3JAWB

Atomic model of a microtubule seam based on a cryo-em reconstruction of the eb3-bound microtubule (merged dataset containing tubulin bound to gtpgammas, gmpcpp, and gdp)
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
429
structure length
429
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
molecule tags Structural protein
total genus 145
structure length 429
sequence length 429
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jawB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jawB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jawB01
3UT5A 2BTOA 5JH7A 4FFBA 4I50A 5J2TA 3CB2A 3WGNA 1FFXA 4I4TA 4O4IA 1W581 4O2AB 4O4JB 5JCOC 5GONB 1W5FA 3HKEB 5KMGA 5JVDB 5LXTB 5MN5A 1W5BA 2R6R1 4U39A 3JASB 5EYPB 3WGJA 4EI9A 1OFUA 3ZIDA 5FNVB 4X1KA 4HNAA 4O4LB 2BTQA 5EZYA 4YJ3A 4B46A 5KX5B 3JAWB 4B45A 2XKAA 1TVKB 3HKCA 5JCOA 5C8YA 5LOVB 3N2GB 5J2UA 3E22A 4M8IA 4LNUA 1JFFA 1FSZA 3N2KB 3RYCB 3HKDA 4X1YA 3RYHA 4X20B 2VAWA 3VOAA 5LYJA 4ZOLB 4TV9A 2RHLA 3R4VA 2RHOA 4YJ2B 3V3TA 3JAKB 3JARA 5EIBD 5EIBC 5MN6A 4IIJB 4ZHQB 4O2AA 4O4JA 1Z5WA 1Z5VA 4EB6B 4WBNB 5LP6C 3HKBA 4IHJB 4U3JB 5CA0A 3RYFB 4F6RA 3WGKA 4O4HA 4TUYA 4ZI7A 5BMVA 4TV8A 4DRXB 3JATB 5IJ9B 1TUBB 5IJ0B 5IYZA 3UT5B 4KWEA 5CA1A 4FFBB 4I55B 5JH7B 4I50B 1W5EA 5JQGA 4O4LA 3WGMA 5CB4A 1FFXB 4I4TB 4O4IB 5M7EA 3RYIA 5LA6B 2Q1XA 3JALA 2R751 1RQ7A 5LP6A 5KMGB 3WGLA 4X1IB 3M8KA 3ZBPA 4EI8A 2GVIA 4X1KB 4HNAB 4DXDA 5EZYB 2BTQB 1RLUA 4YJ3B 1RQ2A 2VXYA 4O2BB 3HKCB 5C8YB 1W5AA 2RHHA 5GONA 5J2UB 3E22B 3HKEA 5ITZB 4IIJA 4LNUB 5JVDA 5LXTA 1SA0B 3ZBQA 4EB6A 4WBNA 3HKDB 3JASA 5EYPA 4X1YB 3RYHB 5FNVA 1W59A 5J2TB 5LYJB 3JATA 4TV9B 3M89A 5IJ9A 1TUBA 3JAWA 5IJ0A 5KX5A 2RHJA 2Q1YA 1TVKA 2VAPA 4I55A 3VOBA 3VO9A 3JARB 3C8LA 3VPAA 5LOVA 3N2GA 5LA6A 2VAMA 4DRXA 3HKBB 5CA0B 4F6RB 3N2KA 3RYCA 4O4HB 4TUYB 4E6EA 4X1IA 4ZI7B 4TV8B 5BMVB 4XCQA 4EI7A 4X20A 5IYZB 5CA1B 4ZOLA 5MN4A 5JQGB 5CB4B 4YJ2A 3RYIB 3JAKA 4O2BA 3JALB 4ZHQA 1JFFB 5LP6B 2XKBA 3RB8A 4IHJA 4U3JA 3VO8A 3RYFA 5ITZA 1SA0A
chains in the Genus database with same CATH superfamily
1MUUA 2BTOA 1Q16A 4GLXA 5KIAA 3ZVKA 3L75H 4M8SA 3THXA 4L0MA 4BTVA 2VNKA 1Z0SA 2YYEA 5LQJA 1KIAA 1UC5B 5ALMA 4M46A 2JIOA 4ALIA 5A4KA 3U0BA 2GBPA 1XEQA 5HY0A 2E4AA 1QOQB 1W5EA 3E8GA 1EBOA 4AP6A 1BAPA 3VOTA 5AI0A 4K9KA 1SKBA 3QLVC 1WMFA 3DG9A 3O4JA 4Q3AA 2RHMA 3S02A 2IQIA 1M2WA 1JMVA 1WO8A 4IGFA 2AIFA 3LNCA 3CVUA 2LW1A 2ZPTX 1EVLA 3I0NA 1DOAA 2YFYA 2FDXA 4NBUA 1FK8A 2POQX 4M6WB 3ONWA 5HF5A 1WU7A 1N36O 2EDAA 4V1CA 1OZFA 1ZR4A 5DKFA 4DMRA 3JALB 1GD1O 3GVXA 2BGLA 2O2HA 3SEAA 5DK6A 4RMJA 2XAAA 4JVMA 1H94A 1VF5B 3LUAA 2SCUB 3EFOB 3V7WA 3UJ6A 4D9JA 2PGGA 3UMYA 4R50A 2JLSA 3AJEA 3KALA 1AMNA 3KC2A 4W5RA 3A3OA 3OZRA 3OD4A 1WM1A 1CWUA 1RPOA 2HIHA 1JP7A 1TJ4A 3IQEA 2O4UX 3BWXA 5FTMA 5IJ9B 1J9ZA 3H5WA 4CMIA 5EWJA 2P4VA 4ZD6A 1UKZA 3A1VA 4N5HX 2GBLC 4EYSA 4R40B 1IV2A 3VZQA 1Q6HA 2HA7A 1OR8A 5FUQA 4HQKA 3HBNA 3KEMA 4BAZA 2OV1A 1K4CC 3DBVO 3RFVA 1TYCA 4Q82A 3IRUA 4PDRA 4TXMA 2DTEA 3C6ZA 4TRRA 3ZRVA 1X7XB 5EJ8A 4NYIQ 2YICA 2RMKA 3OKFA 5BP7A 3G13A 2NU6A 2VQFB 3ZK9A 1ZCJA 2ZULA 1KJIA 4L4ZA 3JAWB 4XZ3A 1NXPA 2R8PA 2VJBA 2CDRA 5C3UA 3OAAA 4X8MA 3ZDBA 3VMMA 3I64A 3DE3X 3AW9A 4FOTA 1FY2A 4HGOA 5DM60 3LECA 2B4QA 4OKSA 5PGMA 2NTYC 3K9WA 3LC1O 4ZQHA 3QO7A 2P62A 4ITRC 2O8FA 3IE1A 1QS0B 2XZDA 1IY2A 2KE5A 4LXXA 4RZSA 4PYOA 3MHSC 3FOCA 2FEXA 1ZN9A 5J9FA 1F0KA 4PBRA 4KSYA 4MTLA 4V2IA 2EZ4A 2JGDA 2VL7A 1PNRA 2RHGB 1O77A 4JTAB 3VSDA 3I4LA 2FFRA 3L04A 5KWIA 3PGKA 3BDAA 3J80N 4M0MA 4N03A 3KOZA 2ES4A 1NQAO 1P0MA 3IVMA 4Y1RB 4MWDA 1O5TA 4MS3B 5H9VA 1V8ZA 1O97D 2AMYA 1CZLA 1KJYA 1WHSA 3EXAA 2VSXA 1H8HD 4MUAA 4LFAO 2IHTA 1N2BA 3I52A 3OE7D 3ZHZA 3BILA 1WJZA 3SS9X 4BATA 1KU6A 3CA8A 4KMOA 4DV1O 3VR5A 4M2LA 3Q12A 3GYGA 3RFRA 3BH7A 1QV7A 1YK0A 3AESA 3EVZA 3DE4X 3QLEA 1KI3A 5GTIZ 1GN9A 4WERA 1MN6A 2X2EA 1E6MA 1T9GS 1K92A 2JD2A 1XI1A 4EM6A 1K9MW 4PXSA 3FTPA 6ABPA 3S2GA 1FRVA 1E7MA 2ZANA 3EGDB 4K9MA 1IPAA 1X80A 2WF7A 2GBIA 4MR7B 3ZN2A 4BE9A 1S8OA 1IL0A 4HMQA 2NUBA 4D5EA 2DC1A 1Q5OA 1DX4A 1R0WA 2J0SA 2ONYA 3DV0A 3WFVA 3SC4A 1OX4B 1E1CA 2BFAA 1R0CA 4B2PA 5HHTA 4R8SA 3GLFA 3ND7A 1G1MA 2YJ5A 3U10A 1H69A 4L75A 1AQJA 5JCOA 4DXAA 1OFTA 4DNPA 3KTOA 4U9UA 4R9RA 2HUNA 2GCOB 4ZOLB 1EBBA 2HBZA 3SPCA 1FYEA 2HFKA 3AF1A 2BGRA 3OT1B 1QBGA 4FDMA 1E7QA 4AZ0A 2ZLBA 3DLCA 5FA5A 3Q4HA 3ZGZA 1OKKD 2OORA 3KPUA 3T15A 3NETA 5KYXA 3PEYA 2WU8A 2HF9A 3TB6A 4BMNA 4NMHA 4O2LA 4OHPA 4IQ8A 5BORA 3VYSC 4INZA 1MC4A 2NZ2A 1K73W 3ND9A 2R9VA 4BV8A 3NBAA 1ZAYA 1YB2A 5C7LO 3R6DA 4YT5A 4E4TA 2O2GA 3ZG6A 4OLAA 1G18A 1QHHB 3IB3A 4LHSA 4EFLA 2EILC 2GKSA 2WYIA 3JQFA 2GAAA 3HUUA 2CE7A 3VNVA 2O0HA 4ETWA 4TWJA 1S4MA 4MQLA 1URFA 2Q6VA 4BVBA 1QHSA 4R1MA 4JI8O 5CJPA 1WBDA 5LUBA 5AK5A 1THTA 2WG0A 4UFZA 4FFMA 3EQ6A 5LYJF 3KCNA 3K8YA 3EZ2A 3OR7C 1YOVA 3L0DA 2ISQA 1K6MA 2BDTA 3GLHE 4PA9A 2GHTA 4ZAZA 2V7BA 2CXRA 2NZWA 2AW5A 1HTTA 5AO9A 3K3WA 2LCAA 3QA3E 3A1UA 3RS9A 3QEBZ 1KDYA 7MHTA 3T1HB 1ZNXA 3BTVA 4GZ3A 3CCMV 5FOVA 1LZLA 5BT9A 1F7YA 3P2KA 3NDRA 4MYRA 3NV7A 4GMHA 5DIZA 1S1MA 5FNZA 3AKZA 4KHPB 4MVOA 3N6VA 1C3VA 4FZ5A 2G25A 2BFCA 2GI4A 1WZCA 5DCVA 1VSBA 1BE0A 3IP8A 2M6LA 3A1DA 2Y93A 4BRZA 4C2BA 4X5OA 3SOPA 3CLTD 2PX3A 3DVAB 4QU9A 1I5YA 1ZUHA 2Z9DA 5TNXA 2V3CC 4FBGA 1K7FB 5TJ9A 2R7LA 3BFJA 3FYTA 5CT4A 1ODSA 3JQBC 1R3UA 3ZWDA 3R9KA 1J49A 4ERNA 3II6X 5L6LB 1CVLA 3TGUH 4YR9A 2PKQO 1X87A 2FUG6 2JIPA 4OI4A 3NCHA 3QG1A 4Y2XA 4DANA 5KSPA 2HY7A 1T2CA 1NIJA 1YJBA 4EA9A 4UTOA 2C92A 1SUEA 1YZ3A 2NP7A 2Z2KA 4YV0A 5C3MA 3GGGA 5EPEA 3BEDA 4DV7B 1YTUA 3BRWA 3AIIA 2HT1A 4EUNA 4INOA 2MWMA 2FUG1 3JASA 3F67A 4EJFA 3RQSA 1US8A 2C9DA 1OHHA 4INPA 3DDZX 5JAPA 4DSUA 5TLSA 2WJZB 3WKAA 1V5IA 2BE3A 2W8ZA 3PRJA 1J4AA 4BO7A 1XTIA 2NSJA 3SE0A 2MINB 5IHPA 2XNDA 1FFXA 2E4YA 1W73A 3IP5A 2V59A 4W4TA 5DM2A 2RH8A 4PV7A 3UZUA 1FNCA 3A0HZ 5EZYA 1EA7A 2J08A 2VWJA 5J4LA 5FWDA 3KZVA 1XTKA 3WLLA 3OCXA 2EJRA 2A67A 1XG5A 3RUCA 1T2UA 3UHJA 5ENDA 5H3CA 4R0MA 3AL3A 3QNWA 2X6BA 1LWNA 2F3TA 1FDOA 1LDEA 1SKQA 4K8XA 3V8RA 2EIJC 5DE3A 2ZQZA 5B1EA 5DM4A 2HNAA 1LS1A 3PKIA 3WGZA 3GLKA 4RAQA 3WXMB 1TLLA 5LQCA 2ODQA 1E1QA 5CYFA 3A58B 5KX5A 2B94A 1OH8A 1USWA 5ECGC 1H2NA 2YV5A 5CFLA 5DP1A 5THKA 2ZRPA 3OUZA 4XDGA 2OPBA 2EGHA 2CUNA 2XB4A 3GP8A 4X92A 2ILMA 4NF2A 1DRVA 1L7NA 3W2HA 2UUBO 5CA3A 1EFTA 1T6XA 3E58A 3RTBA 3MGAA 4BWFB 3U3KA 4GVXA 4UHJA 3LPNA 2DZDA 4YY3O 1K3TA 4JT4A 5I01A 4KE9A 3H3JA 2BKEA 4XVQA 4EFBA 1ILEA 3RIEA 3ACBA 2JI7A 3WLAA 1JEDA 3VDRA 2A9PA 2W4MA 4H7JA 2A0UA 3EUEA 3CH5A 4L4UA 5I51A 1TYBE 5FNVF 2G63A 5L7YA 4YRSA 4INAA 2I4IA 2EBOA 3FGOA 3DF9A 1GNQA 4RYLA 2ZDHA 3K0HA 3K0AB 3SJ7A 1DRKA 4WEOA 4MVWA 1L4EA 2NPOA 1CZRA 5FR2A 4YAGA 3PQ8A 2KLHA 3OQMA 3KT0A 3VDXA 3LF1A 4U9HS 3SK0A 2C07A 1FUYB 5HMLA 2WIBA 2W42A 4PSCA 3E20B 1W88B 4YRLA 1ESMA 5EJ6A 2KLBA 3B60A 4W5QA 3B2EE 3CNNA 3BMCB 2XPCA 1GGHA 2DCUA 5I8WA 2XWJI 2HX1A 5J5AA 2QX6A 3T3GA 1UF9A 2FZWA 1OLSB 1G2QA 4BU0A 2OCCC 1LF5A 1CR0A 1L5HA 5EINA 2JIZG 3AEZA 3S4YA 4DLBA 2IJHA 4JYBA 5AW5A 3SGLA 3DGFC 2YUIA 1TYDE 2QVZX 3I9V6 2C77A 4M21A 3NM5A 5JSYA 2IZ1A 1V1MA 3DBRB 3V3KA 4E3ZA 1J1UA 1KOLA 3RFCA 3AI3A 3HDVA 4OQQA 3B5IA 4FX5A 5EOVA 4CEHB 4ETMA 3BHNA 3ZIAD 1NJSA 2BD0A 3OBWA 3QFFA 2IRWA 4OHVA 3UV6A 1NVVR 4MUBA 1Z37A 3MHTA 4HS9A 4NBLA 3ZS9A 4EABA 2XECA 2HFJA 3T4XA 2CLEB 1JL3A 1ENOA 1TZ2A 4JQSA 1FU7A 3EPKA 1SBZA 3DAHA 4C1NA 2H3OA 1E6LA 1SQSA 5AK6A 1W36B 4IAOA 3EMDA 4P4UA 1Y5RA 1FUKA 5LGUA 4IP0A 5IXJA 2X42A 5GZ6A 1QE0A 3SYMA 4QXMA 1KFJB 3FPEA 4HNSA 2XIJA 4E88A 3K2IA 2RI6A 1Z8DA 3ANSA 5CVTA 2X86A 4HXYA 3WAKA 5BYBA 5ALWA 3UVEA 1IPEA 5AVOA 5MHTA 4KN5A 5C8VA 3PGJA 4K35A 1ZD9A 2MT9A 2G0AA 2XTJA 1DJPA 2UVPA 2C5HA 2RG1A 3QENA 3CO5A 2QSUA 3CP1A 3AK3A 5B3SC 3SHWA 4W1SA 4P4SA 1YASA 1W2HA 1ULHA 2FUNB 4L8GA 3BXHA 1NOKA 3TW8B 1USKA 4A8JC 4QPCA 3GEPA 4WEQA 3TVTA 1LB1B 1QZ3A 2OHHA 2PU5A 2IDKA 4ARZA 4Z51A 4H13B 3ASOB 2W6QA 2CH7B 1BRTA 2FB5A 3EXEA 1MAHA 3OZCA 4PRLA 3NX4A 1SURA 3QHAA 2K2QB 3IR5A 5EIBD 4X89A 2RH5A 2CGEA 3EWAA 1F38A 1GLNA 4TKZA 4YDSA 2P9QA 1I14A 4GX0A 2WB2A 2Q4BA 3FH0A 4FYMA 1PL6A 5F7XA 2H4JA 4RKYA 5K0GA 1P9LA 1HDJA 3C4QA 1XVVA 3NAQA 1ACLA 4EPTA 6NULA 1XTUA 1LSUA 4RHUA 4L16A 4B0OA 5FLXM 5IBQA 3CD6F 2BI7A 3UWKA 1CZNA 2QW1A 1SC1A 2X9GA 3T0GA 5ALFA 3TTXA 4NBVA 3D3QA 1NT2B 4FE4A 3AU8A 4C0JA 2WWYA 5DBGA 3FWKA 3IC5A 2QPOA 2RHDA 4TV9F 5C35A 1OIXA 5CB6A 5JTTA 1YO6A 3PNLA 3QEJA 4OM7A 3FD5A 1N9GA 4CMCA 3G4SF 1FXVA 3HJCA 2Q5QA 1F0NA 4IV8A 4P6VF 3R7BA 3H6GA 4B6JA 2H2HA 4X90A 2F66C 2FFBA 5B1BB 3IUPA 1QLNA 4NPHA 3U7RA 3LZCA 4B5CA 1D0SA 3ROXA 3WA7A 4EGJA 2Q29A 3NHUA 3DL4A 3VVMA 3LZ6A 2XAQA 4G01B 4KQJA 2BTQB 4UFOA 1U3VA 2YC0A 1M8KA 1IOLA 1NV9A 4LBYA 5ES3A 1E8DA 1EDEA 3I39X 1ML4A 1JA8A 4G4WA 3PGMA 4K3VA 3EIOA 4LZOA 1SVWA 1Z0AA 3FPHA 2QE7G 1T2FA 1D5CA 1DT3A 4ES6A 1JG2A 1BYIA 1ZVMA 3G71F 4MVJF 1I3MA 1M2OB 3OFJA 1HYGA 4FXOA 1CVIA 3P9NA 2OHFA 1WSWA 4EOGA 3WL8A 4YCSA 4MAFA 1M8JA 2ISCA 16PKA 2Q5EA 2GUZB 1MQ9A 4QUGA 1DEKA 3H1JH 2HLDD 3K12A 1C1HA 1ZWLA 1Q6YA 3KLMX 3PQDA 1FJXA 1N6IA 3AWDA 3GJ7A 2PMWB 1YVEI 1MG5A 3IQGX 3GGPA 1T9HA 3E18A 4WLEA 4JOQA 2O2ZA 2P40A 4X62B 5ALZA 3PJEA 3D1LA 4J42A 3O4GA 3KHUA 2XODA 2VGMA 3R44A 5AJVB 5C53B 5AQ1A 2PI5A 3CWBH 3PHLA 3VKUA 3WDKA 2ISSD 4KQXA 4Y9DA 2HJWA 2UYKA 1UIRA 5HW0A 5J2TF 1NBMA 4CT4B 3VH2A 1QIKA 3ZH2A 3BTSA 1V3VA 1IZ3A 1EINA 5E3IA 4PHGA 1M75A 1MOSA 1K3EA 2BF4A 1S3GA 3F8WA 1SWVA 2JAWA 1G9TA 4XCXA 3HJRA 3R7FA 3QEKA 3HKBA 3T0IA 1ICIA 4AQDA 4NZZA 2HU2A 5HSGA 4R51A 4BO0A 4CC6A 2J3DA 5K01A 2OCDA 5TXGA 2ZXWC 3O8NA 2IHVA 1VYHA 4WSOA 1LBIA 1A2BA 3WRYC 1LUVA 1YSCA 2Q9LA 5KQRA 5C51B 4FHDA 2PVCA 4EW6A 3GPBA 6PFKA 3N2GA 4K2HA 4FK5C 4IIYA 2ZTMA 3QKSA 3D8HA 4DEXA 3K0BA 3CIOA 4KYUA 2CTWA 3MTJA 4U02A 1P2TA 3TAUA 1W1UA 2R4UA 4W4LA 1UJ5A 1JDTA 1VEWA 4BGIA 1G3UA 1N0IA 2I1QA 4BLQA 1THMA 1RAEA 1W0CA 1B23P 4MR8A 5LMNB 5K05A 4R0NA 2D5IA 1XPJA 2RIPA 2WJ6A 3GJ4A 5C7IO 4BQQA 2YWFA 4E51A 2HTFA 3FNBA 4QUAA 3C8ZA 3K04A 4Q4AA 2Z30A 4Q39A 5LQUA 4NOKA 5AKIA 2WPDG 4KNVA 4HVTA 1RKQA 4V02A 1CNMA 4GPZA 1CZOA 2O3UA 2ZRCA 4QUHA 2PL1A 3W7BA 1V5FA 3PQCA 5AW6A 3HUFA 3E9ZA 2XUQA 5FI0B 4OXSA 1CCWA 2VDPB 1DC6A 1UR5A 1GL6A 4L2IA 4KFUA 4UPDA 1E4OA 4L74A 3O92A 1CJMA 3UHOA 3NTLA 4UVDA 2EGUA 5DM70 4K9QA 2EX3A 3MTBA 3IGAC 2ATIA 1ODCA 3FUWA 4BP1A 3DDSA 3Q3JB 2V8BA 4DNXA 1R8SA 3ELDA 3IUBA 5ELXA 3GLFE 4I81A 5JMPA 2CN1A 5E38A 3M4NA 4U7WA 1H6AA 1RAFA 1UBLS 3S2SA 3L01A 4S2EA 1AQNA 4MV8A 1L4LA 2GLXA 5LJLA 2NMUA 4R8KA 3QLTA 4LYJA 2AYYA 3F7TA 2P22C 2EIKC 3GWGA 2P6MA 2FW0A 1QQ6A 3G9ZA 2Z1UA 3DE0X 3VX4A 3NBFA 1O94A 4YJGB 2NYUA 2F43B 1Q82H 1N3LA 1L5RA 4PG5A 2OQ2A 3RUFA 2W6MA 4YS6A 2JIMA 3LNTA 1Z4NA 5KYTA 3AI1A 2QZJA 1RC0A 1A7UA 2R25B 5L3ZA 2ZOSA 4D0RA 3P2IA 3TFQA 2AFHA 2AJ8A 2Z1FA 4W9NA 2R48A 1GQYA 3TLYA 3GJ3A 4YRIA 1FE8A 4D98A 1G7TA 4I9NA 3EZGA 4IZHA 1ZVKA 1BQ3A 5CYGA 1ISPA 2OUKA 1XDWA 1GTMA 4XDZA 1PZXA 3W3AA 1PFWA 1MVLA 1Y7TA 2RAVA 3D7LA 3DTVD 3W5AA 4DV2B 4X1IB 3MWDB 4IFTA 1E2NA 2PGNA 1B06A 2BAGA 3SZUA 1LWOA 1NF8A 1CP2A 4ENRA 1ADYA 2WLKA 3A8TA 2V45A 3RAGA 3DLTA 1TM3E 3R4CA 4BR6A 1S1CA 3H2SA 2PU7A 4B32A 5HFJA 4C7OB 2YY6A 3NOOA 4AO6A 3RG8A 2QA5A 4F9TA 4CYMA 4WADA 2PZAA 4I99A 1NQOA 3DZDA 2VDOB 4OYHA 2FLVA 1U0EA 2QT0A 1SZJG 3H13A 3KL4A 1BE8A 2WZQA 3VISA 3RTCA 4LECA 3KD3A 1P81A 5CDHA 4Z3KA 2E1RA 3GU3A 1EVKA 3PFBA 1A9QA 1U2PA 2RHTA 5BV8A 1E5LA 2IXAA 4QTTB 3NC4A 4XDYA 4XM0A 2J7PD 4BNFA 3DFKA 2DERA 2FB9A 3CCVF 3KE8A 521PA 1T8SA 2DM6A 2GA9A 1WY7A 3NT4A 2YVLA 1X7OA 2I6FA 3SKYA 4A1OA 2BE9A 1PL7A 1CZKA 4MO9A 1LJ8A 4X41A 1O57A 1X1QA 1GZ0A 1ZM7A 4LXUA 1HWYA 1E9DA 3FYSA 4KVZA 2IH1C 4LWZA 1V16A 3H7AA 1Z22A 2PSSA 1WD7A 3LYLA 3D31A 1IX9A 3CLRD 1QV9A 1Y9EA 1BOOA 3SJAA 3G5UA 3G8AA 3LVRE 2JGFA 4D80A 1PS0A 3EARA 3A26A 5JCOC 3KTAB 1H2LA 2WE7A 4BMDA 4I6GA 5ECYA 2H52A 3OU6A 1D2GA 3RWRD 1KHHA 1XDCA 2IUTA 2CNDA 1Y7LA 2OTMA 1UDCA 1WLYA 3FTCA 4DIEA 5GM2A 5FPTA 1SHZA 1T1GA 2OORC 3TQFA 4KR6A 1S5JA 5AVKA 5F52A 3JATB 2IIQA 1SQXH 4AICA 4TKMA 4DLUA 3V32A 1RE0A 2AV6A 4MW2A 2G72A 1I33A 1XELA 4OQYA 2ZOVA 4NJOA 1PV0A 2GM5A 4Q3EA 1WPXA 2NZ8A 1I08A 1OXXK 4AILC 3SM3A 3M1LA 3KQNA 4QAQA 1G64A 2XUKA 4UCQA 2AW3A 3O84A 3VUFA 1SVKA 3MCUA 4EK9A 1TEXA 3PF9A 4RMNA 1BDHA 3F6PA 2DPHA 2QT1A 3E5MA 3JQFC 2AG5A 3R9WA 1DNPA 4UFPA 1FZQA 3W5CA 1X1SA 2V4UA 4EYQA 5IHXA 4MQBA 1LPOA 4MTFA 1XMVA 4GUAA 5A4IS 3KR2A 2AE2A 4WVFA 4J7ZA 1EBFA 3N86A 5IPFA 5LB2A 4Q20A 5I3CA 2ZYWX 4CQLB 5B4VA 3T34A 4AD8A 3JQRA 4XIIA 4B80A 2JFXA 4DVGA 2QR5A 2ZYTX 3DQQA 3W34A 1GT6A 4MW7A 3EWIA 3HQ4O 1SAYA 2I9PA 4DJDC 2OXEA 2GPAA 3ZD7A 1VMDA 5ADHA 4DR2B 3B7PA 4KGZA 4RQFA 4QPJA 2QMUA 2Y0EA 4BX9A 2ECQA 4MYSA 4K8RB 3MLAA 3GCZA 3LWPC 3RU7A 3UQ8A 1CK2A 4MJ3A 2WLLA 3OOYA 4BQIA 3P9YA 2ZRNA 2Z1EA 1MO6A 4EH1A 4PDVA 4KJXA 3T7CA 3GLUA 3W8EA 5INTA 1I24A 1A96A 3SZ3A 3U62A 2OD9A 2V7QA 2BMEA 4I7ZB 1OWOA 1KYYA 3D7NA 3WO1A 4D99A 1OFUA 3MA0A 4UHFA 3AUXA 3MJRA 3C3DA 4R5MA 1RAGA 2EP5A 3C0KA 5EHIA 4JVOA 2H48A 5LFAA 2P06A 3HZHA 3I58A 3N7TA 4Z1OA 1TAQA 4IJ5A 4RBNA 1YGPA 1L1RA 3AETA 4FFBB 1C8KA 3EFHA 3DMRA 1F4MA 1N78A 3I01A 1N2ZA 4HPJB 2BEVB 3H83A 3ZNQA 2QNBA 3QXJA 4DZZA 3VYTC 3RAJA 3L6OO 4CQNA 3L4KA 4HFJA 4M1TA 3GMSA 3K0FB 4ALLA 1D1TA 4AY4A 4MRRA 1R6UA 1TADA 4BN5A 2B2CA 3AVYA 3CNQS 5KWVA 1XRJA 2W37A 4H33A 1CXZA 4LUCA 3UGJA 5AKLA 1H5QA 2H08A 1OB5A 4RPGA 1IPFA 1RXUA 5E9QA 5EA2A 4EPXA 2BELA 1PEAA 2ETXA 5BSFA 4FW9A 3B6IA 4U39A 2XYQA 3TLEA 2WP0A 3GDGA 3NC0C 4JUIA 4OHKA 1TA0A 1WMDA 1XFAA 2KQXA 1GYPA 5FB3A 4EMBA 1QIIA 5B57C 4A23A 4W6ZA 1XQYA 3OBIA 3G80A 4LYHA 3K57A 1I6MA 4M3NA 2I33A 2LGQA 1XCLA 4JXKA 1IXYA 4QVGA 5BVHB 2JCGA 3PJSK 4G0VA 3QYFA 4CM9A 1PZMA 1WX1A 4ALNA 3LWZA 2C2OA 1W7AA 3GHYA 4NH4A 2P7HA 3TL6A 3IT0A 3QNEA 3ORFA 1EVQA 1BMDA 2R85A 5SY6A 2C4HA 1EVYA 5JSUA 1SZCA 3LLUA 3CE6A 4O3MA 3SF8A 2LP7A 2DX7A 4MW6A 4MYHA 4D6XA 4NMWA 2DWEC 4OUDA 5I6DA 4FDVA 5JSZB 1P0IA 1T34A 3OFNG 1PX0A 4P5EA 3X2SA 1YU9A 2P8SA 1QTRA 3S81A 4MW5A 2CXXA 4MVMA 3UBMA 1FFAA 3NBUA 3ZWNA 2O0LA 3ZR4B 3K5PA 4AKSA 2IX3A 5SY4A 4E4YA 4UZFA 1ENZA 3QPWA 1ZSPA 5DNAA 3C6YA 4CM4A 1KMIZ 4FHCA 2IXEA 2QAGA 4JC5A 3CCQV 2A3RA 4HDNB 4BT6A 4DABA 3DOJA 2Q41A 2XX3A 3OPYA 3EGCA 3HU5A 4GOND 1L0BA 4YRZA 3OLWA 3ABKC 3PYLA 3LLCA 1XHEA 3TECE 1ZIYA 3KZNA 1ZUWA 4D4MA 1WXIA 1SJ9A 3L70H 1TQ2A 3ZK7A 1GGNA 1PYGA 4P33A 1QFMA 4EMUA 3UG7A 2A0KA 1R6DA 5B6PA 3K70B 1WNTA 3QQPA 4G1VA 1X59A 1XZCA 4KO3S 1Q1QA 1MJGM 1KH1A 1MOZA 4YUXA 4H6PA 1VK3A 3L0ZA 5EVCA 2OXTA 1WZIA 4DCUA 5CCXA 4EEKA 4AQ7A 1YJWF 3H86A 5I48A 1WCWA 3VBCA 2RBKA 2JCXA 2JVKA 3GPDG 1XUQA 2BGMA 4XQEA 3MGBA 4D9EA 4EG6A 2AQHA 5BXZA 2Q4OA 4OQZA 5IUJC 3NYIA 1AKUA 5DRTA 1RFLA 4W1RA 1C0KA 1OFHA 3TPFA 1SULA 2VDLB 3IXQA 3R6GA 1RAAA 4JVSB 4RELA 2F55A 4D3DA 3N0WA 1EFVB 2J0UB 2NO9A 4FYJA 1JPNA 1AU9A 3SICE 1Y7HA 4R8CA 1CQIA 1OU0A 4BL5A 4BNDB 5DGDA 3WHKA 3UJNA 4K9OA 4DNOA 2Q3JA 5C4GB 5I5GA 4UCRA 2FC3A 1N1EA 1N0HA 4TLCA 4Q7LA 1CIVA 2WSIA 1CFZA 5K5EA 4RQBA 1QPGA 1F2TA 4LKOA 1XEWX 2Q69A 3M1IA 3VPXA 4JAVA 1ORDA 4I9HA 4IO1A 5EEHA 4AI6A 2EZ8A 1FVXA 4KR7A 4F3YA 5JXHA 4JS0A 3VFDA 3NWOA 4B6FA 3IUQA 1XMIA 4ZCPA 4I50A 4PO8A 3Q40A 1OTYA 3LBYA 3JWHA 5ITWA 3BIOA 2YRXA 3IESA 3FUXA 1QLEC 3E9RA 3KL2A 3UB3A 1NVDA 5LOVB 3UK6A 1ML3A 4BO8A 3H1EA 4CF3A 1NLZA 1J6UA 5GAPK 1B2LA 2BKLA 2BEUB 2A0WA 4Y30A 4FWTA 1Y63A 3TKAA 3EB9A 1T6BY 1TD1A 4N5NA 1TJNA 3ZD8A 2MCFA 4AP9A 3R75A 2BKXA 2PTGA 1MFZA 1D8TA 3JSAA 2IU0A 3Q1KA 1YI2V 3G59A 4QYMA 1AB5A 4BBJA 4Q37A 1YD7A 4KIWA 1WPBA 1RM1C 3B9BA 1CDZA 2WUDA 1U0SY 1KH3A 4BFZA 3EVBA 2D7DA 2CSLA 1T4BA 2C82A 2B3TA 5SZKB 5D1HA 4BV3A 3HZRA 5IJZA 1KR2A 1ZDMA 3R7WA 3NANA 3PSHA 3VZRA 4URUR 2VPYA 2QZSA 1CUJA 2B4YA 3SIVA 4M0PA 2WA3A 5C31A 1ZGAA 3E0QA 1TZBA 1NBME 4MZXA 4JLUA 1E9EA 1PNQA 3R66A 5IT9M 1ETUA 4Q18A 1XDGA 1WB9A 1S5HC 3VU3A 4ZK7A 4MW9A 5C7YA 3CSXA 4RLSA 1XD9A 3JVDA 2AJTA 5AH0A 4KOEC 3ZV6A 3K06A 2X8AA 1M0WA 2WILA 3FNHA 1UPFA 2ZAYA 2CMGA 4MQ4A 3QSYA 1SXJD 2I34A 3O47A 1N0JA 1V1RB 3K2BA 1W2BF 4INJA 1RXSA 1MMFB 4X6UA 1XZGA 2EFJA 4UW9A 1ZR2A 1EFRA 2JLBA 4W5TA 1IN6A 4HMOA 3Q11A 4FZRA 2QM0A 1UEIA 2OUIA 4TZ6A 1JPVA 1EBUA 5BMVB 5JWOA 2ZBVA 4X7PA 3PDHA 3E89A 3EUAA 4HGRA 1OPXA 1ESNA 2H5IA 5IDYA 3C2QA 1RTTA 4X54A 4B35A 2VHJA 1G1AA 4JI5B 3HHEA 4R9SA 2AFIB 1GIAA 1H2ZA 3JAMA 3GQVA 3SZGA 4BNHA 1C1XB 1SXPA 3KAPA 2I03A 4IHKA 1V9CA 5JR3A 3WFJA 4CHTA 1RZUA 2YWEA 2UZIR 3PNBA 3SDSA 3RA6A 3CBGA 1H2FA 5GWXA 2ZUDA 3L07A 2WHPB 4KBFA 1AG9A 3WR5A 1BW9B 2RN9A 1HEYA 5F98A 2FK8A 5G2OA 3D3JA 3RVJA 1TU0A 1EWTA 4TLDA 3VVCA 2GEJA 4MINA 3L6CA 3RHSA 5LQNA 4HO1X 4UE6A 1OZGA 4RE6A 2CMKA 2O3RA 1NGSA 3FCOA 1SUAA 3ZDAA 4DLLA 3LXMA 3LSUA 3VNSA 3TTSA 3OTQA 2HSJA 1UH5A 4UHBA 4L4YA 3AFOA 2G1JA 2XF8A 2QAJA 1Z25A 3HHPA 1CR1A 4JA2A 1DBIA 4Q3LA 4DARA 4HSEA 4OHYA 5E6SB 1JAIA 3N58A 5I9SA 5L3BA 2NVUA 4RXTA 2DULA 2KSDA 3C7CB 2H1RA 4F8JA 5E7QA 1BHSA 1F3OA 3PJFA 3TEJA 2GF9A 1Z5GA 3RAPR 1YHZA 4RLQA 2QJFA 4UHHA 5DWDA 8GPBA 1JLMA 2R97A 2CCKA 4RF4A 3K73O 4KLRA 3V80A 3ZN1A 4AI8A 3PYMA 4Y2JA 2PSEA 4YCNA 1VGRA 2GJSA 3D6HA 3CSUA 3ELWA 2LBTA 1JH8A 3WJPA 3VMFA 2BSKB 4PANA 2BFBA 2XKKA 4U2DA 3T7AA 5G53C 5IM4A 1MEJA 5DO9A 3I5XA 3A1NA 3ZRSA 2X77A 3V4FA 3OC0A 3IURA 1WNSA 1UMDA 2OCBA 3SQDA 1KORA 1JKJA 1GWNA 3A9VA 4D96A 1B26A 3OQJA 3EPJA 4R7CA 3JRNA 1C3OA 3W8RA 1T0PA 4Q9IA 1T4CA 1YMUA 4RDCA 4EJMA 3D6VA 3AB8A 2MYTA 4YV2A 2FP3A 4W8OA 4J7JA 4YEDA 2AFHE 2XITA 5KOYA 4ZEMA 3PQEA 2F1IA 1JTVA 3O9MA 3UUWA 1EVJA 4E70A 2Q46A 4CGYA 3CCUV 4J1TA 5IDWA 2R8RA 5E7MA 1TYZA 1CE8B 3VU0A 2I2BA 2P6JA 5TPWA 1E3WB 1GR1A 4HYEA 3OGCC 1EQUA 3CVXA 2OSBA 5HDQA 3KSUA 1S7GA 3MB8A 3P9PA 1Y76B 1WWKA 1JXMA 3NQ41 3QFRA 2Q8QA 3BL6A 2ODWA 2V9PA 3ODPA 1V96A 3MZ0A 3UNXA 2DMRA 4DZRA 2VHEA 1O96A 5ESXA 4EB8A 3EGIA 5BYKA 3RC7A 4AJKA 2HI0A 1W5SA 2ZNIA 2A9KA 1TLFA 3BQ9A 3DEHA 3I9OA 2V58A 2V7XA 3R6TA 4JZ2A 2FX3A 4PM4A 5I7AA 1F0PA 4NCXA 3AVTA 4YO7A 4JLJA 2DW4A 1D2DA 1RBQA 3O93A 2GJAA 1S3SA 5ALOA 2C7OA 1F2UA 5IK2A 5E2AA 3I0MA 2JVDA 2XEDA 2EHJA 3SVLA 2G83A 2EP8A 4D9MA 3GVPA 3OI7A 4CLOB 1VXOA 2DJIA 2EIXA 2EIHA 3BDIA 2JW5A 4GZ6A 2JRIA 5FD8A 3B6JA 3OVMA 5CG1A 1V7PC 1Z08A 3R1IA 2INGX 3PX2A 1E18A 4E7OA 4BIOA 1QDEA 3NZEA 3SXPA 2Z0AA 3FA2A 3IEPA 1UFIA 2WHXA 2I6RA 2C2KA 4BFLA 3N4ZA 1J5PA 3ICVA 2TECE 2PQ6A 1MT0A 2VRCA 3RHFA 5F9HA 3A05A 4LR3A 1C9DB 3EULA 2XYGA 4RABA 3JQPA 2OGTA 1OX6A 4EPRA 1YT5A 3G67A 1DC3A 3HCAA 4QZVA 3ZGXA 2UYNA 1SUWA 2DAPA 3O73A 1FYJA 3MS7A 1ESZA 1P1BA 5AXBA 4B4OA 1I7FA 3D1VA 2J5BA 4P9NA 1ECFA 4KPUA 2QUJA 4CUZA 1FS5A 1RM0A 2IU3A 1U9YA 2HMYB 1AN0A 4BCBA 3THWB 3UKMA 2KSQA 1WUJS 4C89A 3TXXA 2B8TA 4ZYZA 3HYNA 1NA5A 4TLLB 1ABBA 1KY5A 3WLJA 1JIXA 1OT5A 3ETJA 1IHUA 1JQJC 2QRJA 3MMSA 4UNRA 2ZT8A 1U40A 2LQTA 2W6NA 2WTEA 1Y89A 1O94C 1ZU5A 2FMUA 2VHYA 3BFPA 1TAEA 4E32A 4CS2A 2PMFA 4I55F 4YPOA 2AB0A 4EQZA 5JAUA 1XL6A 4MVZA 3FPKA 3EXG1 5AJYA 3RSQA 4NE2A 1VJ5A 5JCJA 4JMPA 3TTWA 2O1XA 1Y5MA 4W9NC 3H2KA 3TSWA 5A2QN 1Z6TA 2F3UA 2OKGA 4EHAA 3PUJA 2W6IA 5T3YA 3PGA1 1E2MA 4GR4A 4UVBA 3K5NA 2CMFA 1TM2A 4Z2WA 4FGWA 4RY0A 3FAVA 4G1UC 4FYHA 1E8MA 1UIMA 1JR3D 1FLAA 3GXBA 1VQNF 4DA8A 2BR5A 4R2WA 2GLZA 1EFKA 2O19A 1BCRA 1U8EA 4JXXA 5J4KA 3FFTA 1FRFS 3VTFA 3OEED 2FMXA 2ZYSA 3IPLA 4MV5A 3FW1A 1HNNA 3HO8A 3G0BA 1ORRA 4WOKA 3EORA 4D82A 3E1SA 1W59A 4WBNF 4YFYA 2W43A 2H2AA 2YV3A 4KFTA 2V97A 2VWHA 4A2PA 5BMOA 1TK2A 3GWZA 4CH6A 5TQ0A 3BS4A 2QUBA 4WH0A 3P2OA 1M6VA 2P9YA 1WV0A 3Q2OA 3OEHA 2ZRLA 3OCYA 4MGZR 2RKWA 1VJCA 2W6JA 3MRVA 2MDTA 2X1LA 3CB2A 1PNOA 4IJQA 1W581 1M83A 1W19A 4G0YA 3GV0A 3FI9A 1LVGA 1C3XA 4GOJA 1Y3FE 3HXKA 1SZXA 3TEMA 5GY7A 2GN1A 2NUPA 3JQCA 3F47A 2Z9BA 4IKOA 5JXJA 2WC1A 3RVSA 1TUEA 5KTMA 5F7OA 4OPHA 3D5TA 2RHOA 4KXFB 2Q68A 1CRQA 3W9UA 3ZY6A 1I0IA 1E66A 2ZJ0A 2A1UA 3CPSA 5BWMA 2RB4A 4UDXX 2I2WA 5LA6B 4PIMA 3QJGA 1E62A 2PS1A 1DAHA 2YR0A 1JDNA 2AG6A 2FSHA 2E1PA 1G0OA 3WLOA 1HGXA 5LPNA 3AG3B 1NUQA 3T52A 3M89A 4MVJG 2XCSB 1KSJA 2AKAB 1SOUA 2YXNA 3SJAC 5DM6V 5T8KA 3EGWA 2ZP1A 4YAIA 2QTGA 4QASA 1E4VA 5A9SA 4EB3A 4PD4F 3EGEA 2KS6A 3BFVA 1I5EA 1QD9A 3AUYA 3D59A 5DRYA 3J7AC 2LUOA 2OFWA 3PD1A 1NXWA 4C5BA 1EG7A 3SHOA 3ENVA 3IV9A 3QUSA 1JSRA 1WDLA 2VVTA 3DOUA 1I3KA 4FGJA 3PD0A 3D6JA 5I4KA 4C07A 1RQ7A 5LP6A 4KQGA 2DYRB 3NIGB 1OMOA 1SN7A 4JYYA 4D3XA 3ZYZA 5EKUA 4DDUA 3RS0A 1ZVQA 3L6RA 4GSYA 4MI3A 4BEJA 4P30A 2D2IA 3WB1A 3HFJA 4DIOA 1AHNA 2WT8A 3REQB 5JYCA 1VSTA 1ORIA 5EWMA 3K6KA 2ILVA 4CM1A 1SH7A 3HMKA 2LE0A 2P4KA 2JS3A 2R6HA 1U0HC 5EN4A 3SIUA 5EZQA 3OUFA 4BAUA 3PF8A 3BA6A 2WAAA 1HOTA 4YJDA 5AVZA 1BMFA 4BMPB 5A5VA 1QH9A 3B3GA 5C8YA 3WB2A 4K87A 2D2CB 4LNUA 2ZEJA 4YP1A 3W5VA 4PAOA 2XMSA 3GZTB 1P4GA 3UGQA 1P2FA 4I9GA 4P86A 3LOQA 4N0QA 4YT4A 2F4NA 1OCOB 3UV3A 1RJGA 5C5DA 3ZCUA 3IC9A 3HWUA 2QSJA 4R8RA 3DW1X 2E21A 4ADSG 3T4PA 1NG1A 2DOKA 2ZIEA 2QQEA 4YV7A 1SIOA 2FZKA 2W0XA 5H02A 1I6KA 1ATZA 4HJXA 1O9GA 1KB9F 3I62A 3CCQF 4Q4HA 4JB8A 5CVJA 1C3LA 2AZ2A 3E35A 2H3EA 2N9UA 3OM0A 4FGUA 3F97A 3UK7A 2HIMA 2CXQA 3OCZA 5KHAA 4QM7A 3EXG2 2W2MA 4C0AC 1ZUQA 1H9CA 1Q57A 5CCEA 5CB0A 2JNBA 1SFRA 2AOTB 3H0CA 3UWDA 4B7KA 3A9WA 5JCPA 2QPTA 3FYUB 5CDSA 3NH9A 3USZA 3MGKA 9LDBA 3HKDA 1P2GA 4DA0A 4KX3A 4YCBA 1UMCB 2GVNA 3TKYA 1NSFA 3G2LA 4YT2A 3O6VA 4UAVA 4EGSA 5GJVC 1HKUA 2H54A 1XQVA 3LQ4A 3HDQA 2GARA 3ASVA 4ACAA 4CKYA 4FGKA 3QBVA 4LE2A 3I9V1 4NR1A 2BKAA 2VTVA 1CQJA 3W2TA 2F1OA 1TUBA 3UN1A 3H9EO 4H1UA 2IHJA 3ITNA 4BB6A 1DBPA 3Q88A 2WP8J 1HKHA 5K1PA 1AI7A 2JFPA 4AC9A 2Z0MA 5ALQA 3MF4A 4BMVA 3N3AC 5GTDA 5LDGA 3VGJA 4ARAA 2PUGA 2CUTA 3CISA 1DAGA 5FP0A 5G4LA 4XX0A 1SUFA 1WPGA 5AVVA 1J8QA 2EKBA 3JR3A 3L7YA 3X43A 2ZB7A 1KEVA 3KG2A 2IHZA 1T3ZA 1XD8A 3RVMA 4JI7O 4PQEA 3MLEA 3MRSA 3O4VA 3O2JA 1DKRA 5DNEA 4TMZA 2CBZA 1MX1A 2BUAA 3DFUA 2CV0A 2GJ8A 3RYIA 2YHSA 2BWJA 5IVDA 5ALLA 1DBQA 3R20A 4MPDA 3SD7A 2DUMA 3K9FC 4B3MO 4DV5O 4CT0A 2H7VA 1OC4A 1M9NA 2NG1A 5C4MA 4LF9O 1U5BA 2AHYA 4JHLA 2BE7A 3ZMUA 4B40A 3OTOO 2E0IA 1P9WA 4QDKA 3OT5A 3A36A 1XZEA 1CP9A 1C81A 1A8SA 5B64A 1A0OA 5EBWC 2E82A 5AJZA 2XLBA 3SS7X 3TIXB 3RR2A 4UCXA 1U7TA 1KPGA 5AOAA 3FHLA 2GCNA 4YXWD 2VN8A 1P39A 2NUTB 2QAGC 3TGPA 5E3HA 3FB6C 3CJRA 2QSAA 3QE0A 1YDGA 2XCOA 3YASA 3I9NA 1MAWA 1U7XA 2V5UA 5DH9A 3ABMB 4Q1EA 4LOJA 3WLPA 3V9AA 4IGIA 1UDBA 5JWRA 3F2IA 5IABA 1GKUB 2TMKA 1H2BA 4QUIA 4BNUA 3DBHA 1O89A 1HFKA 1B0PA 1P9NA 2QR2A 1LBSA 3N2EA 3VH3A 5L3SB 4HPWA 3SHVA 5DN6A 1VIDA 4H0LB 1GTSA 3C6BA 3PPYA 3F9RA 4C0WA 3T95A 2VF4X 3QYPA 1V6AA 4DNFA 2R84A 1EG2A 2PLWA 3U7IA 1IBKO 1NBAA 1WP4A 4CL8A 5EJEA 3RT9A 4U2EA 1KQOA 4CI9A 1BSMA 4E5VA 3I2JA 2ZWPA 3DO6A 3CHXA 1U5CA 1BS1A 1R88A 1ULTA 5IFKA 1TOAA 1JFRA 3C8DA 4BDSA 4NDZA 5DHSA 1AUVA 3C5EA 3RSFA 2ZB4A 1YR7A 2ZRGA 4J0KA 3ZDEA 1E5XA 4AWBA 2EJCA 3QXGA 4I3FA 4I4TB 5B53A 4IJUA 1M3SA 3L3BA 1FJ2A 1TKBA 3T1OA 3GNSA 3JZFA 1YB5A 2Y99A 4JAVC 1L8QA 2M6RA 3RS4A 1FMLA 4HN4B 3UQYS 2UXBB 4NQZA 4K0KO 3AJ9A 4DYLA 2IZ6A 3MAJA 4IXWA 1N5OX 3F8SA 2VA8A 3GFOA 2ZSBA 3GEBA 4BFUA 4C5AA 1P3JA 3VYUB 3VR6H 1F06A 1IRXA 4J7KA 1AGRA 3O65A 4DY6A 4CQMD 4PPGA 3HB4X 1TW3A 2R6FA 4ZZ3A 3VU8A 2QLTA 4TKUB 2EL9A 4X66B 3KS9A 3G2OA 1B16A 4R6ZA 5FPYA 1MNQA 5BN3B 2Y1CA 4GZLA 1LY1A 3HO1A 3WRVA 4NI5A 3NTUA 1B43A 1E2PA 5H0IA 2OQVA 3STLC 5DK4A 2FKAA 4UTNA 1WPQA 3L6EA 4EVSA 1XALA 1PDWA 4YONB 1X1TA 3ES9A 1NRXA 2A8YA 1W5AA 3BPSA 1E1RA 1JNYA 4ND2A 4ATNA 1RACA 2B83A 1QHTA 2YWJA 3AM3A 3LYAA 2XVAA 1PD3A 2GESA 5IAKA 5GVRA 4QQFA 4XDHA 4EYGA 1LNQA 2D74A 4F04A 3AV3A 2ZPAA 4FILA 5DEIA 4FB5A 3J7AR 1G9XA 2IT1A 2FSVA 2IH2A 3PGXA 3A0BZ 3HCWA 3RK0A 1J7HA 4LVNA 1QH8B 4WT7A 1EVIA 1P8AA 2NO5A 3OQIA 3OPQA 4DF3A 2RHBA 3A1EA 4X64O 3PI7A 4G4VA 2YXYA 4FT2A 4QRIA 3WZMA 4DQKA 1RPNA 1UC8A 2VUTA 1BRMA 2YC4C 1MPTA 2DR3A 3WZLA 1I7LA 2AEEA 2RAFA 4URYR 2BONA 1BFKA 3F6BX 2RHLA 3F9IA 1WLEA 2VDQB 5DF1A 1R8JA 2GVDC 3DF7A 5HYVA 5B1DA 4TT8A 4IIGA 721PA 4KCGA 3A4IA 4N5IX 1Q81H 1D04A 1W36D 3VZSA 2PZFA 4O02B 5MGNA 2Z4TA 1FUEA 4PE5B 2JEOA 4YYEA 1ZD8A 3HCCA 3CVVA 4HHEA 3PWZA 4OQXA 4REQB 5JJJB 2O6LA 1ZJ4A 2AUTA 4GKKB 4DMLA 1VQ5V 4N39A 4OJTA 3ESZA 3F7NA 4B3BA 1PFGA 1E3IA 4C82A 4RPIA 3JQAB 1S8NA 2EJWA 4NCHA 2QJRA 1VE3A 2Y3IA 3ROFA 5E4FA 2W11A 1A8IA 4EHIA 4FN4A 4KRFA 3UYLA 1U0NA 1VG0B 3GELA 1UBGA 1QHXA 5L3QA 1RJWA 1XDUA 4Q1CA 4LC9A 5EESA 4KHZA 3VR4H 4GKVA 5DCYA 3K9CA 3D81A 3GFGA 4XWKA 4HQFA 4UJ3A 2AOWA 5BN4A 1C9NA 1GPJA 2ZYVX 1J22A 4YIHA 3ET5A 2Z95A 3WS7A 2Q1XA 3OE4A 4CMEA 1P33A 3GPCA 1CUBA 3IDZA 4WXYB 1U3FA 2Q21A 5E2BA 2QKAA 4E09A 2I76A 2VQ3A 2H59A 2ID9A 3IALA 3AF5A 1TCAA 5BSEA 3J80M 1KBHA 2EFYA 3V1TC 2PXCA 1BE6A 4BNZA 1N25A 1EUZA 4V2UA 3B89A 1JN1A 4KQ6A 1VHQA 1NMSA 3DWFA 3SEQA 3ZWKA 3AEXA 1ULAA 4GKBA 5HK8A 1KI2A 2HR3A 2XXBA 3P4XA 1HYEA 2Z5VA 4LI3X 5AM2A 3QX8A 3DMHA 4EW2A 3G2KA 4A92A 3MCAB 4HH0A 3MAAC 5I7OA 2O8CA 4ANFA 3BMOA 4TWAA 2DH5A 1XL0A 2CLOB 2OXFA 4AL4A 1X7DA 3CRRA 1VHDA 2F90A 4BZPA 2IUYA 3D2BA 2O2EA 1EE1A 2WVJA 3C3CA 4QT4A 1K7EB 2NZUG 3FWNA 4HDKB 2DRIA 3PS9A 1XRMA 3WLHA 3NVIB 2KMLA 2Z6QA 3OFSA 1KRHA 2OWDA 2FGKA 5CHEA 1CEQA 3OBBA 4DV6O 5FOSA 1TM1E 1H2SB 3ROKA 4HLCA 4RS4A 4WZAA 3OWXA 1RXEA 1HMPA 1FDUA 4IJVA 4MEBA 1AOXA 1R0XA 4AKIA 2XKBA 2PO5A 1D2RA 1BZYA 2GASA 3AL2A 4RHYA 4KACA 1P61B 2YQZA 5CMUA 2XRFA 3H4TA 1D4AA 4WNCA 1A4RA 4J1TC 1KY3A 2PVSA 3N7AA 2HMWA 4A7PA 2R9IA 3WG7B 1PQUA 1XU9A 2WHQA 1U99A 4MICA 1ZOIA 4B2IA 1XJQA 4DLWA 3CVYA 3GFFA 5HFMA 1Q0UA 3AZQA 3ISVA 1QO0A 4OMDA 4WY5A 1N34O 3LKDA 1GPAA 4BFYA 3U6KA 3KR1A 1LH0A 3AG2C 4JKIA 5ER6A 3TJRA 3I5DA 5JUWA 2UYGA 2Q7HA 2GLTA 1L5FA 5HJ2A 4Q5IA 5KC9A 3GBSA 4ZJYA 3KKZA 3ZUPA 5I45A 2Z9CA 3PEVA 5C1BA 3CCMF 3WAGA 5AUNB 4DIUA 3CCCA 2AFVA 2XT6A 5DHAA 4MV6A 1EFUA 2OV8A 3L92A 3KQPA 4IFIA 3LHFA 2PLFA 1YRWA 5G4UC 2GYVA 3QKUA 1Q82W 5AVMA 1UPXA 4QJ4A 3NORA 1JFVA 3UAYA 3QVUA 2EFGA 3FOWA 2VJMA 4W6QA 4KGDA 1GM5A 1BVUA 5IE9A 1XP8A 1R73A 3N8DA 3O8QA 1KBZA 2XUMA 5L45A 4UU8A 3DEKA 5B58C 4AUKA 2FNAA 2DG2A 4A8TA 4O2AA 3E7XA 4FVMA 3DXYA 1GQFA 3H7IA 4LDPA 4QO7A 2GPSA 1Z47A 4F2GA 4G56A 1F4VA 4P83A 3CO0S 4IQFA 5TQJA 2HPHA 3Q5GA 4Z1MA 5FF9A 1EZVH 4CTNA 1MOFA 4G0NA 3ORHA 2QM3A 4LYYA 1Q22A 4BVFA 1OROA 3GJQA 4B3RO 3JR7A 3RI3A 1W2BU 1GX1A 5IN5A 1NZJA 2WIKA 4Y2PA 3WIDA 1B1CA 2GPYA 3KB8A 3WQRA 1GP2A 2DR2A 2D3TA 2O8DB 4HDSB 5FX2A 5C80A 5ELLA 1TEVA 3IP7A 2R1ZA 1R18A 2EBHX 4WLOA 3FAZA 3TRIA 4PC2A 3HY3A 3DLIA 1UBUS 1KDRA 2XNDG 1UJ2A 3H8WA 5A02A 2DQYA 1HEIA 4QJBA 3IBCA 4JAUA 1O4WA 5EHGA 3T5AA 2AF4C 3HM9A 3OMNB 1PHRA 4NYJQ 4DJ5X 2MSKA 1SD1A 2EVWX 2QI2A 3O21A 3EHEA 3EVNA 3FSGA 3M4SA 3C8HA 1YAHA 1II8A 1YFJA 3OJXA 3RABA 2WQ6A 2UUCO 1HDEA 2QI9C 1CG6A 1NI3A 1AP5A 3UWPA 4Z4GA 2IQ5A 2GBGA 1KOGA 1DOZA 3I2KA 4DR5O 2G1KA 3UUFA 1QPBA 2DLCX 3FCAA 1KSHA 1O1YA 4ZOBA 1L8LA 1ETHA 4UHEA 2XBLA 4ZVMA 2L18A 4DJEC 2A9HA 4KDCA 3OUTA 3QWBA 1Z12A 3VPAA 3DZGA 3EDCA 4MKIA 1IDN1 4Y2VA 3GEEA 3ETDA 2FG5A 4ER3A 4RGVA 3DULA 4FHFA 4GOLD 4KB5A 3ZOPA 2J5KA 1J95A 4C7BA 4YPVA 3DKRA 1SA0A 3RUIA 2JFWA 1O2DA 4LJ9A 1N8NA 4B3SO 1KC8H 2QTWB 4BWYA 3EBOA 3I30X 3I83A 3D6MA 5KDDA 5DMXA 4OSEA 3UENA 3FLBA 4YRRA 1YZFA 4LOHA 4PTZA 2ID4A 4KSCA 3P5BA 4E7PA 5BURA 2ZTUA 3HC7A 2VP3A 1R7RA 3UANA 1M1UA 4ME6A 1I6WA 3FPGA 4B62A 2H07A 4R1PA 4K26A 2GVIA 1VE5A 3IQHX 4KR0A 5FUVA 3C6QA 3CSDA 1Y1KE 2OCGA 3WP0A 5K8TA 3KSMA 4F6CA 3BWMA 4RHAA 1GN6A 3CWQA 2P79A 1RJEA 4XD2A 3LUGA 1DK1A 4HUJA 3E8HA 4Y9SA 4B7CA 3TD9A 1R3DA 3RUAA 1YJAA 4Q4JB 1KK3A 3GRAA 4OFXA 5KCMA 4LRUA 1T5BA 5ITSA 3HEBA 4PC1A 4PGGA 1XQ8A 5ABPA 2ZSUA 4N18A 2H8CA 1E98A 4BQOA 4V3BA 1RU3A 1DTOA 2WLIB 3ZWYA 4U0KA 1A7AA 3RREA 1Q7BA 3GN2A 3THYA 1A9OA 3OIGA 4QATA 2NPIA 3ZKWB 1CSEE 3LT1A 1AC5A 4EAAA 1GZSA 2IKQA 5IXYA 3EF0A 2C98A 1OX5A 4O4HA 1RQNA 2G80A 4OFBA 1WA8A 4UMFA 1TGYA 4CG1A 4YRMA 1WZUA 1UL1X 3MAGA 2P2SA 4WKGA 2JDID 3ZBUA 2G70A 4BPBA 2OBXA 1J0DA 3ULKA 1CEZA 1S96A 4R6WA 4K40A 1KKCA 3A1WA 1GRNA 3TD3A 2UXNA 1EFCA 1NW9B 5T8KC 4YV1A 5HCUA 2QJWA 3VBBA 3ONVA 1FNMA 5EZ5A 2YJZA 4EFMA 1IHPA 4IPTA 4EL5A 1OZAA 3EDMA 1NR7A 4HDRB 4ZU6X 3EAGA 4B6RA 3KM0A 5B1IA 4IIDA 3ESXA 5BN5A 3RSSA 1WTCA 4CR6A 1U7PA 1WP9A 1QIJA 4HZUB 3A9SA 2QL7A 1XZNA 1ZQ1A 2LP4Y 5CMLA 4WNIA 5GM1A 1HE3A 4WLNA 2WFLB 2Z98A 4X20B 4CCYB 4NABA 3VC3A 2VUUA 2XMDA 3WWYA 3ZBTA 1RMTA 5KREA 5LP6C 1N32B 4BQNA 5D7BA 2MSEB 3KU4A 5ER9A 3PQ4A 2XTNA 1LF0A 3LYUA 3E1YA 5G4KA 4NX2A 2C5BA 3KEQA 1B3QA 1N6KA 3L8CA 3C14C 1UBTS 3ZXUB 5CYPA 2PUHA 4MQMA 1K7SN 1IXBA 5FI3A 4YXFA 4MAAA 3B85A 1GH6A 4NZMA 3ZY5A 3GUCA 4WN9A 1U8ZA 2Z57A 1HDXA 1AKRA 2GHQA 1T0IA 2AOUA 3S8EA 4LJ8A 4KXWA 4LQCA 3RS7A 3HCEA 4DV0O 2AJCA 2XDWA 5KOJB 1NXXA 1J2RA 3BJEA 3P9XA 3AR6A 2BHNA 4NONA 2GAIA 2AC4A 3TBHA 2OTJV 2HRYA 4W1PA 4YMWA 4KUMA 3AXTA 3P5SA 5AKGA 5I8ZA 4MRNA 3UWSA 2Q2QA 2QTZA 3JX9A 3X2EA 1PM9A 1QGDA 2A78A 3K5MA 5SY9A 1M6HA 3RYHA 2AN4A 1NOJA 4H1WA 1EWRA 3VTIC 4I66A 5IH7A 1GEGA 1FX0B 1NATA 4D45A 3WGMA 2X9NA 1F5SA 1ZBDA 1QKKA 4LMBA 1NQWA 4KTVE 3O4IA 2IYWA 2ZZKA 3W6OA 2I8AA 1NZFA 2WOJA 1D4ZA 5DT2A 4EELA 2OAGA 1KP9A 4RIIA 5HP8A 1IE3A 5MGBA 1E79A 4WACA 4IO0A 1QLWA 3HABA 3OX2A 4CU2A 3DHNA 3R74A 4Z86A 3SXJA 1BXZA 4H77A 2GHYA 1S0VA 1HDCA 1KJNA 1MC8A 1ZD5A 4DR7O 2P2NA 1P4AA 3D3WA 3DBLB 2AR7A 5JATA 3W9SA 2XYRA 3NDIA 1OLUA 1MJHA 2GXSA 1A9XA 3T4DA 2AI3A 5JFTA 4N47A 1AKYA 2PN1A 4BZXA 3V4OA 1YJ9V 2XGMA 3GOHA 5IWCA 3LL4A 4CR7A 1NUHA 3L72H 2C8VA 1T2AA 4CDMA 1L3BA 1L7AA 2Z8XA 4CEJB 1RABA 2ZBGA 1QP7A 1TM4E 2IV7A 1KUQA 3IJPA 3LT0A 2F8LA 1WDWB 1Z5UA 2F3SA 4L7QA 1NNSA 3TD2A 2IYLD 2L0XA 4WL0A 4EF6A 1DC7A 2A84A 4J0JA 3ZJ4A 4XJSA 2X40A 1S9HA 4C4PA 1J5EO 3PIIA 3ECAA 5FJIA 2X15A 3WYCA 2OENG 1DWPA 4N7RA 3EODA 1XCOA 4FM2A 3W05A 5KSYA 2WTMA 5CFRA 1WN7A 1N8KA 3K16A 1VKJA 3IAUA 1XU7A 5L7WA 1EB9A 5CU7A 4EGAA 2YOFA 4LHWA 2PWPA 3V8QA 2Q3LA 3DEJA 1OWLA 3L93A 1ZMOA 1SQFA 4IDCA 3DZBA 4IGEA 4TPKA 3VJRA 3SYAA 2JFUA 4R2JA 1QF7A 3GFBA 3MUNA 5ILOA 1SB8A 4JVNA 2XNHA 4C8GA 4G5QA 3DC2A 5IYZA 3LO8A 3B13B 4FLXA 2Q6LA 2P30A 1Z7YA 1KTVA 1NR1A 3INRA 1RYMA 2TRSB 4F71A 1RQ2A 5KHLB 4PAQA 4Q47A 3FROA 1NP6A 2AWOA 3F1LA 1DTWB 1UBHS 3ESCA 4H35A 2WG1A 4DSZA 3DL2A 1U2QA 4TUYB 3S70A 3GB9A 1MDBA 3B1JA 2ERYA 4DLNA 4O2BA 3LUBA 1G5QA 2W8BA 4Q15A 4XTCS 5FBHA 5G1PA 5FOQA 3GFVA 3GT3A 4MK4A 4B83A 1M7HA 4CUKA 4M60A 2NYAA 4KMSA 4CUJA 5KNDH 1UJCA 3U0ZA 3C45A 2XCIA 1Z6GA 2OHXA 4P2BA 3P0JA 2P9JA 3CRVA 3R0ZA 4DJAA 3O9VA 1XILA 5AKKA 3WNVA 4OF4A 3ZMZA 5J3JA 4NICA 1G1XB 1NBMG 4YMTA 3G49A 4X45A 2WYOA 2Q3FA 4B6OA 4E3WA 4TMFA 3G02A 5K3DA 3VYVA 2WM9B 1SG0A 4QDJA 1NDUA 1OILA 4W7HA 2RJOA 2FXVA 5J4YA 2WD7A 3L05A 3FCCA 2XJ9A 5JJEB 2IYUA 4OG2A 1KZ4A 5JI3E 1Z0KA 5ITVA 3BGVA 1R50A 2B25A 2R8OA 3K5LA 5BQ5A 3MOIA 3QJYA 5J9PC 1RLMA 1R3JC 2A7XA 5IBRA 1X13A 1QG0A 3KKKA 3SSNA 1TUIA 4YJFB 4G9GA 1ZD3A 1ORQC 3IPXA 4M37A 1Z2EA 4CEIA 5LM3A 1VM6A 3SX4A 3WADA 1JJ7A 1Y5NA 4GECA 4JC4A 1PO7A 2F9FA 5CX4A 2E6UX 3G9TA 4ASUA 2C7GA 4B73A 1AGYA 4WKOA 1HE1C 4IFEA 1Q7RA 4WFKA 3E6AA 1F5NA 3T9BA 4I3HA 1XMQO 3HA5A 3VAZA 4UXNA 4HAZA 4FHEA 4UU7A 3NFRA 3OJCA 3RRNA 1YBMA 4NV1A 3BSSA 3IMFA 1X1BA 3C3JA 1Y6JA 4HLNA 4LF4B 4C6SA 1SB9A 3KVNA 5FL7D 3U19A 1PTKA 221PA 1X7WB 5CCBA 5TQ2B 1VJGA 4C2AA 2ZI3A 3M5DA 2Y6UA 3CUYA 4LJLA 1UWLA 2QL6A 2FJPA 3CUKA 4BVKA 2HZBA 4Q9KA 3ESRA 4HF7A 1I2DA 5ALXA 2AUMA 2HXSA 2HMAA 1DLBA 2JRCA 5BYJA 4EW1A 4O3FA 3BWDD 4G5YA 1SD5A 4F2WA 4EJSB 1PJZA 2QVCA 3ZCQA 2QQ0A 4J16A 2XUGA 1BYUA 2CXTA 4QU0A 1VI6A 3V4ZA 3S1AA 3ZCRA 3IYLW 4X8AA 4RFLA 3GQBB 2A92A 3ZJUA 5G0SA 2QRNA 1U6IA 5EHQA 1K3UB 1JVNA 3WDMA 3KJHA 1ZHFA 1AZWA 1GG9A 3Q2KA 1TJ3A 1QVWA 4PNPA 1J8MF 5DXFA 4YJ2F 4MCAA 4UNPA 2ECFA 1CJVC 2FSVC 1MNGA 1Q83A 2UXDB 3QVGA 3NP9A 1JLLA 1YIDA 4WZAE 3CC4V 4C20A 4CM8B 4AJ1A 3F1KA 3LDTA 1RJ9A 2PD6A 2P2CA 2J87A 1N2SA 4H31A 3OD1A 4JSRA 1L8OA 3NBYC 4C14A 4WCEV 4TL9A 5KYKA 3FPIA 4UPVA 4OOEA 3JQ9A 4ZCRA 4WFBV 1T1JA 3SC2B 2QN9A 1E7RA 1PT9A 4E2ZA 4PNEA 4ENUA 4RF2A 3V9PA 2CJFA 1LX6A 2HJRA 3AOEA 1GJRA 1BT8A 3PNQA 2MSDB 3DVQX 4O4IB 2VBIA 4ZMBA 3GYBA 2DWDC 1U63A 3V8VA 3JQGA 2VBCA 4NVRA 1JEQA 3HKEA 3H11B 4FFRA 3PFNA 2J9FB 1FNKA 4QOGA 4JV5B 1WVIA 1YBAA 5EB1B 1KMCA 4R1OA 2CV1A 1EGVB 4XWAA 3EOZA 4V0SA 2BW0A 4B3DA 5B3AA 3D0QA 2Y77A 3KZIZ 1W42A 3K59A 2JJ1D 4LNHA 4ZVPA 1NHWA 2IZ5A 5CXXA 3QMVA 5JH7A 2I78A 4Z49A 4ZQEA 4UASA 3VPGA 4MRSA 4KXYA 4BT2A 2BCCH 4I2NA 1P0PA 3MBIA 5ALKA 4D3FA 1XMPA 2NTNA 1A27A 1Z6YA 4KREA 1ADJA 3SMVA 4KZKA 1TZJA 2R86A 4R84A 2QIPA 1O6BA 4LYEA 5IC4A 3AQIA 4UJ5A 1IBSA 5JYEA 3KIZA 4CMEC 4XD7A 1IMOA 4QXRA 2UDPA 1BCSA 2Q3HA 3PA8A 2W2LA 4F4DA 2ZSAA 3ILSA 1JIKA 5IYDO 2WKSA 2CHQA 1D2CA 4DLSA 4EKGA 2YWHA 1L7RA 5CNKA 4ZK6A 4PA3A 1UZLA 3WSTA 1W0KG 3SE7A 2EJTA 3A25A 1WVMA 4RV4A 2DPMA 1YB1A 4WLFA 1KEUA 1N6RA 4DC9A 3MIIA 1LI4A 2P5YA 3PLNA 1EUDA 1I2ZA 4F2DA 4BRUA 1M1ZA 1X14A 2WSLA 4PWTA 3C3PA 2WIJA 1JSZA 4RM3A 3O8RA 4IQGA 4L78A 1H2MA 4XJTA 5CD9A 3P4UA 4RTMA 2OXIA 3VH1A 1W57A 4NR0A 3ZRWB 4FIDA 2UXCO 4NXMB 1NH2B 3T38A 2HLHA 4Z7OB 4DR6B 2R79A 1RHMA 1K0FA 3I8XA 1U0GA 3BULA 3KKYA 3W5SA 3P2MA 3QVWA 4X7RA 3U17A 3DT6A 2GS9A 1Z4JA 5CA0A 2JKYA 3L74H 4F9GA 5I7FA 5AIAA 3X0DA 3I2HA 1IY9A 2VUHB 1DC4A 1O8BA 2VDUE 4BWGA 5DNWA 5GOTA 3K2XA 1VQ1A 1ISIA 3AEIA 1AJNA 3WGQA 4WNYA 2HWWA 4IIJA 3G79A 2JFOA 2QMEA 1XRRA 2BVNA 3EXHA 4Q0MA 1VHAA 2HHJA 3Q7PA 1JLHA 3DYBA 2C2HA 4BT7A 1E5VA 4KNYA 3ELUA 2IOHA 5MN4A 2QRVA 2VDNB 5B55A 3CYPB 5TMBA 2C9OA 4I0XB 3NBZC 2YN0A 1K88A 1I5OA 4NL4H 5F9MA 4KAJA 3EY4A 4UU1A 5KTOA 1MO4A 3PVZA 3UFXB 4JI6B 4W1QA 1L8XA 3QW2A 3DKIA 1QFXA 3GLGA 4O4LB 4NVPA 2NVWA 4HP8A 4OFZA 1RLGA 5J2UA 4QPNA 3E3OA 5B7QA 2QR3A 1JDUA 2ZB3A 3BHPA 3ADOA 3SEFA 1UK7A 4J11A 4JJ7A 1PAUA 1X77A 3P3NA 1G42A 4ZI7A 3R09A 5GONF 4PX5A 3NS7A 4NZ9A 3C74A 3W4IA 5L4SA 1CU1A 3MJFA 5EJGA 3OZEA 5HF9A 2ZITA 4KFCA 4BC0A 2HBYA 1AA6A 4BHTA 3BIXA 3X1DA 2CK3G 5G3YA 1BHJA 3LWOC 4YIOA 3WNZA 2PBFA 4P31A 1SC4A 3SP1A 1GRJA 4WFIA 3BH0A 1PGPA 1L4FA 1J39A 3B1KA 4Z9XA 5DLPA 2ODEA 2GJ9A 4EG8A 2I2DA 3CT6A 1NQVA 1OCRB 1QB8A 1KJQA 1ENVA 2GZHA 4WVLA 2OA0A 1H42A 3FGNA 1JEJA 4OHRA 5JDCA 3A14A 1QZTA 2PYIA 4BAGA 2NIPA 4HVAA 4PLFA 5AI6A 1TJ5A 3BA9A 3N9IA 2EQBA 5CAEA 2VYFA 5E1BA 3FMFA 2V7QG 5L3EA 2JKZA 1GY8A 5BOSA 1LQTA 4IDAA 2NV2B 2QLFA 4HCJA 3LXXA 4M1SA 4ZQFA 3QM1A 5IJ0B 3ENQA 4IRMA 3DUFB 4EFEA 3LF2A 4L8FA 2XOKG 4YUAA 2WAYA 4Z4QA 3KFVA 1Z63A 4G86A 5JVDA 3R6LA 1ONOA 5EYPA 1AQUA 4ZDIA 2WAOA 4D6YA 1NTMH 3CEIA 1T13A 4XLZA 3LRTA 4IH9A 1QC5A 2XQVA 5IKMA 1V2GA 4BXOA 3A3NA 4PPQA 3ER8A 1NNUA 3SDZA 3BG5A 4DDTA 3PP8A 4UZSA 1QIMA 1ZH8A 1DCTA 1B41A 3A6FA 1GG2A 3ZLTA 3GJSA 1C1DA 2O7SA 1VPEA 2BEJA 1ODTC 3NGMA 2YMPA 1NSYA 3IP6A 4JU8A 2I3BA 2H1HA 1Y3CE 1YS9A 1X7ZB 3K20A 4LGYA 1VKRA 5E0OA 1H8HA 1P1HA 4C08A 3IKMB 4PAGA 3OJ0A 4ITVA 1O4VA 3OE7A 3OPNA 2GD6A 3WIBA 2JH8A 2ONZA 1XRSB 2PY5A 4XGRA 2YDYA 1SPXA 2P9ZA 5FBRB 3S3TA 2J6BA 4C0LA 4WK4B 5BQFA 1OW3B 3EGXB 2J5RA 1J9EA 4JBYA 3DDWA 4R31A 1Z5PA 3ZV7A 1T9DA 3K30A 2X6RA 2AXPA 3LKZA 5LXTA 4NARA 1G7CA 1FL9A 1T6YA 3BXZA 2OV2A 2ZKIA 4MAMA 3U4AA 1OXSC 4IG4A 1H1LB 3H5AA 1IUNA 3L18A 5BO5A 3ZDFA 2WSBA 1VQOV 3R3XA 1XF9A 2XGSA 4O1MA 1Q3KA 4N4AA 2HWYA 3H1TA 4ZK2A 3C7TA 4DK0A 4FC7A 3DCNA 2A4KA 1H8EG 2PEYA 3ROQA 4POOA 2C3OA 1XZBA 4Q1FA 2VDWB 4QPJC 5KPJA 4N23A 1HG1A 4ZIRA 3DQZA 5BRAA 5CB4F 3IT1A 2VTBB 4DC0A 1FU4A 4HRAA 5EIWA 4ZA2A 3RH0A 1WQ4A 1V9LA 2DETA 3SZLA 5L3DA 1UOEA 2B33A 3EEQA 2CHTA 2GZ3A 4KWEA 2XDAA 3R0JA 2R11A 3CUUA 3F7MA 2JJ8A 2XLCA 3FKSD 4FUQA 4NWOB 1Y1TA 2B9ZA 3BFKA 1OKKA 2I8CA 3Q10A 2D0IA 4EO9A 1XGKA 3P1JA 6Q21A 3PRKE 3S28A 2BGGA 2BH2A 1D2EA 2ZTVA 2IYYA 4OGFA 3TQHA 4MWGA 5THXA 1HNXO 1LPAB 1MF7A 5H70A 3D8NA 4R81A 1A72A 1G20A 2CCGA 3W2FA 2IYTA 1AUXA 1ECPA 4FC6A 1ENYA 3VO8A 4PLCA 5KHHA 2FR0A 5ECWA 4GQIA 3W7XA 3Q9UA 4ZODA 5KQGA 1VF6A 4R7GA 1ES9A 2F4VB 2DT5A 1TCCA 4BVTA 5KYWB 1U8CB 2VAXA 2VS0A 1VE9A 3DC6A 3V6MA 1W44A 2OC4A 3WBFA 5K8VA 4WFAV 1OI3A 2G4CA 2WJHA 4ZYXA 3I2GA 5H4GA 3LYBA 1LV8A 4IZIA 3WPXA 1FLDA 3ICCA 4XIFA 2CJWA 4GP7A 4DTCA 2WJ4A 3NUZA 1R4NA 1JE1A 3HDHA 3FGPA 4F11A 4ZT3A 3OG9A 3QUCA 1DHRA 1LEHA 4I0WB 2R2AA 1WW3A 1UJMA 3GTZA 1HW7A 4NMLA 2HCFA 5HFNA 2Q8VA 3UOAB 1R0YA 4KPGA 3G82C 2YJTD 3D6FA 3E22B 1KKLA 3SYLA 5D5HA 2B4RO 1WIWA 1MHPA 4NYMQ 3Q1LA 3D54D 1ZN7A 4AF7A 1L0NH 2AUNA 3BREA 3LY5A 3P9SA 3HG7A 4MMXB 3NALA 2RCYA 2JGUA 4NFLA 1PKXA 3IFSA 2JLUA 1VA4A 2Z8YA 4CKBA 2GK7A 1TQ6A 1QYWA 1SBTA 1XEAA 4DLXA 2XOXA 3L8YA 2P3SA 2EBUA 4JROA 1E0JA 4XA8A 2BGWA 1ZL8A 5EPUA 3GAZA 3ER9A 1GUYA 3L1KA 4W9MC 4NBRA 2ZSJA 3PNYA 2YXHA 1Y8QA 3K5IA 1Y74B 3KUUA 1T1EA 3P0EA 3DOEA 4WZBB 5I4IA 5ALDA 1H0KA 2G40A 3MFQA 3WTBA 4WGGA 2J6CA 2JGEA 4QEDA 1I9CA 2CFOA 1Y98A 3D8TA 1JAYA 2C00A 4GO1A 2TYSB 2YWXA 1YI2F 1K5PA 2P68A 3B8HA 2GWHA 3NH6A 3ESAA 4KK3A 3KK0A 4J2TA 1FRNA 3GLRA 3MQ4A 1T10A 4QUDA 3H1GA 2HRUA 4PG4A 2P41A 2FQ1A 4EGQA 4L9AA 3S0YA 2BFDA 4Q9DA 1MTOA 3CE2A 1MO2A 1I51A 2D1TA 5K2MA 1QU9A 3AUTA 4YDHB 6GPBA 3UW3A 3E82A 3Q9NA 4WA7A 2I4RA 1PJBA 2UYOA 1OY1A 2VWQA 3EG5A 1CUSA 4O29A 3QOFA 4DL9A 3GFTA 5CYOA 3RYFB 2EP7A 4CFYA 4II7A 1YR2A 3BHMA 2J33A 4EDHA 3DXRA 1PF7E 2XHBA 4BMSA 3EG9B 3E86A 4WKPA 4PRZA 4TM7A 4TTVA 3K6JA 1LTKA 1RM3A 1PR4A 1G6OA 4TVOA 3ZBQA 1SC5B 5FLYA 4JOBA 1QH1A 1NVXQ 4XFDA 2C3MA 2HVYD 3DT9A 1W0JG 2IG8A 1BOFA 5IW8A 1A76A 1V39A 4UUMA 4GRDA 4DVJA 1HV8A 3FSRA 3DONA 2YASA 2ZTSA 4P53A 4GLJA 1H05A 1Z0ZA 1JIUA 1JRLA 3CEMA 4X7BA 3TLGA 3K15A 4P3XA 4HTFB 4HLUA 4JB2A 3EVTA 2FPSA 1Q6UA 1JJOA 4D4LA 4N3NA 3VPDA 5TF4A 4ZEWA 2I7VA 5GJBA 5TMDA 1V6CA 3WK7A 4H17A 5GW7A 3V2GA 1OV9A 1ZMTA 5CK5A 2NAPA 2E3JA 2WDPA 4LJAA 4PDMA 5HWSA 1E3TA 3ETNA 4FFNA 2DQSA 5DNDA 3CG6A 4HGQA 3PC4A 3D3IA 5KTPA 4K05A 3AILA 5K6TA 2QX4A 2MTBA 2IDJA 3ZNNA 3C3YA 4RAOA 1C7QA 4KUGA 5CT8A 4IQ4A 4KIJA 1NF3A 1BDMA 2VTDA 4GRIA 2G82A 3A28A 3GNQA 1NI4B 4RE5A 4L07A 2VWPA 5B30A 5JI2E 5E6UB 4KC0A 2CL5A 3M5WA 4N0MA 1FW6A 5D5PA 1LW7A 5EC1C 1WJGA 2CDAA 3DNFA 2IEBA 3EWNA 4BJ6A 3EH2A 3AR8A 4UPEA 2GPJA 4KQKA 3UK2A 3K5HA 1Z45A 1C30A 3E5HA 4Z2AA 4ZT2A 4LGVA 3UC9A 1KQPA 4PI2A 5B7GA 1RDFA 3K0DA 4B4KA 1SUCA 2RHWA 4RU1A 1SBIA 1DXYA 3C4JA 1TVEA 3GA0A 2BSAA 2C3YA 3DOFA 5L3GA 3JVVA 2QL5A 5F2VO 2Q9UA 3ZDQA 5ADUS 4FOSA 3K1ZA 4BQPA 1N33B 2Q5CA 4DWVA 3FVTA 4LJ4A 1I1QB 2LFSA 2J9GA 5C5EA 5DN9A 1FBTA 5BQPA 4MTGA 3P0RA 1DC5A 1YS2X 3C6MA 2GCIA 3TIVA 3TE6A 2M2IA 2W8BC 3ZX6A 2AGVA 1ZO8A 4OM8A 3ZIAA 1TC2A 4LCUC 1N2CB 1QV6A 1BS3A 4BBPA 2XXJA 1EXMA 3ZE1B 2Q4EA 3LSTA 1PX2A 4YQZA 2PGXA 1PWZA 4MV7A 2Y9MB 3OAAG 1ONIA 1RWQA 4Q05A 1MG1A 4MRMA 4FN5A 4Q6BA 2EG9A 4PZEA 3CZAA 3U44A 1TAUA 5AI5A 3SQLA 3CCUF 1QVGF 3W79A 1ZUNA 3WGVA 5K2OA 1KI4A 2IBMA 2X14A 1JSXA 1N6PA 4MV4A 4HRVA 4ZQBA 1Z28A 4BIIA 5HE8A 1SQ6A 2VI5A 3IQIX 1FXKA 1V4BA 4EF4A 1F1JA 1QIEA 3NVAA 2PZLA 2NVOA 4BV2A 1UXHA 4TMTA 2JANA 5BXQC 4R9UC 4I8DA 4F6RB 4PIPA 2HTEA 1FFBA 2PR7A 4S1WA 4QPDA 3KYDA 1DJMA 2V03A 3I04A 1G55A 1T26A 3VH4A 5DGCA 5A1JA 3FB7C 2EYUA 2HOQA 4HQLA 5IULC 3O31A 4AS2A 2C5LA 1VXRA 4HTAA 3GNLA 2C96A 5LMUO 3B6ZA 3B82A 3CLSC 4ROSA 1LLCA 4X1KA 1D07A 1P18A 4FHGA 2Q1WA 3EYWA 4HVCA 4RS3A 4FD3A 3Q8LA 1HBJA 3KQWA 2H8KA 4QPZA 4PR0A 1FJGB 2H0QA 1KETA 2GK3A 1O54A 1XAHA 4GRAA 3G2IA 4OB8A 3V8PA 3P4EA 3BMQB 3CZQA 3RTAA 1JLKA 1H85A 4U7TB 1AP6A 4Y2HA 2ORYA 2VTKA 3I37X 4J6EA 3IAHA 2XR1A 1QH0A 1TT5A 2FYUH 1Q81W 3DL7A 2ACKA 1R6VA 4MJ7A 4TQAA 4MVXA 3ZE2B 2X3FA 1C2TA 2JEZA 3LQYA 4GM4A 3RRMA 2XVMA 3ZP7A 3HR8A 1QJ4A 2D1SA 2REOA 2J31A 4OHBA 3U31A 2VYQA 1U81A 3BL5A 3EBPA 3PDCA 1QAHA 3R3JA 4BFCA 3OTWA 4I50F 1M1XB 3E2IA 4J16C 4DLKA 4LXTA 3UYKA 4DDMA 2EF1A 2H7XA 1Y1PA 3T7JA 3Q2IA 1WLSA 3T5TA 5JQWA 5HCNA 1UAAA 4URVR 2KGWA 5FEMA 3MLBA 2CBGA 4TSFD 3U2QA 1MBZA 3GARA 4P3NA 5IF3A 3I28A 3EXIB 3OF2A 1N7JA 2PH5A 2R47A 1DV2A 1U1FA 4GUNA 1Z74A 4Y6OA 1PSDA 5AW2A 4RA9B 1T3HA 4QHSA 2EKDA 4DDWA 3R0IA 4OREX 1YCGA 3SLKA 2PM8A 5F1KA 3TPCA 3TW0A 1CEEA 2YKGA 3O1LA 3H1AA 5FJJA 3BEOA 2HEIA 3K4HA 4BO3A 3TFWA 5JQGB 1YL6A 1XHXA 3IVXA 2QSYA 4PEVA 3QELA 2VKTA 1E0KA 1QE5A 3JQ9C 3T7DA 4I1UA 3OH8A 3OOHA 1LV7A 3DV9A 2PANA 3NB0A 2ZREA 2GFIA 4JJIA 2ID8A 3JRWA 2RKBA 4DG9A 3ITEA 4OLBA 3GLGE 3MTIA 1X8LA 1QGZA 3AOEC 1PNKA 3MCVA 4NJEB 4BP9A 3H3FA 1IBLB 2R4TA 3RC1A 2FZVA 1Q95A 5HUHA 4MS2A 1YCHA 2BH9A 5D87A 2LV8A 4DCCA 3CXUA 4WJZA 1GM8A 4IEIA 1VKHA 4NG4A 2ZDQA 1UJ6A 1PD1A 4D8TA 4MCHA 4UNIA 4LVOA 3LFOA 2OK7A 1ZUD1 3M3DA 1E92A 3LUTB 4BO1A 5H4HA 2O5CA 2Q0SA 1HURA 1NJGA 3I2FA 1M2FA 3ZLVA 4AJ4A 4MA5A 4MVJH 2A4MA 4QE7A 4YBZA 4Y1FA 5A2QM 2HBQA 4HADA 5GGYA 4O25A 1XK7A 2MSLA 2PY6A 1T9BA 4KNWA 3T5GA 2PO7A 2ESRA 5KVVA 2PV7A 3ILHA 1QR6A 4DV3B 1Y3IA 3MPOA 4ARVA 1GR0A 4P7GA 1V55B 1VYUA 1WUYA 3I12A 1S89A 4WECA 4GMXA 3DZHA 4MB6A 3PLRA 1QTNA 4R2KA 1ROPA 1QCCA 1RCUA 3OM8A 4LH6A 4HWRA 3I05A 4NS1A 3LS2A 5BR4A 2PRZA 2WU1A 5TISZ 1E1NA 2R1TB 4M0FA 4FR5A 2PX6A 1OHHG 2FPWA 4OBEA 1L5VA 4QOJA 1LRJA 5D5QA 2X19A 4FSHA 3EDOA 3ZHUA 3L7AA 2Q2NA 4AO7A 1J0XO 2YX1A 1VH8A 3R8XA 2XGJA 3A3YA 2M6KA 3AC0A 4BW0B 2GA8A 3IOEA 3KBOA 4E08A 1WHTA 3LM8A 4UULA 2K1EA 1U80A 5IF9A 4UCVA 4TTJA 4AF6A 3ZWQA 2GZ2A 5JNUA 1IBMO 1UM9B 1VL6A 2GPTA 3L0SA 2H1OA 4DCTA 1Q7TA 5BSRA 3PUKA 1VQPV 1SMKA 2HWUA 4B5KA 1KZ7B 3AM1A 3C3EA 5DHTA 1DBSA 2I4TA 2C54A 4NULA 3EXHC 2QG6A 1E1QG 5TDHA 4YMIA 5CH5A 1MB0A 1E7WA 3AHIA 1WA5A 5IKEA