3HWUA

Crystal structure of putative dna-binding protein (yp_299413.1) from ralstonia eutropha jmp134 at 1.30 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
144
structure length
144
Chain Sequence
QELKGKYMKTPTGYLMVLRHGDNVLQNLEQLARDEHIPSASFVGIGFMSEATFGFYDFGRKQFDPKTYRNVEMANMTGSIAWKEGKPSIHAHGTVTDGTFQGAGGHLLGLTVGTGSCEITVTVYPQRLDRFVDPEIQANVLGLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative DNA-binding protein
publication title Crystal structure of Putative DNA-binding protein (YP_299413.1) from Ralstonia eutropha JMP134 at 1.30 A resolution
rcsb
source organism Ralstonia eutropha
total genus 28
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2009-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03479 DUF296 Plants and Prokaryotes Conserved (PCC) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.80 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Hypothetical protein, similar to alpha- acetolactate decarboxylase; domain 2 3hwuA00
2H6LA 2P6YA 2HX0A 4BT7A 4BT3A 2NMUA 4BT5A 1XV2A 3HWUA 4BT2A 3HTNA 4BT4A 2DT4A 4BT6A
chains in the Genus database with same CATH superfamily
1H47A 1YJNF 5GIPC 5J2TB 4DRXA 3P10A 4RQOA 2H8CA 4BVSA 1W40A 4BT3A 4ZOLA 1U3LA 2AMTA 3JAWA 1Q81H 3JVHA 3D00A 2ZVYA 2IG8A 5G4VC 1W42A 1M1KH 1YQNA 4TV9B 1W5EA 5LA6B 2YXZA 3I55F 4BW0B 2F9ZC 1W5FA 3HAXD 1DT9A 2ZODA 2HS4A 4ERHA 3VMFB 5ITZB 5EB1B 3AGKA 3HKCA 2HRUA 2HRYA 5HY1A 3TD3A 3V7EA 3IR9A 4YJ3B 3C9RA 5JH7B 2GZLA 2MQEA 4IIJA 4ZHYB 1IV2A 2P6YA 3WJRA 4RHAA 1KNJA 3PLAC 3CPQA 1JN1A 1R1MA 5A2QM 2FC3A 1FNJA 3V3TA 1YJ9F 2BTQB 4ZHVA 1W581 5JQGA 5GAPK 5JCOA 1IV3A 2HQSC 4X1IA 5GONA 2JNBA 1VQMF 4C4WC 4KWEA 1H48A 2RHLA 5IYZA 3JARA 3O85A 3IKEA 4X3LA 4HNAA 3OW2F 2CW4A 3GHZA 2UYPA 4ZOLB 3C8LA 3JAWB 4BT7A 3IEWA 4C8GA 3VTIC 4O4JA 4BT5A 2I6RA 3CCEF 2RB9A 4O2BA 1JD1A 5MN6A 1NQ3A 1RQ2A 3QHDA 1TUBA 1VQ5F 3VI6A 1VQ6F 1PF5A 3E22A 3LWVC 1FNKA 1RLUA 3CG6A 2KTVA 4E6EA 1X25A 3HKCB 1M90H 3M84A 1UI9A 3KJKA 1YJWF 4IIJB 1GO0A 1VQ8F 2UYKA 4O4IA 2QA4F 5IJ0A 4O2AA 3WJPA 4U39A 2RHJA 3CC4F 3L7QA 2UYJA 5EIBC 4C8IA 5JQGB 5HWEA 2RHOA 4X1IB 5HP8A 1ODEA 5GONB 4X3MA 3CC2F 5HY2A 3JARB 5IYZB 1KD1H 1X52A 3RYHA 3CMEF 1YGYA 4HNAB 2RHHA 4X20A 3RA6A 3MBMA 3K0TA 3HKDA 3N2GA 1IPAA 5LP6A 4O4JB 1KNKA 3F0EA 3K14A 4O2BB 1VQ7F 3FD6A 1TUBB 5CA1B 2H6LA 3RYCA 5B8FA 5EAZA 1W57A 1X7PA 3E22B 1QD9A 2UZHA 4O4HA 2LBTA 3FBAA 4X1YA 1GX1A 3MDOA 3S0YA 3K2XA 1SDSA 4XCQA 3RE3A 3C9TA 1GZ0A 2LBXA 3SIVA 2QEXF 3CCRF 3ZO8A 1QAHA 3KJJA 2R6R1 4O4IB 1IV1A 1VK3A 1FFXA 5IJ0B 2HVYD 4EB6A 1T0AA 1CN7A 4BT6A 1YI2F 2R751 2Z1EA 3FD5A 4I50B 1YIJF 3S0WA 3RYHB 4EI7A 1XHOA 2HS3A 3F0DA 3MCQA 3OBYA 4X20B 1W5BA 3GYQA 3IMPA 5IT9M 2Z1FA 3HKDB 3N2GB 3N4ZA 4TV8A 3JAKA 5LP6B 2ZAUA 5AVMA 1Z5VA 2VGMA 2IAFA 2L26A 3P0ZA 3S0HA 3V7QA 3RYCB 3HWUA 1FSZA 5LYJA 5LXTA 1W55A 3CCQF 3G4SF 2KTUA 1W59A 4O4HB 4X1YB 3KE1A 3N4YA 1XBIA 3IEQA 1VQVA 2BTOA 3RA5A 3LWQC 4B62A 4U3JA 3K12A 1JJ2F 5HY4A 4IHJA 4DRXB 1RA4A 3WGNA 1RQ7A 3T80A 3CMAF 2KGWA 4G4ZA 4B46A 1FFXB 3OBWA 4EB6B 2V9YA 4G4WA 3TD5A 2VAMA 1XV2A 5HXZA 1CLIA 2OTJF 2ZVZA 2VAWA 5HP7A 4DXDA 4LCKA 4R40B 3BYQA 3HTNA 3CPWF 3J80M 5JVDA 1W2BF 3I3FA 3HKEA 4ZK7A 3G6EF 3JAKB 5EB0A 2W8BC 3VO8A 2Z1UA 2EWCA 1CK2A 3I7TA 5HY0A 5KX5A 3DC2A 2Q1XA 3VOBA 2HS0A 4EI8A 4YJ2A 5LYJB 5LXTB 1IV4A 3PAFA 3WGKA 3F6MA 1NJIH 2CHTA 1W5AA 2HP3A 2Q1YA 1T0KB 4I4TA 1K73H 2OTLF 4LNUA 1TVKA 1U3PA 3WXMB 4U3JB 2HP0A 1ONIA 2LBWA 1E7KA 1VQOF 1YHQF 5EO3A 2CZWA 5IJ9A 5LOVA 1Z5WA 1Q86H 3HKBA 3JASA 1UFYA 3RYIA 2AIFA 2KG4A 2LCAA 1VQLF 1SZQA 1JY8A 5JCOC 5EZYA 5EWRA 5JVDB 1DBFA 1RLGA 3HKEB 4I55A 3CCMF 3V4DA 3ESJA 1NMUB 3GTZA 5BMVA 3KIZA 3NK7A 3FPIA 4B5CA 1U43A 2CSLA 4FFBA 2IQQA 5KX5B 3J81M 3C9UA 2BO1A 3F0GA 3VYSC 4YJ2B 1VQNF 5ITZA 3B6NA 2CVLA 4C82A 3ZP4A 4O2AB 3ERNA 1Q8RA 3E20B 2GLZA 4I4TB 1JFFA 5CB4A 4LNUB 1TVKB 5GINC 3LWOC 4G4VA 5EYPA 2CHSA 4ZHWA 2HP0B 2Z01A 4BVQA 3NMUC 1VQ4F 5G4UC 3CCJF 2I6DA 3ZP7A 3WPWA 3S06A 4BY9D 5IJ9B 5LOVB 5FJ4C 3HKBB 3JASB 3RYIB 4M8IA 4TZZA 3CCLF 3P4EA 3VYUC 1U40A 5EZYB 3NVKE 4BT4A 3MQWA 3TD4A 2CWJA 4WBNA 3E1YA 3D01A 5FLXM 4I55B 5BMVB 3CYQA 2ZF8A 1S72F 1OFUA 3JAMM 1K9MH 3JATA 4FFBB 5LP6C 2VGNA 4ZI7A 1YITF 5CA0A 2YYEA 3ELCA 2VXYA 4ZHQA 5MN4A 4G4YA 4TUYA 5C8YA 5GANK 4O4LA 3CCUF 2OZBA 3CB2A 4G88A 3WGJA 3MCAB 2QI2A 2PHNA 4NUTA 4C8EA 1VQ9F 4EI9A 2H8EA 3S02A 3LWPC 3CCSF 3C9SA 1JFFB 5CB4B 3N2KA 5KMGA 5EYPB 5J2UA 2UYNA 3WPXA 1PXWA 4NWOB 1SA0A 1H7MA 2ZOVA 1KC8H 3JALA 3IKFA 3Q8HA 4TV8B 1VQPF 1QU9A 3M1XA 5HXUA 3VIUA 1VHAA 3M4SA 5GIOC 1Q82H 2K1SA 1J7HA 4BT2A 3WGLA 2BTUA 1COMA 3LMEA 2N48A 4F6RA 3CXCF 1K8AH 2DYYA 3DDNA 4WBNB 2NMUA 5FNVA 3NK6A 1KQSF 5CA1A 1X7OA 3QTYA 3UT5A 3JATB 3RYFA 3KHNA 4ZI7B 5CA0B 3LWRC 4ZHQB 3WJQA 4B45A 3CCVF 1OAPA 1XRGA 4X1KA 3J7AR 4TUYB 4IHJB 3JCMM 2Z1TA 4O4LB 5C8YB 3VYTC 1Q7YH 2G9IA 2GVIA 3QUWA 3WGMA 4C81A 2B33A 1VH8A 3ON1A 3CC7F 3CYPB 5J2TA 3N2KB 2AIZP 5KMGB 5J2UB 2UYNB 2QTPA 3U0OA 1SA0B 2HX0A 3LDTA 1ZWZA 2OTMA 4PWTA 3JALB 1W3EX 5DCVA 2VAPA 4I50A 1W41A 1VQKF 3ZOPA 3VOAA 3HJWC 2PMPA 4TV9A 3NVIB 3LFOA 4G4XA 2DT4A 5LA6A 3SIUA 5EIBD 4F6RB 3F0FA 3G71F 1QVGF 2ALEA 3CD6F 5FNVB 4BVTA 3FFMA 3D54A 2OHWA 4BVRA 3UT5B 4YJ3A 4NQ3A 5MN5A 5JH7A 3S03A 3OONA 3RYFB 2FGYA 1GO1A 2WALA 1QVFF 3EORA 4X1KB 3VCZA 1N8RH 3I56F 3R0PA 3LYBA
chains in the Genus database with same CATH topology
2H6LA 2P6YA 2HX0A 4BT7A 4BT3A 2NMUA 4BT5A 1XV2A 3HWUA 4BT2A 3HTNA 4BT4A 2DT4A 4BT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6L A;  2P6Y A;  2HX0 A;  4BT7 A;  4BT3 A;  2NMU A;  4BT5 A;  1XV2 A;  3HWU A;  4BT2 A;  3HTN A;  4BT4 A;  2DT4 A;  4BT6 A; 
#chains in the Genus database with same CATH topology
 1H47 A;  1YJN F;  5GIP C;  5J2T B;  4DRX A;  3P10 A;  4RQO A;  2H8C A;  4BVS A;  1W40 A;  4BT3 A;  4ZOL A;  1U3L A;  2AMT A;  3JAW A;  1Q81 H;  3JVH A;  3D00 A;  2ZVY A;  2IG8 A;  5G4V C;  1W42 A;  1M1K H;  1YQN A;  4TV9 B;  1W5E A;  5LA6 B;  2YXZ A;  3I55 F;  4BW0 B;  2F9Z C;  1W5F A;  3HAX D;  1DT9 A;  2ZOD A;  2HS4 A;  4ERH A;  3VMF B;  5ITZ B;  5EB1 B;  3AGK A;  3HKC A;  2HRU A;  2HRY A;  5HY1 A;  3TD3 A;  3V7E A;  3IR9 A;  4YJ3 B;  3C9R A;  5JH7 B;  2GZL A;  2MQE A;  4IIJ A;  4ZHY B;  1IV2 A;  2P6Y A;  3WJR A;  4RHA A;  1KNJ A;  3PLA C;  3CPQ A;  1JN1 A;  1R1M A;  5A2Q M;  2FC3 A;  1FNJ A;  3V3T A;  1YJ9 F;  2BTQ B;  4ZHV A;  1W58 1;  5JQG A;  5GAP K;  5JCO A;  1IV3 A;  2HQS C;  4X1I A;  5GON A;  2JNB A;  1VQM F;  4C4W C;  4KWE A;  1H48 A;  2RHL A;  5IYZ A;  3JAR A;  3O85 A;  3IKE A;  4X3L A;  4HNA A;  3OW2 F;  2CW4 A;  3GHZ A;  2UYP A;  4ZOL B;  3C8L A;  3JAW B;  4BT7 A;  3IEW A;  4C8G A;  3VTI C;  4O4J A;  4BT5 A;  2I6R A;  3CCE F;  2RB9 A;  4O2B A;  1JD1 A;  5MN6 A;  1NQ3 A;  1RQ2 A;  3QHD A;  1TUB A;  1VQ5 F;  3VI6 A;  1VQ6 F;  1PF5 A;  3E22 A;  3LWV C;  1FNK A;  1RLU A;  3CG6 A;  2KTV A;  4E6E A;  1X25 A;  3HKC B;  1M90 H;  3M84 A;  1UI9 A;  3KJK A;  1YJW F;  4IIJ B;  1GO0 A;  1VQ8 F;  2UYK A;  4O4I A;  2QA4 F;  5IJ0 A;  4O2A A;  3WJP A;  4U39 A;  2RHJ A;  3CC4 F;  3L7Q A;  2UYJ A;  5EIB C;  4C8I A;  5JQG B;  5HWE A;  2RHO A;  4X1I B;  5HP8 A;  1ODE A;  5GON B;  4X3M A;  3CC2 F;  5HY2 A;  3JAR B;  5IYZ B;  1KD1 H;  1X52 A;  3RYH A;  3CME F;  1YGY A;  4HNA B;  2RHH A;  4X20 A;  3RA6 A;  3MBM A;  3K0T A;  3HKD A;  3N2G A;  1IPA A;  5LP6 A;  4O4J B;  1KNK A;  3F0E A;  3K14 A;  4O2B B;  1VQ7 F;  3FD6 A;  1TUB B;  5CA1 B;  2H6L A;  3RYC A;  5B8F A;  5EAZ A;  1W57 A;  1X7P A;  3E22 B;  1QD9 A;  2UZH A;  4O4H A;  2LBT A;  3FBA A;  4X1Y A;  1GX1 A;  3MDO A;  3S0Y A;  3K2X A;  1SDS A;  4XCQ A;  3RE3 A;  3C9T A;  1GZ0 A;  2LBX A;  3SIV A;  2QEX F;  3CCR F;  3ZO8 A;  1QAH A;  3KJJ A;  2R6R 1;  4O4I B;  1IV1 A;  1VK3 A;  1FFX A;  5IJ0 B;  2HVY D;  4EB6 A;  1T0A A;  1CN7 A;  4BT6 A;  1YI2 F;  2R75 1;  2Z1E A;  3FD5 A;  4I50 B;  1YIJ F;  3S0W A;  3RYH B;  4EI7 A;  1XHO A;  2HS3 A;  3F0D A;  3MCQ A;  3OBY A;  4X20 B;  1W5B A;  3GYQ A;  3IMP A;  5IT9 M;  2Z1F A;  3HKD B;  3N2G B;  3N4Z A;  4TV8 A;  3JAK A;  5LP6 B;  2ZAU A;  5AVM A;  1Z5V A;  2VGM A;  2IAF A;  2L26 A;  3P0Z A;  3S0H A;  3V7Q A;  3RYC B;  3HWU A;  1FSZ A;  5LYJ A;  5LXT A;  1W55 A;  3CCQ F;  3G4S F;  2KTU A;  1W59 A;  4O4H B;  4X1Y B;  3KE1 A;  3N4Y A;  1XBI A;  3IEQ A;  1VQV A;  2BTO A;  3RA5 A;  3LWQ C;  4B62 A;  4U3J A;  3K12 A;  1JJ2 F;  5HY4 A;  4IHJ A;  4DRX B;  1RA4 A;  3WGN A;  1RQ7 A;  3T80 A;  3CMA F;  2KGW A;  4G4Z A;  4B46 A;  1FFX B;  3OBW A;  4EB6 B;  2V9Y A;  4G4W A;  3TD5 A;  2VAM A;  1XV2 A;  5HXZ A;  1CLI A;  2OTJ F;  2ZVZ A;  2VAW A;  5HP7 A;  4DXD A;  4LCK A;  4R40 B;  3BYQ A;  3HTN A;  3CPW F;  3J80 M;  5JVD A;  1W2B F;  3I3F A;  3HKE A;  4ZK7 A;  3G6E F;  3JAK B;  5EB0 A;  2W8B C;  3VO8 A;  2Z1U A;  2EWC A;  1CK2 A;  3I7T A;  5HY0 A;  5KX5 A;  3DC2 A;  2Q1X A;  3VOB A;  2HS0 A;  4EI8 A;  4YJ2 A;  5LYJ B;  5LXT B;  1IV4 A;  3PAF A;  3WGK A;  3F6M A;  1NJI H;  2CHT A;  1W5A A;  2HP3 A;  2Q1Y A;  1T0K B;  4I4T A;  1K73 H;  2OTL F;  4LNU A;  1TVK A;  1U3P A;  3WXM B;  4U3J B;  2HP0 A;  1ONI A;  2LBW A;  1E7K A;  1VQO F;  1YHQ F;  5EO3 A;  2CZW A;  5IJ9 A;  5LOV A;  1Z5W A;  1Q86 H;  3HKB A;  3JAS A;  1UFY A;  3RYI A;  2AIF A;  2KG4 A;  2LCA A;  1VQL F;  1SZQ A;  1JY8 A;  5JCO C;  5EZY A;  5EWR A;  5JVD B;  1DBF A;  1RLG A;  3HKE B;  4I55 A;  3CCM F;  3V4D A;  3ESJ A;  1NMU B;  3GTZ A;  5BMV A;  3KIZ A;  3NK7 A;  3FPI A;  4B5C A;  1U43 A;  2CSL A;  4FFB A;  2IQQ A;  5KX5 B;  3J81 M;  3C9U A;  2BO1 A;  3F0G A;  3VYS C;  4YJ2 B;  1VQN F;  5ITZ A;  3B6N A;  2CVL A;  4C82 A;  3ZP4 A;  4O2A B;  3ERN A;  1Q8R A;  3E20 B;  2GLZ A;  4I4T B;  1JFF A;  5CB4 A;  4LNU B;  1TVK B;  5GIN C;  3LWO C;  4G4V A;  5EYP A;  2CHS A;  4ZHW A;  2HP0 B;  2Z01 A;  4BVQ A;  3NMU C;  1VQ4 F;  5G4U C;  3CCJ F;  2I6D A;  3ZP7 A;  3WPW A;  3S06 A;  4BY9 D;  5IJ9 B;  5LOV B;  5FJ4 C;  3HKB B;  3JAS B;  3RYI B;  4M8I A;  4TZZ A;  3CCL F;  3P4E A;  3VYU C;  1U40 A;  5EZY B;  3NVK E;  4BT4 A;  3MQW A;  3TD4 A;  2CWJ A;  4WBN A;  3E1Y A;  3D01 A;  5FLX M;  4I55 B;  5BMV B;  3CYQ A;  2ZF8 A;  1S72 F;  1OFU A;  3JAM M;  1K9M H;  3JAT A;  4FFB B;  5LP6 C;  2VGN A;  4ZI7 A;  1YIT F;  5CA0 A;  2YYE A;  3ELC A;  2VXY A;  4ZHQ A;  5MN4 A;  4G4Y A;  4TUY A;  5C8Y A;  5GAN K;  4O4L A;  3CCU F;  2OZB A;  3CB2 A;  4G88 A;  3WGJ A;  3MCA B;  2QI2 A;  2PHN A;  4NUT A;  4C8E A;  1VQ9 F;  4EI9 A;  2H8E A;  3S02 A;  3LWP C;  3CCS F;  3C9S A;  1JFF B;  5CB4 B;  3N2K A;  5KMG A;  5EYP B;  5J2U A;  2UYN A;  3WPX A;  1PXW A;  4NWO B;  1SA0 A;  1H7M A;  2ZOV A;  1KC8 H;  3JAL A;  3IKF A;  3Q8H A;  4TV8 B;  1VQP F;  1QU9 A;  3M1X A;  5HXU A;  3VIU A;  1VHA A;  3M4S A;  5GIO C;  1Q82 H;  2K1S A;  1J7H A;  4BT2 A;  3WGL A;  2BTU A;  1COM A;  3LME A;  2N48 A;  4F6R A;  3CXC F;  1K8A H;  2DYY A;  3DDN A;  4WBN B;  2NMU A;  5FNV A;  3NK6 A;  1KQS F;  5CA1 A;  1X7O A;  3QTY A;  3UT5 A;  3JAT B;  3RYF A;  3KHN A;  4ZI7 B;  5CA0 B;  3LWR C;  4ZHQ B;  3WJQ A;  4B45 A;  3CCV F;  1OAP A;  1XRG A;  4X1K A;  3J7A R;  4TUY B;  4IHJ B;  3JCM M;  2Z1T A;  4O4L B;  5C8Y B;  3VYT C;  1Q7Y H;  2G9I A;  2GVI A;  3QUW A;  3WGM A;  4C81 A;  2B33 A;  1VH8 A;  3ON1 A;  3CC7 F;  3CYP B;  5J2T A;  3N2K B;  2AIZ P;  5KMG B;  5J2U B;  2UYN B;  2QTP A;  3U0O A;  1SA0 B;  2HX0 A;  3LDT A;  1ZWZ A;  2OTM A;  4PWT A;  3JAL B;  1W3E X;  5DCV A;  2VAP A;  4I50 A;  1W41 A;  1VQK F;  3ZOP A;  3VOA A;  3HJW C;  2PMP A;  4TV9 A;  3NVI B;  3LFO A;  4G4X A;  2DT4 A;  5LA6 A;  3SIU A;  5EIB D;  4F6R B;  3F0F A;  3G71 F;  1QVG F;  2ALE A;  3CD6 F;  5FNV B;  4BVT A;  3FFM A;  3D54 A;  2OHW A;  4BVR A;  3UT5 B;  4YJ3 A;  4NQ3 A;  5MN5 A;  5JH7 A;  3S03 A;  3OON A;  3RYF B;  2FGY A;  1GO1 A;  2WAL A;  1QVF F;  3EOR A;  4X1K B;  3VCZ A;  1N8R H;  3I56 F;  3R0P A;  3LYB A; 
#chains in the Genus database with same CATH homology
 2H6L A;  2P6Y A;  2HX0 A;  4BT7 A;  4BT3 A;  2NMU A;  4BT5 A;  1XV2 A;  3HWU A;  4BT2 A;  3HTN A;  4BT4 A;  2DT4 A;  4BT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...