3IMPA

New crystal form of the c-terminal domain of helicobacter pylori motb (residues 125-256)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
131
structure length
131
Chain Sequence
GIDPFTFENATSDAINQDMMLYIERIAKIIQKLPKRVHINVRGFTDDTPLVKTRFKSHYELAANRAYRVMKVLIQYGVNPNQLSFSSYGSTNPIAPNDSLENRMKNNRVEIFFSTDANDLSKIHSILDNEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Chemotaxis protein motB
publication title Crystallographic and Molecular Dynamics Analysis of Loop Motions Unmasking the Peptidoglycan-Binding Site in Stator Protein MotB of Flagellar Motor
pubmed doi rcsb
source organism Helicobacter pylori
total genus 42
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3impA00
3S02A 2N48A 3WPXA 4ZHYB 2ZVYA 3OONA 3TD3A 2LBTA 2W8BC 3CYPB 4ZHWA 4G4YA 4G4VA 3S0WA 3S06A 5EB0A 1R1MA 2MQEA 4RHAA 3S0HA 2HQSC 3WPWA 2KGWA 2K1SA 4G4XA 2ZVZA 5EAZA 3S03A 5EB1B 4G4WA 4ZHVA 2LCAA 3IMPA 3TD4A 3LDTA 4B62A 2ZF8A 4G4ZA 4R40B 2L26A 3KHNA 4ERHA 4G88A 3CYQA 3S0YA 2ZOVA 4B5CA 3TD5A 2AIZP 4PWTA 1OAPA
chains in the Genus database with same CATH superfamily
5J2UA 3N4YA 3ELCA 3N2KB 1VHAA 3QHDA 3NK6A 4ZI7B 2ALEA 1VQPF 1E7KA 1GX1A 3I55F 1VQVA 5CB4B 2HP0A 4I4TB 1W57A 2PHNA 2QTPA 4O2AA 4O4JA 5LXTB 3V3TA 1GO0A 3MBMA 1TUBA 5JH7B 5IJ9A 4C8GA 1ONIA 5EIBD 4YJ2B 3RYHB 3MCAB 3F0FA 4E6EA 3FD6A 5AVMA 3OBWA 5KX5B 4F6RA 1VQ6F 5LP6A 2H8CA 3HKBA 5GINC 1IV1A 2G9IA 3E1YA 3RYIA 3S0WA 1PXWA 3D54A 5JVDA 5LA6A 3R0PA 2BTQB 1K8AH 3U0OA 1RA4A 4G4XA 1H48A 1QU9A 4TUYA 1VQ4F 4G4WA 1W5FA 3C8LA 2RHJA 4C4WC 3C9SA 1FSZA 2HRUA 1W59A 5HXUA 2CVLA 4X20A 5FNVB 5CB4A 4I4TA 3VOBA 5LXTA 5ITZB 4YJ3B 5JH7A 5MN6A 2HS3A 1SA0B 4G4VA 5EWRA 2MQEA 4KWEA 3RYHA 2GZLA 2HQSC 3E20B 3V7EA 1QVGF 4DRXB 5KX5A 4X3LA 1ZWZA 5LYJB 3IKEA 5MN4A 2RHHA 2VGNA 1YGYA 4BW0B 3CD6F 3E22B 3WGNA 1OFUA 3FFMA 2CHTA 4IHJB 4X1YB 4PWTA 1UFYA 4TV8A 2IAFA 1IV2A 3CC7F 3RYCB 2W8BC 1W5BA 1YHQF 3S06A 3HKCB 5KMGB 5FNVA 5HXZA 2LBXA 2VGMA 3G71F 2DYYA 3NMUC 4HNAB 5ITZA 4YJ3A 2VXYA 1IPAA 4X3MA 1SA0A 2NMUA 4U39A 3CCQF 1N8RH 4DRXA 3VMFB 3LWVC 5LYJA 3HWUA 5LP6C 4ZHYB 5CA1B 1Z5VA 1CN7A 4BT5A 3C9TA 2LBTA 3WXMB 2IQQA 2YYEA 3CC4F 3JAKB 3RA5A 3CC2F 1FNJA 3E22A 3V7QA 2PMPA 2OZBA 4IHJA 4X1YA 1DT9A 1PF5A 1YJ9F 3RYCA 3CMAF 1VQ5F 3MCQA 2LCAA 4TV9B 1W55A 3KIZA 3HKCA 3VO8A 5BMVB 5LP6B 3HKBB 3DDNA 4G4ZA 3HKDB 3WGJA 3K2XA 1T0KB 3JARA 3ZP4A 3I3FA 5JVDB 1VQKF 4HNAA 2QI2A 3JATB 4LCKA 1Q86H 2N48A 1RLUA 2ZVYA 3PLAC 3CCSF 5GIOC 4B46A 3ESJA 1K73H 4TUYB 5IJ0B 4B45A 4C81A 1KD1H 5GONB 1X25A 5LOVB 5C8YB 4X20B 2CW4A 4BT6A 5CA1A 3RA6A 5EB1B 3ZO8A 3FBAA 2UYJA 2I6RA 5HY1A 3JAKA 3IKFA 1X52A 2VAWA 3D00A 3KE1A 1UI9A 3TD5A 2GVIA 3T80A 4EI7A 2AIFA 3N2GB 4TV9A 3GYQA 3LMEA 5BMVA 2KTVA 4O2BA 3HKDA 4C8IA 4NUTA 5HY0A 1W5AA 1U3PA 1DBFA 3K0TA 4RHAA 3GTZA 2H6LA 5EZYB 1YJNF 3VYUC 3JATA 5B8FA 5JQGB 1W42A 3F0GA 4X1IB 2CSLA 4ZHQB 3UT5B 1CK2A 5HY4A 4TV8B 3KJJA 3D01A 3TD4A 1CLIA 3WGLA 5IJ0A 1Q8RA 3J7AR 5GONA 5LOVA 3AGKA 5C8YA 2HVYD 3SIVA 1KC8H 3S02A 1KNJA 3P4EA 3LWPC 3WGKA 4ZHWA 5JCOA 4EI8A 1R1MA 3VYTC 2R751 5EAZA 4BT7A 3HJWC 3N2GA 3ERNA 2OTLF 3VCZA 1YQNA 3GHZA 2Q1XA 1YITF 2ZF8A 5GANK 3B6NA 2L26A 4R40B 1M90H 1Q7YH 3N4ZA 5EZYA 3S0YA 1RLGA 3CCJF 3VYSC 5JQGA 4X1IA 1VQOF 2LBWA 4ZHQA 3UT5A 2KG4A 4O4IB 3C9UA 1VQMF 2RHOA 3ON1A 4BT4A 3I7TA 4BVRA 1VQLF 3CCEF 2ZAUA 3FD5A 3S0HA 2B33A 1M1KH 3G4SF 4LNUB 4BT3A 2JNBA 3JARB 2OTMA 5J2TB 1QAHA 2ZVZA 3S03A 1YI2F 2V9YA 2UYKA 5CA0B 4ZHVA 2VAPA 2P6YA 2FGYA 5FJ4C 1X7OA 1NQ3A 2OTJF 4I50B 5DCVA 3J81M 2KTUA 3TD3A 3CCUF 1QD9A 4O4LB 3JCMM 5EYPB 2HP3A 4BY9D 3QUWA 1GZ0A 2K1SA 2Z1EA 1JN1A 2GLZA 2BTOA 4O4IA 1SZQA 5FLXM 2Z01A 3PAFA 3O85A 1H7MA 3FPIA 3CXCF 1VQNF 4O2BB 1KNKA 3RYFB 1QVFF 4LNUA 2EWCA 5J2TA 3BYQA 3P0ZA 4C8EA 3CCLF 5CA0A 5HP7A 5JCOC 1JD1A 4DXDA 5HP8A 4ZK7A 2OHWA 4WBNB 4I50A 3Q8HA 1FNKA 4BT2A 1NMUB 3DC2A 3SIUA 2UZHA 4BVTA 2VAMA 2CZWA 3K12A 5HY2A 5GIPC 4O4LA 3WJPA 3P10A 5EYPA 1KQSF 3KHNA 1FFXB 4B5CA 1JY8A 1W581 3CCVF 5IYZB 1NJIH 1U43A 3WJQA 2IG8A 2Z1TA 3CYPB 3F6MA 3F0EA 5EB0A 3RYFA 3JAMM 1IV3A 3JALB 4M8IA 1K9MH 2HS0A 2WALA 3C9RA 1GO1A 1W41A 1VQ7F 2BO1A 5MN5A 1YJWF 4B62A 3CG6A 4WBNA 1X7PA 3CPWF 3JAWA 1COMA 1RQ7A 3LFOA 2UYPA 2RHLA 3WPXA 2HX0A 1U3LA 4X1KB 1VQ8F 1YIJF 3HKEB 3JASB 4U3JB 1FFXA 4EB6B 1XV2A 5IYZA 3IEQA 1J7HA 3N2KA 5G4VC 1VQ9F 3LYBA 4TZZA 4ZI7A 1JFFB 3IEWA 1XHOA 3EORA 3LWQC 3JALA 3CYQA 2QEXF 3M1XA 2AMTA 2UYNB 3OBYA 2ZODA 1OAPA 3M84A 3F0DA 1VH8A 3NVIB 1W40A 2Z1FA 3NVKE 3WJRA 1W3EX 3I56F 4NWOB 4BVQA 3L7QA 2YXZA 5EO3A 4RQOA 4YJ2A 3G6EF 3CMEF 2CWJA 3LWOC 1TVKB 5A2QM 3J80M 1XBIA 4NQ3A 4X1KA 1W5EA 5IT9M 2DT4A 3K14A 4I55B 2Q1YA 4C82A 1Z5WA 3LDTA 3HKEA 4ZOLB 4BVSA 3IR9A 1H47A 3JASA 1IV4A 4U3JA 4EB6A 1ODEA 2FC3A 3CCMF 2ZOVA 3JVHA 2AIZP 3QTYA 3WGMA 2BTUA 4FFBB 1Q82H 3OONA 3VOAA 1JFFA 4G4YA 4O4HB 2HRYA 1W2BF 2F9ZC 2UYNA 3VIUA 4XCQA 1Q81H 2KGWA 2I6DA 1RQ2A 1XRGA 4IIJB 5J2UB 3HAXD 1JJ2F 3OW2F 2Z1UA 3NK7A 3CCRF 1U40A 1S72F 1VK3A 3V4DA 3MDOA 4G88A 1TVKA 5HWEA 3LWRC 2HP0B 4I55A 4O2AB 2RB9A 4O4JB 4ZOLA 3M4SA 3ZOPA 1T0AA 5GAPK 1TUBB 3CPQA 5IJ9B 3WPWA 2CHSA 4EI9A 2H8EA 3MQWA 3ZP7A 3JAWB 4FFBA 2HS4A 5G4UC 3RE3A 4F6RB 3HTNA 4O4HA 3IMPA 2QA4F 5KMGA 3CB2A 3RYIB 3VI6A 4ERHA 3VTIC 1SDSA 2R6R1 3KJKA 5EIBC 5LA6B 4IIJA
chains in the Genus database with same CATH topology
3S02A 2N48A 3WPXA 4ZHYB 2ZVYA 3OONA 3TD3A 2LBTA 2W8BC 3CYPB 4ZHWA 4G4YA 4G4VA 3S0WA 3S06A 5EB0A 1R1MA 2MQEA 4RHAA 3S0HA 2HQSC 3WPWA 2KGWA 2K1SA 4G4XA 2ZVZA 5EAZA 3S03A 5EB1B 4G4WA 4ZHVA 2LCAA 3IMPA 3TD4A 3LDTA 4B62A 2ZF8A 4G4ZA 4R40B 2L26A 3KHNA 4ERHA 4G88A 3CYQA 3S0YA 2ZOVA 4B5CA 3TD5A 2AIZP 4PWTA 1OAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S02 A;  2N48 A;  3WPX A;  4ZHY B;  2ZVY A;  3OON A;  3TD3 A;  2LBT A;  2W8B C;  3CYP B;  4ZHW A;  4G4Y A;  4G4V A;  3S0W A;  3S06 A;  5EB0 A;  1R1M A;  2MQE A;  4RHA A;  3S0H A;  2HQS C;  3WPW A;  2KGW A;  2K1S A;  4G4X A;  2ZVZ A;  5EAZ A;  3S03 A;  5EB1 B;  4G4W A;  4ZHV A;  2LCA A;  3IMP A;  3TD4 A;  3LDT A;  4B62 A;  2ZF8 A;  4G4Z A;  4R40 B;  2L26 A;  3KHN A;  4ERH A;  4G88 A;  3CYQ A;  3S0Y A;  2ZOV A;  4B5C A;  3TD5 A;  2AIZ P;  4PWT A;  1OAP A; 
#chains in the Genus database with same CATH topology
 5J2U A;  3N4Y A;  3ELC A;  3N2K B;  1VHA A;  3QHD A;  3NK6 A;  4ZI7 B;  2ALE A;  1VQP F;  1E7K A;  1GX1 A;  3I55 F;  1VQV A;  5CB4 B;  2HP0 A;  4I4T B;  1W57 A;  2PHN A;  2QTP A;  4O2A A;  4O4J A;  5LXT B;  3V3T A;  1GO0 A;  3MBM A;  1TUB A;  5JH7 B;  5IJ9 A;  4C8G A;  1ONI A;  5EIB D;  4YJ2 B;  3RYH B;  3MCA B;  3F0F A;  4E6E A;  3FD6 A;  5AVM A;  3OBW A;  5KX5 B;  4F6R A;  1VQ6 F;  5LP6 A;  2H8C A;  3HKB A;  5GIN C;  1IV1 A;  2G9I A;  3E1Y A;  3RYI A;  3S0W A;  1PXW A;  3D54 A;  5JVD A;  5LA6 A;  3R0P A;  2BTQ B;  1K8A H;  3U0O A;  1RA4 A;  4G4X A;  1H48 A;  1QU9 A;  4TUY A;  1VQ4 F;  4G4W A;  1W5F A;  3C8L A;  2RHJ A;  4C4W C;  3C9S A;  1FSZ A;  2HRU A;  1W59 A;  5HXU A;  2CVL A;  4X20 A;  5FNV B;  5CB4 A;  4I4T A;  3VOB A;  5LXT A;  5ITZ B;  4YJ3 B;  5JH7 A;  5MN6 A;  2HS3 A;  1SA0 B;  4G4V A;  5EWR A;  2MQE A;  4KWE A;  3RYH A;  2GZL A;  2HQS C;  3E20 B;  3V7E A;  1QVG F;  4DRX B;  5KX5 A;  4X3L A;  1ZWZ A;  5LYJ B;  3IKE A;  5MN4 A;  2RHH A;  2VGN A;  1YGY A;  4BW0 B;  3CD6 F;  3E22 B;  3WGN A;  1OFU A;  3FFM A;  2CHT A;  4IHJ B;  4X1Y B;  4PWT A;  1UFY A;  4TV8 A;  2IAF A;  1IV2 A;  3CC7 F;  3RYC B;  2W8B C;  1W5B A;  1YHQ F;  3S06 A;  3HKC B;  5KMG B;  5FNV A;  5HXZ A;  2LBX A;  2VGM A;  3G71 F;  2DYY A;  3NMU C;  4HNA B;  5ITZ A;  4YJ3 A;  2VXY A;  1IPA A;  4X3M A;  1SA0 A;  2NMU A;  4U39 A;  3CCQ F;  1N8R H;  4DRX A;  3VMF B;  3LWV C;  5LYJ A;  3HWU A;  5LP6 C;  4ZHY B;  5CA1 B;  1Z5V A;  1CN7 A;  4BT5 A;  3C9T A;  2LBT A;  3WXM B;  2IQQ A;  2YYE A;  3CC4 F;  3JAK B;  3RA5 A;  3CC2 F;  1FNJ A;  3E22 A;  3V7Q A;  2PMP A;  2OZB A;  4IHJ A;  4X1Y A;  1DT9 A;  1PF5 A;  1YJ9 F;  3RYC A;  3CMA F;  1VQ5 F;  3MCQ A;  2LCA A;  4TV9 B;  1W55 A;  3KIZ A;  3HKC A;  3VO8 A;  5BMV B;  5LP6 B;  3HKB B;  3DDN A;  4G4Z A;  3HKD B;  3WGJ A;  3K2X A;  1T0K B;  3JAR A;  3ZP4 A;  3I3F A;  5JVD B;  1VQK F;  4HNA A;  2QI2 A;  3JAT B;  4LCK A;  1Q86 H;  2N48 A;  1RLU A;  2ZVY A;  3PLA C;  3CCS F;  5GIO C;  4B46 A;  3ESJ A;  1K73 H;  4TUY B;  5IJ0 B;  4B45 A;  4C81 A;  1KD1 H;  5GON B;  1X25 A;  5LOV B;  5C8Y B;  4X20 B;  2CW4 A;  4BT6 A;  5CA1 A;  3RA6 A;  5EB1 B;  3ZO8 A;  3FBA A;  2UYJ A;  2I6R A;  5HY1 A;  3JAK A;  3IKF A;  1X52 A;  2VAW A;  3D00 A;  3KE1 A;  1UI9 A;  3TD5 A;  2GVI A;  3T80 A;  4EI7 A;  2AIF A;  3N2G B;  4TV9 A;  3GYQ A;  3LME A;  5BMV A;  2KTV A;  4O2B A;  3HKD A;  4C8I A;  4NUT A;  5HY0 A;  1W5A A;  1U3P A;  1DBF A;  3K0T A;  4RHA A;  3GTZ A;  2H6L A;  5EZY B;  1YJN F;  3VYU C;  3JAT A;  5B8F A;  5JQG B;  1W42 A;  3F0G A;  4X1I B;  2CSL A;  4ZHQ B;  3UT5 B;  1CK2 A;  5HY4 A;  4TV8 B;  3KJJ A;  3D01 A;  3TD4 A;  1CLI A;  3WGL A;  5IJ0 A;  1Q8R A;  3J7A R;  5GON A;  5LOV A;  3AGK A;  5C8Y A;  2HVY D;  3SIV A;  1KC8 H;  3S02 A;  1KNJ A;  3P4E A;  3LWP C;  3WGK A;  4ZHW A;  5JCO A;  4EI8 A;  1R1M A;  3VYT C;  2R75 1;  5EAZ A;  4BT7 A;  3HJW C;  3N2G A;  3ERN A;  2OTL F;  3VCZ A;  1YQN A;  3GHZ A;  2Q1X A;  1YIT F;  2ZF8 A;  5GAN K;  3B6N A;  2L26 A;  4R40 B;  1M90 H;  1Q7Y H;  3N4Z A;  5EZY A;  3S0Y A;  1RLG A;  3CCJ F;  3VYS C;  5JQG A;  4X1I A;  1VQO F;  2LBW A;  4ZHQ A;  3UT5 A;  2KG4 A;  4O4I B;  3C9U A;  1VQM F;  2RHO A;  3ON1 A;  4BT4 A;  3I7T A;  4BVR A;  1VQL F;  3CCE F;  2ZAU A;  3FD5 A;  3S0H A;  2B33 A;  1M1K H;  3G4S F;  4LNU B;  4BT3 A;  2JNB A;  3JAR B;  2OTM A;  5J2T B;  1QAH A;  2ZVZ A;  3S03 A;  1YI2 F;  2V9Y A;  2UYK A;  5CA0 B;  4ZHV A;  2VAP A;  2P6Y A;  2FGY A;  5FJ4 C;  1X7O A;  1NQ3 A;  2OTJ F;  4I50 B;  5DCV A;  3J81 M;  2KTU A;  3TD3 A;  3CCU F;  1QD9 A;  4O4L B;  3JCM M;  5EYP B;  2HP3 A;  4BY9 D;  3QUW A;  1GZ0 A;  2K1S A;  2Z1E A;  1JN1 A;  2GLZ A;  2BTO A;  4O4I A;  1SZQ A;  5FLX M;  2Z01 A;  3PAF A;  3O85 A;  1H7M A;  3FPI A;  3CXC F;  1VQN F;  4O2B B;  1KNK A;  3RYF B;  1QVF F;  4LNU A;  2EWC A;  5J2T A;  3BYQ A;  3P0Z A;  4C8E A;  3CCL F;  5CA0 A;  5HP7 A;  5JCO C;  1JD1 A;  4DXD A;  5HP8 A;  4ZK7 A;  2OHW A;  4WBN B;  4I50 A;  3Q8H A;  1FNK A;  4BT2 A;  1NMU B;  3DC2 A;  3SIU A;  2UZH A;  4BVT A;  2VAM A;  2CZW A;  3K12 A;  5HY2 A;  5GIP C;  4O4L A;  3WJP A;  3P10 A;  5EYP A;  1KQS F;  3KHN A;  1FFX B;  4B5C A;  1JY8 A;  1W58 1;  3CCV F;  5IYZ B;  1NJI H;  1U43 A;  3WJQ A;  2IG8 A;  2Z1T A;  3CYP B;  3F6M A;  3F0E A;  5EB0 A;  3RYF A;  3JAM M;  1IV3 A;  3JAL B;  4M8I A;  1K9M H;  2HS0 A;  2WAL A;  3C9R A;  1GO1 A;  1W41 A;  1VQ7 F;  2BO1 A;  5MN5 A;  1YJW F;  4B62 A;  3CG6 A;  4WBN A;  1X7P A;  3CPW F;  3JAW A;  1COM A;  1RQ7 A;  3LFO A;  2UYP A;  2RHL A;  3WPX A;  2HX0 A;  1U3L A;  4X1K B;  1VQ8 F;  1YIJ F;  3HKE B;  3JAS B;  4U3J B;  1FFX A;  4EB6 B;  1XV2 A;  5IYZ A;  3IEQ A;  1J7H A;  3N2K A;  5G4V C;  1VQ9 F;  3LYB A;  4TZZ A;  4ZI7 A;  1JFF B;  3IEW A;  1XHO A;  3EOR A;  3LWQ C;  3JAL A;  3CYQ A;  2QEX F;  3M1X A;  2AMT A;  2UYN B;  3OBY A;  2ZOD A;  1OAP A;  3M84 A;  3F0D A;  1VH8 A;  3NVI B;  1W40 A;  2Z1F A;  3NVK E;  3WJR A;  1W3E X;  3I56 F;  4NWO B;  4BVQ A;  3L7Q A;  2YXZ A;  5EO3 A;  4RQO A;  4YJ2 A;  3G6E F;  3CME F;  2CWJ A;  3LWO C;  1TVK B;  5A2Q M;  3J80 M;  1XBI A;  4NQ3 A;  4X1K A;  1W5E A;  5IT9 M;  2DT4 A;  3K14 A;  4I55 B;  2Q1Y A;  4C82 A;  1Z5W A;  3LDT A;  3HKE A;  4ZOL B;  4BVS A;  3IR9 A;  1H47 A;  3JAS A;  1IV4 A;  4U3J A;  4EB6 A;  1ODE A;  2FC3 A;  3CCM F;  2ZOV A;  3JVH A;  2AIZ P;  3QTY A;  3WGM A;  2BTU A;  4FFB B;  1Q82 H;  3OON A;  3VOA A;  1JFF A;  4G4Y A;  4O4H B;  2HRY A;  1W2B F;  2F9Z C;  2UYN A;  3VIU A;  4XCQ A;  1Q81 H;  2KGW A;  2I6D A;  1RQ2 A;  1XRG A;  4IIJ B;  5J2U B;  3HAX D;  1JJ2 F;  3OW2 F;  2Z1U A;  3NK7 A;  3CCR F;  1U40 A;  1S72 F;  1VK3 A;  3V4D A;  3MDO A;  4G88 A;  1TVK A;  5HWE A;  3LWR C;  2HP0 B;  4I55 A;  4O2A B;  2RB9 A;  4O4J B;  4ZOL A;  3M4S A;  3ZOP A;  1T0A A;  5GAP K;  1TUB B;  3CPQ A;  5IJ9 B;  3WPW A;  2CHS A;  4EI9 A;  2H8E A;  3MQW A;  3ZP7 A;  3JAW B;  4FFB A;  2HS4 A;  5G4U C;  3RE3 A;  4F6R B;  3HTN A;  4O4H A;  3IMP A;  2QA4 F;  5KMG A;  3CB2 A;  3RYI B;  3VI6 A;  4ERH A;  3VTI C;  1SDS A;  2R6R 1;  3KJK A;  5EIB C;  5LA6 B;  4IIJ A; 
#chains in the Genus database with same CATH homology
 3S02 A;  2N48 A;  3WPX A;  4ZHY B;  2ZVY A;  3OON A;  3TD3 A;  2LBT A;  2W8B C;  3CYP B;  4ZHW A;  4G4Y A;  4G4V A;  3S0W A;  3S06 A;  5EB0 A;  1R1M A;  2MQE A;  4RHA A;  3S0H A;  2HQS C;  3WPW A;  2KGW A;  2K1S A;  4G4X A;  2ZVZ A;  5EAZ A;  3S03 A;  5EB1 B;  4G4W A;  4ZHV A;  2LCA A;  3IMP A;  3TD4 A;  3LDT A;  4B62 A;  2ZF8 A;  4G4Z A;  4R40 B;  2L26 A;  3KHN A;  4ERH A;  4G88 A;  3CYQ A;  3S0Y A;  2ZOV A;  4B5C A;  3TD5 A;  2AIZ P;  4PWT A;  1OAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...