3F0EA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
158
structure length
158
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 52
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3f0eA00
3IEWA 1GX1A 1T0AA 4C8IA 1KNKA 3F0GA 1H47A 3FPIA 5B8FA 2PMPA 3Q8HA 1H48A 2GZLA 3K14A 1IV4A 2UZHA 3RE3A 1U40A 1JN1A 3QHDA 2AMTA 1VH8A 3KE1A 3IEQA 1VHAA 3P10A 3T80A 4C8GA 1W57A 3F0DA 3IKEA 3K2XA 1JY8A 3P0ZA 4C8EA 3ERNA 1IV2A 1U43A 1W55A 4C81A 1IV1A 3ELCA 3F0EA 1U3PA 3ESJA 3B6NA 3IKFA 1IV3A 4C82A 3MBMA 3FBAA 1KNJA 1YQNA 3EORA 3GHZA 3F6MA 3F0FA 3JVHA 1U3LA
chains in the Genus database with same CATH superfamily
4C8IA 1X25A 4X1YA 1YITF 5BMVB 4LNUA 1Q82H 1DT9A 3CD6F 4G4YA 2Z1UA 3NVIB 5IJ9A 3IEQA 5FNVA 4FFBA 1OFUA 1W57A 3I7TA 2CHTA 1Z5WA 3RYHA 5IJ0A 2YYEA 2Z1FA 3LDTA 4YJ3A 4I55B 5G4UC 1TVKB 3S0HA 5CA1B 1KNJA 3LWRC 3WGMA 5JVDA 2F9ZC 2HRYA 3JAWB 1K9MH 2AIFA 4NWOB 3U0OA 4XCQA 1U40A 2DYYA 3QHDA 3WGNA 3ZOPA 4BY9D 2Z01A 3HKBB 2P6YA 4X20B 5HWEA 2L26A 2VGNA 1Q8RA 3HKEB 4O4HB 4TV8B 3VMFB 4ZK7A 3NK7A 3DDNA 3ELCA 1K8AH 1SA0B 1GO0A 2V9YA 1U3LA 3N2KB 2PHNA 5EAZA 3NK6A 4BVSA 4ZHYB 2RHJA 3JATB 4TV9B 3VOAA 2OHWA 4I4TA 3VTIC 5LOVB 2AMTA 3RYCA 3CCSF 2YXZA 2B33A 1W5FA 4EI7A 3CB2A 3IKEA 4TZZA 3JALB 2FGYA 4O2AB 4EB6B 2HP0A 3CCMF 3WJPA 5HY2A 4BT4A 4ZHQB 3JAMM 1W42A 3TD4A 1YQNA 5MN6A 5LP6B 2CVLA 3JASB 3WPWA 1NQ3A 3GTZA 3FPIA 1TUBA 3I3FA 1VQMF 1VK3A 3VO8A 3UT5B 4LCKA 2HRUA 2UYNB 3JARA 5JH7A 3D54A 5C8YB 3ON1A 3LWQC 2ALEA 2VAMA 2EWCA 3GYQA 5LA6B 3VYTC 3CCUF 3G71F 3CCQF 1IV2A 1S72F 3I56F 4C82A 1Z5VA 2UYJA 5CA0A 3RYIB 1W40A 2WALA 2VXYA 3GHZA 5J2TA 3HAXD 4DXDA 4B5CA 1YJ9F 3CYQA 3K12A 2HVYD 3TD3A 1Q86H 5ITZA 1GO1A 3FD5A 4X1KB 4WBNB 4ZI7B 2H8EA 1VQNF 3VYUC 3C9UA 4ERHA 5GINC 3V4DA 2KTUA 4C8EA 3RYFA 3V7EA 4IHJB 5CB4B 1U3PA 3OBYA 2R6R1 3CCVF 1FNKA 3L7QA 1SDSA 4BVRA 1OAPA 4O2BB 1COMA 3NMUC 4G4VA 2LBXA 1H47A 2CHSA 3N2GA 4B46A 3CC4F 5GIOC 5LP6C 1VQ5F 3HKCA 2IQQA 5LYJA 4BW0B 1N8RH 5EIBC 5KX5B 4KWEA 5LXTB 5JCOC 1JFFA 3JAKB 1VQVA 3D01A 3FD6A 4B62A 2Z1EA 4ZOLB 1IV1A 3D00A 4O4IA 2QA4F 3OBWA 1YI2F 5FLXM 2I6DA 3OW2F 4O4LB 3S0YA 5IYZB 4X20A 3CC7F 1FSZA 1X7PA 3LWOC 3KE1A 5GONA 4X1YB 2OTJF 4BVQA 2ZAUA 3FFMA 1DBFA 4LNUB 5JQGA 3CPQA 2NMUA 3VYSC 5EYPA 1W5BA 3N2KA 5IJ9B 5FNVB 1R1MA 4TUYA 3LWVC 2HP3A 2MQEA 2H8CA 3RYHB 4BT3A 1VQKF 4TV9A 4NQ3A 2AIZP 4YJ3B 1T0AA 2ZF8A 5AVMA 4IIJA 3RA5A 2GLZA 2PMPA 1FFXA 3KHNA 5JVDB 4EI8A 4X1IA 3RE3A 3WXMB 2KG4A 4U3JA 2LBTA 5IT9M 2ZOVA 3CXCF 1QU9A 1E7KA 3P0ZA 3J80M 3CC2F 1QVFF 2G9IA 5HXZA 1Q81H 4PWTA 2ZODA 3ZP4A 1Q7YH 2QTPA 3JVHA 1VQ6F 1GX1A 1YHQF 2IG8A 2UYNA 2QI2A 3WPXA 2Z1TA 1VQ4F 1W581 2K1SA 5GAPK 3K14A 4HNAA 1YIJF 1IV4A 2Q1YA 1VH8A 4NUTA 5KMGA 3KJKA 1VQOF 1SZQA 5EO3A 2VAWA 1W55A 4B45A 1YGYA 3E22A 1W3EX 3B6NA 4BT7A 2VGMA 3LWPC 2HX0A 3CCLF 2I6RA 5EZYB 3F0FA 2RHOA 3MCAB 2BTUA 2HQSC 4ZHWA 3M1XA 4DRXB 1K73H 3MCQA 3QTYA 3Q8HA 2RHLA 2UYKA 2IAFA 1J7HA 3KIZA 1JN1A 5J2UB 3S06A 4I50A 1TUBB 4YJ2B 3S03A 3E1YA 1UFYA 2BTOA 3HKDB 3S02A 4O2BA 5HP8A 3CCEF 4O4JB 3JARB 3F0EA 2VAPA 5JH7B 5G4VC 2RB9A 1NJIH 1RQ7A 5BMVA 1KNKA 1XV2A 3HWUA 5MN5A 1VQ8F 3I55F 1RLGA 5KX5A 1T0KB 3CPWF 4C4WC 4F6RB 1H48A 3LFOA 3K0TA 3JAKA 2JNBA 1M90H 1RLUA 4RQOA 5HXUA 4ZOLA 3MDOA 3SIVA 5HY4A 2BTQB 4I55A 1TVKA 1NMUB 3T80A 4C8GA 5CA1A 3RA6A 1YJNF 3IR9A 3M84A 5ITZB 1U43A 2CW4A 2N48A 2KTVA 4BT2A 3DC2A 1FNJA 1X52A 4G88A 3M4SA 3JAWA 2CWJA 1PF5A 2CSLA 1GZ0A 3RYFB 4E6EA 3J81M 1VQ9F 3G6EF 3VCZA 3HKBA 4X3MA 1KQSF 3HKEA 4O4HA 3PLAC 3N4ZA 3S0WA 3SIUA 4TV8A 4RHAA 3TD5A 3CMEF 3N2GB 5GANK 1VHAA 2W8BC 4U39A 5EB0A 1SA0A 1VQPF 3G4SF 3V3TA 3HKCB 4C81A 4BVTA 5HP7A 5LYJB 4EI9A 2HS4A 1CK2A 3WGJA 4FFBB 1JD1A 3VI6A 5DCVA 1JFFB 4G4WA 5EB1B 3ZP7A 3JATA 5IJ0B 1W2BF 5LOVA 1XRGA 4O4IB 2LBWA 1QD9A 2OTMA 3C9TA 2OZBA 1XBIA 1UI9A 3JALA 4O2AA 2R751 4EB6A 5MN4A 3MQWA 5EWRA 1CLIA 4ZHQA 3F0DA 5LP6A 1PXWA 3JASA 5GONB 1QVGF 1KD1H 3FBAA 2GVIA 3ZO8A 2CZWA 5JQGB 3NVKE 5EYPB 3JCMM 2RHHA 3E20B 3IEWA 3UT5A 5JCOA 4TUYB 3CMAF 4G4ZA 5C8YA 3PAFA 1IPAA 2UZHA 5LA6A 5HY0A 1RQ2A 4IIJB 3P10A 1JJ2F 2Q1XA 1FFXB 1ODEA 1ONIA 2FC3A 1QAHA 3CG6A 4X1IB 5EZYA 3RYIA 4G4XA 3R0PA 4U3JB 3J7AR 4I4TB 1ZWZA 2LCAA 3C9SA 4DRXA 2HS3A 3RYCB 1KC8H 3C8LA 3ESJA 3IKFA 3P4EA 1IV3A 3CYPB 3F6MA 1M1KH 2HP0B 3WGKA 3IMPA 5J2UA 3VOBA 3WJQA 1X7OA 4X1KA 4YJ2A 2BO1A 4WBNA 4ZI7A 3QUWA 4BT5A 2GZLA 2HS0A 1W5AA 1H7MA 3HKDA 2QEXF 3CCJF 2DT4A 5FJ4C 4O4JA 1W5EA 4IHJA 5CB4A 2KGWA 4M8IA 4HNAB 3WGLA 3LMEA 3LYBA 1YJWF 3AGKA 5HY1A 3C9RA 5KMGB 4X3LA 1RA4A 1VQLF 3MBMA 4BT6A 3N4YA 5A2QM 1VQ7F 3CCRF 4F6RA 1W59A 5EIBD 4ZHVA 2ZVZA 3E22B 3F0GA 5B8FA 3HJWC 5CA0B 1CN7A 5J2TB 3HTNA 2UYPA 5LXTA 2OTLF 4R40B 3OONA 3O85A 3VIUA 3V7QA 3K2XA 1JY8A 3BYQA 3KJJA 1W41A 3ERNA 3WJRA 2ZVYA 4I50B 2H6LA 1XHOA 5GIPC 4O4LA 3EORA 5IYZA
chains in the Genus database with same CATH topology
3IEWA 1GX1A 1T0AA 4C8IA 1KNKA 3F0GA 1H47A 3FPIA 5B8FA 2PMPA 3Q8HA 1H48A 2GZLA 3K14A 1IV4A 2UZHA 3RE3A 1U40A 1JN1A 3QHDA 2AMTA 1VH8A 3KE1A 3IEQA 1VHAA 3P10A 3T80A 4C8GA 1W57A 3F0DA 3IKEA 3K2XA 1JY8A 3P0ZA 4C8EA 3ERNA 1IV2A 1U43A 1W55A 4C81A 1IV1A 3ELCA 3F0EA 1U3PA 3ESJA 3B6NA 3IKFA 1IV3A 4C82A 3MBMA 3FBAA 1KNJA 1YQNA 3EORA 3GHZA 3F6MA 3F0FA 3JVHA 1U3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEW A;  1GX1 A;  1T0A A;  4C8I A;  1KNK A;  3F0G A;  1H47 A;  3FPI A;  5B8F A;  2PMP A;  3Q8H A;  1H48 A;  2GZL A;  3K14 A;  1IV4 A;  2UZH A;  3RE3 A;  1U40 A;  1JN1 A;  3QHD A;  2AMT A;  1VH8 A;  3KE1 A;  3IEQ A;  1VHA A;  3P10 A;  3T80 A;  4C8G A;  1W57 A;  3F0D A;  3IKE A;  3K2X A;  1JY8 A;  3P0Z A;  4C8E A;  3ERN A;  1IV2 A;  1U43 A;  1W55 A;  4C81 A;  1IV1 A;  3ELC A;  3F0E A;  1U3P A;  3ESJ A;  3B6N A;  3IKF A;  1IV3 A;  4C82 A;  3MBM A;  3FBA A;  1KNJ A;  1YQN A;  3EOR A;  3GHZ A;  3F6M A;  3F0F A;  3JVH A;  1U3L A; 
#chains in the Genus database with same CATH topology
 4C8I A;  1X25 A;  4X1Y A;  1YIT F;  5BMV B;  4LNU A;  1Q82 H;  1DT9 A;  3CD6 F;  4G4Y A;  2Z1U A;  3NVI B;  5IJ9 A;  3IEQ A;  5FNV A;  4FFB A;  1OFU A;  1W57 A;  3I7T A;  2CHT A;  1Z5W A;  3RYH A;  5IJ0 A;  2YYE A;  2Z1F A;  3LDT A;  4YJ3 A;  4I55 B;  5G4U C;  1TVK B;  3S0H A;  5CA1 B;  1KNJ A;  3LWR C;  3WGM A;  5JVD A;  2F9Z C;  2HRY A;  3JAW B;  1K9M H;  2AIF A;  4NWO B;  3U0O A;  4XCQ A;  1U40 A;  2DYY A;  3QHD A;  3WGN A;  3ZOP A;  4BY9 D;  2Z01 A;  3HKB B;  2P6Y A;  4X20 B;  5HWE A;  2L26 A;  2VGN A;  1Q8R A;  3HKE B;  4O4H B;  4TV8 B;  3VMF B;  4ZK7 A;  3NK7 A;  3DDN A;  3ELC A;  1K8A H;  1SA0 B;  1GO0 A;  2V9Y A;  1U3L A;  3N2K B;  2PHN A;  5EAZ A;  3NK6 A;  4BVS A;  4ZHY B;  2RHJ A;  3JAT B;  4TV9 B;  3VOA A;  2OHW A;  4I4T A;  3VTI C;  5LOV B;  2AMT A;  3RYC A;  3CCS F;  2YXZ A;  2B33 A;  1W5F A;  4EI7 A;  3CB2 A;  3IKE A;  4TZZ A;  3JAL B;  2FGY A;  4O2A B;  4EB6 B;  2HP0 A;  3CCM F;  3WJP A;  5HY2 A;  4BT4 A;  4ZHQ B;  3JAM M;  1W42 A;  3TD4 A;  1YQN A;  5MN6 A;  5LP6 B;  2CVL A;  3JAS B;  3WPW A;  1NQ3 A;  3GTZ A;  3FPI A;  1TUB A;  3I3F A;  1VQM F;  1VK3 A;  3VO8 A;  3UT5 B;  4LCK A;  2HRU A;  2UYN B;  3JAR A;  5JH7 A;  3D54 A;  5C8Y B;  3ON1 A;  3LWQ C;  2ALE A;  2VAM A;  2EWC A;  3GYQ A;  5LA6 B;  3VYT C;  3CCU F;  3G71 F;  3CCQ F;  1IV2 A;  1S72 F;  3I56 F;  4C82 A;  1Z5V A;  2UYJ A;  5CA0 A;  3RYI B;  1W40 A;  2WAL A;  2VXY A;  3GHZ A;  5J2T A;  3HAX D;  4DXD A;  4B5C A;  1YJ9 F;  3CYQ A;  3K12 A;  2HVY D;  3TD3 A;  1Q86 H;  5ITZ A;  1GO1 A;  3FD5 A;  4X1K B;  4WBN B;  4ZI7 B;  2H8E A;  1VQN F;  3VYU C;  3C9U A;  4ERH A;  5GIN C;  3V4D A;  2KTU A;  4C8E A;  3RYF A;  3V7E A;  4IHJ B;  5CB4 B;  1U3P A;  3OBY A;  2R6R 1;  3CCV F;  1FNK A;  3L7Q A;  1SDS A;  4BVR A;  1OAP A;  4O2B B;  1COM A;  3NMU C;  4G4V A;  2LBX A;  1H47 A;  2CHS A;  3N2G A;  4B46 A;  3CC4 F;  5GIO C;  5LP6 C;  1VQ5 F;  3HKC A;  2IQQ A;  5LYJ A;  4BW0 B;  1N8R H;  5EIB C;  5KX5 B;  4KWE A;  5LXT B;  5JCO C;  1JFF A;  3JAK B;  1VQV A;  3D01 A;  3FD6 A;  4B62 A;  2Z1E A;  4ZOL B;  1IV1 A;  3D00 A;  4O4I A;  2QA4 F;  3OBW A;  1YI2 F;  5FLX M;  2I6D A;  3OW2 F;  4O4L B;  3S0Y A;  5IYZ B;  4X20 A;  3CC7 F;  1FSZ A;  1X7P A;  3LWO C;  3KE1 A;  5GON A;  4X1Y B;  2OTJ F;  4BVQ A;  2ZAU A;  3FFM A;  1DBF A;  4LNU B;  5JQG A;  3CPQ A;  2NMU A;  3VYS C;  5EYP A;  1W5B A;  3N2K A;  5IJ9 B;  5FNV B;  1R1M A;  4TUY A;  3LWV C;  2HP3 A;  2MQE A;  2H8C A;  3RYH B;  4BT3 A;  1VQK F;  4TV9 A;  4NQ3 A;  2AIZ P;  4YJ3 B;  1T0A A;  2ZF8 A;  5AVM A;  4IIJ A;  3RA5 A;  2GLZ A;  2PMP A;  1FFX A;  3KHN A;  5JVD B;  4EI8 A;  4X1I A;  3RE3 A;  3WXM B;  2KG4 A;  4U3J A;  2LBT A;  5IT9 M;  2ZOV A;  3CXC F;  1QU9 A;  1E7K A;  3P0Z A;  3J80 M;  3CC2 F;  1QVF F;  2G9I A;  5HXZ A;  1Q81 H;  4PWT A;  2ZOD A;  3ZP4 A;  1Q7Y H;  2QTP A;  3JVH A;  1VQ6 F;  1GX1 A;  1YHQ F;  2IG8 A;  2UYN A;  2QI2 A;  3WPX A;  2Z1T A;  1VQ4 F;  1W58 1;  2K1S A;  5GAP K;  3K14 A;  4HNA A;  1YIJ F;  1IV4 A;  2Q1Y A;  1VH8 A;  4NUT A;  5KMG A;  3KJK A;  1VQO F;  1SZQ A;  5EO3 A;  2VAW A;  1W55 A;  4B45 A;  1YGY A;  3E22 A;  1W3E X;  3B6N A;  4BT7 A;  2VGM A;  3LWP C;  2HX0 A;  3CCL F;  2I6R A;  5EZY B;  3F0F A;  2RHO A;  3MCA B;  2BTU A;  2HQS C;  4ZHW A;  3M1X A;  4DRX B;  1K73 H;  3MCQ A;  3QTY A;  3Q8H A;  2RHL A;  2UYK A;  2IAF A;  1J7H A;  3KIZ A;  1JN1 A;  5J2U B;  3S06 A;  4I50 A;  1TUB B;  4YJ2 B;  3S03 A;  3E1Y A;  1UFY A;  2BTO A;  3HKD B;  3S02 A;  4O2B A;  5HP8 A;  3CCE F;  4O4J B;  3JAR B;  3F0E A;  2VAP A;  5JH7 B;  5G4V C;  2RB9 A;  1NJI H;  1RQ7 A;  5BMV A;  1KNK A;  1XV2 A;  3HWU A;  5MN5 A;  1VQ8 F;  3I55 F;  1RLG A;  5KX5 A;  1T0K B;  3CPW F;  4C4W C;  4F6R B;  1H48 A;  3LFO A;  3K0T A;  3JAK A;  2JNB A;  1M90 H;  1RLU A;  4RQO A;  5HXU A;  4ZOL A;  3MDO A;  3SIV A;  5HY4 A;  2BTQ B;  4I55 A;  1TVK A;  1NMU B;  3T80 A;  4C8G A;  5CA1 A;  3RA6 A;  1YJN F;  3IR9 A;  3M84 A;  5ITZ B;  1U43 A;  2CW4 A;  2N48 A;  2KTV A;  4BT2 A;  3DC2 A;  1FNJ A;  1X52 A;  4G88 A;  3M4S A;  3JAW A;  2CWJ A;  1PF5 A;  2CSL A;  1GZ0 A;  3RYF B;  4E6E A;  3J81 M;  1VQ9 F;  3G6E F;  3VCZ A;  3HKB A;  4X3M A;  1KQS F;  3HKE A;  4O4H A;  3PLA C;  3N4Z A;  3S0W A;  3SIU A;  4TV8 A;  4RHA A;  3TD5 A;  3CME F;  3N2G B;  5GAN K;  1VHA A;  2W8B C;  4U39 A;  5EB0 A;  1SA0 A;  1VQP F;  3G4S F;  3V3T A;  3HKC B;  4C81 A;  4BVT A;  5HP7 A;  5LYJ B;  4EI9 A;  2HS4 A;  1CK2 A;  3WGJ A;  4FFB B;  1JD1 A;  3VI6 A;  5DCV A;  1JFF B;  4G4W A;  5EB1 B;  3ZP7 A;  3JAT A;  5IJ0 B;  1W2B F;  5LOV A;  1XRG A;  4O4I B;  2LBW A;  1QD9 A;  2OTM A;  3C9T A;  2OZB A;  1XBI A;  1UI9 A;  3JAL A;  4O2A A;  2R75 1;  4EB6 A;  5MN4 A;  3MQW A;  5EWR A;  1CLI A;  4ZHQ A;  3F0D A;  5LP6 A;  1PXW A;  3JAS A;  5GON B;  1QVG F;  1KD1 H;  3FBA A;  2GVI A;  3ZO8 A;  2CZW A;  5JQG B;  3NVK E;  5EYP B;  3JCM M;  2RHH A;  3E20 B;  3IEW A;  3UT5 A;  5JCO A;  4TUY B;  3CMA F;  4G4Z A;  5C8Y A;  3PAF A;  1IPA A;  2UZH A;  5LA6 A;  5HY0 A;  1RQ2 A;  4IIJ B;  3P10 A;  1JJ2 F;  2Q1X A;  1FFX B;  1ODE A;  1ONI A;  2FC3 A;  1QAH A;  3CG6 A;  4X1I B;  5EZY A;  3RYI A;  4G4X A;  3R0P A;  4U3J B;  3J7A R;  4I4T B;  1ZWZ A;  2LCA A;  3C9S A;  4DRX A;  2HS3 A;  3RYC B;  1KC8 H;  3C8L A;  3ESJ A;  3IKF A;  3P4E A;  1IV3 A;  3CYP B;  3F6M A;  1M1K H;  2HP0 B;  3WGK A;  3IMP A;  5J2U A;  3VOB A;  3WJQ A;  1X7O A;  4X1K A;  4YJ2 A;  2BO1 A;  4WBN A;  4ZI7 A;  3QUW A;  4BT5 A;  2GZL A;  2HS0 A;  1W5A A;  1H7M A;  3HKD A;  2QEX F;  3CCJ F;  2DT4 A;  5FJ4 C;  4O4J A;  1W5E A;  4IHJ A;  5CB4 A;  2KGW A;  4M8I A;  4HNA B;  3WGL A;  3LME A;  3LYB A;  1YJW F;  3AGK A;  5HY1 A;  3C9R A;  5KMG B;  4X3L A;  1RA4 A;  1VQL F;  3MBM A;  4BT6 A;  3N4Y A;  5A2Q M;  1VQ7 F;  3CCR F;  4F6R A;  1W59 A;  5EIB D;  4ZHV A;  2ZVZ A;  3E22 B;  3F0G A;  5B8F A;  3HJW C;  5CA0 B;  1CN7 A;  5J2T B;  3HTN A;  2UYP A;  5LXT A;  2OTL F;  4R40 B;  3OON A;  3O85 A;  3VIU A;  3V7Q A;  3K2X A;  1JY8 A;  3BYQ A;  3KJJ A;  1W41 A;  3ERN A;  3WJR A;  2ZVY A;  4I50 B;  2H6L A;  1XHO A;  5GIP C;  4O4L A;  3EOR A;  5IYZ A; 
#chains in the Genus database with same CATH homology
 3IEW A;  1GX1 A;  1T0A A;  4C8I A;  1KNK A;  3F0G A;  1H47 A;  3FPI A;  5B8F A;  2PMP A;  3Q8H A;  1H48 A;  2GZL A;  3K14 A;  1IV4 A;  2UZH A;  3RE3 A;  1U40 A;  1JN1 A;  3QHD A;  2AMT A;  1VH8 A;  3KE1 A;  3IEQ A;  1VHA A;  3P10 A;  3T80 A;  4C8G A;  1W57 A;  3F0D A;  3IKE A;  3K2X A;  1JY8 A;  3P0Z A;  4C8E A;  3ERN A;  1IV2 A;  1U43 A;  1W55 A;  4C81 A;  1IV1 A;  3ELC A;  3F0E A;  1U3P A;  3ESJ A;  3B6N A;  3IKF A;  1IV3 A;  4C82 A;  3MBM A;  3FBA A;  1KNJ A;  1YQN A;  3EOR A;  3GHZ A;  3F6M A;  3F0F A;  3JVH A;  1U3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...