5GIPC

Crystal structure of box c/d rnp with 13 nt guide regions and 11 nt substrates
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
122
structure length
122
Chain Sequence
ASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 41
structure length 122
sequence length 122
chains with identical sequence D, M, N
ec nomenclature
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5gipC00
3ON1A 3CG6A 3O85A 1VQ7F 2LBWA 3LWPC 5A2QM 3I56F 3CCUF 3WXMB 3OW2F 2LBXA 2JNBA 3G71F 3LWQC 1VQKF 3MCAB 1N8RH 3JCMM 1T0KB 3V7EA 3LWVC 3LFOA 3AGKA 3CXCF 3G6EF 1GO1A 2VGNA 3CC4F 1Q86H 4X3MA 1YJ9F 1KC8H 3PAFA 2AIFA 3E1YA 1H7MA 3CCQF 3N4YA 1VQLF 3SIUA 4C4WC 3CD6F 3CPWF 1VQ4F 1GO0A 4LCKA 1CK2A 1YIJF 5IT9M 1S72F 1NMUB 5GANK 1YHQF 5GIPC 1W3EX 1SDSA 2KG4A 3CMAF 1NJIH 1QVFF 2ALEA 1W2BF 3CCSF 3CPQA 1YITF 3OBWA 1VQ8F 2KTVA 1X7PA 5GINC 3NK6A 1YJWF 1YJNF 4BY9D 3SIVA 3HAXD 3CCLF 4TZZA 1PXWA 3E20B 3OBYA 1VQNF 3NK7A 2QEXF 2KTUA 1VQ6F 1RLGA 1W41A 3G4SF 2CZWA 2VGMA 3LWOC 1W40A 1K73H 1Q82H 1E7KA 3V7QA 1KD1H 2QI2A 1YI2F 1X52A 1KQSF 1VQ5F 1CN7A 1IPAA 3RA6A 3NMUC 1W42A 5G4VC 2HVYD 2FC3A 5EWRA 1K9MH 3CCMF 5EO3A 3PLAC 1Q7YH 3CCRF 3RA5A 3VI6A 3LWRC 1K8AH 3CC2F 3VMFB 3CMEF 1Q81H 3CC7F 1GZ0A 1VQMF 1X7OA 5GAPK 5FLXM 3NVKE 5GIOC 3IR9A 2OZBA 2WALA 3J81M 3J7AR 1ZWZA 3CCJF 3CCEF 5G4UC 3JAMM 4NUTA 3N4ZA 2OHWA 2QA4F 1XBIA 1M1KH 2OTLF 1RA4A 2I6DA 1JJ2F 2OTJF 3GYQA 1VQOF 3NVIB 1DT9A 5FJ4C 5DCVA 1M90H 3HJWC 3J80M 3FFMA 1VQPF 3I55F 2BO1A 1QVGF 4BW0B 3CCVF 1VQ9F 4X3LA
chains in the Genus database with same CATH superfamily
3ON1A 2NMUA 2Z1EA 4RQOA 3WJPA 2IG8A 5A2QM 3WXMB 4EI9A 4O4HB 4LNUB 4ZOLB 5LYJB 2UYNA 3MCAB 1N8RH 3C9RA 4ZHYB 1R1MA 1W5EA 4ZI7A 1T0KB 3V7EA 3LFOA 3IKEA 1CLIA 2VGNA 5EYPA 3CC4F 2N48A 3K14A 2AMTA 2HQSC 2H8CA 3KHNA 3CCQF 4BT2A 1VQLF 5MN4A 3WJQA 1GO0A 3MDOA 1CK2A 2RHJA 4X1IA 1GX1A 5IT9M 1FFXA 3HTNA 3QTYA 1YHQF 3S06A 4X1YA 1JN1A 2CSLA 3JAWA 4ZHQA 1U40A 5EYPB 5LA6A 4G4WA 4YJ3B 3ZP4A 1W5FA 3QUWA 3CCSF 1SZQA 3D00A 3OBWA 4X1IB 4XCQA 1W5AA 3S02A 5GINC 1FFXB 2FGYA 5EAZA 3M4SA 5EB1B 4X1YB 1QAHA 4BY9D 3SIVA 2HRUA 3JAWB 3S0YA 3VYUC 5AVMA 3F6MA 1PXWA 3OBYA 3NK7A 3OONA 1VQ6F 2CZWA 4X20A 3I3FA 1K73H 3JARA 1W5BA 3JATA 3V7QA 2HRYA 4U3JB 2Q1YA 3ZP7A 5HP8A 2F9ZC 4I50A 5EWRA 4BVQA 5KX5A 3CCRF 4G4ZA 5IYZA 3B6NA 1Q81H 3VMFB 3CMEF 4F6RA 1W581 1X7OA 3JARB 1XRGA 1RQ7A 4C81A 3IR9A 2LCAA 3HKCA 2CWJA 4BVRA 5JQGA 5LXTA 1ZWZA 3P0ZA 3C9TA 3CCEF 5G4UC 1OFUA 2OHWA 1M1KH 2OTLF 4I50B 3I7TA 5FNVB 5BMVB 2OTJF 2ZVZA 3RYIB 5KX5B 1VQOF 2CHTA 3ZOPA 3VYSC 3LDTA 5IYZB 5FJ4C 1J7HA 3C9SA 3TD5A 2DYYA 4F6RB 2BO1A 3MQWA 1QVGF 3HKCB 5JQGB 3KJJA 5LXTB 5LOVA 3D01A 4BT6A 3LWPC 3OW2F 2GVIA 4O2AA 3BYQA 2PMPA 4G88A 3P4EA 3JCMM 3KE1A 3F0DA 3FD5A 1VQVA 1KNJA 4G4XA 3LWVC 2ZVYA 3VOAA 2HS0A 5LOVB 1GO1A 3G6EF 3DC2A 3L7QA 5EIBD 5HWEA 1KC8H 4ZHVA 2AIFA 4O2AB 4C4WC 4DRXA 2RB9A 4HNAA 2Q1XA 1TVKA 4TUYA 5EZYA 5J2UA 1S72F 1JD1A 5GANK 5CA1A 3S0WA 5HY0A 3T80A 1U3LA 4E6EA 2BTQB 4TV9A 3WGMA 2Z1TA 3E22A 2CHSA 3ZO8A 3CMAF 4DRXB 1YITF 1T0AA 2BTUA 4O4JA 4PWTA 4TUYB 5J2UB 2QTPA 1YJWF 1H47A 3C9UA 2R751 5CA1B 3CYQA 4G4YA 1TUBA 2UYNB 4TV9B 2MQEA 1VQNF 5JCOA 2QEXF 4ZK7A 4ZI7B 4ERHA 2ZODA 3G4SF 5ITZA 3HKEA 4O2BA 3MBMA 4O4JB 1Q82H 1IV1A 5HY1A 2QI2A 1KQSF 1X52A 1CN7A 3C8LA 3RA6A 3U0OA 5HXUA 3NMUC 2H6LA 3MCQA 1VK3A 2R6R1 1QU9A 1TUBB 3WGNA 5G4VC 2YXZA 2HVYD 5EO3A 1VH8A 2EWCA 3RA5A 3HKBA 1VHAA 5MN5A 4TV8A 4ZHQB 3CC2F 1XV2A 2AIZP 3NVKE 5LA6B 4DXDA 3J81M 2I6RA 3S0HA 3CCJF 2Z1UA 5HXZA 2QA4F 3M1XA 3KJKA 4IIJA 4C8EA 5HY2A 1IV4A 5EB0A 4ZHWA 1FNJA 2IAFA 3HKBB 5DCVA 4TV8B 4B5CA 1VQPF 3I55F 4YJ2A 1VQ9F 1DBFA 4NWOB 3IEWA 3CG6A 3RYFA 1Z5VA 2VXYA 4X20B 3VYTC 3I56F 3CCUF 1VQ7F 4IIJB 3JATB 2VAPA 3G71F 2Z1FA 3LWQC 4B46A 1VQKF 2W8BC 4WBNA 2BTOA 3WPWA 2DT4A 1JFFA 3IMPA 3V3TA 3ELCA 3JASA 3AGKA 5CB4A 3CXCF 1Z5WA 3UT5A 3RYFB 4X3MA 1YJ9F 4I55A 5LP6A 3EORA 4B45A 1H7MA 3N4YA 3SIUA 2RHLA 1QD9A 3CD6F 3WGLA 1VQ4F 3D54A 4WBNB 1YIJF 4O4LA 1NMUB 5JVDA 1NQ3A 1OAPA 4KWEA 1W3EX 3JASB 3LMEA 2VAWA 4EB6A 5CB4B 5KMGA 2B33A 3N2KA 5C8YA 2KG4A 5MN6A 5J2TA 3WPXA 4BT3A 1YQNA 5LP6B 3RYCA 1UFYA 3CPQA 2CVLA 4I4TA 1IV2A 1VQ8F 2KTVA 1X7PA 2ZAUA 3NK6A 3KIZA 1YJNF 5HY4A 5JVDB 3HAXD 3CCLF 5LP6C 5KMGB 5C8YB 3K0TA 2KGWA 5B8FA 3RE3A 4TZZA 2UZHA 3E20B 3VIUA 3RYCB 1RLGA 1W41A 5IJ0A 2VAMA 1W40A 3CB2A 4LNUA 4O4HA 1KD1H 4ZOLA 2ZF8A 1FSZA 4BT5A 3VTIC 4HNAB 1TVKB 2OTMA 4M8IA 5EZYB 1K9MH 2UYKA 3PLAC 5IJ9A 1Q7YH 3WGKA 5IJ0B 3VI6A 3LWRC 3JAKA 3FD6A 2HP3A 3CC7F 1GZ0A 5GAPK 3IKFA 3TD3A 5FLXM 4BT7A 2OZBA 3E22B 2WALA 4RHAA 5CA0A 3J7AR 2HX0A 1U3PA 2GLZA 2HS3A 4NUTA 3M84A 3N4ZA 1U43A 1XBIA 3HWUA 3CYPB 1JY8A 1XHOA 2I6DA 1X25A 2UYPA 5IJ9B 1DT9A 3ERNA 2G9IA 2P6YA 3HJWC 3JAKB 1KNKA 4YJ3A 3RYHA 4FFBA 4X3LA 5CA0B 2RHOA 4R40B 1YGYA 3O85A 2LBWA 5ITZB 3HKEB 4NQ3A 2LBXA 4O2BB 2GZLA 2JNBA 1W59A 1FNKA 4B62A 4BVSA 3F0EA 1SA0A 2HP0A 5JCOC 3ESJA 3HKDA 2PHNA 3RYHB 4FFBB 2HS4A 4O4IA 1ODEA 1Q86H 1RQ2A 4U3JA 3JVHA 3PAFA 5GONA 3E1YA 1COMA 1RLUA 3JALA 2RHHA 3CPWF 2H8EA 4LCKA 2LBTA 1SA0B 2HP0B 3HKDB 3K12A 5GIPC 4U39A 3R0PA 1SDSA 4O4IB 3VO8A 4C8GA 3N2GA 1NJIH 1QVFF 2ALEA 5GONB 1W2BF 4YJ2B 3S03A 3JALB 3DDNA 3FPIA 4IHJA 3K2XA 5FNVA 5BMVA 2YYEA 3F0GA 3RYIA 4BT4A 2L26A 2V9YA 3TD4A 4BVTA 3N2GB 3Q8HA 1JFFB 3FBAA 2KTUA 5JH7A 1ONIA 2VGMA 3LWOC 3VCZA 1PF5A 1IV3A 4IHJB 1Q8RA 1E7KA 3UT5B 1VQ5F 1YI2F 4EI8A 4I55B 1IPAA 1W42A 4X1KA 3WJRA 3P10A 2Z01A 2FC3A 5EIBC 2CW4A 3CCMF 4O4LB 5JH7B 3F0FA 1W55A 1K8AH 4EI7A 4EB6B 3N2KB 1VQMF 5GIOC 5J2TB 3GHZA 3VOBA 2K1SA 3IEQA 4G4VA 4X1KB 3JAMM 3QHDA 4I4TB 4C8IA 3LYBA 1RA4A 1UI9A 1JJ2F 3GYQA 5LYJA 4C82A 3NVIB 3V4DA 1H48A 1M90H 2IQQA 5HP7A 3J80M 3FFMA 2UYJA 3GTZA 3WGJA 2ZOVA 4BW0B 1W57A 3CCVF
chains in the Genus database with same CATH topology
3ON1A 3CG6A 3O85A 1VQ7F 2LBWA 3LWPC 5A2QM 3I56F 3CCUF 3WXMB 3OW2F 4NQ3A 2LBXA 4EI9A 2JNBA 3G71F 3LWQC 1VQKF 3MCAB 1N8RH 3JCMM 4BVSA 3V3TA 1T0KB 3V7EA 3LWVC 3LFOA 3AGKA 3CXCF 3G6EF 1GO1A 2VGNA 3CC4F 5HWEA 1Q86H 4X3MA 1YJ9F 1KC8H 3PAFA 2AIFA 3E1YA 1H7MA 3CCQF 3N4YA 1VQLF 3SIUA 4C4WC 3CD6F 3CPWF 1VQ4F 1GO0A 4LCKA 1CK2A 1YIJF 5IT9M 1S72F 1NMUB 5GANK 1YHQF 5GIPC 5HY0A 1W3EX 1SDSA 2KG4A 3CMAF 1NJIH 1QVFF 2ALEA 1W2BF 3CCSF 3CPQA 3D00A 3OBWA 1YITF 4XCQA 1VQ8F 2KTVA 1X7PA 5GINC 3NK6A 2FGYA 1YJWF 1YJNF 5HY4A 4BY9D 3SIVA 3HAXD 4BVTA 3CCLF 4TZZA 1PXWA 3E20B 3OBYA 1VQNF 3NK7A 2QEXF 2KTUA 1VQ6F 1RLGA 1W41A 3G4SF 2CZWA 2VGMA 3LWOC 1W40A 1K73H 1Q82H 1E7KA 3V7QA 1KD1H 5HY1A 2QI2A 1YI2F 1X52A 4EI8A 1KQSF 1VQ5F 1CN7A 1IPAA 3RA6A 5HXUA 3NMUC 1W42A 5G4VC 2F9ZC 2HVYD 2FC3A 5EWRA 4BVQA 1K9MH 3CCMF 5EO3A 3PLAC 1Q7YH 3CCRF 3RA5A 3VI6A 3LWRC 4EI7A 1K8AH 3CC2F 3VMFB 3CMEF 1Q81H 3CC7F 1GZ0A 1VQMF 1X7OA 5GAPK 5FLXM 3NVKE 5GIOC 3IR9A 2OZBA 4BVRA 2WALA 3J81M 3J7AR 1ZWZA 3CCJF 5HXZA 3CCEF 2GLZA 5G4UC 3JAMM 4NUTA 3N4ZA 2OHWA 2QA4F 1XBIA 1M1KH 2OTLF 1RA4A 5HY2A 2I6DA 1JJ2F 2OTJF 3GYQA 1VQOF 3NVIB 1DT9A 5FJ4C 5DCVA 1M90H 3HJWC 3J80M 3FFMA 1VQPF 3I55F 2BO1A 1QVGF 4BW0B 3CCVF 1VQ9F 4X3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ON1 A;  3CG6 A;  3O85 A;  1VQ7 F;  2LBW A;  3LWP C;  5A2Q M;  3I56 F;  3CCU F;  3WXM B;  3OW2 F;  2LBX A;  2JNB A;  3G71 F;  3LWQ C;  1VQK F;  3MCA B;  1N8R H;  3JCM M;  1T0K B;  3V7E A;  3LWV C;  3LFO A;  3AGK A;  3CXC F;  3G6E F;  1GO1 A;  2VGN A;  3CC4 F;  1Q86 H;  4X3M A;  1YJ9 F;  1KC8 H;  3PAF A;  2AIF A;  3E1Y A;  1H7M A;  3CCQ F;  3N4Y A;  1VQL F;  3SIU A;  4C4W C;  3CD6 F;  3CPW F;  1VQ4 F;  1GO0 A;  4LCK A;  1CK2 A;  1YIJ F;  5IT9 M;  1S72 F;  1NMU B;  5GAN K;  1YHQ F;  5GIP C;  1W3E X;  1SDS A;  2KG4 A;  3CMA F;  1NJI H;  1QVF F;  2ALE A;  1W2B F;  3CCS F;  3CPQ A;  1YIT F;  3OBW A;  1VQ8 F;  2KTV A;  1X7P A;  5GIN C;  3NK6 A;  1YJW F;  1YJN F;  4BY9 D;  3SIV A;  3HAX D;  3CCL F;  4TZZ A;  1PXW A;  3E20 B;  3OBY A;  1VQN F;  3NK7 A;  2QEX F;  2KTU A;  1VQ6 F;  1RLG A;  1W41 A;  3G4S F;  2CZW A;  2VGM A;  3LWO C;  1W40 A;  1K73 H;  1Q82 H;  1E7K A;  3V7Q A;  1KD1 H;  2QI2 A;  1YI2 F;  1X52 A;  1KQS F;  1VQ5 F;  1CN7 A;  1IPA A;  3RA6 A;  3NMU C;  1W42 A;  5G4V C;  2HVY D;  2FC3 A;  5EWR A;  1K9M H;  3CCM F;  5EO3 A;  3PLA C;  1Q7Y H;  3CCR F;  3RA5 A;  3VI6 A;  3LWR C;  1K8A H;  3CC2 F;  3VMF B;  3CME F;  1Q81 H;  3CC7 F;  1GZ0 A;  1VQM F;  1X7O A;  5GAP K;  5FLX M;  3NVK E;  5GIO C;  3IR9 A;  2OZB A;  2WAL A;  3J81 M;  3J7A R;  1ZWZ A;  3CCJ F;  3CCE F;  5G4U C;  3JAM M;  4NUT A;  3N4Z A;  2OHW A;  2QA4 F;  1XBI A;  1M1K H;  2OTL F;  1RA4 A;  2I6D A;  1JJ2 F;  2OTJ F;  3GYQ A;  1VQO F;  3NVI B;  1DT9 A;  5FJ4 C;  5DCV A;  1M90 H;  3HJW C;  3J80 M;  3FFM A;  1VQP F;  3I55 F;  2BO1 A;  1QVG F;  4BW0 B;  3CCV F;  1VQ9 F;  4X3L A; 
#chains in the Genus database with same CATH topology
 3ON1 A;  2NMU A;  2Z1E A;  4RQO A;  3WJP A;  2IG8 A;  5A2Q M;  3WXM B;  4EI9 A;  4O4H B;  4LNU B;  4ZOL B;  5LYJ B;  2UYN A;  3MCA B;  1N8R H;  3C9R A;  4ZHY B;  1R1M A;  1W5E A;  4ZI7 A;  1T0K B;  3V7E A;  3LFO A;  3IKE A;  1CLI A;  2VGN A;  5EYP A;  3CC4 F;  2N48 A;  3K14 A;  2AMT A;  2HQS C;  2H8C A;  3KHN A;  3CCQ F;  4BT2 A;  1VQL F;  5MN4 A;  3WJQ A;  1GO0 A;  3MDO A;  1CK2 A;  2RHJ A;  4X1I A;  1GX1 A;  5IT9 M;  1FFX A;  3HTN A;  3QTY A;  1YHQ F;  3S06 A;  4X1Y A;  1JN1 A;  2CSL A;  3JAW A;  4ZHQ A;  1U40 A;  5EYP B;  5LA6 A;  4G4W A;  4YJ3 B;  3ZP4 A;  1W5F A;  3QUW A;  3CCS F;  1SZQ A;  3D00 A;  3OBW A;  4X1I B;  4XCQ A;  1W5A A;  3S02 A;  5GIN C;  1FFX B;  2FGY A;  5EAZ A;  3M4S A;  5EB1 B;  4X1Y B;  1QAH A;  4BY9 D;  3SIV A;  2HRU A;  3JAW B;  3S0Y A;  3VYU C;  5AVM A;  3F6M A;  1PXW A;  3OBY A;  3NK7 A;  3OON A;  1VQ6 F;  2CZW A;  4X20 A;  3I3F A;  1K73 H;  3JAR A;  1W5B A;  3JAT A;  3V7Q A;  2HRY A;  4U3J B;  2Q1Y A;  3ZP7 A;  5HP8 A;  2F9Z C;  4I50 A;  5EWR A;  4BVQ A;  5KX5 A;  3CCR F;  4G4Z A;  5IYZ A;  3B6N A;  1Q81 H;  3VMF B;  3CME F;  4F6R A;  1W58 1;  1X7O A;  3JAR B;  1XRG A;  1RQ7 A;  4C81 A;  3IR9 A;  2LCA A;  3HKC A;  2CWJ A;  4BVR A;  5JQG A;  5LXT A;  1ZWZ A;  3P0Z A;  3C9T A;  3CCE F;  5G4U C;  1OFU A;  2OHW A;  1M1K H;  2OTL F;  4I50 B;  3I7T A;  5FNV B;  5BMV B;  2OTJ F;  2ZVZ A;  3RYI B;  5KX5 B;  1VQO F;  2CHT A;  3ZOP A;  3VYS C;  3LDT A;  5IYZ B;  5FJ4 C;  1J7H A;  3C9S A;  3TD5 A;  2DYY A;  4F6R B;  2BO1 A;  3MQW A;  1QVG F;  3HKC B;  5JQG B;  3KJJ A;  5LXT B;  5LOV A;  3D01 A;  4BT6 A;  3LWP C;  3OW2 F;  2GVI A;  4O2A A;  3BYQ A;  2PMP A;  4G88 A;  3P4E A;  3JCM M;  3KE1 A;  3F0D A;  3FD5 A;  1VQV A;  1KNJ A;  4G4X A;  3LWV C;  2ZVY A;  3VOA A;  2HS0 A;  5LOV B;  1GO1 A;  3G6E F;  3DC2 A;  3L7Q A;  5EIB D;  5HWE A;  1KC8 H;  4ZHV A;  2AIF A;  4O2A B;  4C4W C;  4DRX A;  2RB9 A;  4HNA A;  2Q1X A;  1TVK A;  4TUY A;  5EZY A;  5J2U A;  1S72 F;  1JD1 A;  5GAN K;  5CA1 A;  3S0W A;  5HY0 A;  3T80 A;  1U3L A;  4E6E A;  2BTQ B;  4TV9 A;  3WGM A;  2Z1T A;  3E22 A;  2CHS A;  3ZO8 A;  3CMA F;  4DRX B;  1YIT F;  1T0A A;  2BTU A;  4O4J A;  4PWT A;  4TUY B;  5J2U B;  2QTP A;  1YJW F;  1H47 A;  3C9U A;  2R75 1;  5CA1 B;  3CYQ A;  4G4Y A;  1TUB A;  2UYN B;  4TV9 B;  2MQE A;  1VQN F;  5JCO A;  2QEX F;  4ZK7 A;  4ZI7 B;  4ERH A;  2ZOD A;  3G4S F;  5ITZ A;  3HKE A;  4O2B A;  3MBM A;  4O4J B;  1Q82 H;  1IV1 A;  5HY1 A;  2QI2 A;  1KQS F;  1X52 A;  1CN7 A;  3C8L A;  3RA6 A;  3U0O A;  5HXU A;  3NMU C;  2H6L A;  3MCQ A;  1VK3 A;  2R6R 1;  1QU9 A;  1TUB B;  3WGN A;  5G4V C;  2YXZ A;  2HVY D;  5EO3 A;  1VH8 A;  2EWC A;  3RA5 A;  3HKB A;  1VHA A;  5MN5 A;  4TV8 A;  4ZHQ B;  3CC2 F;  1XV2 A;  2AIZ P;  3NVK E;  5LA6 B;  4DXD A;  3J81 M;  2I6R A;  3S0H A;  3CCJ F;  2Z1U A;  5HXZ A;  2QA4 F;  3M1X A;  3KJK A;  4IIJ A;  4C8E A;  5HY2 A;  1IV4 A;  5EB0 A;  4ZHW A;  1FNJ A;  2IAF A;  3HKB B;  5DCV A;  4TV8 B;  4B5C A;  1VQP F;  3I55 F;  4YJ2 A;  1VQ9 F;  1DBF A;  4NWO B;  3IEW A;  3CG6 A;  3RYF A;  1Z5V A;  2VXY A;  4X20 B;  3VYT C;  3I56 F;  3CCU F;  1VQ7 F;  4IIJ B;  3JAT B;  2VAP A;  3G71 F;  2Z1F A;  3LWQ C;  4B46 A;  1VQK F;  2W8B C;  4WBN A;  2BTO A;  3WPW A;  2DT4 A;  1JFF A;  3IMP A;  3V3T A;  3ELC A;  3JAS A;  3AGK A;  5CB4 A;  3CXC F;  1Z5W A;  3UT5 A;  3RYF B;  4X3M A;  1YJ9 F;  4I55 A;  5LP6 A;  3EOR A;  4B45 A;  1H7M A;  3N4Y A;  3SIU A;  2RHL A;  1QD9 A;  3CD6 F;  3WGL A;  1VQ4 F;  3D54 A;  4WBN B;  1YIJ F;  4O4L A;  1NMU B;  5JVD A;  1NQ3 A;  1OAP A;  4KWE A;  1W3E X;  3JAS B;  3LME A;  2VAW A;  4EB6 A;  5CB4 B;  5KMG A;  2B33 A;  3N2K A;  5C8Y A;  2KG4 A;  5MN6 A;  5J2T A;  3WPX A;  4BT3 A;  1YQN A;  5LP6 B;  3RYC A;  1UFY A;  3CPQ A;  2CVL A;  4I4T A;  1IV2 A;  1VQ8 F;  2KTV A;  1X7P A;  2ZAU A;  3NK6 A;  3KIZ A;  1YJN F;  5HY4 A;  5JVD B;  3HAX D;  3CCL F;  5LP6 C;  5KMG B;  5C8Y B;  3K0T A;  2KGW A;  5B8F A;  3RE3 A;  4TZZ A;  2UZH A;  3E20 B;  3VIU A;  3RYC B;  1RLG A;  1W41 A;  5IJ0 A;  2VAM A;  1W40 A;  3CB2 A;  4LNU A;  4O4H A;  1KD1 H;  4ZOL A;  2ZF8 A;  1FSZ A;  4BT5 A;  3VTI C;  4HNA B;  1TVK B;  2OTM A;  4M8I A;  5EZY B;  1K9M H;  2UYK A;  3PLA C;  5IJ9 A;  1Q7Y H;  3WGK A;  5IJ0 B;  3VI6 A;  3LWR C;  3JAK A;  3FD6 A;  2HP3 A;  3CC7 F;  1GZ0 A;  5GAP K;  3IKF A;  3TD3 A;  5FLX M;  4BT7 A;  2OZB A;  3E22 B;  2WAL A;  4RHA A;  5CA0 A;  3J7A R;  2HX0 A;  1U3P A;  2GLZ A;  2HS3 A;  4NUT A;  3M84 A;  3N4Z A;  1U43 A;  1XBI A;  3HWU A;  3CYP B;  1JY8 A;  1XHO A;  2I6D A;  1X25 A;  2UYP A;  5IJ9 B;  1DT9 A;  3ERN A;  2G9I A;  2P6Y A;  3HJW C;  3JAK B;  1KNK A;  4YJ3 A;  3RYH A;  4FFB A;  4X3L A;  5CA0 B;  2RHO A;  4R40 B;  1YGY A;  3O85 A;  2LBW A;  5ITZ B;  3HKE B;  4NQ3 A;  2LBX A;  4O2B B;  2GZL A;  2JNB A;  1W59 A;  1FNK A;  4B62 A;  4BVS A;  3F0E A;  1SA0 A;  2HP0 A;  5JCO C;  3ESJ A;  3HKD A;  2PHN A;  3RYH B;  4FFB B;  2HS4 A;  4O4I A;  1ODE A;  1Q86 H;  1RQ2 A;  4U3J A;  3JVH A;  3PAF A;  5GON A;  3E1Y A;  1COM A;  1RLU A;  3JAL A;  2RHH A;  3CPW F;  2H8E A;  4LCK A;  2LBT A;  1SA0 B;  2HP0 B;  3HKD B;  3K12 A;  5GIP C;  4U39 A;  3R0P A;  1SDS A;  4O4I B;  3VO8 A;  4C8G A;  3N2G A;  1NJI H;  1QVF F;  2ALE A;  5GON B;  1W2B F;  4YJ2 B;  3S03 A;  3JAL B;  3DDN A;  3FPI A;  4IHJ A;  3K2X A;  5FNV A;  5BMV A;  2YYE A;  3F0G A;  3RYI A;  4BT4 A;  2L26 A;  2V9Y A;  3TD4 A;  4BVT A;  3N2G B;  3Q8H A;  1JFF B;  3FBA A;  2KTU A;  5JH7 A;  1ONI A;  2VGM A;  3LWO C;  3VCZ A;  1PF5 A;  1IV3 A;  4IHJ B;  1Q8R A;  1E7K A;  3UT5 B;  1VQ5 F;  1YI2 F;  4EI8 A;  4I55 B;  1IPA A;  1W42 A;  4X1K A;  3WJR A;  3P10 A;  2Z01 A;  2FC3 A;  5EIB C;  2CW4 A;  3CCM F;  4O4L B;  5JH7 B;  3F0F A;  1W55 A;  1K8A H;  4EI7 A;  4EB6 B;  3N2K B;  1VQM F;  5GIO C;  5J2T B;  3GHZ A;  3VOB A;  2K1S A;  3IEQ A;  4G4V A;  4X1K B;  3JAM M;  3QHD A;  4I4T B;  4C8I A;  3LYB A;  1RA4 A;  1UI9 A;  1JJ2 F;  3GYQ A;  5LYJ A;  4C82 A;  3NVI B;  3V4D A;  1H48 A;  1M90 H;  2IQQ A;  5HP7 A;  3J80 M;  3FFM A;  2UYJ A;  3GTZ A;  3WGJ A;  2ZOV A;  4BW0 B;  1W57 A;  3CCV F; 
#chains in the Genus database with same CATH homology
 3ON1 A;  3CG6 A;  3O85 A;  1VQ7 F;  2LBW A;  3LWP C;  5A2Q M;  3I56 F;  3CCU F;  3WXM B;  3OW2 F;  4NQ3 A;  2LBX A;  4EI9 A;  2JNB A;  3G71 F;  3LWQ C;  1VQK F;  3MCA B;  1N8R H;  3JCM M;  4BVS A;  3V3T A;  1T0K B;  3V7E A;  3LWV C;  3LFO A;  3AGK A;  3CXC F;  3G6E F;  1GO1 A;  2VGN A;  3CC4 F;  5HWE A;  1Q86 H;  4X3M A;  1YJ9 F;  1KC8 H;  3PAF A;  2AIF A;  3E1Y A;  1H7M A;  3CCQ F;  3N4Y A;  1VQL F;  3SIU A;  4C4W C;  3CD6 F;  3CPW F;  1VQ4 F;  1GO0 A;  4LCK A;  1CK2 A;  1YIJ F;  5IT9 M;  1S72 F;  1NMU B;  5GAN K;  1YHQ F;  5GIP C;  5HY0 A;  1W3E X;  1SDS A;  2KG4 A;  3CMA F;  1NJI H;  1QVF F;  2ALE A;  1W2B F;  3CCS F;  3CPQ A;  3D00 A;  3OBW A;  1YIT F;  4XCQ A;  1VQ8 F;  2KTV A;  1X7P A;  5GIN C;  3NK6 A;  2FGY A;  1YJW F;  1YJN F;  5HY4 A;  4BY9 D;  3SIV A;  3HAX D;  4BVT A;  3CCL F;  4TZZ A;  1PXW A;  3E20 B;  3OBY A;  1VQN F;  3NK7 A;  2QEX F;  2KTU A;  1VQ6 F;  1RLG A;  1W41 A;  3G4S F;  2CZW A;  2VGM A;  3LWO C;  1W40 A;  1K73 H;  1Q82 H;  1E7K A;  3V7Q A;  1KD1 H;  5HY1 A;  2QI2 A;  1YI2 F;  1X52 A;  4EI8 A;  1KQS F;  1VQ5 F;  1CN7 A;  1IPA A;  3RA6 A;  5HXU A;  3NMU C;  1W42 A;  5G4V C;  2F9Z C;  2HVY D;  2FC3 A;  5EWR A;  4BVQ A;  1K9M H;  3CCM F;  5EO3 A;  3PLA C;  1Q7Y H;  3CCR F;  3RA5 A;  3VI6 A;  3LWR C;  4EI7 A;  1K8A H;  3CC2 F;  3VMF B;  3CME F;  1Q81 H;  3CC7 F;  1GZ0 A;  1VQM F;  1X7O A;  5GAP K;  5FLX M;  3NVK E;  5GIO C;  3IR9 A;  2OZB A;  4BVR A;  2WAL A;  3J81 M;  3J7A R;  1ZWZ A;  3CCJ F;  5HXZ A;  3CCE F;  2GLZ A;  5G4U C;  3JAM M;  4NUT A;  3N4Z A;  2OHW A;  2QA4 F;  1XBI A;  1M1K H;  2OTL F;  1RA4 A;  5HY2 A;  2I6D A;  1JJ2 F;  2OTJ F;  3GYQ A;  1VQO F;  3NVI B;  1DT9 A;  5FJ4 C;  5DCV A;  1M90 H;  3HJW C;  3J80 M;  3FFM A;  1VQP F;  3I55 F;  2BO1 A;  1QVG F;  4BW0 B;  3CCV F;  1VQ9 F;  4X3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...