3F0EA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
158
structure length
158
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 52
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3f0eA00
3ESJA 3B6NA 3F0GA 3RE3A 3ELCA 3IEWA 1IV3A 1JN1A 1U3LA 3IKFA 3P0ZA 3Q8HA 3IKEA 2UZHA 1VHAA 3F6MA 1IV4A 1GX1A 2AMTA 3KE1A 3F0FA 3F0DA 3P10A 1H48A 4C81A 1U43A 3MBMA 3T80A 3GHZA 3K14A 4C8IA 3FBAA 3EORA 4C8GA 1U40A 3ERNA 4C8EA 4C82A 2PMPA 1T0AA 1JY8A 1KNJA 1VH8A 1KNKA 2GZLA 3IEQA 1YQNA 3FPIA 3JVHA 1IV2A 1U3PA 3QHDA 1W57A 3F0EA 5B8FA 1IV1A 1W55A 3K2XA 1H47A
chains in the Genus database with same CATH superfamily
3F0GA 4BT4A 3Q8HA 2ALEA 3RYIB 3TD5A 1GX1A 2W8BC 1Q86H 2AIZP 3S02A 3V3TA 4X1IA 3IMPA 3S0YA 2GVIA 1SDSA 3C8LA 3K0TA 5CB4B 5JCOA 3S06A 4C82A 5JQGB 1Q82H 2RHHA 2RHLA 5LP6B 3CPWF 2HP3A 4O4IA 3CCMF 1W3EX 4DRXB 3N2GB 3O85A 1W59A 5B8FA 3HKDB 3L7QA 2NMUA 1W5AA 3JAKA 3UT5A 1K9MH 2VAPA 1JN1A 4I50A 1UI9A 4WBNB 3N4ZA 4O2BA 3V4DA 3HJWC 4BT3A 3RYHB 5MN6A 2V9YA 2KG4A 3CCEF 4ZK7A 2OTJF 4C8IA 5GANK 4X20B 2PMPA 3E22A 4B46A 3HKCB 5CA1A 3WJRA 5C8YA 1T0KB 1YQNA 5HY2A 5EYPA 5JH7A 5KMGA 2F9ZC 3WGMA 1TVKB 3LMEA 4ZHYB 1NJIH 2HRYA 3CC7F 1YJNF 2RHJA 3HAXD 3CCUF 3M4SA 3C9RA 2Q1YA 3FFMA 2H6LA 3ZOPA 4E6EA 3BYQA 2CHTA 5AVMA 4BY9D 4FFBB 2AIFA 2VGMA 2LCAA 4C81A 3CC4F 1QU9A 1IPAA 1VQ5F 2KTVA 1XV2A 3ERNA 3S03A 3JATA 2Z1TA 2GLZA 5J2TA 4O4JB 1YJ9F 1QVGF 1TUBA 2Z01A 5EWRA 5GIOC 1COMA 3E20B 4X3LA 4TV8A 3MCQA 4HNAA 3OBYA 5EB0A 3C9TA 5GONA 2H8EA 4ZHQA 5IYZB 1X7OA 2VAMA 1RA4A 4TUYA 1ZWZA 4ZOLA 4X1YB 2P6YA 3KJKA 1M90H 4NUTA 5MN4A 4IHJB 4G4VA 5LOVA 3P10A 1SA0B 3ZP7A 5DCVA 1K73H 1FFXA 2Z1FA 2R6R1 4G4ZA 4G88A 2LBWA 2Z1UA 2KTUA 3JAMM 4IIJA 2BTOA 4C8GA 3RYCB 5KX5A 1JD1A 3TD3A 5CA0B 1KNJA 3JARA 5FLXM 2FGYA 1DBFA 3VOAA 5G4VC 3QHDA 1N8RH 5JVDB 4BVRA 2UYPA 3RYFB 4BT7A 2K1SA 3FD6A 1VQNF 3V7EA 3RA6A 2ZVZA 3KE1A 2HVYD 2VAWA 3QUWA 3JASB 1VQPF 1U40A 1T0AA 2HP0A 4BVQA 5HY4A 3IEQA 5IJ0B 3R0PA 1W55A 5EZYA 3CCSF 3ESJA 3RE3A 4NWOB 1H7MA 5EIBD 2UZHA 2CW4A 5LXTA 3CYPB 4ERHA 3F0DA 3WGKA 5LYJA 1VQ8F 4NQ3A 1YITF 1YGYA 3DDNA 3CCVF 2OTMA 2ZF8A 3GHZA 1JFFA 2Z1EA 2IAFA 1RLUA 1KNKA 3OBWA 5LA6B 4BVSA 2R751 2IQQA 5BMVA 1E7KA 3D01A 2HX0A 2LBTA 1PXWA 3CPQA 3MDOA 1Z5WA 3VYUC 3WJQA 2EWCA 4EI8A 1VQ7F 2N48A 3ZP4A 2UYNA 1IV4A 2HQSC 4BT5A 1W42A 4BT6A 4G4WA 4G4YA 4O4HB 3JAWB 3KIZA 4F6RB 5HP8A 3K14A 1CK2A 2B33A 5IJ9A 3I7TA 4YJ2B 4TV9A 2JNBA 4U3JB 3D00A 3HKBB 2CVLA 4X1KA 3D54A 3JVHA 3JCMM 1FNKA 1IV1A 3N2KA 2QEXF 3LWOC 3ELCA 3IEWA 3VIUA 4EB6A 3IKFA 3WJPA 3CB2A 4ZI7A 1YI2F 2ZOVA 3CCRF 3NK7A 4RQOA 1GO1A 4O2AA 2UYKA 2KGWA 3SIUA 3CC2F 3LDTA 3VI6A 4X1IB 2ZODA 3CMAF 1W41A 3FBAA 1FNJA 3LWVC 2BO1A 4YJ3A 5IT9M 3JALA 1M1KH 5GIPC 2GZLA 1GZ0A 1W5FA 1IV2A 1K8AH 4O4IB 4O4LA 5FNVA 4I4TA 2PHNA 1H47A 4B5CA 2BTQB 3GTZA 1IV3A 5ITZA 3JAKB 3UT5B 3I56F 3S0HA 4I50B 3MQWA 2UYJA 4I55A 4O2BB 3LWRC 3V7QA 1VQKF 3C9SA 3HKEA 1J7HA 3DC2A 5EO3A 3WGLA 1W581 1X52A 3HWUA 3CCJF 5IJ9B 3I55F 4TZZA 3E22B 5CA1B 5HY1A 3CYQA 5C8YB 4PWTA 1W57A 1XRGA 5EYPB 5JH7B 2ZVYA 3RYIA 5KMGB 3J80M 1VQLF 2CWJA 4EB6B 4KWEA 1W5EA 3CXCF 3RA5A 1VK3A 3K12A 5CB4A 1W5BA 2OZBA 1KD1H 5JQGA 1VQMF 1PF5A 3ZO8A 1RLGA 2QA4F 3LWPC 1W40A 4DRXA 3N2GA 1VH8A 3JATB 3WPWA 1NQ3A 3KHNA 3J81M 5J2TB 2I6DA 3HKDA 1NMUB 1TUBB 3FPIA 3CCQF 1U3PA 5GINC 2VGNA 2HS0A 1R1MA 1VQ6F 1SZQA 2BTUA 4WBNA 4TV8B 4HNAB 1CLIA 5GONB 3TD4A 4ZHQB 3J7AR 3RYHA 3PLAC 5G4UC 4TUYB 1KQSF 3G71F 3F0FA 4ZOLB 4B45A 3WPXA 1XHOA 3VCZA 5LOVB 4X20A 3IR9A 3LFOA 1FFXB 1Q81H 3HKCA 3VYTC 1VQ9F 5HWEA 4IIJB 3WGJA 1ODEA 2VXYA 5KX5B 1QD9A 1TVKA 3JARB 4C4WC 3CD6F 1U3LA 2LBXA 1X25A 3C9UA 2CHSA 3M1XA 2WALA 2IG8A 3OW2F 3MCAB 3GYQA 4FFBA 4EI7A 3NVKE 4X3MA 1QAHA 5FJ4C 3E1YA 3T80A 4O4JA 4DXDA 1RQ2A 2OTLF 2HP0B 4RHAA 3P4EA 4R40B 5IYZA 3CCLF 2YXZA 3I3FA 3VO8A 2H8CA 4B62A 4X1YA 5EIBC 5EZYB 3P0ZA 3LYBA 3IKEA 3PAFA 4IHJA 1YHQF 1VHAA 2FC3A 2AMTA 3FD5A 1SA0A 3QTYA 1W2BF 2YYEA 5LXTB 1KC8H 1UFYA 2DT4A 3RYCA 5EB1B 1U43A 3MBMA 5LP6C 5LYJB 3LWQC 4LNUA 5CA0A 3G6EF 5GAPK 1JFFB 1FSZA 5HY0A 5JVDA 4ZHWA 2L26A 1VQOF 3RYFA 3VOBA 3CMEF 1X7PA 5BMVB 3F0EA 1ONIA 1YJWF 3SIVA 3CG6A 3B6NA 3F6MA 4EI9A 2OHWA 2Q1XA 4BW0B 1CN7A 2UYNB 3JASA 5EAZA 2QTPA 3HTNA 5J2UA 2HS4A 3NMUC 3EORA 2QI2A 3VTIC 2CSLA 5IJ0A 3M84A 4TV9B 4ZHVA 3N4YA 4X1KB 3NK6A 3VMFB 3N2KB 2RB9A 3OONA 3WXMB 1GO0A 4ZI7B 1JJ2F 1H48A 2HRUA 3KJJA 5JCOC 2MQEA 4O2AB 1VQVA 4G4XA 4BVTA 1VQ4F 4LNUB 5LA6A 4C8EA 5A2QM 5LP6A 1JY8A 3WGNA 4U39A 4YJ3B 3ON1A 3JALB 5MN5A 2DYYA 3G4SF 1OAPA 3VYSC 2ZAUA 2G9IA 4O4LB 2CZWA 3AGKA 4I4TB 5FNVB 4XCQA 5HXUA 1YIJF 1Q8RA 4M8IA 3U0OA 5ITZB 1XBIA 5HXZA 1RQ7A 1DT9A 4LCKA 4O4HA 3JAWA 4F6RA 4BT2A 4I55B 3NVIB 5HP7A 1Q7YH 5J2UB 4YJ2A 1OFUA 2RHOA 2HS3A 4U3JA 1S72F 2I6RA 3HKEB 1QVFF 3HKBA 1Z5VA 3S0WA 3K2XA
chains in the Genus database with same CATH topology
3ESJA 3B6NA 3F0GA 3RE3A 3ELCA 3IEWA 1IV3A 1JN1A 1U3LA 3IKFA 3P0ZA 3Q8HA 3IKEA 2UZHA 1VHAA 3F6MA 1IV4A 1GX1A 2AMTA 3KE1A 3F0FA 3F0DA 3P10A 1H48A 4C81A 1U43A 3MBMA 3T80A 3GHZA 3K14A 4C8IA 3FBAA 3EORA 4C8GA 1U40A 3ERNA 4C8EA 4C82A 2PMPA 1T0AA 1JY8A 1KNJA 1VH8A 1KNKA 2GZLA 3IEQA 1YQNA 3FPIA 3JVHA 1IV2A 1U3PA 3QHDA 1W57A 3F0EA 5B8FA 1IV1A 1W55A 3K2XA 1H47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ESJ A;  3B6N A;  3F0G A;  3RE3 A;  3ELC A;  3IEW A;  1IV3 A;  1JN1 A;  1U3L A;  3IKF A;  3P0Z A;  3Q8H A;  3IKE A;  2UZH A;  1VHA A;  3F6M A;  1IV4 A;  1GX1 A;  2AMT A;  3KE1 A;  3F0F A;  3F0D A;  3P10 A;  1H48 A;  4C81 A;  1U43 A;  3MBM A;  3T80 A;  3GHZ A;  3K14 A;  4C8I A;  3FBA A;  3EOR A;  4C8G A;  1U40 A;  3ERN A;  4C8E A;  4C82 A;  2PMP A;  1T0A A;  1JY8 A;  1KNJ A;  1VH8 A;  1KNK A;  2GZL A;  3IEQ A;  1YQN A;  3FPI A;  3JVH A;  1IV2 A;  1U3P A;  3QHD A;  1W57 A;  3F0E A;  5B8F A;  1IV1 A;  1W55 A;  3K2X A;  1H47 A; 
#chains in the Genus database with same CATH topology
 3F0G A;  4BT4 A;  3Q8H A;  2ALE A;  3RYI B;  3TD5 A;  1GX1 A;  2W8B C;  1Q86 H;  2AIZ P;  3S02 A;  3V3T A;  4X1I A;  3IMP A;  3S0Y A;  2GVI A;  1SDS A;  3C8L A;  3K0T A;  5CB4 B;  5JCO A;  3S06 A;  4C82 A;  5JQG B;  1Q82 H;  2RHH A;  2RHL A;  5LP6 B;  3CPW F;  2HP3 A;  4O4I A;  3CCM F;  1W3E X;  4DRX B;  3N2G B;  3O85 A;  1W59 A;  5B8F A;  3HKD B;  3L7Q A;  2NMU A;  1W5A A;  3JAK A;  3UT5 A;  1K9M H;  2VAP A;  1JN1 A;  4I50 A;  1UI9 A;  4WBN B;  3N4Z A;  4O2B A;  3V4D A;  3HJW C;  4BT3 A;  3RYH B;  5MN6 A;  2V9Y A;  2KG4 A;  3CCE F;  4ZK7 A;  2OTJ F;  4C8I A;  5GAN K;  4X20 B;  2PMP A;  3E22 A;  4B46 A;  3HKC B;  5CA1 A;  3WJR A;  5C8Y A;  1T0K B;  1YQN A;  5HY2 A;  5EYP A;  5JH7 A;  5KMG A;  2F9Z C;  3WGM A;  1TVK B;  3LME A;  4ZHY B;  1NJI H;  2HRY A;  3CC7 F;  1YJN F;  2RHJ A;  3HAX D;  3CCU F;  3M4S A;  3C9R A;  2Q1Y A;  3FFM A;  2H6L A;  3ZOP A;  4E6E A;  3BYQ A;  2CHT A;  5AVM A;  4BY9 D;  4FFB B;  2AIF A;  2VGM A;  2LCA A;  4C81 A;  3CC4 F;  1QU9 A;  1IPA A;  1VQ5 F;  2KTV A;  1XV2 A;  3ERN A;  3S03 A;  3JAT A;  2Z1T A;  2GLZ A;  5J2T A;  4O4J B;  1YJ9 F;  1QVG F;  1TUB A;  2Z01 A;  5EWR A;  5GIO C;  1COM A;  3E20 B;  4X3L A;  4TV8 A;  3MCQ A;  4HNA A;  3OBY A;  5EB0 A;  3C9T A;  5GON A;  2H8E A;  4ZHQ A;  5IYZ B;  1X7O A;  2VAM A;  1RA4 A;  4TUY A;  1ZWZ A;  4ZOL A;  4X1Y B;  2P6Y A;  3KJK A;  1M90 H;  4NUT A;  5MN4 A;  4IHJ B;  4G4V A;  5LOV A;  3P10 A;  1SA0 B;  3ZP7 A;  5DCV A;  1K73 H;  1FFX A;  2Z1F A;  2R6R 1;  4G4Z A;  4G88 A;  2LBW A;  2Z1U A;  2KTU A;  3JAM M;  4IIJ A;  2BTO A;  4C8G A;  3RYC B;  5KX5 A;  1JD1 A;  3TD3 A;  5CA0 B;  1KNJ A;  3JAR A;  5FLX M;  2FGY A;  1DBF A;  3VOA A;  5G4V C;  3QHD A;  1N8R H;  5JVD B;  4BVR A;  2UYP A;  3RYF B;  4BT7 A;  2K1S A;  3FD6 A;  1VQN F;  3V7E A;  3RA6 A;  2ZVZ A;  3KE1 A;  2HVY D;  2VAW A;  3QUW A;  3JAS B;  1VQP F;  1U40 A;  1T0A A;  2HP0 A;  4BVQ A;  5HY4 A;  3IEQ A;  5IJ0 B;  3R0P A;  1W55 A;  5EZY A;  3CCS F;  3ESJ A;  3RE3 A;  4NWO B;  1H7M A;  5EIB D;  2UZH A;  2CW4 A;  5LXT A;  3CYP B;  4ERH A;  3F0D A;  3WGK A;  5LYJ A;  1VQ8 F;  4NQ3 A;  1YIT F;  1YGY A;  3DDN A;  3CCV F;  2OTM A;  2ZF8 A;  3GHZ A;  1JFF A;  2Z1E A;  2IAF A;  1RLU A;  1KNK A;  3OBW A;  5LA6 B;  4BVS A;  2R75 1;  2IQQ A;  5BMV A;  1E7K A;  3D01 A;  2HX0 A;  2LBT A;  1PXW A;  3CPQ A;  3MDO A;  1Z5W A;  3VYU C;  3WJQ A;  2EWC A;  4EI8 A;  1VQ7 F;  2N48 A;  3ZP4 A;  2UYN A;  1IV4 A;  2HQS C;  4BT5 A;  1W42 A;  4BT6 A;  4G4W A;  4G4Y A;  4O4H B;  3JAW B;  3KIZ A;  4F6R B;  5HP8 A;  3K14 A;  1CK2 A;  2B33 A;  5IJ9 A;  3I7T A;  4YJ2 B;  4TV9 A;  2JNB A;  4U3J B;  3D00 A;  3HKB B;  2CVL A;  4X1K A;  3D54 A;  3JVH A;  3JCM M;  1FNK A;  1IV1 A;  3N2K A;  2QEX F;  3LWO C;  3ELC A;  3IEW A;  3VIU A;  4EB6 A;  3IKF A;  3WJP A;  3CB2 A;  4ZI7 A;  1YI2 F;  2ZOV A;  3CCR F;  3NK7 A;  4RQO A;  1GO1 A;  4O2A A;  2UYK A;  2KGW A;  3SIU A;  3CC2 F;  3LDT A;  3VI6 A;  4X1I B;  2ZOD A;  3CMA F;  1W41 A;  3FBA A;  1FNJ A;  3LWV C;  2BO1 A;  4YJ3 A;  5IT9 M;  3JAL A;  1M1K H;  5GIP C;  2GZL A;  1GZ0 A;  1W5F A;  1IV2 A;  1K8A H;  4O4I B;  4O4L A;  5FNV A;  4I4T A;  2PHN A;  1H47 A;  4B5C A;  2BTQ B;  3GTZ A;  1IV3 A;  5ITZ A;  3JAK B;  3UT5 B;  3I56 F;  3S0H A;  4I50 B;  3MQW A;  2UYJ A;  4I55 A;  4O2B B;  3LWR C;  3V7Q A;  1VQK F;  3C9S A;  3HKE A;  1J7H A;  3DC2 A;  5EO3 A;  3WGL A;  1W58 1;  1X52 A;  3HWU A;  3CCJ F;  5IJ9 B;  3I55 F;  4TZZ A;  3E22 B;  5CA1 B;  5HY1 A;  3CYQ A;  5C8Y B;  4PWT A;  1W57 A;  1XRG A;  5EYP B;  5JH7 B;  2ZVY A;  3RYI A;  5KMG B;  3J80 M;  1VQL F;  2CWJ A;  4EB6 B;  4KWE A;  1W5E A;  3CXC F;  3RA5 A;  1VK3 A;  3K12 A;  5CB4 A;  1W5B A;  2OZB A;  1KD1 H;  5JQG A;  1VQM F;  1PF5 A;  3ZO8 A;  1RLG A;  2QA4 F;  3LWP C;  1W40 A;  4DRX A;  3N2G A;  1VH8 A;  3JAT B;  3WPW A;  1NQ3 A;  3KHN A;  3J81 M;  5J2T B;  2I6D A;  3HKD A;  1NMU B;  1TUB B;  3FPI A;  3CCQ F;  1U3P A;  5GIN C;  2VGN A;  2HS0 A;  1R1M A;  1VQ6 F;  1SZQ A;  2BTU A;  4WBN A;  4TV8 B;  4HNA B;  1CLI A;  5GON B;  3TD4 A;  4ZHQ B;  3J7A R;  3RYH A;  3PLA C;  5G4U C;  4TUY B;  1KQS F;  3G71 F;  3F0F A;  4ZOL B;  4B45 A;  3WPX A;  1XHO A;  3VCZ A;  5LOV B;  4X20 A;  3IR9 A;  3LFO A;  1FFX B;  1Q81 H;  3HKC A;  3VYT C;  1VQ9 F;  5HWE A;  4IIJ B;  3WGJ A;  1ODE A;  2VXY A;  5KX5 B;  1QD9 A;  1TVK A;  3JAR B;  4C4W C;  3CD6 F;  1U3L A;  2LBX A;  1X25 A;  3C9U A;  2CHS A;  3M1X A;  2WAL A;  2IG8 A;  3OW2 F;  3MCA B;  3GYQ A;  4FFB A;  4EI7 A;  3NVK E;  4X3M A;  1QAH A;  5FJ4 C;  3E1Y A;  3T80 A;  4O4J A;  4DXD A;  1RQ2 A;  2OTL F;  2HP0 B;  4RHA A;  3P4E A;  4R40 B;  5IYZ A;  3CCL F;  2YXZ A;  3I3F A;  3VO8 A;  2H8C A;  4B62 A;  4X1Y A;  5EIB C;  5EZY B;  3P0Z A;  3LYB A;  3IKE A;  3PAF A;  4IHJ A;  1YHQ F;  1VHA A;  2FC3 A;  2AMT A;  3FD5 A;  1SA0 A;  3QTY A;  1W2B F;  2YYE A;  5LXT B;  1KC8 H;  1UFY A;  2DT4 A;  3RYC A;  5EB1 B;  1U43 A;  3MBM A;  5LP6 C;  5LYJ B;  3LWQ C;  4LNU A;  5CA0 A;  3G6E F;  5GAP K;  1JFF B;  1FSZ A;  5HY0 A;  5JVD A;  4ZHW A;  2L26 A;  1VQO F;  3RYF A;  3VOB A;  3CME F;  1X7P A;  5BMV B;  3F0E A;  1ONI A;  1YJW F;  3SIV A;  3CG6 A;  3B6N A;  3F6M A;  4EI9 A;  2OHW A;  2Q1X A;  4BW0 B;  1CN7 A;  2UYN B;  3JAS A;  5EAZ A;  2QTP A;  3HTN A;  5J2U A;  2HS4 A;  3NMU C;  3EOR A;  2QI2 A;  3VTI C;  2CSL A;  5IJ0 A;  3M84 A;  4TV9 B;  4ZHV A;  3N4Y A;  4X1K B;  3NK6 A;  3VMF B;  3N2K B;  2RB9 A;  3OON A;  3WXM B;  1GO0 A;  4ZI7 B;  1JJ2 F;  1H48 A;  2HRU A;  3KJJ A;  5JCO C;  2MQE A;  4O2A B;  1VQV A;  4G4X A;  4BVT A;  1VQ4 F;  4LNU B;  5LA6 A;  4C8E A;  5A2Q M;  5LP6 A;  1JY8 A;  3WGN A;  4U39 A;  4YJ3 B;  3ON1 A;  3JAL B;  5MN5 A;  2DYY A;  3G4S F;  1OAP A;  3VYS C;  2ZAU A;  2G9I A;  4O4L B;  2CZW A;  3AGK A;  4I4T B;  5FNV B;  4XCQ A;  5HXU A;  1YIJ F;  1Q8R A;  4M8I A;  3U0O A;  5ITZ B;  1XBI A;  5HXZ A;  1RQ7 A;  1DT9 A;  4LCK A;  4O4H A;  3JAW A;  4F6R A;  4BT2 A;  4I55 B;  3NVI B;  5HP7 A;  1Q7Y H;  5J2U B;  4YJ2 A;  1OFU A;  2RHO A;  2HS3 A;  4U3J A;  1S72 F;  2I6R A;  3HKE B;  1QVF F;  3HKB A;  1Z5V A;  3S0W A;  3K2X A; 
#chains in the Genus database with same CATH homology
 3ESJ A;  3B6N A;  3F0G A;  3RE3 A;  3ELC A;  3IEW A;  1IV3 A;  1JN1 A;  1U3L A;  3IKF A;  3P0Z A;  3Q8H A;  3IKE A;  2UZH A;  1VHA A;  3F6M A;  1IV4 A;  1GX1 A;  2AMT A;  3KE1 A;  3F0F A;  3F0D A;  3P10 A;  1H48 A;  4C81 A;  1U43 A;  3MBM A;  3T80 A;  3GHZ A;  3K14 A;  4C8I A;  3FBA A;  3EOR A;  4C8G A;  1U40 A;  3ERN A;  4C8E A;  4C82 A;  2PMP A;  1T0A A;  1JY8 A;  1KNJ A;  1VH8 A;  1KNK A;  2GZL A;  3IEQ A;  1YQN A;  3FPI A;  3JVH A;  1IV2 A;  1U3P A;  3QHD A;  1W57 A;  3F0E A;  5B8F A;  1IV1 A;  1W55 A;  3K2X A;  1H47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...