3IMPA

New crystal form of the c-terminal domain of helicobacter pylori motb (residues 125-256)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
131
structure length
131
Chain Sequence
GIDPFTFENATSDAINQDMMLYIERIAKIIQKLPKRVHINVRGFTDDTPLVKTRFKSHYELAANRAYRVMKVLIQYGVNPNQLSFSSYGSTNPIAPNDSLENRMKNNRVEIFFSTDANDLSKIHSILDNEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein motB
publication title Crystallographic and Molecular Dynamics Analysis of Loop Motions Unmasking the Peptidoglycan-Binding Site in Stator Protein MotB of Flagellar Motor
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Membrane protein
total genus 42
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3impA00
4R40B 3CYQA 4G4ZA 4B5CA 2MQEA 3IMPA 5EB1B 3TD4A 3WPXA 2K1SA 5EAZA 4RHAA 1OAPA 4G4VA 4G4YA 3S03A 4G4WA 2ZVYA 3CYPB 3KHNA 4ZHYB 3S0HA 2ZF8A 2AIZP 2L26A 3WPWA 2LBTA 4ZHVA 2KGWA 2ZOVA 4ZHWA 4G4XA 3S02A 1R1MA 3TD5A 3TD3A 4B62A 5EB0A 4ERHA 3S0YA 4PWTA 3LDTA 3S0WA 2HQSC 2N48A 2ZVZA 3S06A 2W8BC 4G88A 2LCAA 3OONA
chains in the Genus database with same CATH superfamily
1NQ3A 3GTZA 3HTNA 3CCUF 4C82A 4DXDA 3KIZA 3VOAA 2RHJA 3CCVF 4X1YA 4TV8A 3CC4F 1U3PA 1KD1H 3FD6A 4WBNA 5JH7B 3S0HA 3RYFB 3U0OA 3GHZA 5HP8A 2KGWA 1T0AA 4LNUA 1VQVA 1VQKF 3RYHA 1R1MA 2DT4A 5EB0A 3F0DA 2GVIA 3VCZA 5HY0A 3PLAC 1K8AH 2OZBA 4X1YB 4TV8B 4O4IA 2QA4F 2Z1TA 1W2BF 3WPWA 3G4SF 2G9IA 1W59A 2CHSA 1W3EX 1W581 4F6RB 3QHDA 3RYHB 3VI6A 5EYPA 2UYKA 4B46A 4X3MA 5HY2A 5LA6A 2BO1A 3DDNA 3ELCA 5HY1A 1RA4A 3C9TA 5GAPK 2BTOA 4YJ3A 2IAFA 3TD3A 2N48A 5EYPB 1W55A 1FNJA 2H8EA 5LA6B 3S06A 3O85A 5LXTB 3P4EA 3OONA 1X25A 3LWQC 4YJ2B 2MQEA 3KJKA 1QAHA 1SA0A 1W42A 2BTUA 1Q81H 3LWOC 4RHAA 3CCRF 3R0PA 5JVDA 3UT5A 4KWEA 1NMUB 3NVIB 3S03A 3CYPB 3MQWA 5LOVA 1TVKA 3CPQA 1X52A 5GANK 3S0YA 5C8YA 1XBIA 3RYCB 1SA0B 4B45A 2B33A 5JVDB 2FC3A 1FFXB 4X20A 1W5BA 2WALA 5MN4A 2LBWA 3PAFA 3JALA 4ZI7A 3P0ZA 5LOVB 3IMPA 1TVKB 1E7KA 3CMEF 1W41A 5JQGA 5C8YB 3L7QA 3KHNA 3M1XA 4ZHVA 1JD1A 5CA0B 3ERNA 3V3TA 4X20B 3MCQA 5B8FA 5HXZA 3JALB 4ZI7B 5GIPC 4TZZA 2CHTA 4FFBB 3LWVC 1CN7A 3JAKA 3HWUA 4C81A 5JQGB 3P10A 3JATA 3MDOA 1VQOF 3J7AR 1QD9A 4NUTA 1VQLF 3VYUC 4BY9D 1GZ0A 5HY4A 5IJ9A 1XV2A 5EAZA 2LBXA 5HP7A 5GIOC 3CCLF 5FJ4C 5DCVA 4O2AB 4G4YA 5EWRA 3VTIC 1U3LA 1X7PA 2QI2A 4G4WA 1JJ2F 1JY8A 5IJ0A 4BT2A 3JATB 2NMUA 2KTVA 4X1KA 3RA6A 3EORA 4BT6A 3FD5A 5IJ9B 5CB4B 3HKCB 3K2XA 4BT5A 4DRXA 4O4HA 2GLZA 3JCMM 3WGLA 1CK2A 1IPAA 4IHJA 1XHOA 2UYPA 1NJIH 3ZOPA 2Z1FA 3C9SA 1TUBB 2RHLA 1K9MH 3CC7F 1H48A 4TUYA 4BVRA 2H6LA 3HKDA 1VQ5F 2VGNA 5ITZA 5MN5A 4DRXB 5HXUA 3RA5A 4XCQA 5J2UA 2AIFA 1COMA 1RLUA 1W5EA 2UYNA 1PXWA 3JVHA 4IHJB 5FNVA 3B6NA 3J81M 3LDTA 5KMGA 3NMUC 4C8EA 4TUYB 1VQMF 1QVGF 1ONIA 3HKDB 1N8RH 2CWJA 4O4JA 4TV9A 4ZHQA 4WBNB 2Z1EA 5ITZB 1H47A 3HKEA 3I55F 3IKEA 2V9YA 5J2UB 3TD4A 4LNUB 2UYNB 3V7QA 3F0FA 5FNVB 5G4VC 5EIBC 1KQSF 3WXMB 1U43A 5FLXM 2H8CA 4O4IB 4O4JB 4TV9B 2Z1UA 3E22A 4BVQA 1Q86H 3GYQA 3F0EA 3LYBA 5EO3A 3FBAA 2VAMA 3JAWA 3N2KA 3F0GA 1GX1A 2HX0A 3HKBA 5KX5A 1XRGA 5LYJA 2OHWA 2VXYA 4X3LA 4U3JA 4YJ3B 5EZYA 4I55A 4G4VA 4ZOLA 1YI2F 3C8LA 3N2KB 2FGYA 2QTPA 2AIZP 1DT9A 4NQ3A 3CCQF 1SZQA 5LYJB 3SIUA 1YITF 4PWTA 3E1YA 4BVTA 5G4UC 3OW2F 2OTLF 5GINC 3MBMA 2KTUA 1IV3A 1DBFA 1UFYA 4BT3A 3UT5B 1T0KB 2LCAA 1VHAA 2CZWA 2AMTA 5EB1B 3CCEF 3DC2A 4I4TA 3CXCF 1OAPA 2HVYD 1FSZA 2R751 3WGMA 1VH8A 1H7MA 2ZVYA 4EI8A 2EWCA 2Q1XA 2LBTA 1IV4A 2JNBA 3QTYA 3K14A 3CCSF 1PF5A 3C9RA 2CSLA 4LCKA 1VQPF 5GONA 1YQNA 4I4TB 4O2BA 2PHNA 2RHHA 3M84A 1W5AA 3T80A 3I56F 3IEQA 1YJ9F 1QVFF 3CD6F 3C9UA 2RHOA 3WJQA 2BTQB 5CA1A 5MN6A 3CB2A 4E6EA 3Q8HA 4IIJA 3D01A 3ZP7A 2Z01A 3ESJA 5GONB 1FNKA 2CVLA 3JAKB 2L26A 2R6R1 4EB6A 4U39A 1W5FA 3ZP4A 1YIJF 3WGKA 5AVMA 5CA1B 2OTMA 5LP6C 3KE1A 4HNAA 4IIJB 5LP6A 3ON1A 4ZK7A 2QEXF 2KG4A 4EI7A 1Q8RA 3K12A 2UYJA 5IJ0B 2UZHA 3OBYA 2K1SA 1IV2A 1S72F 4X1KB 1W40A 1VQ9F 3JARA 3V4DA 1RQ7A 4ZHYB 4HNAB 1RQ2A 3N2GA 1Q82H 5LP6B 1CLIA 1GO1A 4O4HB 3NVKE 3D54A 1X7OA 3G71F 1JFFA 3K0TA 5JH7A 5JCOC 1UI9A 2P6YA 3SIVA 1Z5VA 3F6MA 5JCOA 2W8BC 2CW4A 3N2GB 2YXZA 2ALEA 3WGNA 2YYEA 3RYIA 3CMAF 5BMVA 1Z5WA 1SDSA 1JFFB 3E20B 1VQ4F 3D00A 5KMGB 2Q1YA 3BYQA 4I50A 4F6RA 3KJJA 3VO8A 1YGYA 4ZHQB 1IV1A 1VK3A 1U40A 3HKEB 3RYIB 5BMVB 2HQSC 3NK6A 4BT4A 2HS0A 2ZVZA 4C4WC 3LMEA 3IR9A 3JASA 4G88A 4I50B 3CYQA 3HJWC 3E22B 3V7EA 5LXTA 3CCJF 2ZAUA 3JAWB 4YJ2A 2VAPA 4C8IA 3WGJA 1VQ8F 3JASB 3HKBB 4BT7A 3IEWA 1ODEA 5KX5B 2ZODA 3J80M 1K73H 1YHQF 4M8IA 1YJNF 4U3JB 1KNJA 5IT9M 1KNKA 5EZYB 4I55B 2VAWA 4ZOLB 3AGKA 3I3FA 2I6RA 4R40B 4G4ZA 4B5CA 3RYCA 2HS3A 4X1IA 3VYSC 3WPXA 3VIUA 3WJRA 2OTJF 1FFXA 1JN1A 1M90H 3CCMF 4ZHWA 5IYZA 3N4YA 3IKFA 4ERHA 2GZLA 5J2TA 4X1IB 3CC2F 5CA0A 3VYTC 3CG6A 3S02A 3N4ZA 2F9ZC 4FFBA 4C8GA 4BW0B 5IYZB 3MCAB 5HWEA 5J2TB 2HP0A 3LWPC 3JAMM 3LWRC 4RQOA 4O2BB 2HS4A 2HRUA 4EI9A 1KC8H 3TD5A 1GO0A 4B62A 3HAXD 4O2AA 1VQ6F 5EIBD 3S0WA 1VQNF 2HRYA 2VGMA 3QUWA 2HP0B 1M1KH 2IG8A 4BVSA 4EB6B 3HKCA 3VOBA 3ZO8A 1QU9A 4O4LA 2PMPA 2RB9A 2HP3A 3FPIA 1YJWF 3LFOA 2DYYA 2I6DA 5CB4A 1W57A 1ZWZA 2ZF8A 3VMFB 1TUBA 3OBWA 3CPWF 1OFUA 2ZOVA 3FFMA 4G4XA 3I7TA 4NWOB 3G6EF 3NK7A 3RE3A 4O4LB 1J7HA 3RYFA 1RLGA 1VQ7F 5A2QM 1Q7YH 2IQQA 3WJPA 3M4SA 3JARB
chains in the Genus database with same CATH topology
4R40B 3CYQA 4G4ZA 4B5CA 2MQEA 3IMPA 5EB1B 3TD4A 3WPXA 2K1SA 5EAZA 4RHAA 1OAPA 4G4VA 4G4YA 3S03A 4G4WA 2ZVYA 3CYPB 3KHNA 4ZHYB 3S0HA 2ZF8A 2AIZP 2L26A 3WPWA 2LBTA 4ZHVA 2KGWA 2ZOVA 4ZHWA 4G4XA 3S02A 1R1MA 3TD5A 3TD3A 4B62A 5EB0A 4ERHA 3S0YA 4PWTA 3LDTA 3S0WA 2HQSC 2N48A 2ZVZA 3S06A 2W8BC 4G88A 2LCAA 3OONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R40 B;  3CYQ A;  4G4Z A;  4B5C A;  2MQE A;  3IMP A;  5EB1 B;  3TD4 A;  3WPX A;  2K1S A;  5EAZ A;  4RHA A;  1OAP A;  4G4V A;  4G4Y A;  3S03 A;  4G4W A;  2ZVY A;  3CYP B;  3KHN A;  4ZHY B;  3S0H A;  2ZF8 A;  2AIZ P;  2L26 A;  3WPW A;  2LBT A;  4ZHV A;  2KGW A;  2ZOV A;  4ZHW A;  4G4X A;  3S02 A;  1R1M A;  3TD5 A;  3TD3 A;  4B62 A;  5EB0 A;  4ERH A;  3S0Y A;  4PWT A;  3LDT A;  3S0W A;  2HQS C;  2N48 A;  2ZVZ A;  3S06 A;  2W8B C;  4G88 A;  2LCA A;  3OON A; 
#chains in the Genus database with same CATH topology
 1NQ3 A;  3GTZ A;  3HTN A;  3CCU F;  4C82 A;  4DXD A;  3KIZ A;  3VOA A;  2RHJ A;  3CCV F;  4X1Y A;  4TV8 A;  3CC4 F;  1U3P A;  1KD1 H;  3FD6 A;  4WBN A;  5JH7 B;  3S0H A;  3RYF B;  3U0O A;  3GHZ A;  5HP8 A;  2KGW A;  1T0A A;  4LNU A;  1VQV A;  1VQK F;  3RYH A;  1R1M A;  2DT4 A;  5EB0 A;  3F0D A;  2GVI A;  3VCZ A;  5HY0 A;  3PLA C;  1K8A H;  2OZB A;  4X1Y B;  4TV8 B;  4O4I A;  2QA4 F;  2Z1T A;  1W2B F;  3WPW A;  3G4S F;  2G9I A;  1W59 A;  2CHS A;  1W3E X;  1W58 1;  4F6R B;  3QHD A;  3RYH B;  3VI6 A;  5EYP A;  2UYK A;  4B46 A;  4X3M A;  5HY2 A;  5LA6 A;  2BO1 A;  3DDN A;  3ELC A;  5HY1 A;  1RA4 A;  3C9T A;  5GAP K;  2BTO A;  4YJ3 A;  2IAF A;  3TD3 A;  2N48 A;  5EYP B;  1W55 A;  1FNJ A;  2H8E A;  5LA6 B;  3S06 A;  3O85 A;  5LXT B;  3P4E A;  3OON A;  1X25 A;  3LWQ C;  4YJ2 B;  2MQE A;  3KJK A;  1QAH A;  1SA0 A;  1W42 A;  2BTU A;  1Q81 H;  3LWO C;  4RHA A;  3CCR F;  3R0P A;  5JVD A;  3UT5 A;  4KWE A;  1NMU B;  3NVI B;  3S03 A;  3CYP B;  3MQW A;  5LOV A;  1TVK A;  3CPQ A;  1X52 A;  5GAN K;  3S0Y A;  5C8Y A;  1XBI A;  3RYC B;  1SA0 B;  4B45 A;  2B33 A;  5JVD B;  2FC3 A;  1FFX B;  4X20 A;  1W5B A;  2WAL A;  5MN4 A;  2LBW A;  3PAF A;  3JAL A;  4ZI7 A;  3P0Z A;  5LOV B;  3IMP A;  1TVK B;  1E7K A;  3CME F;  1W41 A;  5JQG A;  5C8Y B;  3L7Q A;  3KHN A;  3M1X A;  4ZHV A;  1JD1 A;  5CA0 B;  3ERN A;  3V3T A;  4X20 B;  3MCQ A;  5B8F A;  5HXZ A;  3JAL B;  4ZI7 B;  5GIP C;  4TZZ A;  2CHT A;  4FFB B;  3LWV C;  1CN7 A;  3JAK A;  3HWU A;  4C81 A;  5JQG B;  3P10 A;  3JAT A;  3MDO A;  1VQO F;  3J7A R;  1QD9 A;  4NUT A;  1VQL F;  3VYU C;  4BY9 D;  1GZ0 A;  5HY4 A;  5IJ9 A;  1XV2 A;  5EAZ A;  2LBX A;  5HP7 A;  5GIO C;  3CCL F;  5FJ4 C;  5DCV A;  4O2A B;  4G4Y A;  5EWR A;  3VTI C;  1U3L A;  1X7P A;  2QI2 A;  4G4W A;  1JJ2 F;  1JY8 A;  5IJ0 A;  4BT2 A;  3JAT B;  2NMU A;  2KTV A;  4X1K A;  3RA6 A;  3EOR A;  4BT6 A;  3FD5 A;  5IJ9 B;  5CB4 B;  3HKC B;  3K2X A;  4BT5 A;  4DRX A;  4O4H A;  2GLZ A;  3JCM M;  3WGL A;  1CK2 A;  1IPA A;  4IHJ A;  1XHO A;  2UYP A;  1NJI H;  3ZOP A;  2Z1F A;  3C9S A;  1TUB B;  2RHL A;  1K9M H;  3CC7 F;  1H48 A;  4TUY A;  4BVR A;  2H6L A;  3HKD A;  1VQ5 F;  2VGN A;  5ITZ A;  5MN5 A;  4DRX B;  5HXU A;  3RA5 A;  4XCQ A;  5J2U A;  2AIF A;  1COM A;  1RLU A;  1W5E A;  2UYN A;  1PXW A;  3JVH A;  4IHJ B;  5FNV A;  3B6N A;  3J81 M;  3LDT A;  5KMG A;  3NMU C;  4C8E A;  4TUY B;  1VQM F;  1QVG F;  1ONI A;  3HKD B;  1N8R H;  2CWJ A;  4O4J A;  4TV9 A;  4ZHQ A;  4WBN B;  2Z1E A;  5ITZ B;  1H47 A;  3HKE A;  3I55 F;  3IKE A;  2V9Y A;  5J2U B;  3TD4 A;  4LNU B;  2UYN B;  3V7Q A;  3F0F A;  5FNV B;  5G4V C;  5EIB C;  1KQS F;  3WXM B;  1U43 A;  5FLX M;  2H8C A;  4O4I B;  4O4J B;  4TV9 B;  2Z1U A;  3E22 A;  4BVQ A;  1Q86 H;  3GYQ A;  3F0E A;  3LYB A;  5EO3 A;  3FBA A;  2VAM A;  3JAW A;  3N2K A;  3F0G A;  1GX1 A;  2HX0 A;  3HKB A;  5KX5 A;  1XRG A;  5LYJ A;  2OHW A;  2VXY A;  4X3L A;  4U3J A;  4YJ3 B;  5EZY A;  4I55 A;  4G4V A;  4ZOL A;  1YI2 F;  3C8L A;  3N2K B;  2FGY A;  2QTP A;  2AIZ P;  1DT9 A;  4NQ3 A;  3CCQ F;  1SZQ A;  5LYJ B;  3SIU A;  1YIT F;  4PWT A;  3E1Y A;  4BVT A;  5G4U C;  3OW2 F;  2OTL F;  5GIN C;  3MBM A;  2KTU A;  1IV3 A;  1DBF A;  1UFY A;  4BT3 A;  3UT5 B;  1T0K B;  2LCA A;  1VHA A;  2CZW A;  2AMT A;  5EB1 B;  3CCE F;  3DC2 A;  4I4T A;  3CXC F;  1OAP A;  2HVY D;  1FSZ A;  2R75 1;  3WGM A;  1VH8 A;  1H7M A;  2ZVY A;  4EI8 A;  2EWC A;  2Q1X A;  2LBT A;  1IV4 A;  2JNB A;  3QTY A;  3K14 A;  3CCS F;  1PF5 A;  3C9R A;  2CSL A;  4LCK A;  1VQP F;  5GON A;  1YQN A;  4I4T B;  4O2B A;  2PHN A;  2RHH A;  3M84 A;  1W5A A;  3T80 A;  3I56 F;  3IEQ A;  1YJ9 F;  1QVF F;  3CD6 F;  3C9U A;  2RHO A;  3WJQ A;  2BTQ B;  5CA1 A;  5MN6 A;  3CB2 A;  4E6E A;  3Q8H A;  4IIJ A;  3D01 A;  3ZP7 A;  2Z01 A;  3ESJ A;  5GON B;  1FNK A;  2CVL A;  3JAK B;  2L26 A;  2R6R 1;  4EB6 A;  4U39 A;  1W5F A;  3ZP4 A;  1YIJ F;  3WGK A;  5AVM A;  5CA1 B;  2OTM A;  5LP6 C;  3KE1 A;  4HNA A;  4IIJ B;  5LP6 A;  3ON1 A;  4ZK7 A;  2QEX F;  2KG4 A;  4EI7 A;  1Q8R A;  3K12 A;  2UYJ A;  5IJ0 B;  2UZH A;  3OBY A;  2K1S A;  1IV2 A;  1S72 F;  4X1K B;  1W40 A;  1VQ9 F;  3JAR A;  3V4D A;  1RQ7 A;  4ZHY B;  4HNA B;  1RQ2 A;  3N2G A;  1Q82 H;  5LP6 B;  1CLI A;  1GO1 A;  4O4H B;  3NVK E;  3D54 A;  1X7O A;  3G71 F;  1JFF A;  3K0T A;  5JH7 A;  5JCO C;  1UI9 A;  2P6Y A;  3SIV A;  1Z5V A;  3F6M A;  5JCO A;  2W8B C;  2CW4 A;  3N2G B;  2YXZ A;  2ALE A;  3WGN A;  2YYE A;  3RYI A;  3CMA F;  5BMV A;  1Z5W A;  1SDS A;  1JFF B;  3E20 B;  1VQ4 F;  3D00 A;  5KMG B;  2Q1Y A;  3BYQ A;  4I50 A;  4F6R A;  3KJJ A;  3VO8 A;  1YGY A;  4ZHQ B;  1IV1 A;  1VK3 A;  1U40 A;  3HKE B;  3RYI B;  5BMV B;  2HQS C;  3NK6 A;  4BT4 A;  2HS0 A;  2ZVZ A;  4C4W C;  3LME A;  3IR9 A;  3JAS A;  4G88 A;  4I50 B;  3CYQ A;  3HJW C;  3E22 B;  3V7E A;  5LXT A;  3CCJ F;  2ZAU A;  3JAW B;  4YJ2 A;  2VAP A;  4C8I A;  3WGJ A;  1VQ8 F;  3JAS B;  3HKB B;  4BT7 A;  3IEW A;  1ODE A;  5KX5 B;  2ZOD A;  3J80 M;  1K73 H;  1YHQ F;  4M8I A;  1YJN F;  4U3J B;  1KNJ A;  5IT9 M;  1KNK A;  5EZY B;  4I55 B;  2VAW A;  4ZOL B;  3AGK A;  3I3F A;  2I6R A;  4R40 B;  4G4Z A;  4B5C A;  3RYC A;  2HS3 A;  4X1I A;  3VYS C;  3WPX A;  3VIU A;  3WJR A;  2OTJ F;  1FFX A;  1JN1 A;  1M90 H;  3CCM F;  4ZHW A;  5IYZ A;  3N4Y A;  3IKF A;  4ERH A;  2GZL A;  5J2T A;  4X1I B;  3CC2 F;  5CA0 A;  3VYT C;  3CG6 A;  3S02 A;  3N4Z A;  2F9Z C;  4FFB A;  4C8G A;  4BW0 B;  5IYZ B;  3MCA B;  5HWE A;  5J2T B;  2HP0 A;  3LWP C;  3JAM M;  3LWR C;  4RQO A;  4O2B B;  2HS4 A;  2HRU A;  4EI9 A;  1KC8 H;  3TD5 A;  1GO0 A;  4B62 A;  3HAX D;  4O2A A;  1VQ6 F;  5EIB D;  3S0W A;  1VQN F;  2HRY A;  2VGM A;  3QUW A;  2HP0 B;  1M1K H;  2IG8 A;  4BVS A;  4EB6 B;  3HKC A;  3VOB A;  3ZO8 A;  1QU9 A;  4O4L A;  2PMP A;  2RB9 A;  2HP3 A;  3FPI A;  1YJW F;  3LFO A;  2DYY A;  2I6D A;  5CB4 A;  1W57 A;  1ZWZ A;  2ZF8 A;  3VMF B;  1TUB A;  3OBW A;  3CPW F;  1OFU A;  2ZOV A;  3FFM A;  4G4X A;  3I7T A;  4NWO B;  3G6E F;  3NK7 A;  3RE3 A;  4O4L B;  1J7H A;  3RYF A;  1RLG A;  1VQ7 F;  5A2Q M;  1Q7Y H;  2IQQ A;  3WJP A;  3M4S A;  3JAR B; 
#chains in the Genus database with same CATH homology
 4R40 B;  3CYQ A;  4G4Z A;  4B5C A;  2MQE A;  3IMP A;  5EB1 B;  3TD4 A;  3WPX A;  2K1S A;  5EAZ A;  4RHA A;  1OAP A;  4G4V A;  4G4Y A;  3S03 A;  4G4W A;  2ZVY A;  3CYP B;  3KHN A;  4ZHY B;  3S0H A;  2ZF8 A;  2AIZ P;  2L26 A;  3WPW A;  2LBT A;  4ZHV A;  2KGW A;  2ZOV A;  4ZHW A;  4G4X A;  3S02 A;  1R1M A;  3TD5 A;  3TD3 A;  4B62 A;  5EB0 A;  4ERH A;  3S0Y A;  4PWT A;  3LDT A;  3S0W A;  2HQS C;  2N48 A;  2ZVZ A;  3S06 A;  2W8B C;  4G88 A;  2LCA A;  3OON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...