1CXZA 1SU7A 1I4LD 2ZBVA 1WG8A 4HUTA 2Q67A 3L8EA 5E38A 4OL0A 3V1KA 4MW2A 3I55F 4PFJA 3BXEA 3K72B 1QUEA 1NBMA 3G4SF 1NS1A 2WOOA 2I6RA 4Z5XA 5A03A 3R0XA 5CGQB 1JU3A 3OOWA 3WSTA 3IEWA 4OBWA 3GMTA 4TOIA 1RLOA 2GCOB 1NQTA 1FUIA 2WA3A 1PSDA 3DE2X 4IGEA 2QRVA 5BORA 3KQTA 3LWDA 3MCTA 1PS9A 1THZA 3GNQA 4OXKA 1TTQB 1RNLA 1K2WA 3AI7A 1NIJA 4GZRB 1P7CA 4KWHA 4ND8B 2V5VA 1R66A 3FVVA 2XDAA 4AICA 3F6RA 4B87A 1PJCA 1AZSC 4Z8XA 4G5HA 1YFJA 4M0KA 2W4IA 2PAAA 3DFFA 1DHTA 2J31A 1KI6B 1Y4DE 1L4GA 4ZGGA 5EMNA 2FPXA 4DYVA 1YVPA 1YE3A 4WGGA 4PXAA 1GNPA 1QH1B 2WLNA 1VMAA 1US8A 1T4CB 3FCSB 3HUDA 2O8BB 1F8UA 2AI1A 3L6DA 2UXDO 1XEWX 1QCZA 3KQUA 1MLDA 3IQIX 3ILXA 4BDTA 1SBQA 3AJ9A 4DBLC 5DIZA 5EZ5A 3BCUA 1NDHA 1JU9A 2GV9A 4DR4B 4LHZA 5BSVA 2B2NA 2DLDA 3F0TA 2GZ3A 3I2IA 2J09A 2R8PA 3S40A 3JZDA 4I0WB 4WLNA 3ZI0A 3RK1A 1HLPA 4V24A 1EGQA 5JDCC 4OQNA 3N70A 1HT2E 4RZUA 4DJJA 1OI2A 3HGTA 4YCBA 2ABWA 5ALUA 1KR5A 3K5OA 3KUXA 4TQGA 4MW4A 1HDGO 2D3WA 2OR3A 1VMEA 2ZB2A 4I5DA 3W3ZB 1WJGA 2OCXA 1WMDA 2G82A 3M33A 1ZD8A 4XX1A 2Q3DA 5BSWA 2QTVB 4FYIA 4CIDA 2M6RA 3D0RA 4GI2A 3LSQA 4O5OA 3UCFA 5AHKA 1UI9A 3CCRV 1GUBA 3BQNB 3A1DA 3UH0A 1X8XA 3C3KA 2GXAA 3JYPA 1O3YA 4WJKB 2WWRA 2XZPA 4N5LA 1M67A 3K03A 1XTUA 1PU2A 2G09A 3P19A 4HPJB 3GZJA 3DC5A 5JS1A 1Q81W 1J5EO 2V0CA 4M1OA 4YMLA 3CRZA 3RSQA 3R1IA 1YF3A 1CLUA 1T0KB 2FUNB 3FGPA 2DRIA 4QE7A 4G07A 3ZBUA 2PH7A 4RTOA 3K6RA 4TS9A 4P53A 4ZVUA 4JLOA 4XCXA 1Y3HA 4E2FA 3G9ZA 5TF0A 1EDBA 3D8RA 3OBIA 4DV5O 1Z56C 1P6XA 2FNAA 3GR6A 3BAZA 5CBPB 4M9CA 4U7WA 1VSTA 2UYOA 4PR3A 2JGDA 5FYDA 3K9AA 4IYJA 2VN8A 3A3KA 1E60A 3HRIA 3N27A 5K0JA 3ZCQA 2ZI6A 2IH1C 2OILA 5HJ5A 2G7MC 4MW7A 1BCCH 1C14A 1BH2A 1N2IA 4R0MA 2PXXA 2A9VA 1QS0A 1VZ2A 1XCPA 1JJVA 4M1ZA 1BX0A 3B48A 4FIPC 5A5FA 3J81M 4L6CA 1HKUA 1U9IA 1BMFD 2CNWD 4EI8A 2DB3A 5JADA 1RJGA 2VK4A 3R7SA 4LJLA 3CR7A 5CGZA 1ETUA 3ROEA 1JOYA 4II2A 1ES9A 3DOCA 1EUZA 3E8MA 4UTVA 5DTEA 3Q2OA 4ZOLA 2C78A 5CU7A 4B3TB 4NV3A 1CE8A 3VO8A 3NBKA 1I24A 3B85A 1P31A 1WA8A 5F1OA 1WSAA 1C3OB 1SVKA 3Q2KA 3CVOA 2Q29A 1YVDA 1BROA 4EFEA 1O6CA 5KYXB 1HQCA 4F4FA 1Z0IA 4ZDWA 2AEMA 1QCCA 3F7OA 4BLRA 4DC9A 1S5HC 3ICEA 3ZMZA 2P5UA 2VLBA 4OQLA 4E31A 4GPAA 5ESXA 2FFJA 3E82A 3MDSA 1E8NA 3BXZA 1BJRE 3T7TA 3MTQA 1G5HA 3FNIA 3M5DA 1WV0A 4IG9A 2C9BA 4FLTA 4QPKA 1ZKDA 3WNBA 5JTUA 4L51A 2R1ZA 5JQGA 1IHUA 3TSWA 5H59A 3GPBA 4B6QA 4TV8B 4C4TA 3ICXA 1ZIXA 1TW3A 4DMMA 3TLBA 2YUTA 3IT1A 5DYNA 4L73A 5CX4A 2GNPA 3E2IA 2QVLA 4GI1A 4M6WA 1HX7A 5FHQA 1NI5A 1M0SA 4ZQFA 2E5LO 2QN9A 5BO5A 3U61B 1FMCA 4M7PA 1YR9A 1JA9A 4HLCA 3UPUA 1R6KA 1ZSPA 3LT1A 5HKKA 1WMBA 1J9GA 2V4UA 3JVDA 4N0PA 5LP6F 2CNLA 2XE7A 5LLTA 1YRWA 3JAMM 1U28A 4BLQA 2E82A 4YIPA 2WD7B 3DSRA 4LJ9A 3RKSA 5B7PA 3GGSA 1ZD9A 7REQB 4B5KA 3LECA 5JMTA 4DNPA 2RKBA 5J2TF 3IXMA 2YS6A 4AF7A 1GG5A 1IXMA 4NI5A 1BS1A 4G84A 2DCUA 5AESA 2VPIA 1TD9A 4NZNA 3IHLA 4WA7A 4LFAO 4KPUA 8GPBA 4OXSA 2HCBA 3GCZA 2ZCJA 2QY9A 1D09A 4CMIA 1XBTA 2IE8A 1LQTA 4DA6A 4PHZA 3OPXA 3L6BA 1QF7A 5GP1A 2QLMA 4DOMA 5E2IA 1GPAA 4WRRA 2IW3A 2LR0A 4Z3DA 5LB2A 1K66A 3WYCA 1VRWA 3HUUA 3DDCA 1FVOA 5TC4A 2QPOA 4B4UA 1G7RA 3VQVA 1E0JA 4BBPA 2RHWA 3EMBA 1MJGM 5EFOA 3DHNA 1Z5NA 1J22A 4DIOA 1EBBA 1S2LA 3K0AA 3P30A 2GJ8A 5I7FA 3CLUC 4KH0A 2AXQA 2BLNA 4U7OA 2OA0A 1NVPB 1II9A 1E2QA 2KLHA 2YRWA 3N8DA 1VLLA 1NV8A 1QPBA 3DXRB 4TTAA 3TKLA 2Y0DA 1BCSB 1AK9A 1O6FA 1HPLA 2F43B 1GN9A 5IJXA 5A9SB 5JD4A 5AXBA 1MABB 4UOZA 2ORWA 2PIDA 8AT1A 3X3HA 3CMCO 5H0IA 1USKA 4LOKA 3GVXA 3OJFA 3AW8A 4FJ1A 1PEAA 1FYEA 4DILA 2BBSA 2X0FA 2ZRFA 3IQFA 4GL2A 2XY4A 4INPA 4PX5A 3B6IA 3HYLA 4DR6O 2C58A 4V0MA 1JKMA 4YYEA 1W0KA 4HH3C 3PLRA 2FTKE 2NU6A 3WGHA 4HGQA 1JHXA 1AE1A 1FXWF 3HO1A 5AVVA 4NBWA 2JCYA 3CCUF 1B6QA 4JJFA 1LFAA 1NUTA 2HU2A 2QR5A 4UASA 2FMIA 3OP1A 4OQEA 4UARA 3IBCA 3MEQA 5ELMA 1QDLB 3I9KA 4INAA 3I8SA 2JI7A 1NJ8A 4FWTA 2XWBF 5C2JB 4UHKA 4XWOA 4PYRA 1HRKA 2CB9A 5E2AA 5CLFA 2VHQA 1KFCB 1NOKA 2C77A 1V41E 1Q7RA 4O0LA 4LJSA 3CD6F 1KK2A 1B0AA 1PUJA 3CHYA 2R66A 3HY3A 2PXCA 4BE9A 3FAKA 3TEJA 5KTNA 2AR9A 3GJQA 2R47A 4QOGA 2D0DA 4WF9V 1E3WA 1WZ2A 3WKAA 3PBKA 1AJEA 2ISCA 2XJ4A 5C0OE 4LH7A 1B93A 4K0KB 2QU7A 1A9XA 1JPNA 3OM0A 3WZMA 3AUYA 3ZI7A 1GGVA 4WCDA 4KJZA 1JL3A 3EAQA 4XE5A 4BFCA 1AUPA 1I1OA 1Q7CA 2AJCA 3ZLJA 2BSKB 5DEDA 2F93B 1LDMA 3ZVNA 2E18A 4AXBA 1BVRA 1UWVA 3DP7A 5BRJA 3QU7A 5IYBO 1IDSA 4NCBA 4D6XA 1PM9A 4HV4A 4MUBA 1WOMA 5EAZA 3UV3A 1Q22A 3STXA 4GGOA 2DYSB 2ZITA 3OCWA 5JH7A 5IMBA 5CMUA 2VJOA 5IJ9A 2BR4A 3EFEA 2YXDA 2Q4OA 2PJUA 3BWBA 2W2MA 2DFDA 4HYYA 4JLBA 5HMLA 1RJFA 3KSBC 2PD4A 4ZTBA 3L43A 4KI7A 5E9JA 5JAZA 3U4AA 4WK4B 1L5SA 2ILVA 4DJDC 4B81A 3GLSA 1RYHA 2HS4A 5BQXA 3TVTA 3F49S 1EQAA 2QJOA 4WFFA 4C6TA 3IIMA 2I67A 2BYTA 3U56A 3PIIA 3ADPA 3OSUA 5ESDA 3OVMA 1EUDA 4M0CA 1GU7A 2FUKA 1NQ5A 3D2CA 3V42A 3ZX6A 4KN8A 3UH1A 1AJPA 2VTBB 5HY2A 4V3CA 3JW8A 4DJAA 1XLTA 4MS4A 2AJTA 3GCGA 2UYPA 2NT3A 3KXLA 2P7HA 4QOJA 4DA7A 1DBFA 4KTTE 1VK3A 2R8ZA 3C98A 3T4UA 2W5UA 3MTJA 3PQ4A 1YITV 5IWAB 1A7UA 4RQUA 3AB3A 1OXUA 2R72A 1MAAA 1Q21A 1TVEA 4RFVA 2FQWA 4EGFA 2XRMA 3RIGA 3WIUA 5TGTA 4JITA 2W83A 2VR1A 1FS0G 4Y1RA 1J0CA 4AYXA 4O2LA 4NZZA 4N21A 3AF5A 5DN9A 1GZ7A 3IODA 1Y34E 3LKDA 5H4HA 3SVZA 3U4IA 3CMMA 3LK6A 3TFWA 3V2HA 4E4TA 3CRMA 4CIVA 3AHEA 3GBPA 1JEYB 4MKIA 3CJQA 1W59A 4RH1A 4HAMA 3P10A 4RV9A 3AONB 1NQVA 1U3VA 3X2QC 3KKMA 4F12A 3U9SA 2RHLA 4JZGA 3ZD9A 1TT5B 2FPGA 3SJZA 5C8VA 5JT1A 4AHCA 1SA0B 4P38A 4PWZA 3FJOA 3MM4A 4BWVA 1EFUA 1S4QA 1M1NA 4AL4A 4P4SB 3ZIAA 3V4RA 5DK6A 2IXDA 1VF5B 4DC1A 4UCQA 1FXVA 4FYHA 4EKDA 3K73O 2LCFA 4A5SA 1KQPA 2AMYA 3CC2V 4I9FA 3I61A 2O6LA 2G70A 3TRDA 3HP7A 2HD4A 3T1VA 1G8FA 3PGKA 2WYOA 1GIAA 5FBHA 3SIVA 3NOQA 2WHXA 1QP8A 2JLUA 4F46A 1XV2A 1TTTA 3CCCA 4OXRA 1HW7A 4UE6A 3G6WA 2PJZA 1PUIA 2ZTUA 1ZO8A 4QASA 4EK9A 4Q66C 1YCFA 2A9QA 1T9CA 2VP5A 1TX4B 3DOUA 3AI2A 4Q4AA 3WO0A 1HYQA 1A8HA 2OD2A 3EPRA 5JJJB 4KU4A 5KCZA 4RSRA 3RNOA 1JSRA 3ZW9A 4IYHA 4DWWA 5F2VO 1QIDA 2J41A 1OI4A 2HT1A 4R69A 3DDNA 4UBOA 5LHGA 2E4UA 1SJ9A 3ONFA 4HQOA 3ZMVA 1L5KA 3KU4A 4K0RA 2AUNA 5DSTA 5A71A 4MRAA 1MSWD 3ITNA 4LF9B 2CV1A 3R3HA 1P3DA 3ZD6A 2GCEA 1ZDMA 1QOQB 1M2GA 5LDHA 3JVUA 3DTYA 2P2GA 3RS0A 4LXYA 3FFAA 4PCLA 1NL3A 1FDRA 3C6QA 4GQBA 3ZHVA 1K8YB 3BCSA 3W7UA 1WNTA 2ILTA 3U40A 3QYJA 2VF2A 3R74A 5KOHA 2CK3A 2EU8A 1US6A 3B3GA 3SP1A 1IG3A 1C1YA 1NVTA 5EVJA 4OBXA 2GZSA 1HE2A 1U94A 2ZF8A 4H0NA 4NATA 1B15A 3LNNA 3SEQA 2NTNA 3MWDB 2ZTLA 4N7MA 1QM5A 3WP0A 4ZOEA 5ERXA 2P65A 4LVOA 4BXOA 3F90A 2QTHA 4OLAA 4G4VA 3O1IC 4R0NA 5I8PA 2WF7A 1AR4A 3HBAA 3D3QA 2IEGA 5JAMA 1NXWA 3TLGB 3AHDA 4EY3A 4MGHA 1L1RA 5CW1A 1N8RW 1NZJA 2PL5A 4NPHA 3KLNA 4KXUA 1N6OA 2ZDIA 1JDNA 1OFUX 4KV7A 5FWAA 1TMYA 4ABYA 1UZAA 3GGPA 1N5DA 2ZREA 3OTWA 2I91A 1KJJA 2PZEA 3NC1C 3ZVKA 2P06A 3ESYA 1XD2A 4EL5A 4R98A 5DGCA 2UXCO 3AX6A 3B78A 5KSYA 2IBTA 2MSDB 1PJBA 2F4NA 1YDGA 2JATA 5REQB 3KQQA 3AR5A 4MV9A 3ILHA 4U0JA 5DHUA 1GA6A 1NP7A 1QK4A 2IS1A 3WL7A 2NUBA 5G2OA 1EFKA 1ZGAA 2FOIA 2YVQA 3LA8A 4G1MB 5JJLA 1H66A 3FMVA 1N5JA 2QTTA 2VJAA 1CZOA 2YI9A 4ALMA 1P39A 2PZGA 1E3JA 3PJEA 1FAFA 1L5VA 4S1NA 2P9ZA 5EXPA 2QUJA 4PVCA 2J9GA 1SBHA 4BQNA 3HADA 1ZPDA 1SVWA 4BX9A 4PYIA 4Q4LA 2FX5A 3VV3A 1NW6A 4GP9A 1MEEA 5HEKA 1Y1PA 5IMSA 4WLVA 5H5NA 2H3HA 4NR1A 2ZG6A 4QIWF 2FSGA 5HS4A 3ZY6A 3ROZA 2GRAA 3IERA 3JARB 1GWNA 4K1LA 1VPWA 5K2OA 4M4SA 1UEJA 1D5NA 1M1YB 5CA1B 2DECA 1IHDA 8LDHA 4NFLA 5BT8A 2Y4TA 1GRQA 5BYBA 1F14A 4OI1A 2XYPA 2BZGA 3L5OA 1HUQA 3T9FA 3BG5A 4D56A 2V4ZA 5JAQA 2CHFA 2CLHB 2ZS8A 1OHHD 2UV8A 1NW3A 1PL7A 3LC1O 4MDYA 3KFLA 3M1IA 4FR2A 1L4YA 1Y7LA 3N6RA 3UN1A 3K2BA 4JDUA 4I0XB 1P60A 2G63A 4M7RA 3A4LA 4KODA 1YKFA 4LISA 4BW9A 2VHVA 3R76A 5JPCA 3WPXA 4YCSA 3KZOA 1NN3A 5B4TA 3WGNA 1NA5A 1F38A 3PQDA 4FR0A 4GR4A 1G2PA 3TQHA 2D4HA 1Y5MA 4QO8A 5IDXA 3DAHA 3K12A 1PJ8A 4NS4A 5KHJA 1LNQA 4N54A 1OXBB 5HQ3A 2AF3C 5IT9N 1PJ4A 1KNXA 3K9CA 3FTFA 3M8KA 1THTA 4YJGB 1RR6A 3LAWA 1LDNA 3MD9A 3EUEA 2A9FA 1OXVA 1XZBA 3H01A 4PDLA 3SE7A 1I0ZA 4B76A 4KSBA 2G38A 3ZCRA 2FEPA 3IAHA 2OYCA 4TMYA 1GSAA 3KSZO 2C2OA 5E1AC 5KB3A 1XLWA 4BEBA 4ZHYB 1UM9A 1OZFA 1GT6A 3S70A 4ZVRA 5KOYA 3O84A 1R9GA 3JQGB 2OP1A 2X5JO 3DJFA 1P9RA 1XT6A 4ESHA 2FZ5A 2JJYA 2FMLA 4BT3A 4KO8A 4JBNA 4E1BA 2XZOA 1XAJA 2HJSA 4BQRA 1N9GA 2PE5A 3TI7A 2ZATA 1TOAA 3P9NA 3ND7A 3FDFA 3DEJA 4REMA 4HH1A 2QWRB 5SZKB 2DQ0A 1U2RA 5JYEA 1Z5UA 1SCQA 4DCGA 5M2QA 1D0SA 3W6PA 1C8BA 3UJ6A 4JBIA 1EPUA 2PT5A 3X1KA 1DDOA 4Y2JA 4QXMA 1BHO1 3CU5A 3WK9A 4PAQA 5CD1A 4DQKA 4C3UA 1PKEA 2QHXA 3I64A 1KOGA 1AZWA 2PGLA 3H1FA 3FNFA 3EZ6A 2WSMA 1T6YA 1XA3A 2QD3A 5JVDF 5KZMB 4LDRA 3OOHA 2CWJA 2JFFA 4Q9JA 1KBZA 1CZLA 4KAJA 5KYYA 1V3UA 1DXYA 3DE3X 3CPSA 4XPIB 1XROA 2BI7A 1ZGBA 2YEVB 4X64O 3AILA 1L6RA 2R62A 5D86A 1JAHA 6AT1A 4UCFA 4AS1A 1Z07A 4HWKA 3BQMB 3C3MA 3GBVA 4R2HA 3GA7A 1Q3EA 4ZOCA 4B6OA 1NR1A 3JYCA 2YZ2A 4PZLA 3AGKA 4HDSA 1DP4A 2OZKA 1FX0B 2QZ4A 1GY8A 1GL3A 3CMEV 4TVKA 2DMXA 2Q45A 3R4VA 1I08A 1GM5A 4KLAA 3VKHA 1FTWA 1FYXA 2HSGA 4PU0A 5CX1A 2NVUB 1L5QA 4QDKA 3RWOA 1SOUA 4V0OA 4P92A 2J9FB 4RV5A 4JU9A 3H99A 3P9ZA 4A23A 2D62A 3ONWA 1T2CA 2AMLA 4MS1A 3NATA 3MTDA 1C7FA 3FTNA 5K99A 1GAWA 1SXHA 3MAGA 2PKYX 4G5RA 3IAXA 1W5AA 3NNSA 3E23A 1T9ZA 4WASA 3K32A 2AXTZ 2Y48A 2WSLA 5SYNA 1UMCA 2WJWA 4WNIA 4L9WA 1SESA 1BQ0A 3CWQA 1FJ2A 1DBRA 5ALJA 2RIRA 3TQFA 1P5JA 2X8LA 5FWXB 4CMKA 1NG1A 3DMTA 5EYPA 1UBSB 5HQTA 2JLVA 1NKVA 1FLAA 1UJMA 3REQB 3IAYA 4G4YA 3GVIA 5A02A 4EY6A 4M7OA 1F2TA 2JFOA 1R5JA 4IFBA 2NO9A 1GN4A 1CEZA 1L5ZA 2PZLA 3J80N 1AM4D 7MDHA 4Y2TA 1PVVA 1IC6A 5F5NA 2OG1A 3LGAA 5EHGA 4LEIA 3PUIA 1IXSB 3GJ8A 1HE1C 1TTPB 1B6GA 1NVUQ 1UBFA 1ND5A 3AR3A 2OK7A 1OBCA 1OHHG 5EWRA 4ZVMA 4H7IA 2G3YA 4NZ9A 3V4FA 2FC3A 3HK2A 1KSJA 4YY3B 3NHYA 5HWSA 1XJCA 3CPWF 1XGKA 1T8UA 4DANA 1F4PA 1B16A 1NY5A 2DAPA 4J76A 1PR2A 1NUHA 5AKYA 4YJDA 4IZHA 4RJLA 2TRSB 4NKGB 2DETA 3RVSA 3LVBA 2FSVA 1C9DB 3UM9A 1PNMA 1RS0A 2KJQA 3DKRA 2NXJA 4RCZA 1CFJA 1IZ9A 3JWGA 3FKSA 3L7BA 2M2IA 5AJUA 4KYIB 3NTVA 3TD9A 4LDQA 3KR0A 1KVSA 4PZYA 4HZIA 5JNTA 2APJA 1X59A 1BE1A 3D31A 4QDOA 3CRCA 1UDBA 2YOHA 3BFJA 3UPDA 3V6LA 1IBLO 1VJDA 4TM7A 3ND9A 3AC0A 4LHSA 4YJ2A 3ZLVA 2I9KA 2L17A 3GA5A 3H9GA 3P0RA 3MCQA 1R6XA 3GFTA 2XIQA 4I55B 1EU1A 2Q8PA 5CA0B 4UHDA 2VZ8A 4QG7A 4KZKA 4NKRA 3UEOA 2XAJA 3TB4A 4A10A 1S8NA 5I51A 2B21A 3K2XA 1YR7A 1JKJA 1JTVA 2QXTA 4E7PA 5EESA 1JKIA 2ZNIA 3CEHA 5KQLA 1V95A 3GJ7A 1GQ2A 3TECE 2N04A 5FPSA 5LDGA 4RTLA 3L3BA 3C5CA 3F6MA 2C0PA 3GFGA 2Z1UA 2QUKA 1I6MA 2ZB3A 3W8DA 5JEEA 2A3NA 3G0CA 1PNRA 1V7CA 4DWVA 3SZUA 2Z6UA 3KD2A 4FSXA 1LLQA 3LYBA 4XUDA 2CTQA 4CDRA 1R1DA 4ZALA 4UAUA 2XMRA 3K3WA 4EZBA 2ZSAA 1I10A 4IV0A 3FSGD 4WKBA 5EWJA 4JT8A 3T1TA 4LRYA 4P08A 4DCCA 1QE3A 2ECKA 1G8GA 1OY1A 4AJNA 1OAPA 3M9WA 5CLHA 2YWHA 4CNBA 1SC1A 3KTAA 3ZWCA 2AIRA 5LOVA 4I14A 2OOKA 3V97A 1D6NA 3SIRA 3IKVA 3HR7A 4JUBA 4X1YA 3RU9A 1X7WA 4Y2HA 3HCNA 5J4VA 5HF9A 3QYFA 1SAYA 2XB6A 3PWTA 3C3SA 2CL0X 1VJCA 1FQWA 1AUVA 1RYEA 4D81A 1FX1A 1VHQA 1LC0A 3EDQA 4WXPA 5A62A 2H00A 3OM9A 1FRVA 2G7ZA 2I2BA 3GLIE 3HJFA 1WNFA 5LJIA 3URMA 3RYCA 3KCQA 5EMJA 2IV7A 3SPJA 1HMPA 2H4XA 2P91A 3OURA 3C1OA 3QQ5A 1ZVVA 3ENZA 1FXKC 4D8UA 3CY6A 3PC8C 4QEKA 2B1GA 1FDSA 3HBFA 4PE5B 3D7NA 5TGDA 1WP8A 4AC9A 3GPCA 3KVOA 3IOEA 4WDRA 1T9AA 3DC6A 4WOCA 2BT4A 2VS1A 2EJTA 4DA4A 4XB2A 2UZHA 4IH4A 4NE9A 3VMMA 3HM9A 4J91A 3HFRA 3OAAA 3TJZA 3LCVB 3U09A 1LSUA 2UUPA 2P8SA 3II6X 1A9SA 1DEOA 2XKJE 3EMDA 2B8JA 2HA0A 4C9BA 5I9MA 3ENKA 1Z2EA 1M93A 2D8AA 2X0IA 1V71A 4D4IA 3C9RA 1CUBA 5BSUA 2YN4A 4P58A 5INTA 3ND6A 3U37A 3MIIA 3WL8A 4WN9B 5M29A 5TX7A 5K20A 3KYDA 5C1DA 3N8KA 4G24A 1LVHA 1AQ6A 5AW0A 2HLPA 2HSJA 4LE1A 4AUKA 4UXHA 3ADDA 1D5WA 1HSZA 4AMGA 2PHNA 4LYFA 3F3YA 1TFRA 3JD1A 1GM7A 4F6RB 5JY6A 3LD9A 5D8DA 3HCEA 1FFGA 5J43A 4ZCPA 2P4UA 3AGPA 1EJ2A 4JI7B 2VP9A 1K27A 1LXCA 5GIOE 1YBFA 4YJ3F 1SY7A 4FFBB 1NH2B 3U3JA 4Z54A 3FD6A 3NT5A 4QGFA 3CEAA 3B9BA 1ZJ6A 2C2HA 2WHEA 3DOHA 3RC1A 2IUUA 2ODBA 1GH6A 3IHKA 1XWWA 4EPWA 3NG1A 5KWIA 5JWRA 3P97A 5IVDA 1BFUA 4HEA6 3THXA 1RI5A 3K4HA 1W2HA 1G8PA 2P9HA 4X6LA 1ODCA 2QJWA 4NAVA 1G63A 5C4GB 2VXYA 5T64A 3OTOB 1L4BA 1WE2A 1LF0A 3HKEA 2G9UA 1ZUHA 1K5PA 4M88A 1OAOC 4JQSA 3CVVA 3A0HZ 3LT5A 3S44A 2C9OA 4G1UC 4E94A 3NC0C 5L3QB 3DMPA 3A3PA 4BKPA 4R1TA 1V4BA 2XTZA 2IAFA 3C4QA 1VMGA 3WLHA 1V9SA 4AJ1A 1JILA 4MVQA 3GIWA 4K3UA 5EP1A 3TQCA 3QXXA 3E9RA 1OCEA 3VR2A 5GOZA 4L28A 2UYHA 3AEQA 1JE1A 2YWJA 5GGYA 4ER7A 4LGVA 5HIIA 4WY8A 1X8LA 4WTOA 1H4VB 2XNSA 1FL9A 1Z88A 3OM3B 3ICWA 2JGRA 1J21A 3CSUA 3M5CA 3TBKA 1ZWZA 3GDOA 3N8HA 5HWEA 1RJEA 2BFAA 1L2TA 3OBYA 2HA6A 1ZJYA 2AUTA 4OAPA 1DG3A 2AG1A 1X39A 2VSNA 4P36A 5FI5A 1S2DA 5D6NA 2O8FB 2LCAA 5HP8A 1J1IA 5G4KB 3DZFA 5HNKA 5C7OO 2GZ1A 3FG9A 1JX9A 2OCHA 1RWPA 3P4XA 3R0QA 4AG5A 4RXUA 3U3ZA 3PDUA 4I8DA 2ODWA 5D01A 3ZC3A 2FFBA 3K0FB 2R2GA 1KNQA 1Q0PA 1M2VB 1KD1H 1LWOA 3HMQA 4IGAA 1Q3TA 3DLBA 4I50B 5AI6A 2XYQA 3W3AH 2X14A 3QHDA 4J1TA 1M8JA 4PC1A 3SJAC 2X6TA 4II3A 2JH8A 4R68A 1CF2O 2XR1A 4D9JA 4RUFA 1GAQA 3ZU5A 4F3TA 2CW4A 3AT1A 3E7DA 3GP5A 3B1YA 2G5PA 3ICCA 3L7JA 5KVSA 2ID4A 5ICMA 5DBEX 3GRCA 3V33A 4X3PA 1FTNA 3RVBA 2A1TR 4ZCLA 2B9VA 3PC4A 3DZ8A 3UHPA 1DMRA 2V6IA 2LIPA 1R4NB 4UM9B 3QI7A 3UICA 2BGWA 4AWBA 1I2CA 3LCCA 4E0BA 5EZYB 3CLTD 4JB0A 3OWXA 1U96A 3AESB 4L3WA 4Q7EA 4P3OA 3EAFA 1BXRA 4IDNA 4H13B 4OQYA 2ZSEA 1DIOB 1AKEA 2A9KA 2IYTA 1XRJA 2VL7A 1GCGA 2HXSA 3CNNA 2GBLC 3WPWA 3F4KA 2P1RA 2VK1A 3OZEA 3FVQA 3HKDB 4X9XA 1V43A 3ZU2A 2QRJA 4NENB 3PA6A 1CVLA 3WKDA 5KNBH 3IOYA 3VR4H 3LBFA 4HD8A 4B83A 2ZSHA 3PNBA 4YT8A 4FVTA 3KQNA 3VH2A 4Q18A 1U8TA 2FYTA 3FOWA 2D1SA 3LWQC 2HAEA 2Q46A 3V8PA 2QMUA 4URFA 4Y2RA 4G4SO 2HLDD 4BV8A 1PJZA 3AHHA 2FKNA 5JBQA 2IYPA 4ACBA 3MPUA 5CEJA 2GJSA 3PT9A 3QVWA 4DRYA 5DLEA 1BEEA 1RQPA 4RPGA 2H08A 1XCGB 2Q27A 2R9AA 3DBOB 4V1CB 2PTGA 3AB8A 1FLDA 5JROA 3O1HB 3Q72A 5H3HA 1F9EA 3LZ6A 2J5XA 3OOYA 3FMGA 1M2OA 2YINC 5ITSA 1E1LA 3D5EA 1FRFS 1M1KH 2Z0AA 2XODA 3DV9A 4JLWA 1PYGA 3H4VA 2FZWA 4O4JF 2D00A 1Q1QA 1JTFA 3U4QA 2YICA 4IYIA 4U7JA 1O0CA 4M9RA 2NTJA 3FB8C 3QOFA 3Q5EA 1FUKA 2ALJA 4KIWA 3P9QA 3QJYA 1M75A 2XNDA 1NX9A 4A0FA 1WF6A 3T41A 1O95A 1CY7A 1XILA 1VKOA 1XL1A 4GKVA 1KORA 3AIOA 4G28B 1Q0SA 5JEDA 4WJZA 1YO6A 2DQSA 2HCRA 3G5MA 1XTPA 4GEKA 2QE7A 5A04A 3AQIA 1GLVA 3VI4B 3OQ6A 4ZFNA 2K6GA 2BMVA 3TH5A 3ETEA 2WLJA 1ISHA 1GITA 3QK7A 1KB9F 2RGUA 4WNCA 2OP0A 5K0GA 3WK5A 3CUUA 1EX1A 5JNLA 2EYQA 2ONCA 4LBVA 3EF1A 3Q88A 2HF9A 3GLHE 1B8NA 1X86B 3BREA 1YI2V 4AJPA 2Q49A 5BUSA 2Q5QA 3DAFA 3I2JA 2Y99A 1R3IC 2QI9C 3H9EO 3OZUA 3K1YA 1MOFA 4AILC 4NABA 2FFAA 4PG4A 4NYIR 1OV9A 3F5SA 4I2NA 3KJGA 4OTZA 3VHRA 1YV9A 1R9JA 2FMHA 2PX5A 4YMSA 3EZLA 2DPYA 3JQAD 3PCRB 2VDOB 3C8MA 2VHEA 5KC9A 1QHGA 3ANLA 2VZEA 5E7IA 5L45A 1FYFA 3OJWA 4BNKA 1MAVA 4J7XA 5IM4F 5TQJA 2EXXA 1JLSA 2ZR8A 3CONA 2IJGX 3EXEA 3ANYB 4OMUA 6Q21A 4B3XA 1EG7A 4C6RA 4DQ0A 5CRIA 1UMDB 3LW8A 3RR2A 4R9VA 3Q6NA 3PDWA 1YHYA 1G291 3FWNA 1OROA 1S0VA 3EMKA 3TW8A 3DFIA 1REQA 2NN4A 2V4MA 1DZ3A 2PZFA 1FNBA 4ARSA 4ESVA 2JCXA 3LRTA 3ID6C 2WJIA 3OBWA 4DDTA 2IX9A 1VG0B 2QAGB 3BSWA 4W9NA 3VM6A 3RVKA 1E3IA 2QZSA 2HUNA 1LI7A 4ZCRA 1U9JA 5AJYA 3SYPA 3RT3C 4ZV4A 2FV8A 4BKRA 1GYPA 4CEJA 5CFLA 3TK1A 5AJHA 4FEYA 3N87A 3U7QB 4HNVA 1LPMA 3EXAA 1N5LA 3OUZA 4BKUA 1BHQ1 1J6UA 1YD7A 3HA5A 3U4GA 3OBBA 3X1JA 2R6JA 3T7EA 1DO8A 1NQXA 2YQ5A 2O48X 1BS9A 5JOQA 2FSSA 4G2NA 2CFCA 4MVOA 2EBFX 2AFHB 1GZVA 1PFQA 4RUEA 5KAMA 4M9XA 3CR3C 3J81N 4J0FA 1D3AA 4YT2A 2YY5A 1NPTO 1W25A 1PK7A 4OA5A 3UT5B 2FZVA 1O2DA 2XLBA 3H1EA 4JB8A 4LCKA 4Q3CA 2J85A 3Q11A 1D7OA 2LP4Y 2EFHB 4YXWD 4ZVOA 4C5BA 2Q8VA 3H0CA 4NFYA 4QYWA 1KQFA 4QRDA 1RQLA 1VJ0A 4B08A 4MP8A 2HZ7A 2WIGA 2FGYA 2R11A 3AKYA 2HLDG 4LHXA 3ABTA 4HADA 1HF3A 4WVLA 3B13B 4GI3A 4WKNA 1PR6A 4B46A 3TCUA 4AJ2A 4LKOA 4I66A 1L4HA 3CXRA 3EZGA 3OX1A 4P8RA 3RUDA 3DTVA 4EFMA 1E79D 4WL0A 5LBQA 4D4MA 4AIRA 1BMQA 2UDPA 3TPFA 3WY9A 2BOCC 2IJJA 3A28A 3R8FA 3OM8A 3EEOA 3V1NA 2A78A 1QAOA 2WE8A 3H5TA 4QHYA 3O4RA 4MZDA 3ZKWB 3M6AA 2V97A 4F84A 3HZOA 1AN9A 1MO5A 1QHHA 3R5KA 4E5UA 5AMXA 2DEUA 4XSGA 4CMBA 4NWIA 3ZCSA 5CLLA 3T3PB 4BGVA 1YASA 4RVSA 5EQFA 2KGWA 1CEXA 3I72A 4QQFA 1VPDA 3E8HA 3SX2A 1SULA 5GJVC 4GICA 1MDFA 4FFWA 3NHMA 5SZJA 4URUR 1KZGB 4PZUA 4YQEA 2CZQA 1QIHA 1HTWA 5LGNA 1KP9A 5B1OA 4TZKA 4Q1BA 2Q0OC 1VQ6F 2FRVA 2W8ZA 4K6GA 4MV8A 3JAMN 2O9JA 2BE3A 1YZVA 2D1TA 4F71A 3EXFB 1H48A 4M38A 2VP3A 1AT1A 2PSJA 4BVQA 3SE0A 1EX6A 4LC0A 2WP8J 3Q15C 2G6TA 1O03A 2LW1A 1GOTA 4I4TB 2MW2B 1EVIA 4EB6B 4UOQA 3FW1A 4EHLA 1YMQA 1Q1BA 1YIAA 1KS2A 1R0LA 2CJXA 4L4YA 4KDEA 1HDEA 5HVNA 2PUWA 1RHUA 3E22A 1HZJA 2FKAA 2MT9A 3IUBA 3P9XA 5BR8O 5EWLA 2ON6A 4DMCA 5AW4A 3B89A 4F3RA 1A95A 1M0EA 4MIOA 2YWGA 2VTDA 3KT8A 4DGQA 1CQWA 3LUTB 5FQNA 2G8LA 2OFWA 4AJOA 5A7HA 2YJ6A 1NQ3A 4P3NA 2DUUA 1EWKA 2GPAA 2H4ZA 3SIUA 1UP7A 1YQUA 1IB6A 1HFKA 2NU7A 1UINA 3AFIA 1QAHA 4WH0A 4CF6A 1E2FA 2HJDA 4LY6A 1GX1A 2VKTA 5JALA 4TYNA 1E1CA 4ZTZB 5DF1A 3ZUPA 1XMXA 1LFDB 4HKTA 3BFVA 4FYJA 1FQOA 4P3PA 1UANA 2EJCA 5LQAA 5FBQB 3P94A 3HO8A 3VHQA 3LFOA 5A5DA 1SOAA 3VKVA 5IT5A 5BY2A 2WJVA 2X4GA 2YV5A 4XVUA 4C8EA 3LVRE 4YHBA 5EIOA 2BELA 3LM8A 1RXYA 1OCOB 4ENQA 3PHBE 5ALVA 1LD3A 5CK4A 4K8OA 1GPWB 4QUAA 1CUXA 1WCWA 1WD7A 1G98A 3JAKB 1PAUA 3ZMSA 3UB3A 4HQ0A 4GXTA 3QG1A 1OWPA 2JEZA 2WF9A 2HRQA 4P34A 1W4AA 3DOEA 4LF4O 3TINA 1OTHA 2P79A 3DYVA 4XBFA 3GOHA 4ZARA 1IUKA 2B99A 4KMMA 1U2ZA 3ORSA 3WB2A 5KIAA 3HU2A 2EKDA 3EVNA 3UM7A 4UKDA 4RQTA 3AI1A 2QLLA 2X6QA 1HETA 1GZHB 3KBBA 3I8XA 1V35A 3DM5A 4TRRA 3DE0X 2O7NA 4JBXA 2IUSA 1SIOA 2FW0A 4KP7A 1XZDA 3ILSA 3WL5A 4UMEA 3WG9A 2HJVA 1T2VA 2WD8A 5DM0A 4YV1A 4KEAA 5ECDA 4IEIA 1UXGA 1FBTA 1D9ZA 2IL1A 4RHTA 2IHNA 1BA2A 5BNFA 2XSZA 1VF7A 2H2WA 3AJEA 1SQQH 4RGBA 4DR5B 1WIWA 4XFDA 4LI3X 3RS3A 1DC4A 2VDUE 3UAYA 2QRHA 1L7NA 2FVXA 2GKGA 1D2GA 5BW8A 2CV2A 4TS4A 3ZGLA 3RU3A 1VLHA 3BTSA 3TNJA 1URFA 4C3OB 4J1QA 4IQGA 2ZRBA 3GHHA 3CLKA 3UNXA 1K9MH 3IVRA 2DERA 2CNKA 10MHA 1L1FA 1ICIA 2EEPA 3NEYA 2IHYA 2C31A 2ZIZA 2Z1MA 5CDYA 2ONYA 2VJYA 1YR1A 3K09C 3VZDA 3VUFA 3S8EA 5AW5A 3MBMA 1SHKA 5KYWA 4WK6A 1C2YA 1D0IA 5FV4A 1FYWA 1TADA 1BMFG 3KR9A 1UZLA 2RKWA 3M84A 1MNAA 4RS3A 1FFBA 2QN8A 2NXNA 1ZCBA 3SU8A 3SEFA 1YJXA 3WVNA 2E2WA 3V7YA 1XDDA 1P3JA 3QUCA 2ZGVA 4KN9S 4H1WA 3CJRA 3VR5A 2Q6VA 2PS1A 3G0GA 5L3SB 4ZD6A 4O4LF 3QTTA 3EK2A 1YEWA 2MQEA 1CT9A 1KH1A 5CDHA 3GDWA 2F3SA 4QGHA 3G7UA 1F48A 5BVHB 1D04A 1Q2XA 3ROPA 1GTVA 5U4QA 3CSSA 1XCMA 4MKGA 2GFIA 1IM8A 4TL7A 1NXVA 1WSBA 4UU7A 4OJQA 3VKFA 3NHJA 1FSPA 1V7PC 3QO8A 3NT2A 5J5AA 2O7VA 4YGYA 3ZOZA 4QYIB 3FGOA 2CHGA 1RMTA 3F46A 2R2AA 4R8MA 5FWYB 4W8GA 4MCJA 1XZFA 3IIKA 2A5DA 2IIVA 1LBTA 4FCCA 1C0PA 1V3QE 4Y2VA 1H4QA 4LWZA 3L8DA 1NZFA 4P4LA 2PMFA 4RJIA 3LI2A 1V16B 5C93A 4FHDA 4RF2A 4BWFB 2OQ2A 2QW0X 2WYVA 3B7PA 1VBNA 1EFTA 2OGSA 2P9QA 4N6GA 5CW2A 4HX9A 2W8BB 1TKBA 4GDMA 2IU0A 1QV9A 4C21A 4X8OA 3QLUA 4CT5A 4R83A 4RVCA 1ZIDA 5L3GA 4YRCA 1U1EA 2QRZA 1OCZC 4RDIA 2CGOA 1G5TA 1RLJA 1P4JA 3ZBHA 3ELCA 3RARA 1NC3A 1AQIA 3FHCB 3U6BA 3GWZA 3RE1A 5DN6A 2ZXUA 4U2KA 4H17A 2N0SA 1YS2X 2IHJA 2HJWA 3OZTA 1TQDA 1BMDA 3JQ8B 4NBKA 3V00A 5AI8A 1RAGA 4TKMA 1H1TA 5AHOA 3DLIA 4K9DA 1RSOB 3BJZA 3HCCA 1VIBA 1G5QA 4YACA 1PKXA 4KMOA 3DQQA 3W4KA 3RRMA 4PNHA 3Q0IA 5EMKA 2HFJA 1GLGA 2I4MA 3SMQA 1Z6AA 2F55A 3I01A 1B41A 4MW5A 1AB6A 3OTIA 3VNSA 1PWXA 1PNKA 2H17A 5K3EA 2BUAA 2OENG 4GQIA 4WK0B 3RSLA 1H9CA 1OMOA 3H0KA 4LK3A 3I4LA 1H8HA 1L1QA 1M34B 4MW9A 1XFDA 1XEXB 5EIAA 3ELYA 5JLJA 2I6SA 4G8BA 3KPJA 5AJVB 2B98A 4KFMA 2A84A 3ABOB 4FX5A 4RELA 3ERNA 3MTIA 1OGIA 5C8YF 4IIJB 2ZWVA 3OZWA 1G0OA 1UKCA 5JCZA 1L8DA 1UPGA 2TMYA 4CDMA 1G4UR 2WQZA 4W1RA 3TFQA 3UK0A 4PLZA 1IJEA 2PUGA 1SM4A 3IAAA 3EUFA 521PA 4PBSA 1FB5A 1U3FA 3G85A 2QMHA 1ZSYA 1T5EA 4BO8A 1N2EA 2VHWA 2JFQA 4NEGA 1QQTA 1Y7IA 4UAVA 4YMTA 5F12A 1JHYA 3VYTC 3WU2Z 4NAHA 4U39A 3KEGA 3ZY5A 4A0RA 4D46A 2IE0A 1IJKA 3DWEX 4I1SA 3QW4B 1W5SA 3ITDA 1MVNA 1JR3D 5ICSA 4BNMA 4MI9A 3ZZTA 4CG1A 5COBA 3CEMA 3D6JA 3G2KA 2VAWA 4CLXA 3KIPA 2VPWA 3N05A 3TNDA 3JAWA 1XDZA 4BMPB 5I9LA 1EWTA 2LWIA 1YB4A 4DQUA 2JCGA 1QU7A 1NULA 3SSOA 3H1LH 1T9HA 4HQKA 5FNZA 1COZA 5C34B 3EY4A 3H87A 1Y8RB 5FFMA 4BNUA 3KAJA 3D36C 4XI9A 2QORA 3CZQA 5BV8A 4H7JA 2O19A 1A3CA 5AKZA 1X9IA 1EVZA 3C3WA 2C2AA 1AGYA 1P73A 2W7TA 3GMIA 2ZI9A 2Z1DA 3DR3A 3WRWA 2Q9LA 1UDCA 2PUHA 4J0KA 3OZ7A 5EWMB 4EB0A 3VDQA 1XALA 1KMIZ 5I4IA 4ROSA 3F7YC 2FTKA 3W7VA 3C6XA 3S1AA 4DV4B 4FDLA 1C3XA 2J6HA 5C46F 2Q5IA 3PG5A 2QG6A 4DEXA 2QTNA 1U11A 4OPMA 2R8OA 1E1NA 3TSOA 4MEBA 1FYJA 1L8LA 4PX9A 4RKFA 4RQAA 3OC0A 3DOIA 3JQPA 3WOHA 2XUKA 1KFKB 2WSYB 3T3OA 3QPWA 5CTAA 1UKAA 2FP4A 2QN2A 5HRUA 3ZNNA 3KTFA 4X94A 4NCJA 1H3EA 4UPDA 3D8BA 4K9SA 3EVBA 4M0EA 4CLRA 1VQNV 1JQ0A 2Y1OA 4IS3A 4EMTA 2WR8A 4C29A 1CZHA 5FBZA 3BFRA 3D8NA 2D5LA 2HEPA 1E1QD 2QSJA 1RSZA 3TGUH 3RC8A 4CG3A 2OT5A 2K2QB 5G0WA 3RW9A 3FHOA 5JNVA 2V7PA 3V8QA 4XVHA 2ORED 1XAIA 2NQ8A 5FL7D 1Q0LA 3U7RA 1IRIA 4H77A 4ZAYA 3W1WA 4RFLA 2ZIMA 4ENSA 1Z4PX 1C7JA 2GVIA 2YS8A 1F4VA 5C1PA 1K1EA 2R1VA 4DYHA 1SXJD 2VCEA 2HCTA 2HF7A 1E2IA 1E2LA 4D43A 3EGEA 5CH3A 3L4BA 4HNSA 3WDKA 4HP8A 2P0EA 3SMVA 4CIYA 1NMZA 1BN6A 1WP4A 1T8RA 3VNVA 4KBYA 1JFFA 4LYHA 4C07A 3CJTA 3MN1A 4LE2A 3ZKAA 5B36A 4RAOA 2IUEA 1I3NA 4OM7A 1QE0A 2IIQA 2FR0A 3PIDA 2Q0QA 3I53A 4JUDX 4W5HA 2XDQA 3D6NB 4H7EA 5EQJB 2WJ4A 3TG2A 3AI3A 1IWOA 2A9PA 3WG7C 4P7GA 1F6DA 4D98A 1WZNA 3NYWA 3ZI4A 5DLDA 3QTCA 1EUQA 4HWPA 3ON1A 1CRLA 4GR9A 4YUYA 3DBLA 1YJNF 3LNCA 3LRXA 4CUJA 3QKIA 4O4HA 1P5RA 1PS8A 1CY0A 1NQUA 1LS1A 4C82A 2EILC 3VNBA 4PLFA 4FMTA 5AWFC 5DYGA 3MW8A 4IWXA 2GHYA 2IS6A 5C5CA 1DX4A 1QLNA 3KT3A 1P2DA 2Z2KA 3KYCB 2VA8A 2J4CA 1MDBA 4PX3A 2B3DA 4WDQA 3VZSA 1SCKA 3NR2A 4FMCB 3MCUA 3O8BA 3GRUA 3M83A 3EFHA 1ZMBA 1W42A 1S96A 2BEWB 2PLFA 4A16A 1SVSA 3CLTC 2ZUBA 1H3NA 1K8AH 4EAQA 1ZOPA 2WUFA 4DZRA 3OEHA 2Z2ZA 3IR5A 1X80A 4FGKA 4TZZA 4ITUA 4FK8A 3AYXB 3TZBA 5J23A 3BMNA 1Q0ZA 2BSXA 1EVLA 1LQUA 4ZVVA 3L6RA 4BLOA 1FYVA 2BCCH 4DSNA 4XQGA 2FUCA 4D41A 5FO0A 1YC5A 1BE8A 3ZX4A 3JD2A 4OJNA 2QVYX 4E13A 4H59A 2NSHA 3A6EA 1QFXA 3V55A 2PS3A 4QUBA 4X91A 4KLRA 1I0IA 3Q7QA 4IZ6A 4ZI7A 5C1BA 1M2FA 4YT5A 5FNVA 2ZR2A 1Z18A 3R6LA 4AM8A 4CZZA 1P7VA 5SICE 2BEUA 3ZHBA 1LW6E 3WYNA 1ML4A 1DJOA 4R31A 4BRUA 1Q82H 1XEAA 1LBHA 3QUQA 1BWQA 1TM4E 4AU1A 1N1GA 5DNVA 5GM2A 3ZDYB 4ACAA 3GUHA 1U9YA 2RK6A 3I4CA 1IVNA 5EXXA 3RTBA 3AP1A 1KQSF 2FPMA 1ZITA 3CB4A 3DH0A 3EF3A 1FUEA 5IAKA 4MUEA 1RI4A 2VJCA 2R44A 1YTFB 2PPLA 3M1YA 5CT8A 1JEDA 3EVFA 3B8NA 3B9PA 3DMHA 4DSUA 3HN2A 1TUBA 4KXNA 4IIUA 1Y5LA 3MLAA 3CF4A 1NI3A 1NSFA 2UZIR 1LDEA 3X1ZA 4LXUA 2OO7A 2Q4DA 5DYIA 2QKAA 2OHFA 2ZT8A 3GFOA 5L95A 3GJRA 2V7GA 4UE3S 5T41A 4B3SO 1X7YB 3W5BA 3T38A 1L5FA 2JGAA 2FPRA 1KFEB 3VKWA 2UUCO 3CVUA 4QT0A 2IPOA 1IURA 4BZXA 3R5XA 3ZRSA 4MIYA 1SOWA 4K9KA 1W52X 4NQRA 3CX4A 2VNHA 2CFOA 3K8QA 4DLRA 1FS5A 2JK5C 4IDQA 3O9OA 3K0GA 4OM8A 1VQ7V 4NC9A 5F2KA 5DM60 3BMQB 4G1BA 1E1QG 5LXTA 1COWA 3EH1A 4D8XA 4J16A 1DEHA 1GV1A 1ZEMA 1OBOA 3QKUA 1OYVA 2BGUA 1WDLA 2DYRC 3OTQA 5LKRA 1TNDA 4BEVA 5LMUB 2PWZA 4K3VA 1C1XB 3V48A 5FL7G 3IQDB 3ZMUA 2Z2JA 2YIMA 3NAGA 4CKEB 5I9NA 2JFPA 3N2NA 5CNJA 2G80A 4ZHSA 5HM8A 2J3IA 1BGYH 1ONOA 1KSFX 1JGTA 2ZYVX 2IPXA 3GUYA 2JFNA 3ETDA 2I7CA 4JL5A 2LVBA 3R9IA 4XYMA 2I1WA 4EKYA 2KI5A 1ZN7A 3BWVA 5L3DA 5KYKA 5L3CA 5FLEX 2VG8A 4CTKA 5D51S 1K9SA 4YLEA 3BIOA 3D8UA 4G5SA 2PKRA 2WB2A 2CLSA 2AHRA 5BQ3A 3HCPA 1LPBB 3HI4A 3TN7A 3WYFA 2C7GA 1O58A 4IOJA 4NTYA 2OCDA 3C8HA 1MFPA 4OI4A 2G4LA 1YOBA 3I3OA 2QTAA 4U9HS 5HJEA 2IC5A 3UK7A 2C3OA 2MDTA 3NBYC 3KAPA 2XUPA 4NBVA 3NTOA 4MKRA 4L8LA 3CW8X 3FHLA 4HEQA 3E3OA 2FE4A 1R4ZA 4N3CA 3RFXA 3MILA 4CQLA 4FOOA 2JJMA 5CIQA 3UY4A 4B31A 1N34B 4DMGA 4C0QC 4WAUA 5SY9A 5UKDA 1TMOA 1GLNA 4OHUA 1O9HA 3T1YO 1HORA 1KHHA 1AI5A 3DZKA 4MYCA 1L4EA 2ZOVA 1OCZB 4GX5A 2CJWA 1U81A 3ZRWA 2B94A 2WWGA 2HKOA 1P1IA 1R8JA 2I8CA 2NSYA 1X8KA 4NEHB 1J06A 4G9GA 2VAVA 2ZT6A 4TWRA 1S3SA 1XHOA 5HBGA 2O3JA 2P4HX 4HDKA 5GZ1A 3RSFA 1Z26A 2QGNA 1YRLA 4CFZA 2WZDA 3F7NA 3IPXA 3IQGX 3PXBA 1DFGA 4B9EA 4WNAB 3CF0A 2O8VA 3OGIB 3NHPA 4IH9A 2B9EA 3EXIA 5DBHX 3R9XB 3ADKA 1KQOA 1KAEA 1L4LA 3ZQJA 3TE7A 4HJRA 3LC0A 4OXNA 1PW5A 1H8ED 4MIEA 3N39C 3H7AA 4B6FA 2XCOA 1YZBA 5GADl 4DR7B 1SQPH 4Z4IA 3FDZA 2XRZA 4YAEA 1CG6A 1NLYA 3BILA 3X2QB 4XH9B 4XEHA 1ZAKA 3B8EA 1AA6A 1QANA 3BTVA 2WEKA 2VWKA 1MT3A 2VZ9A 4GYCB 1NOJA 1ESMA 4XX0A 3ZW7A 4PDVA 4B3RB 2BP7A 2CMGA 5IE9A 1YJWF 2GBOA 4MP6A 4QBFA 3HGQA 1VIDA 2ZUEA 1RD4A 1EDEA 2FA9A 5KTSA 3ABZA 3IGFA 2V7XA 3GROA 2CEKA 5JHHB 3HDVA 4KN5A 1QP7A 1U2SA 1V1MA 4K9NA 3WKBA 1KK0A 4R6ZA 3FOCA 2DLCX 3VYTB 3JYHA 2R1TA 1NFRA 1KOFA 1KH2A 4PBRA 4M1QA 4EY5A 4CM9D 3HEAA 1RHQA 4YMGA 3EVGA 2ACVA 1VE3A 3MSCA 2AE1A 4D9FA 2EX3A 4CE6A 3EIQA 1D0VA 4H44B 3M8AA 2XOEA 4P1ZA 4PSVA 4ZHVA 4JGSA 3GJ0A 2ZKIA 4YJHA 1VA5A 5HZHA 4H7KA 3ZCXA 4DRXB 1TUEA 1HWYA 4KR7A 2C59A 3CH7A 5COQA 3RNLA 2LPMA 4ISCA 4AO7A 3W9YA 3MPOA 5ECYA 1WM1A 4CV1A 2ODEA 1IWPB 1U2EA 1BWSA 1J4AA 3U10A 1KKDA 1R8XA 3O8OA 4MRPA 2QWQB 1G8JA 1XDCA 3WLLA 5EKSA 2WF8A 2FZCA 4P0PB 2C2ZA 4YRDA 2WRZA 2QV0A 1N1EA 3NW9A 3TRJA 4G5FA 1IDOA 4MMYB 3EULA 4NG5A 3L1IA 5AG2A 3WNZA 3MOSA 2L69A 2V9PA 2MYTA 4H4DA 1MV8A 4ND6A 3FHJA 4C2UA 1Q44A 3VRHA 3F78A 4LN1A 5FTMA 2OM6A 3QTLA 4RA9A 4C3VA 1PJSA 5JE8A 2HIHA 3CW2A 3TQQA 3ZWVA 4HT3B 2OK8A 5DHPA 2XF8A 5TMBA 3W4JA 3L75H 2H4FA 2N47A 1K0UA 3WMEA 4R40B 4DEVA 1YWGO 5JISA 1X74A 3GLKA 2XX3A 4KQWA 4RQFA 4RHAA 1GNSA 3IMFA 1YFZA 4OYLA 3PL5A 2XGOA 5EPEA 3KCXA 1CNFA 2WSIA 2QRNA 4E1AA 2ZJBA 1GRRA 1P1KA 1SQFA 3BN3A 3L7LA 4HVLA 1SCIA 5B3JC 2OLKA 2AI2A 2N46A 1G5IA 1JRLA 4AZWA 1BS2A 4Q3NA 1QU9A 1BXZA 3MQ2A 4I2VA 4EG0A 3DEFA 2HBZA 3K06A 1TQ2A 1JNXX 4DDVA 2I2AA 1TXGA 2COUA 4DMHA 4NYJQ 3OY7A 4A1OA 1UC4B 4A0HA 4BT4A 3QVXA 1QV7A 2YVUA 2VTEA 1E2JA 4N39A 1X1QA 5HQJA 4IGKA 1DJMA 2BIFA 1SBYA 4EPVA 1XRPA 3LUCA 4RLQA 3IAM6 4E2XA 4M21A 3QBVA 3EF0A 3DAGA 1NSYA 4OCZA 4ALKA 2QWPB 2R7NA 2QTZA 4R1SA 4D8WA 4K28A 3A4YA 2HR1A 4OHXA 5LZ5A 1JW9B 3OA0A 4R8RA 3HNRA 3VTKA 4N48A 4DLBA 4HNAA 3FVWA 3PHGA 2C4WA 2B6HA 4RD0A 3AG7A 2V9YA 5CH8A 4KXFB 4OHOA 1E1RD 3FB5C 2IF0A 3OOEA 1V6CA 5FX2A 4IHJB 4C20A 3WG7B 4H33A 2MU1A 5DX1A 4HAIA 2BC9A 4ALNA 3WWPA 3F3KA 4U7PB 4AFNA 3FMOB 2JARA 1D2RA 5KYVA 1JHQA 1AGRA 3DBRA 4GKJO 1CIJA 2QMQA 5LUBA 3K04A 4XDYA 2A5GA 1P45A 4MVJI 2I4RA 1FJGO 3QE4A 4MA5A 1GUYA 3E84A 2CVHA 5ALYA 4M9SA 1E9BA 1W8DA 2QX6A 4YPVA 1ISGA 4YJKA 3E9MA 3KPYA 3I0MA 5JZBA 2IYSA 4JTAB 4RH3A 3T5TA 2FR8C 1LTKA 1UOOA 2PSDA 1ILEA 2GJAA 5GJWC 4QDTA 3DQPA 4FCVA 2E55A 4C05A 3CJHB 4NMLA 2IJKA 1N33B 1TEHA 5DK4A 3KTDA 3K9GA 4PLHA 4ZAXA 4AZSA 3FTQA 4ETWA 4LV6A 1X0VA 4EI7A 1XTKA 4RPKA 1YL5A 3IRUA 2V54A 1IY0A 1GRNA 4IIYA 4U63A 2RB5A 4NOJA 4MHTA 3HRKA 3I6ZA 1A9YA 1U1FA 2O2XA 2YTZA 3OMWA 4ZQHA 3H05A 1PJRA 5AK0A 3K6KA 2WM3A 3GLTA 5C1OA 5IXJA 3GOQA 4WLEA 2C84A 1BN7A 1Q91A 1VMDA 4JHXA 4BAUA 1KEEA 1OZHA 3B1XA 1NQWA 3V80A 4OQXA 1Z6GA 3TKYA 3BGDA 3GZTB 2L35A 3R7BA 2Z5GA 4MPPA 1P2VA 3NM6B 3SPGA 1DELA 1J49A 5DIFA 1V45E 3OW2F 4BLTA 3P9IA 3S3WA 4MV1A 5IDYA 4R81A 5J1SB 3M3HA 3S2SA 4EJ6A 1BC5A 2GEKA 4Z1MD 2ZM5A 3A10A 1LUWA 5AM2A 1ZWLA 3WJ2A 3A14A 3KXDA 2M6YA 2DSTA 3VOTA 1TCCA 4MVXA 3DYBA 1BJKA 4QJBA 2ZFUA 4NL4H 4HZGA 1EK6A 3K0SA 3L7OA 1N9KA 2QL6A 3VYVA 4X90A 3NXKA 4JJIA 5CVEA 3I01M 5ITZB 3ZVRA 3AJRA 3MVEA 4S1VA 1TK3A 3CE9A 3CCVV 2UVPB 3LFTA 4E5KA 2KKWA 4P80A 5COAA 1KOJA 3NVAA 4Q34A 2WM8A 4MR8A 3E9YA 1P4SA 5IK2A 1F3OA 5FPOA 2BMJA 3ZGZA 3FIUA 3DDUA 1SQGA 1PTJC 2F6RA 4JV5O 3PSHA 3NYIA 1TIPA 3K5HA 3OE1A 3WLRA 3GLIA 1OXKB 3O4HA 5JATA 1CEQA 4C7OB 4IXNA 3CB2A 4FYVA 4K3AA 4AJ9A 4EA7A 3ZHOA 3X1WA 5I7SA 2RN9A