3F0EA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
158
structure length
158
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 52
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3f0eA00
1VH8A 1IV3A 1U40A 1JY8A 3IEQA 2AMTA 3ELCA 2GZLA 1T0AA 1YQNA 3GHZA 3ERNA 3ESJA 3IKFA 1IV2A 4C8EA 3KE1A 1U3LA 1W55A 2PMPA 3MBMA 4C8IA 1IV4A 1IV1A 2UZHA 3EORA 3F0EA 1KNKA 3F6MA 3T80A 3F0FA 3K2XA 4C82A 4C8GA 1GX1A 3IKEA 5B8FA 3Q8HA 1W57A 1H47A 3P0ZA 4C81A 3IEWA 3F0GA 3JVHA 3P10A 3FBAA 3FPIA 3RE3A 1U3PA 1VHAA 3F0DA 3B6NA 3QHDA 1JN1A 3K14A 1U43A 1KNJA 1H48A
chains in the Genus database with same CATH superfamily
5HWEA 2ZVYA 1VQKF 4O2AA 2Q1YA 1SA0A 5EO3A 4U3JB 5J2UA 1M90H 3ERNA 3L7QA 3HKCA 3WGMA 3I55F 5EZYB 2UZHA 5FNVA 3KHNA 2CW4A 2PHNA 1OAPA 1UI9A 3VOAA 3P0ZA 1GZ0A 5HXZA 1YI2F 1R1MA 2F9ZC 1RQ2A 1TVKB 2ZOVA 5CA0A 3VMFB 4O4HB 1PXWA 1X7OA 4YJ2A 4IIJA 3D01A 3D00A 3CCEF 5CB4B 2CVLA 2DYYA 5HP7A 4RQOA 3JARA 1W581 1OFUA 2Z1FA 3P4EA 5JVDB 5HY2A 3WGNA 3K2XA 2P6YA 3S0WA 1H47A 3J81M 5LA6A 2OHWA 4B45A 3NK6A 3F0DA 2IQQA 3CCJF 2QTPA 1KNJA 2OTLF 1H7MA 2R6R1 3HKBB 1FFXA 1JY8A 3RA5A 5JQGA 3GHZA 1RA4A 3ZOPA 3OW2F 3CG6A 3IKFA 4TZZA 1U3LA 2PMPA 2K1SA 1K73H 3LWPC 2AIFA 4O2AB 4O4IA 4BVQA 1W40A 3EORA 1QVGF 5J2UB 3F6MA 3F0FA 3HKCB 3JASA 1X7PA 1GX1A 4IHJA 3CB2A 5FNVB 3Q8HA 1W57A 1JD1A 4C81A 4F6RB 2QA4F 5BMVA 5MN6A 3C9SA 4ZHQB 1VQNF 4U3JA 4G4WA 2H8CA 4RHAA 2OZBA 3SIUA 3C9TA 5LP6A 1NJIH 1XHOA 4C8EA 1ODEA 3RYCA 4YJ2B 2FC3A 4IIJB 5KX5A 1JJ2F 3E20B 5C8YA 3IMPA 4C4WC 1W5FA 3JARB 3OBWA 3CD6F 1TVKA 3VI6A 4O4HA 1VQ5F 5LA6B 3RYFB 3G6EF 5CA1A 3CCVF 3HWUA 3CMEF 1IV3A 1Q81H 2BTOA 5FJ4C 5HP8A 1W55A 1YIJF 2I6RA 2HP3A 4ZI7B 3JAKB 3M4SA 4WBNB 3WJRA 4X20A 2IG8A 1Q8RA 1VQ9F 3WJQA 3M1XA 4DRXA 1VQLF 2VAWA 4O4JB 5EIBC 2HS4A 4IHJB 5HY1A 3RE3A 1M1KH 1K8AH 3OBYA 4R40B 2VXYA 5MN5A 3CCUF 3PLAC 3ON1A 1W5BA 2Z01A 5BMVB 1QAHA 1W2BF 2YYEA 2AMTA 3LMEA 2ZAUA 4C8IA 5G4UC 3MBMA 3PAFA 2ALEA 4O4LA 5G4VC 1CLIA 2Z1UA 5LP6B 5EYPB 3TD3A 4HNAB 1S72F 5KMGA 2BO1A 3R0PA 3TD5A 4F6RA 1NQ3A 3RYCB 1VQPF 3WPXA 5ITZB 3JCMM 4ZHQA 5KX5B 3JVHA 5C8YB 3LWQC 4M8IA 1X52A 3FPIA 4BVTA 4G4ZA 4ZOLA 3I56F 1Q86H 5AVMA 2KTVA 1U43A 4O2BA 1JFFB 4U39A 1YGYA 5CA1B 2CWJA 2R751 3N2GA 3KE1A 4NWOB 3RYHA 1IPAA 4ZK7A 2NMUA 2RHLA 1KNKA 4C8GA 1YJWF 2V9YA 3VTIC 3CMAF 1Q82H 2Q1XA 4B46A 3RYFA 4X20B 4BVSA 2UYNA 1U3PA 2LBXA 3QHDA 2H6LA 5LOVB 4DRXB 2HX0A 3CCSF 2G9IA 5DCVA 2EWCA 3IR9A 5IJ0B 1T0KB 1VQMF 1KQSF 2GZLA 1E7KA 4BT2A 4ZI7A 3JAKA 1FNJA 3DC2A 3QTYA 4WBNA 3OONA 2KTUA 3RYIA 1IV4A 1NMUB 5IYZB 3CXCF 3NMUC 4I50A 1YJ9F 1UFYA 1QVFF 2YXZA 4O4JA 2H8EA 4O4LB 3FFMA 4BY9D 3GYQA 3S06A 2ZVZA 1QU9A 3HKEA 5KMGB 3N4ZA 1FNKA 3HAXD 4I4TA 3E1YA 2HVYD 2VGMA 3CCMF 3UT5B 5GIOC 1XBIA 2WALA 5LXTA 4LNUA 4G88A 4ZOLB 3IEQA 3V7QA 1CN7A 1K9MH 2KG4A 2W8BC 2L26A 2HRUA 3ESJA 4O2BB 4B5CA 4TV8A 5EYPA 4HNAA 5GONA 1W59A 2BTUA 5ITZA 1W42A 5IJ9A 3N2GB 3IKEA 3V7EA 2Z1TA 3RYHB 2VAPA 1TUBB 4TV9B 5GANK 3TD4A 1YJNF 4G4XA 3FD5A 1VHAA 1JFFA 1W3EX 3N4YA 3LWRC 3CPQA 2CSLA 3T80A 2HQSC 3VYUC 2UYNB 3G71F 3N2KB 3WGLA 1T0AA 2ZODA 4NUTA 1IV2A 2HP0B 3JATA 5HY0A 4X1IB 2RB9A 4DXDA 4I55B 2UYKA 3RYIB 2HRYA 4EI7A 2I6DA 2RHHA 4I50B 5EB0A 3IEWA 5LOVA 2CHSA 3LWOC 3BYQA 1DT9A 2Z1EA 2GVIA 2ZF8A 3WPWA 5IJ0A 2CZWA 3KJKA 3HKEB 3K14A 3MDOA 3V3TA 3F0GA 4ZHYB 2HS0A 4BT5A 4ZHVA 4X1YA 4I4TB 5IYZA 2CHTA 3LDTA 5GAPK 1J7HA 4PWTA 2KGWA 4LNUB 3VO8A 5LXTB 3JAWB 3NVIB 1DBFA 1COMA 3F0EA 4TV8B 3E22A 5GIPC 3HJWC 4BT3A 1ZWZA 3J80M 5GONB 3G4SF 3CYQA 5IJ9B 3UT5A 3S03A 5J2TB 1VQ6F 4LCKA 3FBAA 4BT4A 2LCAA 4KWEA 3HKDA 1JN1A 3K0TA 3VYSC 2QEXF 2JNBA 3ELCA 4FFBB 5EB1B 3C9RA 2AIZP 4G4VA 3ZP4A 2HS3A 5EAZA 1TUBA 4TV9A 3NK7A 2VAMA 3KJJA 3FD6A 3WXMB 5IT9M 1RLUA 3JATB 4EB6A 4TUYA 2GLZA 3CCRF 1X25A 1W5EA 5JCOC 4E6EA 3N2KA 2UYPA 5FLXM 3VIUA 3CC7F 2HP0A 1YQNA 4X1IA 2QI2A 4I55A 4ERHA 1IV1A 4X1YB 3CCLF 4YJ3B 3JALA 5HY4A 5MN4A 3GTZA 1VQ8F 3MCAB 2LBTA 3S02A 3LYBA 3S0HA 2OTJF 1Z5WA 1FSZA 1Q7YH 4BW0B 3E22B 3O85A 5A2QM 4X3MA 1CK2A 4BT6A 3CYPB 2RHJA 1KD1H 3WJPA 1GO0A 1SZQA 3JAWA 3M84A 3CC4F 3HKDB 4X1KA 2MQEA 3VOBA 3VCZA 3WGJA 5JH7A 3AGKA 3SIVA 5LYJA 1SA0B 3CCQF 4EI8A 2LBWA 4EI9A 3LWVC 4XCQA 3HTNA 2B33A 2DT4A 3S0YA 1VQVA 2IAFA 4ZHWA 1PF5A 5J2TA 3JAMM 1KC8H 2BTQB 3RA6A 3P10A 4B62A 4EB6B 4TUYB 3DDNA 3VYTC 4BVRA 2VGNA 1H48A 4FFBA 1SDSA 1VH8A 1U40A 5EZYA 1XRGA 1Z5VA 5EIBD 5CA0B 3QUWA 1YITF 1W5AA 4NQ3A 1VQOF 1QD9A 5B8FA 1VK3A 3CC2F 2OTMA 3JALB 4BT7A 1RQ7A 3C9UA 3J7AR 5EWRA 1YHQF 3ZP7A 1VQ4F 3MQWA 1W41A 4X3LA 3KIZA 3WGKA 5HXUA 5CB4A 4YJ3A 1XV2A 5JVDA 1N8RH 3ZO8A 1FFXB 3NVKE 3CPWF 2N48A 1RLGA 3LFOA 5JQGB 4X1KB 3I3FA 5LP6C 4C82A 5JH7B 3MCQA 3U0OA 1GO1A 4O4IB 5LYJB 3V4DA 2FGYA 4G4YA 3K12A 5JCOA 3JASB 1ONIA 1VQ7F 2RHOA 3HKBA 5GINC 3I7TA 3B6NA 2UYJA 3D54A 3C8LA
chains in the Genus database with same CATH topology
1VH8A 1IV3A 1U40A 1JY8A 3IEQA 2AMTA 3ELCA 2GZLA 1T0AA 1YQNA 3GHZA 3ERNA 3ESJA 3IKFA 1IV2A 4C8EA 3KE1A 1U3LA 1W55A 2PMPA 3MBMA 4C8IA 1IV4A 1IV1A 2UZHA 3EORA 3F0EA 1KNKA 3F6MA 3T80A 3F0FA 3K2XA 4C82A 4C8GA 1GX1A 3IKEA 5B8FA 3Q8HA 1W57A 1H47A 3P0ZA 4C81A 3IEWA 3F0GA 3JVHA 3P10A 3FBAA 3FPIA 3RE3A 1U3PA 1VHAA 3F0DA 3B6NA 3QHDA 1JN1A 3K14A 1U43A 1KNJA 1H48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VH8 A;  1IV3 A;  1U40 A;  1JY8 A;  3IEQ A;  2AMT A;  3ELC A;  2GZL A;  1T0A A;  1YQN A;  3GHZ A;  3ERN A;  3ESJ A;  3IKF A;  1IV2 A;  4C8E A;  3KE1 A;  1U3L A;  1W55 A;  2PMP A;  3MBM A;  4C8I A;  1IV4 A;  1IV1 A;  2UZH A;  3EOR A;  3F0E A;  1KNK A;  3F6M A;  3T80 A;  3F0F A;  3K2X A;  4C82 A;  4C8G A;  1GX1 A;  3IKE A;  5B8F A;  3Q8H A;  1W57 A;  1H47 A;  3P0Z A;  4C81 A;  3IEW A;  3F0G A;  3JVH A;  3P10 A;  3FBA A;  3FPI A;  3RE3 A;  1U3P A;  1VHA A;  3F0D A;  3B6N A;  3QHD A;  1JN1 A;  3K14 A;  1U43 A;  1KNJ A;  1H48 A; 
#chains in the Genus database with same CATH topology
 5HWE A;  2ZVY A;  1VQK F;  4O2A A;  2Q1Y A;  1SA0 A;  5EO3 A;  4U3J B;  5J2U A;  1M90 H;  3ERN A;  3L7Q A;  3HKC A;  3WGM A;  3I55 F;  5EZY B;  2UZH A;  5FNV A;  3KHN A;  2CW4 A;  2PHN A;  1OAP A;  1UI9 A;  3VOA A;  3P0Z A;  1GZ0 A;  5HXZ A;  1YI2 F;  1R1M A;  2F9Z C;  1RQ2 A;  1TVK B;  2ZOV A;  5CA0 A;  3VMF B;  4O4H B;  1PXW A;  1X7O A;  4YJ2 A;  4IIJ A;  3D01 A;  3D00 A;  3CCE F;  5CB4 B;  2CVL A;  2DYY A;  5HP7 A;  4RQO A;  3JAR A;  1W58 1;  1OFU A;  2Z1F A;  3P4E A;  5JVD B;  5HY2 A;  3WGN A;  3K2X A;  2P6Y A;  3S0W A;  1H47 A;  3J81 M;  5LA6 A;  2OHW A;  4B45 A;  3NK6 A;  3F0D A;  2IQQ A;  3CCJ F;  2QTP A;  1KNJ A;  2OTL F;  1H7M A;  2R6R 1;  3HKB B;  1FFX A;  1JY8 A;  3RA5 A;  5JQG A;  3GHZ A;  1RA4 A;  3ZOP A;  3OW2 F;  3CG6 A;  3IKF A;  4TZZ A;  1U3L A;  2PMP A;  2K1S A;  1K73 H;  3LWP C;  2AIF A;  4O2A B;  4O4I A;  4BVQ A;  1W40 A;  3EOR A;  1QVG F;  5J2U B;  3F6M A;  3F0F A;  3HKC B;  3JAS A;  1X7P A;  1GX1 A;  4IHJ A;  3CB2 A;  5FNV B;  3Q8H A;  1W57 A;  1JD1 A;  4C81 A;  4F6R B;  2QA4 F;  5BMV A;  5MN6 A;  3C9S A;  4ZHQ B;  1VQN F;  4U3J A;  4G4W A;  2H8C A;  4RHA A;  2OZB A;  3SIU A;  3C9T A;  5LP6 A;  1NJI H;  1XHO A;  4C8E A;  1ODE A;  3RYC A;  4YJ2 B;  2FC3 A;  4IIJ B;  5KX5 A;  1JJ2 F;  3E20 B;  5C8Y A;  3IMP A;  4C4W C;  1W5F A;  3JAR B;  3OBW A;  3CD6 F;  1TVK A;  3VI6 A;  4O4H A;  1VQ5 F;  5LA6 B;  3RYF B;  3G6E F;  5CA1 A;  3CCV F;  3HWU A;  3CME F;  1IV3 A;  1Q81 H;  2BTO A;  5FJ4 C;  5HP8 A;  1W55 A;  1YIJ F;  2I6R A;  2HP3 A;  4ZI7 B;  3JAK B;  3M4S A;  4WBN B;  3WJR A;  4X20 A;  2IG8 A;  1Q8R A;  1VQ9 F;  3WJQ A;  3M1X A;  4DRX A;  1VQL F;  2VAW A;  4O4J B;  5EIB C;  2HS4 A;  4IHJ B;  5HY1 A;  3RE3 A;  1M1K H;  1K8A H;  3OBY A;  4R40 B;  2VXY A;  5MN5 A;  3CCU F;  3PLA C;  3ON1 A;  1W5B A;  2Z01 A;  5BMV B;  1QAH A;  1W2B F;  2YYE A;  2AMT A;  3LME A;  2ZAU A;  4C8I A;  5G4U C;  3MBM A;  3PAF A;  2ALE A;  4O4L A;  5G4V C;  1CLI A;  2Z1U A;  5LP6 B;  5EYP B;  3TD3 A;  4HNA B;  1S72 F;  5KMG A;  2BO1 A;  3R0P A;  3TD5 A;  4F6R A;  1NQ3 A;  3RYC B;  1VQP F;  3WPX A;  5ITZ B;  3JCM M;  4ZHQ A;  5KX5 B;  3JVH A;  5C8Y B;  3LWQ C;  4M8I A;  1X52 A;  3FPI A;  4BVT A;  4G4Z A;  4ZOL A;  3I56 F;  1Q86 H;  5AVM A;  2KTV A;  1U43 A;  4O2B A;  1JFF B;  4U39 A;  1YGY A;  5CA1 B;  2CWJ A;  2R75 1;  3N2G A;  3KE1 A;  4NWO B;  3RYH A;  1IPA A;  4ZK7 A;  2NMU A;  2RHL A;  1KNK A;  4C8G A;  1YJW F;  2V9Y A;  3VTI C;  3CMA F;  1Q82 H;  2Q1X A;  4B46 A;  3RYF A;  4X20 B;  4BVS A;  2UYN A;  1U3P A;  2LBX A;  3QHD A;  2H6L A;  5LOV B;  4DRX B;  2HX0 A;  3CCS F;  2G9I A;  5DCV A;  2EWC A;  3IR9 A;  5IJ0 B;  1T0K B;  1VQM F;  1KQS F;  2GZL A;  1E7K A;  4BT2 A;  4ZI7 A;  3JAK A;  1FNJ A;  3DC2 A;  3QTY A;  4WBN A;  3OON A;  2KTU A;  3RYI A;  1IV4 A;  1NMU B;  5IYZ B;  3CXC F;  3NMU C;  4I50 A;  1YJ9 F;  1UFY A;  1QVF F;  2YXZ A;  4O4J A;  2H8E A;  4O4L B;  3FFM A;  4BY9 D;  3GYQ A;  3S06 A;  2ZVZ A;  1QU9 A;  3HKE A;  5KMG B;  3N4Z A;  1FNK A;  3HAX D;  4I4T A;  3E1Y A;  2HVY D;  2VGM A;  3CCM F;  3UT5 B;  5GIO C;  1XBI A;  2WAL A;  5LXT A;  4LNU A;  4G88 A;  4ZOL B;  3IEQ A;  3V7Q A;  1CN7 A;  1K9M H;  2KG4 A;  2W8B C;  2L26 A;  2HRU A;  3ESJ A;  4O2B B;  4B5C A;  4TV8 A;  5EYP A;  4HNA A;  5GON A;  1W59 A;  2BTU A;  5ITZ A;  1W42 A;  5IJ9 A;  3N2G B;  3IKE A;  3V7E A;  2Z1T A;  3RYH B;  2VAP A;  1TUB B;  4TV9 B;  5GAN K;  3TD4 A;  1YJN F;  4G4X A;  3FD5 A;  1VHA A;  1JFF A;  1W3E X;  3N4Y A;  3LWR C;  3CPQ A;  2CSL A;  3T80 A;  2HQS C;  3VYU C;  2UYN B;  3G71 F;  3N2K B;  3WGL A;  1T0A A;  2ZOD A;  4NUT A;  1IV2 A;  2HP0 B;  3JAT A;  5HY0 A;  4X1I B;  2RB9 A;  4DXD A;  4I55 B;  2UYK A;  3RYI B;  2HRY A;  4EI7 A;  2I6D A;  2RHH A;  4I50 B;  5EB0 A;  3IEW A;  5LOV A;  2CHS A;  3LWO C;  3BYQ A;  1DT9 A;  2Z1E A;  2GVI A;  2ZF8 A;  3WPW A;  5IJ0 A;  2CZW A;  3KJK A;  3HKE B;  3K14 A;  3MDO A;  3V3T A;  3F0G A;  4ZHY B;  2HS0 A;  4BT5 A;  4ZHV A;  4X1Y A;  4I4T B;  5IYZ A;  2CHT A;  3LDT A;  5GAP K;  1J7H A;  4PWT A;  2KGW A;  4LNU B;  3VO8 A;  5LXT B;  3JAW B;  3NVI B;  1DBF A;  1COM A;  3F0E A;  4TV8 B;  3E22 A;  5GIP C;  3HJW C;  4BT3 A;  1ZWZ A;  3J80 M;  5GON B;  3G4S F;  3CYQ A;  5IJ9 B;  3UT5 A;  3S03 A;  5J2T B;  1VQ6 F;  4LCK A;  3FBA A;  4BT4 A;  2LCA A;  4KWE A;  3HKD A;  1JN1 A;  3K0T A;  3VYS C;  2QEX F;  2JNB A;  3ELC A;  4FFB B;  5EB1 B;  3C9R A;  2AIZ P;  4G4V A;  3ZP4 A;  2HS3 A;  5EAZ A;  1TUB A;  4TV9 A;  3NK7 A;  2VAM A;  3KJJ A;  3FD6 A;  3WXM B;  5IT9 M;  1RLU A;  3JAT B;  4EB6 A;  4TUY A;  2GLZ A;  3CCR F;  1X25 A;  1W5E A;  5JCO C;  4E6E A;  3N2K A;  2UYP A;  5FLX M;  3VIU A;  3CC7 F;  2HP0 A;  1YQN A;  4X1I A;  2QI2 A;  4I55 A;  4ERH A;  1IV1 A;  4X1Y B;  3CCL F;  4YJ3 B;  3JAL A;  5HY4 A;  5MN4 A;  3GTZ A;  1VQ8 F;  3MCA B;  2LBT A;  3S02 A;  3LYB A;  3S0H A;  2OTJ F;  1Z5W A;  1FSZ A;  1Q7Y H;  4BW0 B;  3E22 B;  3O85 A;  5A2Q M;  4X3M A;  1CK2 A;  4BT6 A;  3CYP B;  2RHJ A;  1KD1 H;  3WJP A;  1GO0 A;  1SZQ A;  3JAW A;  3M84 A;  3CC4 F;  3HKD B;  4X1K A;  2MQE A;  3VOB A;  3VCZ A;  3WGJ A;  5JH7 A;  3AGK A;  3SIV A;  5LYJ A;  1SA0 B;  3CCQ F;  4EI8 A;  2LBW A;  4EI9 A;  3LWV C;  4XCQ A;  3HTN A;  2B33 A;  2DT4 A;  3S0Y A;  1VQV A;  2IAF A;  4ZHW A;  1PF5 A;  5J2T A;  3JAM M;  1KC8 H;  2BTQ B;  3RA6 A;  3P10 A;  4B62 A;  4EB6 B;  4TUY B;  3DDN A;  3VYT C;  4BVR A;  2VGN A;  1H48 A;  4FFB A;  1SDS A;  1VH8 A;  1U40 A;  5EZY A;  1XRG A;  1Z5V A;  5EIB D;  5CA0 B;  3QUW A;  1YIT F;  1W5A A;  4NQ3 A;  1VQO F;  1QD9 A;  5B8F A;  1VK3 A;  3CC2 F;  2OTM A;  3JAL B;  4BT7 A;  1RQ7 A;  3C9U A;  3J7A R;  5EWR A;  1YHQ F;  3ZP7 A;  1VQ4 F;  3MQW A;  1W41 A;  4X3L A;  3KIZ A;  3WGK A;  5HXU A;  5CB4 A;  4YJ3 A;  1XV2 A;  5JVD A;  1N8R H;  3ZO8 A;  1FFX B;  3NVK E;  3CPW F;  2N48 A;  1RLG A;  3LFO A;  5JQG B;  4X1K B;  3I3F A;  5LP6 C;  4C82 A;  5JH7 B;  3MCQ A;  3U0O A;  1GO1 A;  4O4I B;  5LYJ B;  3V4D A;  2FGY A;  4G4Y A;  3K12 A;  5JCO A;  3JAS B;  1ONI A;  1VQ7 F;  2RHO A;  3HKB A;  5GIN C;  3I7T A;  3B6N A;  2UYJ A;  3D54 A;  3C8L A; 
#chains in the Genus database with same CATH homology
 1VH8 A;  1IV3 A;  1U40 A;  1JY8 A;  3IEQ A;  2AMT A;  3ELC A;  2GZL A;  1T0A A;  1YQN A;  3GHZ A;  3ERN A;  3ESJ A;  3IKF A;  1IV2 A;  4C8E A;  3KE1 A;  1U3L A;  1W55 A;  2PMP A;  3MBM A;  4C8I A;  1IV4 A;  1IV1 A;  2UZH A;  3EOR A;  3F0E A;  1KNK A;  3F6M A;  3T80 A;  3F0F A;  3K2X A;  4C82 A;  4C8G A;  1GX1 A;  3IKE A;  5B8F A;  3Q8H A;  1W57 A;  1H47 A;  3P0Z A;  4C81 A;  3IEW A;  3F0G A;  3JVH A;  3P10 A;  3FBA A;  3FPI A;  3RE3 A;  1U3P A;  1VHA A;  3F0D A;  3B6N A;  3QHD A;  1JN1 A;  3K14 A;  1U43 A;  1KNJ A;  1H48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...