5GIPC

Crystal structure of box c/d rnp with 13 nt guide regions and 11 nt substrates
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
122
structure length
122
Chain Sequence
ASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
total genus 41
structure length 122
sequence length 122
chains with identical sequence D, M, N
ec nomenclature
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5gipC00
3ON1A 2JNBA 2KG4A 2OHWA 1K73H 1M90H 3CCLF 3LWVC 1VQ6F 1VQ5F 1GZ0A 1SDSA 3WXMB 5IT9M 3CCRF 3CD6F 3O85A 1YITF 4NUTA 1YJ9F 5G4UC 1VQ8F 4BW0B 3NK7A 4X3LA 1PXWA 2AIFA 3V7EA 3CCMF 1H7MA 2BO1A 3CCQF 3AGKA 3NK6A 3RA6A 1VQ4F 1VQ9F 5GANK 5GIOC 1VQPF 1YIJF 2LBWA 3I55F 1Q7YH 3CCSF 1RA4A 3GYQA 2QA4F 3N4YA 3G4SF 1CN7A 1YHQF 1XBIA 3NVIB 1Q86H 2OZBA 2LBXA 3SIVA 3LWPC 1X7OA 3CMEF 2QEXF 3CCEF 1VQOF 1RLGA 3E1YA 3SIUA 1NJIH 1NMUB 3CC7F 5FJ4C 3CG6A 1N8RH 1KD1H 3LFOA 5A2QM 1Q82H 1E7KA 3N4ZA 3LWQC 3J7AR 1YJNF 1W2BF 3CXCF 3NVKE 2QI2A 1YJWF 1CK2A 2HVYD 2KTUA 3I56F 1GO1A 1QVGF 2OTJF 3G6EF 3OBYA 3HAXD 1KC8H 4X3MA 3OW2F 3J81M 1K8AH 2VGMA 3FFMA 3MCAB 3CPWF 4BY9D 1VQMF 5DCVA 5EWRA 3J80M 1ZWZA 1DT9A 3CPQA 3IR9A 5G4VC 5GIPC 3RA5A 1KQSF 1VQ7F 3G71F 4LCKA 3CCVF 1W41A 3PAFA 1YI2F 1VQLF 2KTVA 3CC2F 3OBWA 3V7QA 4C4WC 3VI6A 2FC3A 3JCMM 1GO0A 3VMFB 3CCUF 3CMAF 5GINC 1VQNF 1S72F 3NMUC 1Q81H 2ALEA 2WALA 2CZWA 3LWOC 1JJ2F 5FLXM 1QVFF 1W40A 2VGNA 4TZZA 1W3EX 3E20B 2OTLF 3HJWC 1X52A 1M1KH 1IPAA 3CCJF 1K9MH 5GAPK 3CC4F 2I6DA 3JAMM 5EO3A 1T0KB 3LWRC 3PLAC 1VQKF 1X7PA 1W42A
chains in the Genus database with same CATH superfamily
4IHJB 2EWCA 1M90H 3LWVC 4X1YA 1RQ2A 1SDSA 5IT9M 3RYHA 1W55A 2AIZP 2VXYA 2HP0B 5KX5B 2QTPA 5CA1A 3KJJA 3V7EA 2Z1EA 2BO1A 3CCMF 5LP6C 4TV8A 4I4TA 4I50B 2LBWA 1FNJA 2L26A 5LA6A 1W57A 3JAWA 4E6EA 3I55F 1Q7YH 3FD6A 1RA4A 3CCSF 3G4SF 2UYPA 2ZVZA 3DDNA 1ONIA 1Z5WA 3JAKA 2LBXA 4ZHQB 4BT2A 1X7OA 3ZP4A 5LYJB 1VQOF 1NMUB 2HS4A 3ZOPA 2IG8A 5JH7A 3TD3A 3VYSC 1Q82H 3N4ZA 2CHTA 2Q1YA 1YJNF 3J7AR 3NVKE 1JN1A 1CK2A 2HVYD 2VAPA 1J7HA 4C8GA 2FGYA 3I56F 2HX0A 2UYNB 2OTJF 4TV9A 3OBYA 3HAXD 1KC8H 4BVTA 3KJKA 3MBMA 2PHNA 3FD5A 3MCAB 4WBNB 4O4IB 1VH8A 4G4ZA 3VO8A 5EWRA 3S0HA 5CA0B 1DT9A 1UI9A 5J2TB 1QU9A 4LNUA 2BTUA 5GONA 5J2TA 5GIPC 3M4SA 4EI7A 3HKEB 1FFXA 4NQ3A 4LCKA 3CCVF 3LDTA 4ZHQA 1IV4A 3ERNA 1R1MA 4PWTA 3IEQA 3QUWA 4ZK7A 2UYNA 3WGNA 3HKCA 3JCMM 4O4HB 4X20A 1SA0A 3WPXA 5LP6A 4I55B 5LXTA 4TV8B 3RE3A 3B6NA 1PF5A 1IV1A 3HKBB 5MN6A 2NMUA 1IV2A 1ODEA 5BMVA 4DRXB 3TD4A 3C9UA 3MCQA 5FLXM 1JJ2F 1W40A 4TZZA 4O4JB 1W3EX 3E20B 2OTLF 4U3JA 4KWEA 1X52A 3JARB 2BTQB 1M1KH 4B46A 1IPAA 2I6DA 5GONB 1SA0B 3LWRC 1YGYA 3U0OA 1QAHA 3ON1A 2DYYA 2JNBA 1JY8A 2YYEA 3UT5B 1VQ6F 3HKDB 1FNKA 4IIJA 5MN5A 3VIUA 1YITF 4NUTA 4EB6B 1YJ9F 4BW0B 3NK7A 3I3FA 3N2KB 3VTIC 4LNUB 4G4YA 3CCQF 3AGKA 3JASB 1U3LA 2ZVYA 5GANK 1VQPF 2YXZA 1YIJF 2VAWA 5HP8A 1U3PA 3GYQA 2F9ZC 1W581 3HKDA 4IIJB 2OZBA 3SIVA 3GHZA 2CHSA 3K0TA 2QEXF 3E1YA 3N2GA 5EYPB 3RYCB 5A2QM 3WJRA 3LWQC 2ZOVA 3CXCF 3T80A 2QI2A 3N2KA 5HY4A 1VK3A 1YJWF 3F0GA 3VYTC 2KTUA 3V3TA 1GO1A 1JFFA 2HP0A 2CWJA 4O4LB 3UT5A 4X3MA 3OW2F 3J81M 1K8AH 1OFUA 2R751 3JAWB 3CPWF 3D00A 5DCVA 5CB4B 3J80M 4YJ2B 1ZWZA 3M1XA 3WPWA 1KNKA 3IKFA 5JVDA 1GX1A 1IV3A 2Z1TA 3ZO8A 1VQ7F 2G9IA 3JALB 1XHOA 1YI2F 3S06A 2ZAUA 1VQLF 4G88A 4O4LA 5EB1B 1JFFB 3MQWA 5LA6B 3BYQA 2FC3A 3RYFA 3VMFB 3RYIA 3VOAA 3WGMA 5IJ0A 3I7TA 1W59A 3FBAA 4U39A 5GINC 3RYCA 2HS3A 5KX5A 4BT7A 5LOVB 3L7QA 4X1IA 1S72F 3N2GB 3HKCB 3NMUC 1Q81H 3WGJA 5MN4A 1YQNA 5C8YA 5C8YB 3LWOC 2Q1XA 5KMGB 2DT4A 5EZYB 3HJWC 3S02A 4NWOB 5HXUA 3CCJF 5IYZB 5EAZA 2RHOA 1K9MH 5GAPK 4RQOA 2H6LA 4O2AB 4BT3A 3WGLA 2IAFA 3E22B 1T0KB 4F6RA 3PLAC 1H47A 5LYJA 1COMA 5CB4A 3JATB 2ALEA 1CLIA 3R0PA 1W42A 4U3JB 4O4JA 5FNVA 2OHWA 4B45A 2GLZA 3CCLF 1VQ5F 1GZ0A 5JCOC 4BVRA 2H8EA 3LYBA 2IQQA 4G4VA 2Z01A 1PXWA 1DBFA 4I4TB 3KE1A 3FPIA 3NK6A 3RA6A 3KIZA 1VQ9F 3HWUA 5GIOC 3RYFB 2HQSC 2ZODA 4HNAA 2HRUA 1CN7A 3QHDA 3N4YA 5EYPA 5HY2A 3C9SA 3P4EA 2CSLA 4O2BA 1TVKA 3CCEF 4B62A 3CMEF 2Z1FA 5JQGB 3SIUA 2RHLA 1NJIH 5JVDB 3CC7F 1UFYA 1N8RH 1KD1H 1W2BF 4C81A 5HY1A 1H48A 1W5FA 3Q8HA 2RHHA 3G6EF 3K14A 3EORA 1RLUA 2VGMA 3FFMA 1SZQA 3VYUC 1VQMF 4ZHWA 3ZP7A 3HKEA 3E22A 2HP3A 4EI9A 1W5EA 5LOVA 1KNJA 1XRGA 3JASA 4FFBB 3CYPB 5CA0A 4TUYB 5HY0A 3WJQA 3C9TA 3RA5A 5ITZB 3G71F 1T0AA 1VHAA 2R6R1 4WBNA 5JCOA 1W41A 3PAFA 2GZLA 3D54A 3CC2F 3OBWA 4C4WC 3CB2A 1JD1A 1GO0A 3CCUF 3S0WA 1OAPA 1TUBA 3CMAF 3F0DA 2CVLA 4RHAA 5EB0A 1VQNF 5LXTB 4C8IA 1U40A 1QD9A 3S0YA 4DRXA 3P10A 4O2BB 2VAMA 3M84A 1QVFF 4X1KB 2UYJA 3HTNA 4R40B 4IHJA 5BMVB 3P0ZA 1RQ7A 4XCQA 4EI8A 4ZHYB 1NQ3A 2LCAA 1W5AA 2V9YA 3WGKA 3CC4F 4TUYA 3C8LA 3JAMM 5EO3A 4I55A 5CA1B 2KGWA 3WJPA 1VQKF 3D01A 2KG4A 1K73H 3WXMB 3CCRF 2MQEA 2UYKA 3CD6F 2RB9A 3O85A 3VCZA 3HKBA 2PMPA 3F6MA 5G4UC 1VQ8F 4X3LA 4F6RB 2AIFA 1H7MA 1TUBB 1VQ4F 5EIBD 3C9RA 5HWEA 2W8BC 4O4IA 2QA4F 4EB6A 1YHQF 5KMGA 1XBIA 3NVIB 1Q86H 3F0FA 5IJ9B 1W5BA 4TV9B 4ZOLB 3LWPC 2K1SA 4DXDA 1RLGA 2HS0A 3K12A 3ESJA 4HNAB 2I6RA 5FJ4C 3CG6A 3VOBA 3LFOA 1E7KA 4BVSA 2H8CA 3ELCA 4YJ2A 4BT6A 3CYQA 5J2UA 1QVGF 3TD5A 1TVKB 3IMPA 3JAKB 3RYHB 2UZHA 4BY9D 2ZF8A 2B33A 3OONA 4G4WA 2HRYA 4BT4A 5HP7A 4I50A 5HXZA 3CPQA 3IR9A 1X25A 5G4VC 5LP6B 1U43A 5JQGA 2Z1UA 1KQSF 4O4HA 4X20B 4C82A 5IYZA 3IEWA 1Z5VA 4X1KA 5B8FA 4M8IA 3MDOA 4ZOLA 5IJ9A 2CW4A 3JVHA 1VQVA 2AMTA 2KTVA 4X1YB 3JATA 5J2UB 3V7QA 5FNVB 3VI6A 1FFXB 2BTOA 5ITZA 2P6YA 2LBTA 4BVQA 4YJ3A 1Q8RA 2RHJA 2WALA 3DC2A 2CZWA 3V4DA 3GTZA 2VGNA 4ZI7A 4ZHVA 3K2XA 2OTMA 3QTYA 3LMEA 4YJ3B 1XV2A 3IKEA 3JALA 4C8EA 4ERHA 4O2AA 3S03A 1FSZA 4G4XA 4X1IB 4FFBA 3F0EA 3KHNA 5EIBC 2GVIA 4BT5A 5JH7B 5AVMA 4B5CA 5IJ0B 5EZYA 2N48A 4ZI7B 3JARA 3RYIB 1X7PA
chains in the Genus database with same CATH topology
3ON1A 2JNBA 2KG4A 2OHWA 1K73H 2GLZA 3CCLF 3LWVC 1M90H 1VQ5F 1GZ0A 1VQ6F 1SDSA 3WXMB 5IT9M 3CCRF 3CD6F 3O85A 4BVRA 1YITF 4NUTA 1YJ9F 5G4UC 1VQ8F 4BW0B 3NK7A 4X3LA 1PXWA 2AIFA 3V7EA 3CCMF 1H7MA 2BO1A 3CCQF 3AGKA 3NK6A 3RA6A 1VQ4F 1VQ9F 5HWEA 5GANK 5GIOC 1VQPF 1YIJF 2LBWA 3I55F 1Q7YH 3CCSF 1RA4A 3GYQA 2QA4F 3N4YA 3G4SF 1CN7A 5HY2A 1YHQF 1XBIA 3NVIB 2F9ZC 1Q86H 2OZBA 2LBXA 3SIVA 3LWPC 1X7OA 3CMEF 2QEXF 3CCEF 1VQOF 1RLGA 3E1YA 3SIUA 1NJIH 1NMUB 3CC7F 5FJ4C 3CG6A 1N8RH 1KD1H 3LFOA 5A2QM 1Q82H 1E7KA 3N4ZA 3LWQC 3J7AR 1YJNF 1W2BF 3CXCF 4BVSA 3NVKE 2QI2A 5HY1A 5HY4A 1YJWF 1CK2A 2HVYD 2KTUA 2FGYA 3V3TA 3I56F 1GO1A 1QVGF 2OTJF 3G6EF 3OBYA 3HAXD 1KC8H 4X3MA 4BVTA 3J81M 3OW2F 2VGMA 1K8AH 3FFMA 3MCAB 3CPWF 4BY9D 1VQMF 3D00A 5DCVA 5EWRA 3J80M 4EI9A 1ZWZA 1DT9A 5HXZA 3CPQA 3IR9A 5G4VC 5GIPC 5HY0A 4EI7A 3RA5A 1KQSF 1VQ7F 3G71F 4NQ3A 4LCKA 3CCVF 1W41A 3PAFA 1YI2F 1VQLF 2KTVA 3CC2F 3OBWA 3V7QA 4C4WC 3VI6A 2FC3A 3JCMM 1GO0A 3VMFB 3CCUF 3CMAF 5GINC 1VQNF 4BVQA 1S72F 3NMUC 1Q81H 2ALEA 2WALA 2CZWA 3LWOC 1JJ2F 5FLXM 1QVFF 1W40A 2VGNA 4TZZA 1W3EX 3E20B 2OTLF 3HJWC 1X52A 4XCQA 1M1KH 1IPAA 4EI8A 5HXUA 3CCJF 1K9MH 5GAPK 3CC4F 2I6DA 3JAMM 5EO3A 1T0KB 3LWRC 3PLAC 1VQKF 1X7PA 1W42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ON1 A;  2JNB A;  2KG4 A;  2OHW A;  1K73 H;  1M90 H;  3CCL F;  3LWV C;  1VQ6 F;  1VQ5 F;  1GZ0 A;  1SDS A;  3WXM B;  5IT9 M;  3CCR F;  3CD6 F;  3O85 A;  1YIT F;  4NUT A;  1YJ9 F;  5G4U C;  1VQ8 F;  4BW0 B;  3NK7 A;  4X3L A;  1PXW A;  2AIF A;  3V7E A;  3CCM F;  1H7M A;  2BO1 A;  3CCQ F;  3AGK A;  3NK6 A;  3RA6 A;  1VQ4 F;  1VQ9 F;  5GAN K;  5GIO C;  1VQP F;  1YIJ F;  2LBW A;  3I55 F;  1Q7Y H;  3CCS F;  1RA4 A;  3GYQ A;  2QA4 F;  3N4Y A;  3G4S F;  1CN7 A;  1YHQ F;  1XBI A;  3NVI B;  1Q86 H;  2OZB A;  2LBX A;  3SIV A;  3LWP C;  1X7O A;  3CME F;  2QEX F;  3CCE F;  1VQO F;  1RLG A;  3E1Y A;  3SIU A;  1NJI H;  1NMU B;  3CC7 F;  5FJ4 C;  3CG6 A;  1N8R H;  1KD1 H;  3LFO A;  5A2Q M;  1Q82 H;  1E7K A;  3N4Z A;  3LWQ C;  3J7A R;  1YJN F;  1W2B F;  3CXC F;  3NVK E;  2QI2 A;  1YJW F;  1CK2 A;  2HVY D;  2KTU A;  3I56 F;  1GO1 A;  1QVG F;  2OTJ F;  3G6E F;  3OBY A;  3HAX D;  1KC8 H;  4X3M A;  3OW2 F;  3J81 M;  1K8A H;  2VGM A;  3FFM A;  3MCA B;  3CPW F;  4BY9 D;  1VQM F;  5DCV A;  5EWR A;  3J80 M;  1ZWZ A;  1DT9 A;  3CPQ A;  3IR9 A;  5G4V C;  5GIP C;  3RA5 A;  1KQS F;  1VQ7 F;  3G71 F;  4LCK A;  3CCV F;  1W41 A;  3PAF A;  1YI2 F;  1VQL F;  2KTV A;  3CC2 F;  3OBW A;  3V7Q A;  4C4W C;  3VI6 A;  2FC3 A;  3JCM M;  1GO0 A;  3VMF B;  3CCU F;  3CMA F;  5GIN C;  1VQN F;  1S72 F;  3NMU C;  1Q81 H;  2ALE A;  2WAL A;  2CZW A;  3LWO C;  1JJ2 F;  5FLX M;  1QVF F;  1W40 A;  2VGN A;  4TZZ A;  1W3E X;  3E20 B;  2OTL F;  3HJW C;  1X52 A;  1M1K H;  1IPA A;  3CCJ F;  1K9M H;  5GAP K;  3CC4 F;  2I6D A;  3JAM M;  5EO3 A;  1T0K B;  3LWR C;  3PLA C;  1VQK F;  1X7P A;  1W42 A; 
#chains in the Genus database with same CATH topology
 4IHJ B;  2EWC A;  1M90 H;  3LWV C;  4X1Y A;  1RQ2 A;  1SDS A;  5IT9 M;  3RYH A;  1W55 A;  2AIZ P;  2VXY A;  2HP0 B;  5KX5 B;  2QTP A;  5CA1 A;  3KJJ A;  3V7E A;  2Z1E A;  2BO1 A;  3CCM F;  5LP6 C;  4TV8 A;  4I4T A;  4I50 B;  2LBW A;  1FNJ A;  2L26 A;  5LA6 A;  1W57 A;  3JAW A;  4E6E A;  3I55 F;  1Q7Y H;  3FD6 A;  1RA4 A;  3CCS F;  3G4S F;  2UYP A;  2ZVZ A;  3DDN A;  1ONI A;  1Z5W A;  3JAK A;  2LBX A;  4ZHQ B;  4BT2 A;  1X7O A;  3ZP4 A;  5LYJ B;  1VQO F;  1NMU B;  2HS4 A;  3ZOP A;  2IG8 A;  5JH7 A;  3TD3 A;  3VYS C;  1Q82 H;  3N4Z A;  2CHT A;  2Q1Y A;  1YJN F;  3J7A R;  3NVK E;  1JN1 A;  1CK2 A;  2HVY D;  2VAP A;  1J7H A;  4C8G A;  2FGY A;  3I56 F;  2HX0 A;  2UYN B;  2OTJ F;  4TV9 A;  3OBY A;  3HAX D;  1KC8 H;  4BVT A;  3KJK A;  3MBM A;  2PHN A;  3FD5 A;  3MCA B;  4WBN B;  4O4I B;  1VH8 A;  4G4Z A;  3VO8 A;  5EWR A;  3S0H A;  5CA0 B;  1DT9 A;  1UI9 A;  5J2T B;  1QU9 A;  4LNU A;  2BTU A;  5GON A;  5J2T A;  5GIP C;  3M4S A;  4EI7 A;  3HKE B;  1FFX A;  4NQ3 A;  4LCK A;  3CCV F;  3LDT A;  4ZHQ A;  1IV4 A;  3ERN A;  1R1M A;  4PWT A;  3IEQ A;  3QUW A;  4ZK7 A;  2UYN A;  3WGN A;  3HKC A;  3JCM M;  4O4H B;  4X20 A;  1SA0 A;  3WPX A;  5LP6 A;  4I55 B;  5LXT A;  4TV8 B;  3RE3 A;  3B6N A;  1PF5 A;  1IV1 A;  3HKB B;  5MN6 A;  2NMU A;  1IV2 A;  1ODE A;  5BMV A;  4DRX B;  3TD4 A;  3C9U A;  3MCQ A;  5FLX M;  1JJ2 F;  1W40 A;  4TZZ A;  4O4J B;  1W3E X;  3E20 B;  2OTL F;  4U3J A;  4KWE A;  1X52 A;  3JAR B;  2BTQ B;  1M1K H;  4B46 A;  1IPA A;  2I6D A;  5GON B;  1SA0 B;  3LWR C;  1YGY A;  3U0O A;  1QAH A;  3ON1 A;  2DYY A;  2JNB A;  1JY8 A;  2YYE A;  3UT5 B;  1VQ6 F;  3HKD B;  1FNK A;  4IIJ A;  5MN5 A;  3VIU A;  1YIT F;  4NUT A;  4EB6 B;  1YJ9 F;  4BW0 B;  3NK7 A;  3I3F A;  3N2K B;  3VTI C;  4LNU B;  4G4Y A;  3CCQ F;  3AGK A;  3JAS B;  1U3L A;  2ZVY A;  5GAN K;  1VQP F;  2YXZ A;  1YIJ F;  2VAW A;  5HP8 A;  1U3P A;  3GYQ A;  2F9Z C;  1W58 1;  3HKD A;  4IIJ B;  2OZB A;  3SIV A;  3GHZ A;  2CHS A;  3K0T A;  2QEX F;  3E1Y A;  3N2G A;  5EYP B;  3RYC B;  5A2Q M;  3WJR A;  3LWQ C;  2ZOV A;  3CXC F;  3T80 A;  2QI2 A;  3N2K A;  5HY4 A;  1VK3 A;  1YJW F;  3F0G A;  3VYT C;  2KTU A;  3V3T A;  1GO1 A;  1JFF A;  2HP0 A;  2CWJ A;  4O4L B;  3UT5 A;  4X3M A;  3OW2 F;  3J81 M;  1K8A H;  1OFU A;  2R75 1;  3JAW B;  3CPW F;  3D00 A;  5DCV A;  5CB4 B;  3J80 M;  4YJ2 B;  1ZWZ A;  3M1X A;  3WPW A;  1KNK A;  3IKF A;  5JVD A;  1GX1 A;  1IV3 A;  2Z1T A;  3ZO8 A;  1VQ7 F;  2G9I A;  3JAL B;  1XHO A;  1YI2 F;  3S06 A;  2ZAU A;  1VQL F;  4G88 A;  4O4L A;  5EB1 B;  1JFF B;  3MQW A;  5LA6 B;  3BYQ A;  2FC3 A;  3RYF A;  3VMF B;  3RYI A;  3VOA A;  3WGM A;  5IJ0 A;  3I7T A;  1W59 A;  3FBA A;  4U39 A;  5GIN C;  3RYC A;  2HS3 A;  5KX5 A;  4BT7 A;  5LOV B;  3L7Q A;  4X1I A;  1S72 F;  3N2G B;  3HKC B;  3NMU C;  1Q81 H;  3WGJ A;  5MN4 A;  1YQN A;  5C8Y A;  5C8Y B;  3LWO C;  2Q1X A;  5KMG B;  2DT4 A;  5EZY B;  3HJW C;  3S02 A;  4NWO B;  5HXU A;  3CCJ F;  5IYZ B;  5EAZ A;  2RHO A;  1K9M H;  5GAP K;  4RQO A;  2H6L A;  4O2A B;  4BT3 A;  3WGL A;  2IAF A;  3E22 B;  1T0K B;  4F6R A;  3PLA C;  1H47 A;  5LYJ A;  1COM A;  5CB4 A;  3JAT B;  2ALE A;  1CLI A;  3R0P A;  1W42 A;  4U3J B;  4O4J A;  5FNV A;  2OHW A;  4B45 A;  2GLZ A;  3CCL F;  1VQ5 F;  1GZ0 A;  5JCO C;  4BVR A;  2H8E A;  3LYB A;  2IQQ A;  4G4V A;  2Z01 A;  1PXW A;  1DBF A;  4I4T B;  3KE1 A;  3FPI A;  3NK6 A;  3RA6 A;  3KIZ A;  1VQ9 F;  3HWU A;  5GIO C;  3RYF B;  2HQS C;  2ZOD A;  4HNA A;  2HRU A;  1CN7 A;  3QHD A;  3N4Y A;  5EYP A;  5HY2 A;  3C9S A;  3P4E A;  2CSL A;  4O2B A;  1TVK A;  3CCE F;  4B62 A;  3CME F;  2Z1F A;  5JQG B;  3SIU A;  2RHL A;  1NJI H;  5JVD B;  3CC7 F;  1UFY A;  1N8R H;  1KD1 H;  1W2B F;  4C81 A;  5HY1 A;  1H48 A;  1W5F A;  3Q8H A;  2RHH A;  3G6E F;  3K14 A;  3EOR A;  1RLU A;  2VGM A;  3FFM A;  1SZQ A;  3VYU C;  1VQM F;  4ZHW A;  3ZP7 A;  3HKE A;  3E22 A;  2HP3 A;  4EI9 A;  1W5E A;  5LOV A;  1KNJ A;  1XRG A;  3JAS A;  4FFB B;  3CYP B;  5CA0 A;  4TUY B;  5HY0 A;  3WJQ A;  3C9T A;  3RA5 A;  5ITZ B;  3G71 F;  1T0A A;  1VHA A;  2R6R 1;  4WBN A;  5JCO A;  1W41 A;  3PAF A;  2GZL A;  3D54 A;  3CC2 F;  3OBW A;  4C4W C;  3CB2 A;  1JD1 A;  1GO0 A;  3CCU F;  3S0W A;  1OAP A;  1TUB A;  3CMA F;  3F0D A;  2CVL A;  4RHA A;  5EB0 A;  1VQN F;  5LXT B;  4C8I A;  1U40 A;  1QD9 A;  3S0Y A;  4DRX A;  3P10 A;  4O2B B;  2VAM A;  3M84 A;  1QVF F;  4X1K B;  2UYJ A;  3HTN A;  4R40 B;  4IHJ A;  5BMV B;  3P0Z A;  1RQ7 A;  4XCQ A;  4EI8 A;  4ZHY B;  1NQ3 A;  2LCA A;  1W5A A;  2V9Y A;  3WGK A;  3CC4 F;  4TUY A;  3C8L A;  3JAM M;  5EO3 A;  4I55 A;  5CA1 B;  2KGW A;  3WJP A;  1VQK F;  3D01 A;  2KG4 A;  1K73 H;  3WXM B;  3CCR F;  2MQE A;  2UYK A;  3CD6 F;  2RB9 A;  3O85 A;  3VCZ A;  3HKB A;  2PMP A;  3F6M A;  5G4U C;  1VQ8 F;  4X3L A;  4F6R B;  2AIF A;  1H7M A;  1TUB B;  1VQ4 F;  5EIB D;  3C9R A;  5HWE A;  2W8B C;  4O4I A;  2QA4 F;  4EB6 A;  1YHQ F;  5KMG A;  1XBI A;  3NVI B;  1Q86 H;  3F0F A;  5IJ9 B;  1W5B A;  4TV9 B;  4ZOL B;  3LWP C;  2K1S A;  4DXD A;  1RLG A;  2HS0 A;  3K12 A;  3ESJ A;  4HNA B;  2I6R A;  5FJ4 C;  3CG6 A;  3VOB A;  3LFO A;  1E7K A;  4BVS A;  2H8C A;  3ELC A;  4YJ2 A;  4BT6 A;  3CYQ A;  5J2U A;  1QVG F;  3TD5 A;  1TVK B;  3IMP A;  3JAK B;  3RYH B;  2UZH A;  4BY9 D;  2ZF8 A;  2B33 A;  3OON A;  4G4W A;  2HRY A;  4BT4 A;  5HP7 A;  4I50 A;  5HXZ A;  3CPQ A;  3IR9 A;  1X25 A;  5G4V C;  5LP6 B;  1U43 A;  5JQG A;  2Z1U A;  1KQS F;  4O4H A;  4X20 B;  4C82 A;  5IYZ A;  3IEW A;  1Z5V A;  4X1K A;  5B8F A;  4M8I A;  3MDO A;  4ZOL A;  5IJ9 A;  2CW4 A;  3JVH A;  1VQV A;  2AMT A;  2KTV A;  4X1Y B;  3JAT A;  5J2U B;  3V7Q A;  5FNV B;  3VI6 A;  1FFX B;  2BTO A;  5ITZ A;  2P6Y A;  2LBT A;  4BVQ A;  4YJ3 A;  1Q8R A;  2RHJ A;  2WAL A;  3DC2 A;  2CZW A;  3V4D A;  3GTZ A;  2VGN A;  4ZI7 A;  4ZHV A;  3K2X A;  2OTM A;  3QTY A;  3LME A;  4YJ3 B;  1XV2 A;  3IKE A;  3JAL A;  4C8E A;  4ERH A;  4O2A A;  3S03 A;  1FSZ A;  4G4X A;  4X1I B;  4FFB A;  3F0E A;  3KHN A;  5EIB C;  2GVI A;  4BT5 A;  5JH7 B;  5AVM A;  4B5C A;  5IJ0 B;  5EZY A;  2N48 A;  4ZI7 B;  3JAR A;  3RYI B;  1X7P A; 
#chains in the Genus database with same CATH homology
 3ON1 A;  2JNB A;  2KG4 A;  2OHW A;  1K73 H;  2GLZ A;  3CCL F;  3LWV C;  1M90 H;  1VQ5 F;  1GZ0 A;  1VQ6 F;  1SDS A;  3WXM B;  5IT9 M;  3CCR F;  3CD6 F;  3O85 A;  4BVR A;  1YIT F;  4NUT A;  1YJ9 F;  5G4U C;  1VQ8 F;  4BW0 B;  3NK7 A;  4X3L A;  1PXW A;  2AIF A;  3V7E A;  3CCM F;  1H7M A;  2BO1 A;  3CCQ F;  3AGK A;  3NK6 A;  3RA6 A;  1VQ4 F;  1VQ9 F;  5HWE A;  5GAN K;  5GIO C;  1VQP F;  1YIJ F;  2LBW A;  3I55 F;  1Q7Y H;  3CCS F;  1RA4 A;  3GYQ A;  2QA4 F;  3N4Y A;  3G4S F;  1CN7 A;  5HY2 A;  1YHQ F;  1XBI A;  3NVI B;  2F9Z C;  1Q86 H;  2OZB A;  2LBX A;  3SIV A;  3LWP C;  1X7O A;  3CME F;  2QEX F;  3CCE F;  1VQO F;  1RLG A;  3E1Y A;  3SIU A;  1NJI H;  1NMU B;  3CC7 F;  5FJ4 C;  3CG6 A;  1N8R H;  1KD1 H;  3LFO A;  5A2Q M;  1Q82 H;  1E7K A;  3N4Z A;  3LWQ C;  3J7A R;  1YJN F;  1W2B F;  3CXC F;  4BVS A;  3NVK E;  2QI2 A;  5HY1 A;  5HY4 A;  1YJW F;  1CK2 A;  2HVY D;  2KTU A;  2FGY A;  3V3T A;  3I56 F;  1GO1 A;  1QVG F;  2OTJ F;  3G6E F;  3OBY A;  3HAX D;  1KC8 H;  4X3M A;  4BVT A;  3J81 M;  3OW2 F;  2VGM A;  1K8A H;  3FFM A;  3MCA B;  3CPW F;  4BY9 D;  1VQM F;  3D00 A;  5DCV A;  5EWR A;  3J80 M;  4EI9 A;  1ZWZ A;  1DT9 A;  5HXZ A;  3CPQ A;  3IR9 A;  5G4V C;  5GIP C;  5HY0 A;  4EI7 A;  3RA5 A;  1KQS F;  1VQ7 F;  3G71 F;  4NQ3 A;  4LCK A;  3CCV F;  1W41 A;  3PAF A;  1YI2 F;  1VQL F;  2KTV A;  3CC2 F;  3OBW A;  3V7Q A;  4C4W C;  3VI6 A;  2FC3 A;  3JCM M;  1GO0 A;  3VMF B;  3CCU F;  3CMA F;  5GIN C;  1VQN F;  4BVQ A;  1S72 F;  3NMU C;  1Q81 H;  2ALE A;  2WAL A;  2CZW A;  3LWO C;  1JJ2 F;  5FLX M;  1QVF F;  1W40 A;  2VGN A;  4TZZ A;  1W3E X;  3E20 B;  2OTL F;  3HJW C;  1X52 A;  4XCQ A;  1M1K H;  1IPA A;  4EI8 A;  5HXU A;  3CCJ F;  1K9M H;  5GAP K;  3CC4 F;  2I6D A;  3JAM M;  5EO3 A;  1T0K B;  3LWR C;  3PLA C;  1VQK F;  1X7P A;  1W42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...