5GIPC

Crystal structure of box c/d rnp with 13 nt guide regions and 11 nt substrates
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
122
structure length
122
Chain Sequence
b'ASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
molecule tags Transferase/rna
source organism Sulfolobus solfataricus
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
total genus 41
structure length 122
sequence length 122
chains with identical sequence D, M, N
ec nomenclature
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5gipC00
5G4VC 2CZWA 1Q82H 1VQ9F 1VQ6F 3WXMB 1W40A 1KD1H 1CK2A 2LBXA 2VGMA 3LWVC 3FFMA 1YJWF 1E7KA 3CCUF 2WALA 4C4WC 1GO1A 1W42A 1Q7YH 3E20B 3RA5A 3LWQC 3SIVA 2HVYD 3RA6A 3LWRC 3ON1A 5EO3A 1YJ9F 2JNBA 3G71F 5FLXM 1H7MA 3E1YA 3NK6A 3CPWF 2OTLF 1IPAA 1CN7A 3MCAB 4BY9D 1SDSA 4X3LA 3JCMM 2BO1A 3LWOC 3OBYA 1GZ0A 1VQ8F 3G4SF 3GYQA 1S72F 1NMUB 1VQ7F 1RA4A 1W3EX 2KTVA 1X7PA 1GO0A 5IT9M 1VQPF 1VQ4F 3AGKA 3LFOA 1W41A 3CC7F 1ZWZA 2I6DA 3OBWA 2KG4A 2LBWA 3CCVF 5FJ4C 4X3MA 4NUTA 1VQMF 3I56F 4BW0B 3CC4F 1YIJF 3G6EF 2OZBA 3CCJF 2FC3A 3CCLF 1YJNF 2ALEA 2VGNA 2AIFA 3J81M 1YHQF 1YITF 3VI6A 1VQKF 1DT9A 1QVFF 1K8AH 3CCSF 3HJWC 1X7OA 5GINC 3CCMF 3OW2F 5GANK 3CMEF 5EWRA 1KC8H 1Q81H 3CCQF 5A2QM 1JJ2F 4TZZA 3NVKE 1K73H 3CD6F 1VQ5F 1K9MH 3NMUC 5GIOC 3V7QA 2QA4F 1PXWA 3CCRF 5G4UC 1QVGF 3PLAC 4LCKA 1XBIA 3CMAF 3CPQA 5GIPC 3IR9A 3SIUA 3CG6A 3O85A 3N4YA 2QI2A 3N4ZA 3V7EA 3VMFB 5GAPK 3I55F 5DCVA 2KTUA 3J7AR 1VQNF 1YI2F 3PAFA 1X52A 2QEXF 1M1KH 1KQSF 3NVIB 3J80M 1NJIH 3JAMM 3HAXD 3NK7A 3CXCF 3CC2F 2OTJF 2OHWA 3CCEF 1W2BF 1VQLF 1Q86H 1RLGA 3LWPC 1T0KB 1M90H 1VQOF 1N8RH
chains in the Genus database with same CATH superfamily
3RYCA 2PMPA 1FSZA 1W40A 4BVTA 5MN5A 3LWVC 3D00A 5LYJB 3IMPA 5JQGA 3RYHB 3SIVA 3VYUC 5HXUA 4ZHQA 4BT6A 3IEWA 4O4HB 1ODEA 3ON1A 2JNBA 3E22B 3EORA 5FLXM 1CN7A 1QU9A 1VH8A 3K14A 4ZHWA 3LWOC 4B5CA 3GYQA 2H6LA 1IV4A 3RYIB 2DT4A 3RYFA 2W8BC 1JY8A 1W3EX 4O4IA 2KTVA 5HP7A 2RB9A 1VQ4F 4X1YA 3S06A 4O4IB 5EB0A 2LBWA 3WGKA 2KG4A 5C8YB 4YJ3B 5BMVA 1VQMF 3MBMA 3D01A 3N2GA 5EYPB 3CCJF 5GONA 2FC3A 3J81M 1K8AH 4G4ZA 3VYTC 5GINC 3OW2F 2VAWA 2YXZA 3ZP7A 3HKCA 3CMEF 4C8EA 1KC8H 3CCQF 2VAMA 3R0PA 3WJPA 5IJ9B 3NVKE 4I55A 3ZP4A 3CD6F 5EZYA 1VQ5F 3V7QA 2CHTA 2VAPA 3ELCA 1PXWA 5J2TB 4HNAB 2CSLA 1QVGF 3CMAF 1RQ2A 5CA0B 5HY0A 3I7TA 5GIPC 3SIUA 1VHAA 2NMUA 3CG6A 4BT7A 3F0GA 3N4YA 5CA0A 3N2KA 4EI8A 3JALA 3VMFB 1JN1A 1VQNF 2GVIA 2HS3A 5KX5A 4ZI7B 5IYZB 2N48A 5B8FA 3RYCB 3LDTA 1X52A 4O4LB 3ZO8A 5KX5B 1M1KH 3N2KB 5HXZA 2LBTA 5CB4A 3HAXD 3JAKA 2UYKA 3GHZA 1Z5VA 2R6R1 1W2BF 1RLGA 1T0KB 4BT5A 3RYHA 1XHOA 5JQGB 1PF5A 3RYFB 3JATA 5KMGB 4G4YA 5G4VC 4X1IB 1VQ6F 1KD1H 2KGWA 3FFMA 3QUWA 3CCUF 3WPXA 1X25A 2P6YA 1H48A 2WALA 4G4WA 1U3LA 1OAPA 5C8YA 2ZVZA 1JFFB 2UYPA 4O4HA 4ZHYB 1XRGA 3CPWF 1H7MA 3E1YA 3NK6A 1VK3A 4BY9D 1W55A 5JVDA 4DRXA 1SDSA 4X1KA 5EIBD 2K1SA 5LA6A 3VTIC 3OBYA 5BMVB 1GZ0A 1VQ8F 5LP6A 5LA6B 3KIZA 5AVMA 3HKDA 4U3JB 1RA4A 4NWOB 4M8IA 4IIJB 1U3PA 5IT9M 4X1YB 1GX1A 2BTUA 3AGKA 4TV8A 4B62A 1ZWZA 2I6DA 2RHOA 2V9YA 3FD5A 2VXYA 4FFBA 5FJ4C 4NUTA 4WBNB 2CW4A 4BW0B 4O4JA 1FFXA 4R40B 2HP3A 3N2GB 3G6EF 1IV2A 1SZQA 1TVKB 4TV8B 4X1KB 3C9TA 3VIUA 3FD6A 3CCLF 1YJNF 2AIFA 2VGNA 1YITF 3VI6A 1OFUA 1DT9A 1VQKF 1QVFF 4BVQA 4G88A 3CCMF 5GANK 3JASB 3JAKB 5EWRA 5J2TA 1Q81H 3VO8A 2IG8A 5LYJA 2MQEA 3NMUC 1ONIA 1J7HA 3JALB 2QA4F 5G4UC 3JATB 5KMGA 4NQ3A 4TV9A 4LCKA 1R1MA 2ZOVA 2OTMA 4O2AA 4C8IA 3D54A 3K12A 1YGYA 3MCQA 5CB4B 3Q8HA 3LYBA 2G9IA 5GAPK 4EI7A 4TV9B 3GTZA 1YI2F 3V4DA 5IJ0B 1RLUA 4ZI7A 2UYJA 2Z1EA 1CLIA 1COMA 2QEXF 3C9SA 1KQSF 5JVDB 2GZLA 3FPIA 2EWCA 5JH7B 3J80M 4BT2A 3I3FA 5MN6A 5LP6C 3CCEF 5EIBC 3BYQA 5HP8A 3TD4A 4I50B 3LWPC 1Q86H 2FGYA 2I6RA 3KE1A 1M90H 3M1XA 4O2BA 1N8RH 3T80A 4B45A 5ITZB 2CZWA 1Q82H 1VQ9F 4ZOLB 4ZK7A 2UYNA 3P10A 2VGMA 4B46A 1E7KA 1W57A 1W59A 3P0ZA 4DRXB 4TUYA 5IJ0A 5IJ9A 2CHSA 1KNJA 2Z1FA 4C4WC 1GO1A 2HRYA 3E20B 4FFBB 3S0WA 2HVYD 3RA6A 2F9ZC 5FNVA 2HP0B 3HKCB 1YJ9F 2Z1UA 2OTLF 4LNUB 1Q8RA 4I55B 4E6EA 3QHDA 3F6MA 4F6RB 2BO1A 5LP6B 3S0HA 3G4SF 4U39A 1S72F 3F0EA 4YJ2B 3HKBA 1NMUB 4X20A 4IHJB 3V3TA 3L7QA 2HX0A 1X7PA 2CWJA 4ZHQB 1W5BA 3E22A 3LFOA 2Z01A 4YJ2A 1W41A 3QTYA 2L26A 3CCVF 4IHJA 5LOVB 2Z1TA 4X3MA 2RHLA 4KWEA 3I56F 3CC4F 4O4JB 1YIJF 2IAFA 3P4EA 4C81A 2OZBA 5HY1A 5JCOC 1UFYA 1FNJA 1FNKA 1QAHA 3JARA 3OONA 2B33A 5LOVA 2Q1XA 1YHQF 3C9RA 3K2XA 2UZHA 3C8LA 1YQNA 3IKEA 3ZOPA 3WJRA 3WPWA 5A2QM 2BTOA 3WGJA 2H8CA 2HQSC 5LXTB 1K73H 3CYPB 2ZAUA 1RQ7A 2ZF8A 5GIOC 4ZOLA 2PHNA 4BVSA 1U40A 3PLAC 4I4TB 1XBIA 2RHJA 4O2AB 3IR9A 3KJKA 3O85A 3U0OA 2QI2A 3ESJA 3N4ZA 4G4XA 5EB1B 4TUYB 3WGNA 5JH7A 3VOBA 5DCVA 2YYEA 1IV1A 3DDNA 1TUBB 3KHNA 5HY2A 4PWTA 3JVHA 5HY4A 2RHHA 4LNUA 1W581 1DBFA 4WBNA 3NVIB 3LMEA 4DXDA 4O2BB 1NJIH 4YJ3A 3JAMM 1JD1A 3CYQA 3HKEA 3CXCF 2OTJF 2AMTA 2AIZP 1VQLF 1VQOF 3JAWA 4X20B 5GONB 3WXMB 3VOAA 1CK2A 2LBXA 1FFXB 5EZYB 1YJWF 2HS0A 1T0AA 3IKFA 3JAWB 2DYYA 4EI9A 1Q7YH 1W42A 3DC2A 3RA5A 3LWQC 3C9UA 5HWEA 3CB2A 5JCOA 2HP0A 3LWRC 5EO3A 3G71F 2ZVYA 4BVRA 3JARB 1IPAA 3MCAB 3UT5A 5J2UA 4RHAA 4X3LA 3HWUA 3JCMM 4F6RA 5IYZA 5MN4A 1W5AA 4X1IA 1NQ3A 1VQVA 1IV3A 1VQ7F 5CA1B 3F0FA 1GO0A 1VQPF 1JFFA 4I4TA 3B6NA 3CC7F 3M84A 3OBWA 4ZHVA 3K0TA 1H47A 2H8EA 2IQQA 1XV2A 3IEQA 3ERNA 5LXTA 4RQOA 4BT4A 2LCAA 2ALEA 1SA0B 4U3JA 3CCSF 3HJWC 1X7OA 2Q1YA 4G4VA 1SA0A 4C82A 3TD5A 3RYIA 2CVLA 3F0DA 4EB6A 1W5FA 3S0YA 1JJ2F 3HKEB 3WGMA 5EYPA 4TZZA 2UYNB 5ITZA 1K9MH 3WGLA 3S03A 2R751 3WJQA 4BT3A 4EB6B 1Z5WA 3CCRF 2HRUA 1TUBA 4I50A 1U43A 3RE3A 3CPQA 4IIJA 2GLZA 3MDOA 3TD3A 5FNVB 4XCQA 3V7EA 3HKDB 3HKBB 3I55F 2KTUA 3J7AR 4HNAA 4C8GA 2HS4A 3PAFA 5EAZA 4ERHA 1TVKA 2BTQB 3VCZA 3MQWA 3KJJA 3VYSC 5J2UB 1W5EA 3UT5B 1UI9A 3NK7A 3CC2F 3FBAA 2OHWA 3HTNA 2QTPA 2ZODA 3M4SA 3JASA 5CA1A 1KNKA 3S02A 1QD9A 4O4LA
chains in the Genus database with same CATH topology
5G4VC 2CZWA 1Q82H 1VQ9F 1VQ6F 3WXMB 1W40A 1KD1H 1CK2A 2LBXA 4BVTA 2VGMA 3LWVC 3D00A 3FFMA 1YJWF 1E7KA 3CCUF 2WALA 4C4WC 4EI9A 1GO1A 1W42A 1Q7YH 3E20B 3RA5A 3LWQC 5HWEA 3SIVA 5HXUA 2HVYD 3RA6A 2F9ZC 3LWRC 3ON1A 5EO3A 1YJ9F 2JNBA 3G71F 5FLXM 1H7MA 3E1YA 3NK6A 3CPWF 4BVRA 2OTLF 1IPAA 1CN7A 3MCAB 4BY9D 1SDSA 4X3LA 3JCMM 2BO1A 3LWOC 3OBYA 1GZ0A 1VQ8F 3G4SF 3GYQA 1S72F 1NMUB 1VQ7F 3V3TA 1RA4A 1W3EX 2KTVA 1X7PA 1GO0A 5IT9M 1VQPF 1VQ4F 3AGKA 3LFOA 1W41A 3CC7F 1ZWZA 2I6DA 3OBWA 2KG4A 2LBWA 3CCVF 5FJ4C 4X3MA 4NUTA 1VQMF 3I56F 4BW0B 3CC4F 1YIJF 3G6EF 2OZBA 5HY1A 3CCJF 2FC3A 3CCLF 1YJNF 2ALEA 2VGNA 2AIFA 3J81M 1YHQF 1YITF 3VI6A 1VQKF 1DT9A 1QVFF 1K8AH 4BVQA 3CCSF 3HJWC 1X7OA 5GINC 3CCMF 3OW2F 5GANK 3CMEF 5EWRA 1KC8H 1Q81H 3CCQF 5A2QM 1JJ2F 4TZZA 3NVKE 1K73H 3CD6F 1VQ5F 1K9MH 3NMUC 5GIOC 3V7QA 2QA4F 1PXWA 4BVSA 3CCRF 5G4UC 1QVGF 3PLAC 4NQ3A 4LCKA 1XBIA 3CMAF 3CPQA 5HY0A 2GLZA 3IR9A 5GIPC 3SIUA 3CG6A 3O85A 3N4YA 2QI2A 3N4ZA 4XCQA 3V7EA 4EI8A 3VMFB 5GAPK 3I55F 4EI7A 2KTUA 3J7AR 5DCVA 5HY2A 1YI2F 1VQNF 3PAFA 5HY4A 1X52A 2QEXF 1M1KH 1KQSF 5HXZA 3NVIB 3J80M 1NJIH 3JAMM 3HAXD 3NK7A 3CXCF 3CC2F 2OTJF 2OHWA 3CCEF 1W2BF 1VQLF 1Q86H 1RLGA 3LWPC 1T0KB 2FGYA 1M90H 1VQOF 1N8RH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G4V C;  2CZW A;  1Q82 H;  1VQ9 F;  1VQ6 F;  3WXM B;  1W40 A;  1KD1 H;  1CK2 A;  2LBX A;  2VGM A;  3LWV C;  3FFM A;  1YJW F;  1E7K A;  3CCU F;  2WAL A;  4C4W C;  1GO1 A;  1W42 A;  1Q7Y H;  3E20 B;  3RA5 A;  3LWQ C;  3SIV A;  2HVY D;  3RA6 A;  3LWR C;  3ON1 A;  5EO3 A;  1YJ9 F;  2JNB A;  3G71 F;  5FLX M;  1H7M A;  3E1Y A;  3NK6 A;  3CPW F;  2OTL F;  1IPA A;  1CN7 A;  3MCA B;  4BY9 D;  1SDS A;  4X3L A;  3JCM M;  2BO1 A;  3LWO C;  3OBY A;  1GZ0 A;  1VQ8 F;  3G4S F;  3GYQ A;  1S72 F;  1NMU B;  1VQ7 F;  1RA4 A;  1W3E X;  2KTV A;  1X7P A;  1GO0 A;  5IT9 M;  1VQP F;  1VQ4 F;  3AGK A;  3LFO A;  1W41 A;  3CC7 F;  1ZWZ A;  2I6D A;  3OBW A;  2KG4 A;  2LBW A;  3CCV F;  5FJ4 C;  4X3M A;  4NUT A;  1VQM F;  3I56 F;  4BW0 B;  3CC4 F;  1YIJ F;  3G6E F;  2OZB A;  3CCJ F;  2FC3 A;  3CCL F;  1YJN F;  2ALE A;  2VGN A;  2AIF A;  3J81 M;  1YHQ F;  1YIT F;  3VI6 A;  1VQK F;  1DT9 A;  1QVF F;  1K8A H;  3CCS F;  3HJW C;  1X7O A;  5GIN C;  3CCM F;  3OW2 F;  5GAN K;  3CME F;  5EWR A;  1KC8 H;  1Q81 H;  3CCQ F;  5A2Q M;  1JJ2 F;  4TZZ A;  3NVK E;  1K73 H;  3CD6 F;  1VQ5 F;  1K9M H;  3NMU C;  5GIO C;  3V7Q A;  2QA4 F;  1PXW A;  3CCR F;  5G4U C;  1QVG F;  3PLA C;  4LCK A;  1XBI A;  3CMA F;  3CPQ A;  5GIP C;  3IR9 A;  3SIU A;  3CG6 A;  3O85 A;  3N4Y A;  2QI2 A;  3N4Z A;  3V7E A;  3VMF B;  5GAP K;  3I55 F;  5DCV A;  2KTU A;  3J7A R;  1VQN F;  1YI2 F;  3PAF A;  1X52 A;  2QEX F;  1M1K H;  1KQS F;  3NVI B;  3J80 M;  1NJI H;  3JAM M;  3HAX D;  3NK7 A;  3CXC F;  3CC2 F;  2OTJ F;  2OHW A;  3CCE F;  1W2B F;  1VQL F;  1Q86 H;  1RLG A;  3LWP C;  1T0K B;  1M90 H;  1VQO F;  1N8R H; 
#chains in the Genus database with same CATH topology
 3RYC A;  2PMP A;  1FSZ A;  1W40 A;  4BVT A;  5MN5 A;  3LWV C;  3D00 A;  5LYJ B;  3IMP A;  5JQG A;  3RYH B;  3SIV A;  3VYU C;  5HXU A;  4ZHQ A;  4BT6 A;  3IEW A;  4O4H B;  1ODE A;  3ON1 A;  2JNB A;  3E22 B;  3EOR A;  5FLX M;  1CN7 A;  1QU9 A;  1VH8 A;  3K14 A;  4ZHW A;  3LWO C;  4B5C A;  3GYQ A;  2H6L A;  1IV4 A;  3RYI B;  2DT4 A;  3RYF A;  2W8B C;  1JY8 A;  1W3E X;  4O4I A;  2KTV A;  5HP7 A;  2RB9 A;  1VQ4 F;  4X1Y A;  3S06 A;  4O4I B;  5EB0 A;  2LBW A;  3WGK A;  2KG4 A;  5C8Y B;  4YJ3 B;  5BMV A;  1VQM F;  3MBM A;  3D01 A;  3N2G A;  5EYP B;  3CCJ F;  5GON A;  2FC3 A;  3J81 M;  1K8A H;  4G4Z A;  3VYT C;  5GIN C;  3OW2 F;  2VAW A;  2YXZ A;  3ZP7 A;  3HKC A;  3CME F;  4C8E A;  1KC8 H;  3CCQ F;  2VAM A;  3R0P A;  3WJP A;  5IJ9 B;  3NVK E;  4I55 A;  3ZP4 A;  3CD6 F;  5EZY A;  1VQ5 F;  3V7Q A;  2CHT A;  2VAP A;  3ELC A;  1PXW A;  5J2T B;  4HNA B;  2CSL A;  1QVG F;  3CMA F;  1RQ2 A;  5CA0 B;  5HY0 A;  3I7T A;  5GIP C;  3SIU A;  1VHA A;  2NMU A;  3CG6 A;  4BT7 A;  3F0G A;  3N4Y A;  5CA0 A;  3N2K A;  4EI8 A;  3JAL A;  3VMF B;  1JN1 A;  1VQN F;  2GVI A;  2HS3 A;  5KX5 A;  4ZI7 B;  5IYZ B;  2N48 A;  5B8F A;  3RYC B;  3LDT A;  1X52 A;  4O4L B;  3ZO8 A;  5KX5 B;  1M1K H;  3N2K B;  5HXZ A;  2LBT A;  5CB4 A;  3HAX D;  3JAK A;  2UYK A;  3GHZ A;  1Z5V A;  2R6R 1;  1W2B F;  1RLG A;  1T0K B;  4BT5 A;  3RYH A;  1XHO A;  5JQG B;  1PF5 A;  3RYF B;  3JAT A;  5KMG B;  4G4Y A;  5G4V C;  4X1I B;  1VQ6 F;  1KD1 H;  2KGW A;  3FFM A;  3QUW A;  3CCU F;  3WPX A;  1X25 A;  2P6Y A;  1H48 A;  2WAL A;  4G4W A;  1U3L A;  1OAP A;  5C8Y A;  2ZVZ A;  1JFF B;  2UYP A;  4O4H A;  4ZHY B;  1XRG A;  3CPW F;  1H7M A;  3E1Y A;  3NK6 A;  1VK3 A;  4BY9 D;  1W55 A;  5JVD A;  4DRX A;  1SDS A;  4X1K A;  5EIB D;  2K1S A;  5LA6 A;  3VTI C;  3OBY A;  5BMV B;  1GZ0 A;  1VQ8 F;  5LP6 A;  5LA6 B;  3KIZ A;  5AVM A;  3HKD A;  4U3J B;  1RA4 A;  4NWO B;  4M8I A;  4IIJ B;  1U3P A;  5IT9 M;  4X1Y B;  1GX1 A;  2BTU A;  3AGK A;  4TV8 A;  4B62 A;  1ZWZ A;  2I6D A;  2RHO A;  2V9Y A;  3FD5 A;  2VXY A;  4FFB A;  5FJ4 C;  4NUT A;  4WBN B;  2CW4 A;  4BW0 B;  4O4J A;  1FFX A;  4R40 B;  2HP3 A;  3N2G B;  3G6E F;  1IV2 A;  1SZQ A;  1TVK B;  4TV8 B;  4X1K B;  3C9T A;  3VIU A;  3FD6 A;  3CCL F;  1YJN F;  2AIF A;  2VGN A;  1YIT F;  3VI6 A;  1OFU A;  1DT9 A;  1VQK F;  1QVF F;  4BVQ A;  4G88 A;  3CCM F;  5GAN K;  3JAS B;  3JAK B;  5EWR A;  5J2T A;  1Q81 H;  3VO8 A;  2IG8 A;  5LYJ A;  2MQE A;  3NMU C;  1ONI A;  1J7H A;  3JAL B;  2QA4 F;  5G4U C;  3JAT B;  5KMG A;  4NQ3 A;  4TV9 A;  4LCK A;  1R1M A;  2ZOV A;  2OTM A;  4O2A A;  4C8I A;  3D54 A;  3K12 A;  1YGY A;  3MCQ A;  5CB4 B;  3Q8H A;  3LYB A;  2G9I A;  5GAP K;  4EI7 A;  4TV9 B;  3GTZ A;  1YI2 F;  3V4D A;  5IJ0 B;  1RLU A;  4ZI7 A;  2UYJ A;  2Z1E A;  1CLI A;  1COM A;  2QEX F;  3C9S A;  1KQS F;  5JVD B;  2GZL A;  3FPI A;  2EWC A;  5JH7 B;  3J80 M;  4BT2 A;  3I3F A;  5MN6 A;  5LP6 C;  3CCE F;  5EIB C;  3BYQ A;  5HP8 A;  3TD4 A;  4I50 B;  3LWP C;  1Q86 H;  2FGY A;  2I6R A;  3KE1 A;  1M90 H;  3M1X A;  4O2B A;  1N8R H;  3T80 A;  4B45 A;  5ITZ B;  2CZW A;  1Q82 H;  1VQ9 F;  4ZOL B;  4ZK7 A;  2UYN A;  3P10 A;  2VGM A;  4B46 A;  1E7K A;  1W57 A;  1W59 A;  3P0Z A;  4DRX B;  4TUY A;  5IJ0 A;  5IJ9 A;  2CHS A;  1KNJ A;  2Z1F A;  4C4W C;  1GO1 A;  2HRY A;  3E20 B;  4FFB B;  3S0W A;  2HVY D;  3RA6 A;  2F9Z C;  5FNV A;  2HP0 B;  3HKC B;  1YJ9 F;  2Z1U A;  2OTL F;  4LNU B;  1Q8R A;  4I55 B;  4E6E A;  3QHD A;  3F6M A;  4F6R B;  2BO1 A;  5LP6 B;  3S0H A;  3G4S F;  4U39 A;  1S72 F;  3F0E A;  4YJ2 B;  3HKB A;  1NMU B;  4X20 A;  4IHJ B;  3V3T A;  3L7Q A;  2HX0 A;  1X7P A;  2CWJ A;  4ZHQ B;  1W5B A;  3E22 A;  3LFO A;  2Z01 A;  4YJ2 A;  1W41 A;  3QTY A;  2L26 A;  3CCV F;  4IHJ A;  5LOV B;  2Z1T A;  4X3M A;  2RHL A;  4KWE A;  3I56 F;  3CC4 F;  4O4J B;  1YIJ F;  2IAF A;  3P4E A;  4C81 A;  2OZB A;  5HY1 A;  5JCO C;  1UFY A;  1FNJ A;  1FNK A;  1QAH A;  3JAR A;  3OON A;  2B33 A;  5LOV A;  2Q1X A;  1YHQ F;  3C9R A;  3K2X A;  2UZH A;  3C8L A;  1YQN A;  3IKE A;  3ZOP A;  3WJR A;  3WPW A;  5A2Q M;  2BTO A;  3WGJ A;  2H8C A;  2HQS C;  5LXT B;  1K73 H;  3CYP B;  2ZAU A;  1RQ7 A;  2ZF8 A;  5GIO C;  4ZOL A;  2PHN A;  4BVS A;  1U40 A;  3PLA C;  4I4T B;  1XBI A;  2RHJ A;  4O2A B;  3IR9 A;  3KJK A;  3O85 A;  3U0O A;  2QI2 A;  3ESJ A;  3N4Z A;  4G4X A;  5EB1 B;  4TUY B;  3WGN A;  5JH7 A;  3VOB A;  5DCV A;  2YYE A;  1IV1 A;  3DDN A;  1TUB B;  3KHN A;  5HY2 A;  4PWT A;  3JVH A;  5HY4 A;  2RHH A;  4LNU A;  1W58 1;  1DBF A;  4WBN A;  3NVI B;  3LME A;  4DXD A;  4O2B B;  1NJI H;  4YJ3 A;  3JAM M;  1JD1 A;  3CYQ A;  3HKE A;  3CXC F;  2OTJ F;  2AMT A;  2AIZ P;  1VQL F;  1VQO F;  3JAW A;  4X20 B;  5GON B;  3WXM B;  3VOA A;  1CK2 A;  2LBX A;  1FFX B;  5EZY B;  1YJW F;  2HS0 A;  1T0A A;  3IKF A;  3JAW B;  2DYY A;  4EI9 A;  1Q7Y H;  1W42 A;  3DC2 A;  3RA5 A;  3LWQ C;  3C9U A;  5HWE A;  3CB2 A;  5JCO A;  2HP0 A;  3LWR C;  5EO3 A;  3G71 F;  2ZVY A;  4BVR A;  3JAR B;  1IPA A;  3MCA B;  3UT5 A;  5J2U A;  4RHA A;  4X3L A;  3HWU A;  3JCM M;  4F6R A;  5IYZ A;  5MN4 A;  1W5A A;  4X1I A;  1NQ3 A;  1VQV A;  1IV3 A;  1VQ7 F;  5CA1 B;  3F0F A;  1GO0 A;  1VQP F;  1JFF A;  4I4T A;  3B6N A;  3CC7 F;  3M84 A;  3OBW A;  4ZHV A;  3K0T A;  1H47 A;  2H8E A;  2IQQ A;  1XV2 A;  3IEQ A;  3ERN A;  5LXT A;  4RQO A;  4BT4 A;  2LCA A;  2ALE A;  1SA0 B;  4U3J A;  3CCS F;  3HJW C;  1X7O A;  2Q1Y A;  4G4V A;  1SA0 A;  4C82 A;  3TD5 A;  3RYI A;  2CVL A;  3F0D A;  4EB6 A;  1W5F A;  3S0Y A;  1JJ2 F;  3HKE B;  3WGM A;  5EYP A;  4TZZ A;  2UYN B;  5ITZ A;  1K9M H;  3WGL A;  3S03 A;  2R75 1;  3WJQ A;  4BT3 A;  4EB6 B;  1Z5W A;  3CCR F;  2HRU A;  1TUB A;  4I50 A;  1U43 A;  3RE3 A;  3CPQ A;  4IIJ A;  2GLZ A;  3MDO A;  3TD3 A;  5FNV B;  4XCQ A;  3V7E A;  3HKD B;  3HKB B;  3I55 F;  2KTU A;  3J7A R;  4HNA A;  4C8G A;  2HS4 A;  3PAF A;  5EAZ A;  4ERH A;  1TVK A;  2BTQ B;  3VCZ A;  3MQW A;  3KJJ A;  3VYS C;  5J2U B;  1W5E A;  3UT5 B;  1UI9 A;  3NK7 A;  3CC2 F;  3FBA A;  2OHW A;  3HTN A;  2QTP A;  2ZOD A;  3M4S A;  3JAS A;  5CA1 A;  1KNK A;  3S02 A;  1QD9 A;  4O4L A; 
#chains in the Genus database with same CATH homology
 5G4V C;  2CZW A;  1Q82 H;  1VQ9 F;  1VQ6 F;  3WXM B;  1W40 A;  1KD1 H;  1CK2 A;  2LBX A;  4BVT A;  2VGM A;  3LWV C;  3D00 A;  3FFM A;  1YJW F;  1E7K A;  3CCU F;  2WAL A;  4C4W C;  4EI9 A;  1GO1 A;  1W42 A;  1Q7Y H;  3E20 B;  3RA5 A;  3LWQ C;  5HWE A;  3SIV A;  5HXU A;  2HVY D;  3RA6 A;  2F9Z C;  3LWR C;  3ON1 A;  5EO3 A;  1YJ9 F;  2JNB A;  3G71 F;  5FLX M;  1H7M A;  3E1Y A;  3NK6 A;  3CPW F;  4BVR A;  2OTL F;  1IPA A;  1CN7 A;  3MCA B;  4BY9 D;  1SDS A;  4X3L A;  3JCM M;  2BO1 A;  3LWO C;  3OBY A;  1GZ0 A;  1VQ8 F;  3G4S F;  3GYQ A;  1S72 F;  1NMU B;  1VQ7 F;  3V3T A;  1RA4 A;  1W3E X;  2KTV A;  1X7P A;  1GO0 A;  5IT9 M;  1VQP F;  1VQ4 F;  3AGK A;  3LFO A;  1W41 A;  3CC7 F;  1ZWZ A;  2I6D A;  3OBW A;  2KG4 A;  2LBW A;  3CCV F;  5FJ4 C;  4X3M A;  4NUT A;  1VQM F;  3I56 F;  4BW0 B;  3CC4 F;  1YIJ F;  3G6E F;  2OZB A;  5HY1 A;  3CCJ F;  2FC3 A;  3CCL F;  1YJN F;  2ALE A;  2VGN A;  2AIF A;  3J81 M;  1YHQ F;  1YIT F;  3VI6 A;  1VQK F;  1DT9 A;  1QVF F;  1K8A H;  4BVQ A;  3CCS F;  3HJW C;  1X7O A;  5GIN C;  3CCM F;  3OW2 F;  5GAN K;  3CME F;  5EWR A;  1KC8 H;  1Q81 H;  3CCQ F;  5A2Q M;  1JJ2 F;  4TZZ A;  3NVK E;  1K73 H;  3CD6 F;  1VQ5 F;  1K9M H;  3NMU C;  5GIO C;  3V7Q A;  2QA4 F;  1PXW A;  4BVS A;  3CCR F;  5G4U C;  1QVG F;  3PLA C;  4NQ3 A;  4LCK A;  1XBI A;  3CMA F;  3CPQ A;  5HY0 A;  2GLZ A;  3IR9 A;  5GIP C;  3SIU A;  3CG6 A;  3O85 A;  3N4Y A;  2QI2 A;  3N4Z A;  4XCQ A;  3V7E A;  4EI8 A;  3VMF B;  5GAP K;  3I55 F;  4EI7 A;  2KTU A;  3J7A R;  5DCV A;  5HY2 A;  1YI2 F;  1VQN F;  3PAF A;  5HY4 A;  1X52 A;  2QEX F;  1M1K H;  1KQS F;  5HXZ A;  3NVI B;  3J80 M;  1NJI H;  3JAM M;  3HAX D;  3NK7 A;  3CXC F;  3CC2 F;  2OTJ F;  2OHW A;  3CCE F;  1W2B F;  1VQL F;  1Q86 H;  1RLG A;  3LWP C;  1T0K B;  2FGY A;  1M90 H;  1VQO F;  1N8R H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...