5GIPC

Crystal structure of box c/d rnp with 13 nt guide regions and 11 nt substrates
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
122
structure length
122
Chain Sequence
ASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
total genus 41
structure length 122
sequence length 122
chains with identical sequence D, M, N
ec nomenclature
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5gipC00
1Q86H 3NVKE 3I56F 2AIFA 1W40A 2KTUA 3PAFA 1RLGA 3NMUC 3V7EA 2QI2A 1M90H 1GO1A 2HVYD 5G4UC 2CZWA 1K8AH 3OBWA 1GZ0A 3CG6A 3CC7F 3HJWC 3LWPC 3OBYA 3LWRC 2OTJF 4NUTA 3CPQA 3G4SF 3CCUF 3NK7A 5GINC 1K73H 1T0KB 1VQPF 3JCMM 5DCVA 4BW0B 3G71F 2KTVA 1KQSF 2VGMA 1W41A 2VGNA 3CC4F 1QVGF 1GO0A 1CK2A 2FC3A 1ZWZA 1VQ7F 1W42A 3O85A 5GANK 1SDSA 3CMEF 1CN7A 3RA5A 3CCJF 4TZZA 3CCQF 1W2BF 2I6DA 2LBXA 1X52A 3CPWF 5GIOC 3J80M 3I55F 3SIUA 3RA6A 1K9MH 3CCLF 1YIJF 1KC8H 5G4VC 3J81M 3CCSF 3HAXD 3CMAF 3NK6A 1IPAA 3AGKA 3NVIB 2ALEA 3CCRF 5EO3A 1Q81H 1QVFF 5A2QM 3SIVA 1VQ6F 5FLXM 4X3MA 5GAPK 4LCKA 1XBIA 3VMFB 1YJWF 2OZBA 3CXCF 2BO1A 2LBWA 1KD1H 2QA4F 3CD6F 5GIPC 3PLAC 2WALA 1VQ5F 3LFOA 3VI6A 5IT9M 1VQKF 1RA4A 3J7AR 3N4ZA 3G6EF 3LWVC 1VQ8F 1S72F 3E20B 3GYQA 1YJNF 3LWQC 1VQ9F 1YITF 3CCEF 1VQ4F 2JNBA 3N4YA 2OTLF 1YJ9F 1VQNF 3V7QA 2QEXF 1W3EX 1X7OA 1Q7YH 1M1KH 3FFMA 3IR9A 3CC2F 3CCVF 1VQLF 1E7KA 1N8RH 3WXMB 2KG4A 3ON1A 3JAMM 5FJ4C 4C4WC 1JJ2F 3LWOC 1VQMF 1H7MA 1X7PA 3CCMF 1PXWA 1VQOF 1YHQF 1Q82H 4BY9D 3MCAB 1NJIH 1DT9A 4X3LA 3E1YA 3OW2F 1YI2F 1NMUB 5EWRA 2OHWA
chains in the Genus database with same CATH superfamily
2B33A 4RHAA 3HTNA 1ODEA 1SA0A 1W5EA 1TVKB 3I56F 2KTUA 3PAFA 5KMGB 3NMUC 4EI9A 5G4UC 4O4JB 5JQGB 1Q8RA 3OBWA 1GZ0A 4X1KA 3CG6A 5LP6B 3L7QA 4DXDA 2P6YA 3IKFA 3B6NA 1QD9A 1H48A 3RYFA 3VYSC 3WGLA 3CPQA 1Z5WA 3RE3A 5JH7B 1T0KB 3JCMM 1TUBA 3VCZA 3JASB 3GHZA 1FFXB 1VH8A 2KTVA 5BMVA 2VGNA 4IHJA 1QVGF 3C9TA 1JFFA 1SDSA 2H8CA 5IYZB 3I3FA 2IQQA 1X52A 2CW4A 4ZK7A 4ZI7A 5HY0A 1Z5VA 5GIOC 3RYIA 3WGJA 5JCOC 1K9MH 2RHLA 3WJPA 1XRGA 1TVKA 3CCSF 4O2BB 1KNKA 5KMGA 3CMAF 4BT4A 1RQ7A 3JAWB 4KWEA 5CB4B 4PWTA 5A2QM 1IV1A 3SIVA 5FLXM 3WGKA 4F6RB 5LP6A 5GONB 1UI9A 3VMFB 3K0TA 3JAKB 2BO1A 2LBWA 2QA4F 2Q1XA 4X20B 3PLAC 2WALA 5JH7A 2CSLA 3R0PA 3LFOA 3T80A 3JASA 3K12A 3G6EF 4TV8B 1FFXA 3Q8HA 1S72F 4BT2A 3VO8A 4I55A 1RQ2A 2VAWA 4C82A 1YJNF 2FGYA 5IYZA 2ZAUA 4O4IB 2BTOA 2JNBA 2OTLF 1RLUA 5IJ0B 1SZQA 4ZHWA 2UYNA 2GZLA 2VXYA 4O2BA 3IKEA 4YJ3B 2KG4A 3JAWA 1OFUA 3RYCB 2HP3A 1IV2A 3LWOC 3F0EA 5GONA 1FSZA 3TD4A 1SA0B 4G4YA 2UYPA 1X7PA 1PXWA 2AMTA 3GTZA 4TV9B 4C81A 4ERHA 1J7HA 4XCQA 1Q82H 1R1MA 3S0HA 2CWJA 1DT9A 4X3LA 1IV3A 5J2TB 4FFBB 4TV8A 2GLZA 3EORA 4G4ZA 2DT4A 4BT5A 1W40A 5IJ9B 1RLGA 2QI2A 5HP8A 1GO1A 2HVYD 4LNUB 2CZWA 4O4IA 4RQOA 3JARB 5HY1A 5EYPB 2L26A 5IJ0A 3HKDB 4HNAB 3CC7F 2YYEA 3VTIC 4ZHVA 3HJWC 3OBYA 3LWRC 2HX0A 4YJ3A 3E22B 3CCUF 1K73H 2Z1TA 3NK7A 4BVQA 4BW0B 2HRUA 3RYCA 2CHSA 3HKCA 2VGMA 3ZO8A 3RYIB 3BYQA 2FC3A 5GANK 3KJJA 3O85A 1X25A 4I4TB 3CMEF 4TV9A 3M1XA 3RA5A 5AVMA 3S06A 4O4HA 1W2BF 3P10A 2I6DA 3K14A 2QTPA 2HQSC 3I55F 1U43A 3RA6A 5J2TA 4FFBA 1KC8H 4EI7A 5IJ9A 2W8BC 3S0YA 3HAXD 1QAHA 3P4EA 5EB0A 3TD5A 1IPAA 3FBAA 1DBFA 1VHAA 3ZP4A 4LNUA 3NVIB 3CCRF 5EO3A 1Q81H 1QVFF 3MCQA 3JARA 5EYPA 3HKDA 4HNAA 3VIUA 1U3PA 1XBIA 4B62A 3VYTC 3D01A 2Z1UA 2OZBA 4I50A 5LOVB 4I55B 4C8EA 3N2GB 3E22A 3CYPB 1OAPA 3VI6A 4B45A 1RA4A 5HXZA 1FNKA 2OTMA 3HKBB 4O4LB 2UYNB 2HS3A 3GYQA 2HRYA 4I4TA 1U40A 1VQ9F 3U0OA 5C8YB 3D00A 3CCEF 5HY2A 3N4YA 4C8IA 1VQNF 5HWEA 4TUYB 2QEXF 1IV4A 1X7OA 5JVDA 2R751 3M4SA 2UZHA 3MQWA 1E7KA 3WXMB 3KJKA 4O2AB 4X1YB 4EI8A 4C4WC 5EIBD 2R6R1 1COMA 3WJRA 4BVRA 4NQ3A 2H6LA 4IIJA 5LOVA 1XV2A 3N2GA 4BVTA 1VQOF 1YHQF 3MCAB 3VOAA 4ZHYB 4ZHQB 1YI2F 2UYKA 2Z01A 2ZVZA 2IAFA 1Q86H 1W581 5HXUA 3NVKE 3HKBA 4O4LA 3V7EA 3LMEA 4C8GA 5MN5A 1M90H 3LDTA 4G4XA 2YXZA 5C8YA 2BTQB 3N2KB 5CA1B 2LCAA 3HKCB 3JVHA 2UYJA 4TUYA 2GVIA 3JATB 2OTJF 4NUTA 3M84A 5ITZB 3QHDA 5GINC 3IMPA 4O4HB 1FNJA 4O2AA 1VQPF 5DCVA 3C9SA 1YQNA 5J2UB 4X1YA 3V4DA 3G71F 1KQSF 1W41A 3FD5A 5FNVB 1CK2A 1ZWZA 3WJQA 1W42A 1CN7A 3CCQF 2LBXA 4ZHQA 2HP0B 3WPXA 5B8FA 3F0FA 1ONIA 3WGMA 4X1IB 2K1SA 1YGYA 2KGWA 2ZOVA 4I50B 3NK6A 2ZODA 2NMUA 3N2KA 5HY4A 1W57A 5CA1A 1VQ6F 4G4VA 4X3MA 4LCKA 1YJWF 3DC2A 3JATA 1KD1H 2H8EA 2Z1EA 5ITZA 1JY8A 5GIPC 1W55A 1QU9A 2AIZP 4U3JB 5MN4A 5IT9M 1VQKF 5CA0B 5J2UA 2RHHA 2PMPA 3ERNA 5FNVA 3TD3A 3F6MA 2I6RA 5JVDB 3LWQC 1YITF 5EIBC 4BT6A 1VQ4F 1YJ9F 3UT5B 4YJ2B 2HP0A 3KE1A 4IIJB 1Q7YH 2HS0A 2Q1YA 4X1IA 1M1KH 3FFMA 3IR9A 3CCVF 4NWOB 1N8RH 4G4WA 3ZOPA 2RB9A 3ON1A 3KHNA 3I7TA 4DRXB 3QUWA 2N48A 5FJ4C 1JJ2F 1H7MA 4E6EA 3RYHB 5MN6A 3ESJA 5LYJA 2G9IA 3E1YA 4U3JA 5EWRA 3D54A 5CA0A 4EB6B 5KX5B 2IG8A 3HKEB 4ZOLB 3CB2A 2EWCA 2AIFA 5HP7A 3IEQA 3QTYA 3LYBA 3WGNA 3S0WA 1K8AH 3HWUA 1NQ3A 2CHTA 3UT5A 4YJ2A 2ZVYA 5LXTB 2V9YA 3LWPC 3DDNA 4M8IA 3JALB 3G4SF 2CVLA 4O4JA 3KIZA 5JQGA 4DRXA 3C9UA 2HS4A 3CC4F 4R40B 3RYHA 1GO0A 3F0GA 1VQ7F 3CCJF 4TZZA 1XHOA 4WBNB 4BT7A 1W5AA 3CPWF 3J80M 3SIUA 4EB6A 5KX5A 3CCLF 1YIJF 3HKEA 4ZOLA 5G4VC 3J81M 5EZYB 3AGKA 2ALEA 2MQEA 3V3TA 1UFYA 4B5CA 1CLIA 3ZP7A 4G88A 2LBTA 5GAPK 3FPIA 5LXTA 3CXCF 5LA6B 1VQVA 3JALA 3CD6F 3S02A 5CB4A 5EB1B 2BTUA 1VQ5F 3IEWA 2VAPA 3F0DA 4B46A 3J7AR 4F6RA 3N4ZA 3LWVC 2DYYA 1W5BA 2F9ZC 1VQ8F 1H47A 3JAKA 5LP6C 5EAZA 3E20B 2RHOA 2VAMA 4X20A 2ZF8A 1GX1A 3VYUC 4WBNA 4X1KB 1KNJA 3K2XA 3OONA 3V7QA 1W59A 1W3EX 3FD6A 3RYFB 4U39A 5EZYA 3MBMA 1T0AA 1JD1A 3CC2F 1VQLF 3P0ZA 3VOBA 1PF5A 1TUBB 5LYJB 4BVSA 3JAMM 1U3LA 3S03A 1VK3A 1W5FA 1VQMF 3CYQA 5BMVB 4IHJB 3C9RA 3ELCA 4BT3A 1JFFB 2PHNA 3CCMF 1JN1A 5LA6A 3MDOA 2RHJA 4BY9D 1NJIH 5JCOA 2Z1FA 3WPWA 3OW2F 4ZI7B 1NMUB 3C8LA 2OHWA
chains in the Genus database with same CATH topology
1Q86H 5HXUA 2GLZA 3NVKE 3I56F 2AIFA 1W40A 2KTUA 3PAFA 1RLGA 3NMUC 3V7EA 2QI2A 1M90H 1GO1A 2HVYD 4EI9A 5G4UC 2CZWA 5HY1A 1K8AH 3OBWA 1GZ0A 3CG6A 3CC7F 3HJWC 3LWPC 3OBYA 3LWRC 2OTJF 4NUTA 3CPQA 3G4SF 3CCUF 3NK7A 5GINC 1K73H 4BVQA 1T0KB 1VQPF 3JCMM 5DCVA 4BW0B 3G71F 2KTVA 1KQSF 2VGMA 1W41A 2VGNA 3CC4F 1QVGF 1GO0A 1CK2A 2FC3A 1ZWZA 1VQ7F 1W42A 3O85A 5GANK 1SDSA 3CMEF 1CN7A 3RA5A 3CCJF 4TZZA 3CCQF 1W2BF 2I6DA 2LBXA 1X52A 5HY0A 3CPWF 5GIOC 3J80M 3I55F 3SIUA 3RA6A 1K9MH 3CCLF 1YIJF 1KC8H 5G4VC 4EI7A 3J81M 3CCSF 3HAXD 3CMAF 3NK6A 1IPAA 3AGKA 3NVIB 2ALEA 3CCRF 5EO3A 1Q81H 3V3TA 1QVFF 5A2QM 5HY4A 3SIVA 1VQ6F 5FLXM 4X3MA 5GAPK 4LCKA 1XBIA 3VMFB 1YJWF 2OZBA 3CXCF 2BO1A 2LBWA 1KD1H 2QA4F 3CD6F 5GIPC 3PLAC 2WALA 1VQ5F 3LFOA 3VI6A 5IT9M 1VQKF 1RA4A 3J7AR 5HXZA 3N4ZA 3G6EF 3LWVC 2F9ZC 1VQ8F 1S72F 3E20B 3GYQA 1YJNF 3LWQC 1VQ9F 2FGYA 1YITF 3D00A 3CCEF 5HY2A 2JNBA 1VQ4F 3N4YA 2OTLF 1YJ9F 1VQNF 5HWEA 3V7QA 2QEXF 1W3EX 1X7OA 1Q7YH 1M1KH 3FFMA 3IR9A 3CC2F 3CCVF 1VQLF 1E7KA 1N8RH 3WXMB 2KG4A 3ON1A 4BVSA 3JAMM 5FJ4C 4EI8A 4C4WC 1JJ2F 3LWOC 1VQMF 1H7MA 4BVRA 4NQ3A 1X7PA 3CCMF 1PXWA 4BVTA 1VQOF 4XCQA 1YHQF 1Q82H 3MCAB 1NJIH 4BY9D 1DT9A 4X3LA 3E1YA 3OW2F 1YI2F 1NMUB 5EWRA 2OHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 H;  3NVK E;  3I56 F;  2AIF A;  1W40 A;  2KTU A;  3PAF A;  1RLG A;  3NMU C;  3V7E A;  2QI2 A;  1M90 H;  1GO1 A;  2HVY D;  5G4U C;  2CZW A;  1K8A H;  3OBW A;  1GZ0 A;  3CG6 A;  3CC7 F;  3HJW C;  3LWP C;  3OBY A;  3LWR C;  2OTJ F;  4NUT A;  3CPQ A;  3G4S F;  3CCU F;  3NK7 A;  5GIN C;  1K73 H;  1T0K B;  1VQP F;  3JCM M;  5DCV A;  4BW0 B;  3G71 F;  2KTV A;  1KQS F;  2VGM A;  1W41 A;  2VGN A;  3CC4 F;  1QVG F;  1GO0 A;  1CK2 A;  2FC3 A;  1ZWZ A;  1VQ7 F;  1W42 A;  3O85 A;  5GAN K;  1SDS A;  3CME F;  1CN7 A;  3RA5 A;  3CCJ F;  4TZZ A;  3CCQ F;  1W2B F;  2I6D A;  2LBX A;  1X52 A;  3CPW F;  5GIO C;  3J80 M;  3I55 F;  3SIU A;  3RA6 A;  1K9M H;  3CCL F;  1YIJ F;  1KC8 H;  5G4V C;  3J81 M;  3CCS F;  3HAX D;  3CMA F;  3NK6 A;  1IPA A;  3AGK A;  3NVI B;  2ALE A;  3CCR F;  5EO3 A;  1Q81 H;  1QVF F;  5A2Q M;  3SIV A;  1VQ6 F;  5FLX M;  4X3M A;  5GAP K;  4LCK A;  1XBI A;  3VMF B;  1YJW F;  2OZB A;  3CXC F;  2BO1 A;  2LBW A;  1KD1 H;  2QA4 F;  3CD6 F;  5GIP C;  3PLA C;  2WAL A;  1VQ5 F;  3LFO A;  3VI6 A;  5IT9 M;  1VQK F;  1RA4 A;  3J7A R;  3N4Z A;  3G6E F;  3LWV C;  1VQ8 F;  1S72 F;  3E20 B;  3GYQ A;  1YJN F;  3LWQ C;  1VQ9 F;  1YIT F;  3CCE F;  1VQ4 F;  2JNB A;  3N4Y A;  2OTL F;  1YJ9 F;  1VQN F;  3V7Q A;  2QEX F;  1W3E X;  1X7O A;  1Q7Y H;  1M1K H;  3FFM A;  3IR9 A;  3CC2 F;  3CCV F;  1VQL F;  1E7K A;  1N8R H;  3WXM B;  2KG4 A;  3ON1 A;  3JAM M;  5FJ4 C;  4C4W C;  1JJ2 F;  3LWO C;  1VQM F;  1H7M A;  1X7P A;  3CCM F;  1PXW A;  1VQO F;  1YHQ F;  1Q82 H;  4BY9 D;  3MCA B;  1NJI H;  1DT9 A;  4X3L A;  3E1Y A;  3OW2 F;  1YI2 F;  1NMU B;  5EWR A;  2OHW A; 
#chains in the Genus database with same CATH topology
 2B33 A;  4RHA A;  3HTN A;  1ODE A;  1SA0 A;  1W5E A;  1TVK B;  3I56 F;  2KTU A;  3PAF A;  5KMG B;  3NMU C;  4EI9 A;  5G4U C;  4O4J B;  5JQG B;  1Q8R A;  3OBW A;  1GZ0 A;  4X1K A;  3CG6 A;  5LP6 B;  3L7Q A;  4DXD A;  2P6Y A;  3IKF A;  3B6N A;  1QD9 A;  1H48 A;  3RYF A;  3VYS C;  3WGL A;  3CPQ A;  1Z5W A;  3RE3 A;  5JH7 B;  1T0K B;  3JCM M;  1TUB A;  3VCZ A;  3JAS B;  3GHZ A;  1FFX B;  1VH8 A;  2KTV A;  5BMV A;  2VGN A;  4IHJ A;  1QVG F;  3C9T A;  1JFF A;  1SDS A;  2H8C A;  5IYZ B;  3I3F A;  2IQQ A;  1X52 A;  2CW4 A;  4ZK7 A;  4ZI7 A;  5HY0 A;  1Z5V A;  5GIO C;  3RYI A;  3WGJ A;  5JCO C;  1K9M H;  2RHL A;  3WJP A;  1XRG A;  1TVK A;  3CCS F;  4O2B B;  1KNK A;  5KMG A;  3CMA F;  4BT4 A;  1RQ7 A;  3JAW B;  4KWE A;  5CB4 B;  4PWT A;  5A2Q M;  1IV1 A;  3SIV A;  5FLX M;  3WGK A;  4F6R B;  5LP6 A;  5GON B;  1UI9 A;  3VMF B;  3K0T A;  3JAK B;  2BO1 A;  2LBW A;  2QA4 F;  2Q1X A;  4X20 B;  3PLA C;  2WAL A;  5JH7 A;  2CSL A;  3R0P A;  3LFO A;  3T80 A;  3JAS A;  3K12 A;  3G6E F;  4TV8 B;  1FFX A;  3Q8H A;  1S72 F;  4BT2 A;  3VO8 A;  4I55 A;  1RQ2 A;  2VAW A;  4C82 A;  1YJN F;  2FGY A;  5IYZ A;  2ZAU A;  4O4I B;  2BTO A;  2JNB A;  2OTL F;  1RLU A;  5IJ0 B;  1SZQ A;  4ZHW A;  2UYN A;  2GZL A;  2VXY A;  4O2B A;  3IKE A;  4YJ3 B;  2KG4 A;  3JAW A;  1OFU A;  3RYC B;  2HP3 A;  1IV2 A;  3LWO C;  3F0E A;  5GON A;  1FSZ A;  3TD4 A;  1SA0 B;  4G4Y A;  2UYP A;  1X7P A;  1PXW A;  2AMT A;  3GTZ A;  4TV9 B;  4C81 A;  4ERH A;  1J7H A;  4XCQ A;  1Q82 H;  1R1M A;  3S0H A;  2CWJ A;  1DT9 A;  4X3L A;  1IV3 A;  5J2T B;  4FFB B;  4TV8 A;  2GLZ A;  3EOR A;  4G4Z A;  2DT4 A;  4BT5 A;  1W40 A;  5IJ9 B;  1RLG A;  2QI2 A;  5HP8 A;  1GO1 A;  2HVY D;  4LNU B;  2CZW A;  4O4I A;  4RQO A;  3JAR B;  5HY1 A;  5EYP B;  2L26 A;  5IJ0 A;  3HKD B;  4HNA B;  3CC7 F;  2YYE A;  3VTI C;  4ZHV A;  3HJW C;  3OBY A;  3LWR C;  2HX0 A;  4YJ3 A;  3E22 B;  3CCU F;  1K73 H;  2Z1T A;  3NK7 A;  4BVQ A;  4BW0 B;  2HRU A;  3RYC A;  2CHS A;  3HKC A;  2VGM A;  3ZO8 A;  3RYI B;  3BYQ A;  2FC3 A;  5GAN K;  3KJJ A;  3O85 A;  1X25 A;  4I4T B;  3CME F;  4TV9 A;  3M1X A;  3RA5 A;  5AVM A;  3S06 A;  4O4H A;  1W2B F;  3P10 A;  2I6D A;  3K14 A;  2QTP A;  2HQS C;  3I55 F;  1U43 A;  3RA6 A;  5J2T A;  4FFB A;  1KC8 H;  4EI7 A;  5IJ9 A;  2W8B C;  3S0Y A;  3HAX D;  1QAH A;  3P4E A;  5EB0 A;  3TD5 A;  1IPA A;  3FBA A;  1DBF A;  1VHA A;  3ZP4 A;  4LNU A;  3NVI B;  3CCR F;  5EO3 A;  1Q81 H;  1QVF F;  3MCQ A;  3JAR A;  5EYP A;  3HKD A;  4HNA A;  3VIU A;  1U3P A;  1XBI A;  4B62 A;  3VYT C;  3D01 A;  2Z1U A;  2OZB A;  4I50 A;  5LOV B;  4I55 B;  4C8E A;  3N2G B;  3E22 A;  3CYP B;  1OAP A;  3VI6 A;  4B45 A;  1RA4 A;  5HXZ A;  1FNK A;  2OTM A;  3HKB B;  4O4L B;  2UYN B;  2HS3 A;  3GYQ A;  2HRY A;  4I4T A;  1U40 A;  1VQ9 F;  3U0O A;  5C8Y B;  3D00 A;  3CCE F;  5HY2 A;  3N4Y A;  4C8I A;  1VQN F;  5HWE A;  4TUY B;  2QEX F;  1IV4 A;  1X7O A;  5JVD A;  2R75 1;  3M4S A;  2UZH A;  3MQW A;  1E7K A;  3WXM B;  3KJK A;  4O2A B;  4X1Y B;  4EI8 A;  4C4W C;  5EIB D;  2R6R 1;  1COM A;  3WJR A;  4BVR A;  4NQ3 A;  2H6L A;  4IIJ A;  5LOV A;  1XV2 A;  3N2G A;  4BVT A;  1VQO F;  1YHQ F;  3MCA B;  3VOA A;  4ZHY B;  4ZHQ B;  1YI2 F;  2UYK A;  2Z01 A;  2ZVZ A;  2IAF A;  1Q86 H;  1W58 1;  5HXU A;  3NVK E;  3HKB A;  4O4L A;  3V7E A;  3LME A;  4C8G A;  5MN5 A;  1M90 H;  3LDT A;  4G4X A;  2YXZ A;  5C8Y A;  2BTQ B;  3N2K B;  5CA1 B;  2LCA A;  3HKC B;  3JVH A;  2UYJ A;  4TUY A;  2GVI A;  3JAT B;  2OTJ F;  4NUT A;  3M84 A;  5ITZ B;  3QHD A;  5GIN C;  3IMP A;  4O4H B;  1FNJ A;  4O2A A;  1VQP F;  5DCV A;  3C9S A;  1YQN A;  5J2U B;  4X1Y A;  3V4D A;  3G71 F;  1KQS F;  1W41 A;  3FD5 A;  5FNV B;  1CK2 A;  1ZWZ A;  3WJQ A;  1W42 A;  1CN7 A;  3CCQ F;  2LBX A;  4ZHQ A;  2HP0 B;  3WPX A;  5B8F A;  3F0F A;  1ONI A;  3WGM A;  4X1I B;  2K1S A;  1YGY A;  2KGW A;  2ZOV A;  4I50 B;  3NK6 A;  2ZOD A;  2NMU A;  3N2K A;  5HY4 A;  1W57 A;  5CA1 A;  1VQ6 F;  4G4V A;  4X3M A;  4LCK A;  1YJW F;  3DC2 A;  3JAT A;  1KD1 H;  2H8E A;  2Z1E A;  5ITZ A;  1JY8 A;  5GIP C;  1W55 A;  1QU9 A;  2AIZ P;  4U3J B;  5MN4 A;  5IT9 M;  1VQK F;  5CA0 B;  5J2U A;  2RHH A;  2PMP A;  3ERN A;  5FNV A;  3TD3 A;  3F6M A;  2I6R A;  5JVD B;  3LWQ C;  1YIT F;  5EIB C;  4BT6 A;  1VQ4 F;  1YJ9 F;  3UT5 B;  4YJ2 B;  2HP0 A;  3KE1 A;  4IIJ B;  1Q7Y H;  2HS0 A;  2Q1Y A;  4X1I A;  1M1K H;  3FFM A;  3IR9 A;  3CCV F;  4NWO B;  1N8R H;  4G4W A;  3ZOP A;  2RB9 A;  3ON1 A;  3KHN A;  3I7T A;  4DRX B;  3QUW A;  2N48 A;  5FJ4 C;  1JJ2 F;  1H7M A;  4E6E A;  3RYH B;  5MN6 A;  3ESJ A;  5LYJ A;  2G9I A;  3E1Y A;  4U3J A;  5EWR A;  3D54 A;  5CA0 A;  4EB6 B;  5KX5 B;  2IG8 A;  3HKE B;  4ZOL B;  3CB2 A;  2EWC A;  2AIF A;  5HP7 A;  3IEQ A;  3QTY A;  3LYB A;  3WGN A;  3S0W A;  1K8A H;  3HWU A;  1NQ3 A;  2CHT A;  3UT5 A;  4YJ2 A;  2ZVY A;  5LXT B;  2V9Y A;  3LWP C;  3DDN A;  4M8I A;  3JAL B;  3G4S F;  2CVL A;  4O4J A;  3KIZ A;  5JQG A;  4DRX A;  3C9U A;  2HS4 A;  3CC4 F;  4R40 B;  3RYH A;  1GO0 A;  3F0G A;  1VQ7 F;  3CCJ F;  4TZZ A;  1XHO A;  4WBN B;  4BT7 A;  1W5A A;  3CPW F;  3J80 M;  3SIU A;  4EB6 A;  5KX5 A;  3CCL F;  1YIJ F;  3HKE A;  4ZOL A;  5G4V C;  3J81 M;  5EZY B;  3AGK A;  2ALE A;  2MQE A;  3V3T A;  1UFY A;  4B5C A;  1CLI A;  3ZP7 A;  4G88 A;  2LBT A;  5GAP K;  3FPI A;  5LXT A;  3CXC F;  5LA6 B;  1VQV A;  3JAL A;  3CD6 F;  3S02 A;  5CB4 A;  5EB1 B;  2BTU A;  1VQ5 F;  3IEW A;  2VAP A;  3F0D A;  4B46 A;  3J7A R;  4F6R A;  3N4Z A;  3LWV C;  2DYY A;  1W5B A;  2F9Z C;  1VQ8 F;  1H47 A;  3JAK A;  5LP6 C;  5EAZ A;  3E20 B;  2RHO A;  2VAM A;  4X20 A;  2ZF8 A;  1GX1 A;  3VYU C;  4WBN A;  4X1K B;  1KNJ A;  3K2X A;  3OON A;  3V7Q A;  1W59 A;  1W3E X;  3FD6 A;  3RYF B;  4U39 A;  5EZY A;  3MBM A;  1T0A A;  1JD1 A;  3CC2 F;  1VQL F;  3P0Z A;  3VOB A;  1PF5 A;  1TUB B;  5LYJ B;  4BVS A;  3JAM M;  1U3L A;  3S03 A;  1VK3 A;  1W5F A;  1VQM F;  3CYQ A;  5BMV B;  4IHJ B;  3C9R A;  3ELC A;  4BT3 A;  1JFF B;  2PHN A;  3CCM F;  1JN1 A;  5LA6 A;  3MDO A;  2RHJ A;  4BY9 D;  1NJI H;  5JCO A;  2Z1F A;  3WPW A;  3OW2 F;  4ZI7 B;  1NMU B;  3C8L A;  2OHW A; 
#chains in the Genus database with same CATH homology
 1Q86 H;  5HXU A;  2GLZ A;  3NVK E;  3I56 F;  2AIF A;  1W40 A;  2KTU A;  3PAF A;  1RLG A;  3NMU C;  3V7E A;  2QI2 A;  1M90 H;  1GO1 A;  2HVY D;  4EI9 A;  5G4U C;  2CZW A;  5HY1 A;  1K8A H;  3OBW A;  1GZ0 A;  3CG6 A;  3CC7 F;  3HJW C;  3LWP C;  3OBY A;  3LWR C;  2OTJ F;  4NUT A;  3CPQ A;  3G4S F;  3CCU F;  3NK7 A;  5GIN C;  1K73 H;  4BVQ A;  1T0K B;  1VQP F;  3JCM M;  5DCV A;  4BW0 B;  3G71 F;  2KTV A;  1KQS F;  2VGM A;  1W41 A;  2VGN A;  3CC4 F;  1QVG F;  1GO0 A;  1CK2 A;  2FC3 A;  1ZWZ A;  1VQ7 F;  1W42 A;  3O85 A;  5GAN K;  1SDS A;  3CME F;  1CN7 A;  3RA5 A;  3CCJ F;  4TZZ A;  3CCQ F;  1W2B F;  2I6D A;  2LBX A;  1X52 A;  5HY0 A;  3CPW F;  5GIO C;  3J80 M;  3I55 F;  3SIU A;  3RA6 A;  1K9M H;  3CCL F;  1YIJ F;  1KC8 H;  5G4V C;  4EI7 A;  3J81 M;  3CCS F;  3HAX D;  3CMA F;  3NK6 A;  1IPA A;  3AGK A;  3NVI B;  2ALE A;  3CCR F;  5EO3 A;  1Q81 H;  3V3T A;  1QVF F;  5A2Q M;  5HY4 A;  3SIV A;  1VQ6 F;  5FLX M;  4X3M A;  5GAP K;  4LCK A;  1XBI A;  3VMF B;  1YJW F;  2OZB A;  3CXC F;  2BO1 A;  2LBW A;  1KD1 H;  2QA4 F;  3CD6 F;  5GIP C;  3PLA C;  2WAL A;  1VQ5 F;  3LFO A;  3VI6 A;  5IT9 M;  1VQK F;  1RA4 A;  3J7A R;  5HXZ A;  3N4Z A;  3G6E F;  3LWV C;  2F9Z C;  1VQ8 F;  1S72 F;  3E20 B;  3GYQ A;  1YJN F;  3LWQ C;  1VQ9 F;  2FGY A;  1YIT F;  3D00 A;  3CCE F;  5HY2 A;  2JNB A;  1VQ4 F;  3N4Y A;  2OTL F;  1YJ9 F;  1VQN F;  5HWE A;  3V7Q A;  2QEX F;  1W3E X;  1X7O A;  1Q7Y H;  1M1K H;  3FFM A;  3IR9 A;  3CC2 F;  3CCV F;  1VQL F;  1E7K A;  1N8R H;  3WXM B;  2KG4 A;  3ON1 A;  4BVS A;  3JAM M;  5FJ4 C;  4EI8 A;  4C4W C;  1JJ2 F;  3LWO C;  1VQM F;  1H7M A;  4BVR A;  4NQ3 A;  1X7P A;  3CCM F;  1PXW A;  4BVT A;  1VQO F;  4XCQ A;  1YHQ F;  1Q82 H;  3MCA B;  1NJI H;  4BY9 D;  1DT9 A;  4X3L A;  3E1Y A;  3OW2 F;  1YI2 F;  1NMU B;  5EWR A;  2OHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...