3IMPA

New crystal form of the c-terminal domain of helicobacter pylori motb (residues 125-256)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
131
structure length
131
Chain Sequence
GIDPFTFENATSDAINQDMMLYIERIAKIIQKLPKRVHINVRGFTDDTPLVKTRFKSHYELAANRAYRVMKVLIQYGVNPNQLSFSSYGSTNPIAPNDSLENRMKNNRVEIFFSTDANDLSKIHSILDNEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein motB
publication title Crystallographic and Molecular Dynamics Analysis of Loop Motions Unmasking the Peptidoglycan-Binding Site in Stator Protein MotB of Flagellar Motor
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Membrane protein
total genus 42
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3impA00
2ZVZA 3S0WA 1R1MA 1OAPA 4B62A 2AIZP 4G4WA 4ZHYB 2K1SA 3CYQA 4ERHA 4ZHVA 3TD5A 4ZHWA 4G88A 3S02A 4G4ZA 2KGWA 3S0HA 5EAZA 2MQEA 5EB1B 3S03A 3TD4A 4B5CA 3OONA 2ZF8A 2N48A 2LCAA 4G4XA 4G4VA 4RHAA 3S0YA 3IMPA 3S06A 3CYPB 2ZOVA 2LBTA 3KHNA 3LDTA 5EB0A 3TD3A 3WPXA 4R40B 2HQSC 2W8BC 2ZVYA 4G4YA 3WPWA 2L26A 4PWTA
chains in the Genus database with same CATH superfamily
3FD5A 4O2BA 3WJRA 1KNKA 2HP3A 1KC8H 2HS3A 2Z1FA 5EO3A 2IAFA 2OTLF 1IV3A 1JFFB 5KX5A 4G88A 3VOBA 3JVHA 3S03A 5EAZA 1VQ8F 1Q86H 4X1IA 3C9SA 1UI9A 3CCSF 4C4WC 1CN7A 3RYFA 3N2KA 1W59A 1JY8A 3FPIA 3MQWA 1IV2A 5LP6B 3EORA 3GTZA 3RYCB 3CCVF 5ITZB 1Q8RA 4TV9B 3GYQA 4EB6B 3D00A 3SIUA 5IT9M 3F0GA 3ZP7A 4M8IA 3CMAF 3CC4F 1FFXA 2RHOA 1PXWA 2VXYA 3IEWA 1W5AA 3UT5A 1SDSA 1IV1A 1GO1A 3ZP4A 4BT7A 1FNKA 2HP0A 5AVMA 1W5EA 4O2AB 1E7KA 5EIBC 3F0FA 5CA1A 1TUBA 5EIBD 4X20A 2CVLA 3JAWB 5G4VC 5EWRA 4O4HB 3VTIC 4DRXA 3FD6A 2WALA 5EYPB 3Q8HA 3JATB 2EWCA 3NVKE 5FNVA 5HP7A 3SIVA 3LWOC 2OZBA 5HP8A 5JCOA 1U43A 3FBAA 4O4JA 3VI6A 1K8AH 3C8LA 1CK2A 1W3EX 4X3LA 1U3LA 3J80M 3WPWA 2KTVA 3RYIB 4YJ3B 4WBNB 5GIPC 1VQ9F 5B8FA 1K73H 3C9TA 2H8EA 4I50A 3CCEF 1COMA 3VYSC 3HKEA 4O2BB 5LYJA 4ZHQB 4LNUA 5DCVA 2Z1UA 5GIOC 2PHNA 1W2BF 4U39A 1K9MH 3ZO8A 2CW4A 5KX5B 3HKDA 3BYQA 2LCAA 3S0YA 3CC2F 4EI8A 4O4IA 4X1IB 3LFOA 1SA0A 3WJPA 5IJ9B 2OTJF 2I6RA 1YIJF 2ZVYA 1YQNA 3RYFB 5A2QM 3JAMM 3N2KB 3CCQF 3GHZA 1QVGF 4BVSA 1T0AA 2AMTA 4DXDA 4NQ3A 1YGYA 4XCQA 3NVIB 5EB1B 1XBIA 5JQGA 3I55F 3CCUF 4C81A 3CCLF 3HWUA 5BMVA 2CHTA 4F6RA 1YJWF 2N48A 3MCAB 2H8CA 2LBXA 3RA5A 1XHOA 1FFXB 2UYPA 4BT5A 1VQ7F 5EB0A 3F0DA 1XV2A 3L7QA 3PAFA 2AIFA 4BVTA 4E6EA 3PLAC 2HP0B 2KTUA 2RHJA 4B62A 3CCRF 1JJ2F 3I56F 5KMGA 1FNJA 1TUBB 4ZHQA 2K1SA 3DC2A 4ZOLA 4X20B 4ERHA 5CA1B 3NK6A 2VAMA 1W57A 1W40A 4DRXB 2QEXF 3S02A 3I7TA 4BVQA 2B33A 5FNVB 5J2TA 3RA6A 2FGYA 4C8EA 5EZYA 1VQ5F 4O4JB 2CWJA 3HTNA 5IJ9A 5LXTA 1JD1A 5CA0A 3E1YA 3CCJF 3K12A 4HNAA 1YHQF 3VO8A 1M1KH 5GAPK 1ODEA 1QD9A 1S72F 4TV8A 4X1KA 4BT3A 1OAPA 3KJKA 2PMPA 3HKBA 1RQ2A 2GVIA 1ONIA 4I50B 4ZHWA 5J2UA 3R0PA 3HKEB 3IKEA 2ALEA 4X1YA 5HWEA 5LYJB 4LNUB 3WGMA 1QVFF 2DYYA 3OONA 5LOVA 1RQ7A 2YYEA 4B45A 3HKDB 3IEQA 3QTYA 2ZOVA 1KNJA 1X7PA 3VCZA 4NWOB 2BTQB 4O4IB 3JCMM 2W8BC 4BT4A 3KIZA 4BVRA 1SA0B 5IJ0A 5GINC 4TZZA 3S0WA 1R1MA 2Z1TA 1IV4A 3F0EA 5HY0A 3P10A 1DT9A 4G4WA 1FSZA 3CYQA 4LCKA 3CD6F 3U0OA 1VQ6F 3TD5A 2ZODA 1KQSF 3MBMA 3CMEF 2HVYD 2ZF8A 2UZHA 4G4VA 5JQGB 3WGKA 5GANK 1CLIA 4U3JA 5BMVB 1ZWZA 3RYHA 3S06A 4F6RB 5JH7A 3LWQC 1Q81H 3IKFA 3VOAA 3LMEA 4R40B 1NQ3A 2HS4A 4X3MA 1Z5VA 3P4EA 1TVKA 3NMUC 2UYKA 5KMGB 5LA6A 4ZOLB 1VQPF 3G71F 1GZ0A 2CSLA 5LP6C 1U40A 4IHJA 1U3PA 2YXZA 5J2TB 3ESJA 3VYUC 5HXUA 2QTPA 2OHWA 3CYPB 3K0TA 5EZYB 5FLXM 2RHLA 3CPQA 3V3TA 5LXTB 3CXCF 3G4SF 5CA0B 4YJ2A 2Q1XA 3LWPC 3MCQA 2P6YA 4HNAB 3LWVC 5C8YA 4TV8B 4X1KB 2LBWA 3NK7A 3ERNA 1W55A 4TUYA 3E22A 3HKBB 5MN4A 3D54A 5MN5A 2QA4F 5CB4B 2CZWA 1VHAA 5J2UB 3ZOPA 2VGMA 4X1YB 1NJIH 2UYNA 4G4XA 3M84A 1Z5WA 2G9IA 5LOVB 4FFBA 3K14A 1YJ9F 3LDTA 5GONA 1N8RH 4G4YA 1H48A 3LWRC 4BW0B 4BY9D 2HRYA 3AGKA 3ON1A 5IJ0B 5HY1A 1QAHA 5HY4A 4C8GA 4C8IA 3M4SA 5HXZA 1GX1A 3T80A 5FJ4C 3P0ZA 2V9YA 3QHDA 3IMPA 2VAPA 1XRGA 3KHNA 1PF5A 1X7OA 2HQSC 1X52A 4U3JB 3RYHB 3WGJA 5JH7B 3JASA 1VQLF 4C82A 3N2GA 3F6MA 1J7HA 2AIZP 3ELCA 1VQ4F 4I4TA 3CC7F 1VK3A 4ZI7A 1T0KB 2H6LA 2R6R1 4I55A 1TVKB 3IR9A 5CB4A 4G4ZA 4BT6A 2MQEA 3WGNA 1RA4A 1X25A 3CCMF 5LA6B 3CB2A 2IQQA 2BTOA 3G6EF 3N4YA 1SZQA 5IYZA 4IHJB 2RB9A 4ZK7A 2GZLA 3VMFB 2BO1A 3HKCA 2Q1YA 3O85A 2GLZA 4YJ2B 1YJNF 3J81M 4ZHVA 3E20B 5C8YB 3K2XA 4O4LA 3JALA 2OTMA 4TUYB 3E22B 1GO0A 2KG4A 1VQVA 5JVDA 3RE3A 3WXMB 3DDNA 4RHAA 1YITF 4IIJA 1NMUB 2FC3A 3JAKA 2UYNB 1QU9A 3LYBA 2JNBA 1YI2F 4FFBB 4PWTA 5GONB 3N4ZA 3V7EA 1JN1A 2R751 3OBWA 5G4UC 1JFFA 4ZHYB 3V4DA 5JCOC 3WJQA 5MN6A 2ZAUA 2Z1EA 4EI9A 1W5BA 2UYJA 1DBFA 2KGWA 1Q82H 3C9UA 4BT2A 4B5CA 3KE1A 4RQOA 2Z01A 3M1XA 2CHSA 2HX0A 2I6DA 2RHHA 5LP6A 3RYCA 3D01A 3WGLA 3TD3A 3WPXA 5ITZA 3OW2F 2VAWA 2VGNA 2L26A 4B46A 3I3FA 3JARB 4TV9A 4EB6A 3B6NA 3MDOA 3JASB 1IPAA 3J7AR 2HS0A 3N2GB 3CG6A 1OFUA 2DT4A 4I4TB 3V7QA 1H7MA 1VH8A 4ZI7B 4I55B 3TD4A 1W581 1UFYA 3FFMA 1VQKF 1VQOF 2LBTA 4O2AA 3HJWC 3C9RA 1RLUA 2F9ZC 2IG8A 3KJJA 3JAWA 5IYZB 1KD1H 4O4HA 3HAXD 1Q7YH 2ZVZA 3HKCB 5EYPA 5HY2A 3JATA 1RLGA 3VYTC 1H47A 2HRUA 4KWEA 1W41A 2BTUA 1W42A 3S0HA 1M90H 2NMUA 3CPWF 1VQMF 4O4LB 3JALB 1VQNF 4NUTA 3QUWA 3OBYA 2QI2A 4EI7A 5JVDB 4YJ3A 3RYIA 4WBNA 4IIJB 3JAKB 3UT5B 3JARA 3VIUA 1W5FA
chains in the Genus database with same CATH topology
2ZVZA 3S0WA 1R1MA 1OAPA 4B62A 2AIZP 4G4WA 4ZHYB 2K1SA 3CYQA 4ERHA 4ZHVA 3TD5A 4ZHWA 4G88A 3S02A 4G4ZA 2KGWA 3S0HA 5EAZA 2MQEA 5EB1B 3S03A 3TD4A 4B5CA 3OONA 2ZF8A 2N48A 2LCAA 4G4XA 4G4VA 4RHAA 3S0YA 3IMPA 3S06A 3CYPB 2ZOVA 2LBTA 3KHNA 3LDTA 5EB0A 3TD3A 3WPXA 4R40B 2HQSC 2W8BC 2ZVYA 4G4YA 3WPWA 2L26A 4PWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZVZ A;  3S0W A;  1R1M A;  1OAP A;  4B62 A;  2AIZ P;  4G4W A;  4ZHY B;  2K1S A;  3CYQ A;  4ERH A;  4ZHV A;  3TD5 A;  4ZHW A;  4G88 A;  3S02 A;  4G4Z A;  2KGW A;  3S0H A;  5EAZ A;  2MQE A;  5EB1 B;  3S03 A;  3TD4 A;  4B5C A;  3OON A;  2ZF8 A;  2N48 A;  2LCA A;  4G4X A;  4G4V A;  4RHA A;  3S0Y A;  3IMP A;  3S06 A;  3CYP B;  2ZOV A;  2LBT A;  3KHN A;  3LDT A;  5EB0 A;  3TD3 A;  3WPX A;  4R40 B;  2HQS C;  2W8B C;  2ZVY A;  4G4Y A;  3WPW A;  2L26 A;  4PWT A; 
#chains in the Genus database with same CATH topology
 3FD5 A;  4O2B A;  3WJR A;  1KNK A;  2HP3 A;  1KC8 H;  2HS3 A;  2Z1F A;  5EO3 A;  2IAF A;  2OTL F;  1IV3 A;  1JFF B;  5KX5 A;  4G88 A;  3VOB A;  3JVH A;  3S03 A;  5EAZ A;  1VQ8 F;  1Q86 H;  4X1I A;  3C9S A;  1UI9 A;  3CCS F;  4C4W C;  1CN7 A;  3RYF A;  3N2K A;  1W59 A;  1JY8 A;  3FPI A;  3MQW A;  1IV2 A;  5LP6 B;  3EOR A;  3GTZ A;  3RYC B;  3CCV F;  5ITZ B;  1Q8R A;  4TV9 B;  3GYQ A;  4EB6 B;  3D00 A;  3SIU A;  5IT9 M;  3F0G A;  3ZP7 A;  4M8I A;  3CMA F;  3CC4 F;  1FFX A;  2RHO A;  1PXW A;  2VXY A;  3IEW A;  1W5A A;  3UT5 A;  1SDS A;  1IV1 A;  1GO1 A;  3ZP4 A;  4BT7 A;  1FNK A;  2HP0 A;  5AVM A;  1W5E A;  4O2A B;  1E7K A;  5EIB C;  3F0F A;  5CA1 A;  1TUB A;  5EIB D;  4X20 A;  2CVL A;  3JAW B;  5G4V C;  5EWR A;  4O4H B;  3VTI C;  4DRX A;  3FD6 A;  2WAL A;  5EYP B;  3Q8H A;  3JAT B;  2EWC A;  3NVK E;  5FNV A;  5HP7 A;  3SIV A;  3LWO C;  2OZB A;  5HP8 A;  5JCO A;  1U43 A;  3FBA A;  4O4J A;  3VI6 A;  1K8A H;  3C8L A;  1CK2 A;  1W3E X;  4X3L A;  1U3L A;  3J80 M;  3WPW A;  2KTV A;  3RYI B;  4YJ3 B;  4WBN B;  5GIP C;  1VQ9 F;  5B8F A;  1K73 H;  3C9T A;  2H8E A;  4I50 A;  3CCE F;  1COM A;  3VYS C;  3HKE A;  4O2B B;  5LYJ A;  4ZHQ B;  4LNU A;  5DCV A;  2Z1U A;  5GIO C;  2PHN A;  1W2B F;  4U39 A;  1K9M H;  3ZO8 A;  2CW4 A;  5KX5 B;  3HKD A;  3BYQ A;  2LCA A;  3S0Y A;  3CC2 F;  4EI8 A;  4O4I A;  4X1I B;  3LFO A;  1SA0 A;  3WJP A;  5IJ9 B;  2OTJ F;  2I6R A;  1YIJ F;  2ZVY A;  1YQN A;  3RYF B;  5A2Q M;  3JAM M;  3N2K B;  3CCQ F;  3GHZ A;  1QVG F;  4BVS A;  1T0A A;  2AMT A;  4DXD A;  4NQ3 A;  1YGY A;  4XCQ A;  3NVI B;  5EB1 B;  1XBI A;  5JQG A;  3I55 F;  3CCU F;  4C81 A;  3CCL F;  3HWU A;  5BMV A;  2CHT A;  4F6R A;  1YJW F;  2N48 A;  3MCA B;  2H8C A;  2LBX A;  3RA5 A;  1XHO A;  1FFX B;  2UYP A;  4BT5 A;  1VQ7 F;  5EB0 A;  3F0D A;  1XV2 A;  3L7Q A;  3PAF A;  2AIF A;  4BVT A;  4E6E A;  3PLA C;  2HP0 B;  2KTU A;  2RHJ A;  4B62 A;  3CCR F;  1JJ2 F;  3I56 F;  5KMG A;  1FNJ A;  1TUB B;  4ZHQ A;  2K1S A;  3DC2 A;  4ZOL A;  4X20 B;  4ERH A;  5CA1 B;  3NK6 A;  2VAM A;  1W57 A;  1W40 A;  4DRX B;  2QEX F;  3S02 A;  3I7T A;  4BVQ A;  2B33 A;  5FNV B;  5J2T A;  3RA6 A;  2FGY A;  4C8E A;  5EZY A;  1VQ5 F;  4O4J B;  2CWJ A;  3HTN A;  5IJ9 A;  5LXT A;  1JD1 A;  5CA0 A;  3E1Y A;  3CCJ F;  3K12 A;  4HNA A;  1YHQ F;  3VO8 A;  1M1K H;  5GAP K;  1ODE A;  1QD9 A;  1S72 F;  4TV8 A;  4X1K A;  4BT3 A;  1OAP A;  3KJK A;  2PMP A;  3HKB A;  1RQ2 A;  2GVI A;  1ONI A;  4I50 B;  4ZHW A;  5J2U A;  3R0P A;  3HKE B;  3IKE A;  2ALE A;  4X1Y A;  5HWE A;  5LYJ B;  4LNU B;  3WGM A;  1QVF F;  2DYY A;  3OON A;  5LOV A;  1RQ7 A;  2YYE A;  4B45 A;  3HKD B;  3IEQ A;  3QTY A;  2ZOV A;  1KNJ A;  1X7P A;  3VCZ A;  4NWO B;  2BTQ B;  4O4I B;  3JCM M;  2W8B C;  4BT4 A;  3KIZ A;  4BVR A;  1SA0 B;  5IJ0 A;  5GIN C;  4TZZ A;  3S0W A;  1R1M A;  2Z1T A;  1IV4 A;  3F0E A;  5HY0 A;  3P10 A;  1DT9 A;  4G4W A;  1FSZ A;  3CYQ A;  4LCK A;  3CD6 F;  3U0O A;  1VQ6 F;  3TD5 A;  2ZOD A;  1KQS F;  3MBM A;  3CME F;  2HVY D;  2ZF8 A;  2UZH A;  4G4V A;  5JQG B;  3WGK A;  5GAN K;  1CLI A;  4U3J A;  5BMV B;  1ZWZ A;  3RYH A;  3S06 A;  4F6R B;  5JH7 A;  3LWQ C;  1Q81 H;  3IKF A;  3VOA A;  3LME A;  4R40 B;  1NQ3 A;  2HS4 A;  4X3M A;  1Z5V A;  3P4E A;  1TVK A;  3NMU C;  2UYK A;  5KMG B;  5LA6 A;  4ZOL B;  1VQP F;  3G71 F;  1GZ0 A;  2CSL A;  5LP6 C;  1U40 A;  4IHJ A;  1U3P A;  2YXZ A;  5J2T B;  3ESJ A;  3VYU C;  5HXU A;  2QTP A;  2OHW A;  3CYP B;  3K0T A;  5EZY B;  5FLX M;  2RHL A;  3CPQ A;  3V3T A;  5LXT B;  3CXC F;  3G4S F;  5CA0 B;  4YJ2 A;  2Q1X A;  3LWP C;  3MCQ A;  2P6Y A;  4HNA B;  3LWV C;  5C8Y A;  4TV8 B;  4X1K B;  2LBW A;  3NK7 A;  3ERN A;  1W55 A;  4TUY A;  3E22 A;  3HKB B;  5MN4 A;  3D54 A;  5MN5 A;  2QA4 F;  5CB4 B;  2CZW A;  1VHA A;  5J2U B;  3ZOP A;  2VGM A;  4X1Y B;  1NJI H;  2UYN A;  4G4X A;  3M84 A;  1Z5W A;  2G9I A;  5LOV B;  4FFB A;  3K14 A;  1YJ9 F;  3LDT A;  5GON A;  1N8R H;  4G4Y A;  1H48 A;  3LWR C;  4BW0 B;  4BY9 D;  2HRY A;  3AGK A;  3ON1 A;  5IJ0 B;  5HY1 A;  1QAH A;  5HY4 A;  4C8G A;  4C8I A;  3M4S A;  5HXZ A;  1GX1 A;  3T80 A;  5FJ4 C;  3P0Z A;  2V9Y A;  3QHD A;  3IMP A;  2VAP A;  1XRG A;  3KHN A;  1PF5 A;  1X7O A;  2HQS C;  1X52 A;  4U3J B;  3RYH B;  3WGJ A;  5JH7 B;  3JAS A;  1VQL F;  4C82 A;  3N2G A;  3F6M A;  1J7H A;  2AIZ P;  3ELC A;  1VQ4 F;  4I4T A;  3CC7 F;  1VK3 A;  4ZI7 A;  1T0K B;  2H6L A;  2R6R 1;  4I55 A;  1TVK B;  3IR9 A;  5CB4 A;  4G4Z A;  4BT6 A;  2MQE A;  3WGN A;  1RA4 A;  1X25 A;  3CCM F;  5LA6 B;  3CB2 A;  2IQQ A;  2BTO A;  3G6E F;  3N4Y A;  1SZQ A;  5IYZ A;  4IHJ B;  2RB9 A;  4ZK7 A;  2GZL A;  3VMF B;  2BO1 A;  3HKC A;  2Q1Y A;  3O85 A;  2GLZ A;  4YJ2 B;  1YJN F;  3J81 M;  4ZHV A;  3E20 B;  5C8Y B;  3K2X A;  4O4L A;  3JAL A;  2OTM A;  4TUY B;  3E22 B;  1GO0 A;  2KG4 A;  1VQV A;  5JVD A;  3RE3 A;  3WXM B;  3DDN A;  4RHA A;  1YIT F;  4IIJ A;  1NMU B;  2FC3 A;  3JAK A;  2UYN B;  1QU9 A;  3LYB A;  2JNB A;  1YI2 F;  4FFB B;  4PWT A;  5GON B;  3N4Z A;  3V7E A;  1JN1 A;  2R75 1;  3OBW A;  5G4U C;  1JFF A;  4ZHY B;  3V4D A;  5JCO C;  3WJQ A;  5MN6 A;  2ZAU A;  2Z1E A;  4EI9 A;  1W5B A;  2UYJ A;  1DBF A;  2KGW A;  1Q82 H;  3C9U A;  4BT2 A;  4B5C A;  3KE1 A;  4RQO A;  2Z01 A;  3M1X A;  2CHS A;  2HX0 A;  2I6D A;  2RHH A;  5LP6 A;  3RYC A;  3D01 A;  3WGL A;  3TD3 A;  3WPX A;  5ITZ A;  3OW2 F;  2VAW A;  2VGN A;  2L26 A;  4B46 A;  3I3F A;  3JAR B;  4TV9 A;  4EB6 A;  3B6N A;  3MDO A;  3JAS B;  1IPA A;  3J7A R;  2HS0 A;  3N2G B;  3CG6 A;  1OFU A;  2DT4 A;  4I4T B;  3V7Q A;  1H7M A;  1VH8 A;  4ZI7 B;  4I55 B;  3TD4 A;  1W58 1;  1UFY A;  3FFM A;  1VQK F;  1VQO F;  2LBT A;  4O2A A;  3HJW C;  3C9R A;  1RLU A;  2F9Z C;  2IG8 A;  3KJJ A;  3JAW A;  5IYZ B;  1KD1 H;  4O4H A;  3HAX D;  1Q7Y H;  2ZVZ A;  3HKC B;  5EYP A;  5HY2 A;  3JAT A;  1RLG A;  3VYT C;  1H47 A;  2HRU A;  4KWE A;  1W41 A;  2BTU A;  1W42 A;  3S0H A;  1M90 H;  2NMU A;  3CPW F;  1VQM F;  4O4L B;  3JAL B;  1VQN F;  4NUT A;  3QUW A;  3OBY A;  2QI2 A;  4EI7 A;  5JVD B;  4YJ3 A;  3RYI A;  4WBN A;  4IIJ B;  3JAK B;  3UT5 B;  3JAR A;  3VIU A;  1W5F A; 
#chains in the Genus database with same CATH homology
 2ZVZ A;  3S0W A;  1R1M A;  1OAP A;  4B62 A;  2AIZ P;  4G4W A;  4ZHY B;  2K1S A;  3CYQ A;  4ERH A;  4ZHV A;  3TD5 A;  4ZHW A;  4G88 A;  3S02 A;  4G4Z A;  2KGW A;  3S0H A;  5EAZ A;  2MQE A;  5EB1 B;  3S03 A;  3TD4 A;  4B5C A;  3OON A;  2ZF8 A;  2N48 A;  2LCA A;  4G4X A;  4G4V A;  4RHA A;  3S0Y A;  3IMP A;  3S06 A;  3CYP B;  2ZOV A;  2LBT A;  3KHN A;  3LDT A;  5EB0 A;  3TD3 A;  3WPX A;  4R40 B;  2HQS C;  2W8B C;  2ZVY A;  4G4Y A;  3WPW A;  2L26 A;  4PWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...