2HX0A

Three-dimensional structure of the hypothetical protein from salmonella cholerae-suis (aka salmonella enterica) at the resolution 1.55 a. northeast structural genomics target scr59.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
138
Chain Sequence
HHNASTARFYALRLLPGQEVFSQLHAFVQQNQLRAAWIAGCTGSLTDVALRYAGQEATTSLTGTFEVISLNGTLELTGEHLHLAVSDPYGVMLGGHMMPGCTVRTTLELVIGELPALTFSRQPCAISGYDELHISSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the hypothetical protein from Salmonella cholerae-suis (aka Salmonella enterica) at the resolution 1.55 A. Northeast Structural Genomics target ScR59.
rcsb
source organism Salmonella choleraesuis
molecule tags Dna binding protein
molecule keywords Putative DNA-binding protein
total genus 33
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03479 DUF296 Plants and Prokaryotes Conserved (PCC) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.80 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Hypothetical protein, similar to alpha- acetolactate decarboxylase; domain 2 2hx0A01
2NMUA 2P6YA 1XV2A 3HTNA 4BT6A 4BT3A 2DT4A 4BT4A 4BT5A 2HX0A 3HWUA 2H6LA 4BT7A 4BT2A
chains in the Genus database with same CATH superfamily
3F6MA 3VYSC 3C8LA 3JARA 3OONA 5EB1B 3LWPC 2VGMA 2YYEA 3HWUA 3S0YA 3C9RA 5DCVA 2KTUA 2HS3A 4TV8B 1RQ7A 3I3FA 4LNUA 3NMUC 2EWCA 1YIJF 2ZVZA 1T0AA 5EO3A 1W5EA 3JVHA 4ZHQB 1Z5WA 5FLXM 1VQNF 3CCRF 1SA0B 5CA1A 5C8YB 3I55F 3S06A 3LWOC 1FNJA 5LOVA 4I55A 4C81A 3LWQC 3FD6A 3CCSF 3C9UA 1CLIA 1SZQA 5HY2A 4O4LB 4O2BB 5IYZB 4EI8A 1OFUA 5CA0B 1JFFA 4ZHYB 2HS4A 3F0DA 3O85A 1X52A 3CCVF 3WXMB 5G4UC 3HKBB 3JAWA 5HP8A 5HY0A 4TUYA 3WGKA 4U3JA 3QTYA 3N2GA 2AIZP 4IHJB 5J2TA 1VQMF 5MN6A 5CB4B 2VXYA 4BVSA 1KNKA 3M4SA 3RYFB 3V3TA 2VAWA 3UT5B 5KMGA 2BTQB 2OTJF 5LYJB 1DBFA 3JATA 2HS0A 2UZHA 1KD1H 3F0FA 3D00A 4EB6A 3RYCB 3JAKA 2W8BC 2CWJA 2FGYA 3C9TA 3F0EA 2HP0B 2LBWA 2F9ZC 1VQLF 2I6DA 3I56F 4X1IB 2IAFA 1VQ6F 3JAKB 4EI7A 3LMEA 1JY8A 5C8YA 3B6NA 2HRYA 5JH7B 3T80A 4I4TA 1CN7A 3TD5A 2QI2A 5IJ9B 5IJ0A 5JQGA 3CMEF 1YGYA 3GHZA 3CCMF 3KE1A 4O4HA 4BT4A 5GANK 3HJWC 1PXWA 3J7AR 4U39A 3WGJA 3HKBA 2K1SA 1N8RH 1QD9A 3K12A 3HKCA 4I50A 5A2QM 1U3LA 2HRUA 5HWEA 2CSLA 2GZLA 4HNAB 4X3LA 5AVMA 3ERNA 3Q8HA 1X7OA 4EI9A 3QHDA 3JATB 4F6RA 4M8IA 1K73H 1W5BA 1H7MA 5FNVA 3U0OA 5HXUA 5GONB 2BO1A 3RYIB 5GONA 2V9YA 4LNUB 4EB6B 3JALB 2UYNA 1IPAA 2ALEA 5BMVB 5JCOA 1T0KB 5JVDA 3G6EF 3VMFB 5ITZA 3E22A 5LXTB 4ZI7B 5EB0A 5LP6C 3ELCA 1NMUB 3RYCA 5LA6A 2Z1FA 3LDTA 1Q81H 2OTLF 2CHTA 2KG4A 3RA5A 3TD4A 2GVIA 2ZOVA 4C82A 1S72F 3P4EA 3VTIC 1ZWZA 2LCAA 1U43A 3FBAA 3MQWA 4C8IA 4BVTA 3E20B 4TV9B 2DYYA 2RB9A 2CVLA 2Z1EA 4NQ3A 3S02A 5G4VC 3IEQA 5EZYA 3SIVA 5LYJA 3PAFA 1JD1A 4G88A 1W5FA 3WGNA 2UYKA 2VAMA 4G4WA 3S0WA 3LYBA 1VQ4F 2FC3A 2WALA 4TUYB 1YI2F 4X20A 3OW2F 1ONIA 5HY4A 1JN1A 4DRXA 3VYTC 2BTUA 1K8AH 1DT9A 1W59A 4RHAA 1TUBB 5BMVA 1K9MH 3VIUA 3D54A 5LOVB 5EIBD 2CZWA 2QEXF 4C8GA 3NK6A 3G71F 1VH8A 2UYPA 3VO8A 1VQ8F 3S03A 2QA4F 3TD3A 1QVFF 3J80M 1TVKB 4ZK7A 4X1YB 1PF5A 4FFBA 4ZHVA 4YJ3A 4WBNB 3DC2A 5FJ4C 4BT6A 5CA0A 5MN5A 3N2KA 3V4DA 4B46A 2HQSC 2Q1XA 1XHOA 2Z1TA 3D01A 3CPQA 4WBNA 2LBTA 4E6EA 1IV2A 3CYQA 3E1YA 3N2GB 3J81M 3WJQA 1COMA 3BYQA 1U40A 2KTVA 3CB2A 5GIOC 1H47A 3V7QA 3VCZA 3ZP7A 3CMAF 1RLUA 1VQ5F 1VQ7F 5IT9M 3DDNA 1J7HA 4HNAA 3HKEB 4X1KB 3WJRA 4G4XA 5CB4A 4TV8A 1W57A 3C9SA 2HX0A 5J2UA 2CW4A 3F0GA 2KGWA 3WGMA 3CPWF 3HKEA 3VYUC 3HTNA 1VQKF 3KHNA 1VQPF 5HP7A 4IIJA 1KNJA 4C4WC 4DRXB 5HY1A 2P6YA 5LA6B 3WPXA 1M1KH 2G9IA 4BVQA 3K2XA 3MCQA 4YJ2A 3WPWA 2RHJA 3N2KB 2MQEA 5ITZB 2UYJA 2AIFA 1QVGF 3FD5A 4B45A 3CCEF 1FFXA 4O4IB 2JNBA 1FFXB 4O4IA 1VHAA 4BY9D 3N4YA 2VGNA 3CCQF 5IJ0B 3ZO8A 1JJ2F 1W3EX 1Z5VA 3RA6A 2I6RA 3MDOA 1GZ0A 4BVRA 3UT5A 5KMGB 3WJPA 3LWRC 1E7KA 1UFYA 1X7PA 2PMPA 1Q8RA 3CD6F 3I7TA 4PWTA 5EYPA 2Q1YA 3OBYA 2OZBA 3QUWA 3MCAB 2AMTA 5LP6B 3CCJF 1XBIA 2QTPA 5KX5B 3NK7A 5FNVB 4X20B 3HKCB 3E22B 4I50B 3V7EA 5B8FA 4BT5A 3IKEA 4ZOLA 2UYNB 3ZP4A 4ZOLB 5JCOC 3JALA 4G4YA 5JVDB 4O4JA 2R751 3IMPA 1W55A 1Q82H 1VQVA 1M90H 3JAMM 1RLGA 1YITF 3KJJA 4C8EA 2CHSA 2ZAUA 3GYQA 3CC7F 5EIBC 1NQ3A 4I55B 1FSZA 3AGKA 3WGLA 4FFBB 3R0PA 4I4TB 3K14A 5CA1B 5IYZA 1R1MA 4RQOA 1KC8H 3G4SF 4BT3A 1XRGA 2LBXA 2ZVYA 4X3MA 3CXCF 3MBMA 2H8EA 3IKFA 3M1XA 3ZOPA 3RYFA 5GIPC 4ZHWA 2RHHA 3PLAC 5J2TB 4B5CA 2DT4A 3SIUA 2OHWA 2RHOA 1VQ9F 1IV1A 1SDSA 3IR9A 3HKDB 3JARB 1NJIH 1VQOF 3VI6A 1W42A 2H8CA 1CK2A 1QU9A 4F6RB 4IHJA 2HP0A 2L26A 1H48A 2IG8A 1KQSF 5J2UB 3VOAA 1RQ2A 1TUBA 1YHQF 3KJKA 3IEWA 4O4JB 2H6LA 4X1YA 3K0TA 4ZI7A 4O2AB 3RYHB 3ESJA 4O2AA 3RYHA 4O4LA 1IV4A 3CCLF 1OAPA 3P0ZA 4O4HB 4ZHQA 2GLZA 2VAPA 3NVIB 4DXDA 4B62A 1GX1A 1W5AA 4X1IA 4O2BA 1SA0A 3JAWB 5EZYB 3RE3A 1YJNF 1W581 5IJ9A 5JQGB 1RA4A 4KWEA 1GO1A 1W41A 2HVYD 3HKDA 1UI9A 3N4ZA 4YJ3B 5EAZA 3L7QA 1JFFB 1XV2A 3RYIA 4NUTA 3OBWA 3CCUF 3HAXD 3NVKE 2ZODA 1X25A 4X1KA 1YJ9F 4U3JB 3ON1A 3KIZA 2ZF8A 3M84A 1ODEA 3S0HA 4BT2A 1QAHA 2NMUA 1YJWF 2YXZA 2BTOA 5KX5A 2Z01A 1W40A 3EORA 3VOBA 5LXTA 3FPIA 4R40B 5EWRA 1W2BF 1Q86H 5GAPK 2R6R1 2OTMA 3FFMA 2RHLA 4YJ2B 3LFOA 4XCQA 3P10A 1TVKA 3CC4F 1Q7YH 4IIJB 5JH7A 3CC2F 1U3PA 4G4ZA 2B33A 4TV9A 4NWOB 3CYPB 2HP3A 3JASA 1YQNA 4TZZA 3JASB 5GINC 4ERHA 2IQQA 1GO0A 3CG6A 1FNKA 3LWVC 5LP6A 1IV3A 3GTZA 3JCMM 5MN4A 2N48A 2PHNA 2Z1UA 5EYPB 1VK3A 5HXZA 4LCKA 4BW0B 4G4VA 4BT7A
chains in the Genus database with same CATH topology
2NMUA 2P6YA 1XV2A 3HTNA 4BT6A 4BT3A 2DT4A 4BT4A 4BT5A 2HX0A 3HWUA 2H6LA 4BT7A 4BT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NMU A;  2P6Y A;  1XV2 A;  3HTN A;  4BT6 A;  4BT3 A;  2DT4 A;  4BT4 A;  4BT5 A;  2HX0 A;  3HWU A;  2H6L A;  4BT7 A;  4BT2 A; 
#chains in the Genus database with same CATH topology
 3F6M A;  3VYS C;  3C8L A;  3JAR A;  3OON A;  5EB1 B;  3LWP C;  2VGM A;  2YYE A;  3HWU A;  3S0Y A;  3C9R A;  5DCV A;  2KTU A;  2HS3 A;  4TV8 B;  1RQ7 A;  3I3F A;  4LNU A;  3NMU C;  2EWC A;  1YIJ F;  2ZVZ A;  1T0A A;  5EO3 A;  1W5E A;  3JVH A;  4ZHQ B;  1Z5W A;  5FLX M;  1VQN F;  3CCR F;  1SA0 B;  5CA1 A;  5C8Y B;  3I55 F;  3S06 A;  3LWO C;  1FNJ A;  5LOV A;  4I55 A;  4C81 A;  3LWQ C;  3FD6 A;  3CCS F;  3C9U A;  1CLI A;  1SZQ A;  5HY2 A;  4O4L B;  4O2B B;  5IYZ B;  4EI8 A;  1OFU A;  5CA0 B;  1JFF A;  4ZHY B;  2HS4 A;  3F0D A;  3O85 A;  1X52 A;  3CCV F;  3WXM B;  5G4U C;  3HKB B;  3JAW A;  5HP8 A;  5HY0 A;  4TUY A;  3WGK A;  4U3J A;  3QTY A;  3N2G A;  2AIZ P;  4IHJ B;  5J2T A;  1VQM F;  5MN6 A;  5CB4 B;  2VXY A;  4BVS A;  1KNK A;  3M4S A;  3RYF B;  3V3T A;  2VAW A;  3UT5 B;  5KMG A;  2BTQ B;  2OTJ F;  5LYJ B;  1DBF A;  3JAT A;  2HS0 A;  2UZH A;  1KD1 H;  3F0F A;  3D00 A;  4EB6 A;  3RYC B;  3JAK A;  2W8B C;  2CWJ A;  2FGY A;  3C9T A;  3F0E A;  2HP0 B;  2LBW A;  2F9Z C;  1VQL F;  2I6D A;  3I56 F;  4X1I B;  2IAF A;  1VQ6 F;  3JAK B;  4EI7 A;  3LME A;  1JY8 A;  5C8Y A;  3B6N A;  2HRY A;  5JH7 B;  3T80 A;  4I4T A;  1CN7 A;  3TD5 A;  2QI2 A;  5IJ9 B;  5IJ0 A;  5JQG A;  3CME F;  1YGY A;  3GHZ A;  3CCM F;  3KE1 A;  4O4H A;  4BT4 A;  5GAN K;  3HJW C;  1PXW A;  3J7A R;  4U39 A;  3WGJ A;  3HKB A;  2K1S A;  1N8R H;  1QD9 A;  3K12 A;  3HKC A;  4I50 A;  5A2Q M;  1U3L A;  2HRU A;  5HWE A;  2CSL A;  2GZL A;  4HNA B;  4X3L A;  5AVM A;  3ERN A;  3Q8H A;  1X7O A;  4EI9 A;  3QHD A;  3JAT B;  4F6R A;  4M8I A;  1K73 H;  1W5B A;  1H7M A;  5FNV A;  3U0O A;  5HXU A;  5GON B;  2BO1 A;  3RYI B;  5GON A;  2V9Y A;  4LNU B;  4EB6 B;  3JAL B;  2UYN A;  1IPA A;  2ALE A;  5BMV B;  5JCO A;  1T0K B;  5JVD A;  3G6E F;  3VMF B;  5ITZ A;  3E22 A;  5LXT B;  4ZI7 B;  5EB0 A;  5LP6 C;  3ELC A;  1NMU B;  3RYC A;  5LA6 A;  2Z1F A;  3LDT A;  1Q81 H;  2OTL F;  2CHT A;  2KG4 A;  3RA5 A;  3TD4 A;  2GVI A;  2ZOV A;  4C82 A;  1S72 F;  3P4E A;  3VTI C;  1ZWZ A;  2LCA A;  1U43 A;  3FBA A;  3MQW A;  4C8I A;  4BVT A;  3E20 B;  4TV9 B;  2DYY A;  2RB9 A;  2CVL A;  2Z1E A;  4NQ3 A;  3S02 A;  5G4V C;  3IEQ A;  5EZY A;  3SIV A;  5LYJ A;  3PAF A;  1JD1 A;  4G88 A;  1W5F A;  3WGN A;  2UYK A;  2VAM A;  4G4W A;  3S0W A;  3LYB A;  1VQ4 F;  2FC3 A;  2WAL A;  4TUY B;  1YI2 F;  4X20 A;  3OW2 F;  1ONI A;  5HY4 A;  1JN1 A;  4DRX A;  3VYT C;  2BTU A;  1K8A H;  1DT9 A;  1W59 A;  4RHA A;  1TUB B;  5BMV A;  1K9M H;  3VIU A;  3D54 A;  5LOV B;  5EIB D;  2CZW A;  2QEX F;  4C8G A;  3NK6 A;  3G71 F;  1VH8 A;  2UYP A;  3VO8 A;  1VQ8 F;  3S03 A;  2QA4 F;  3TD3 A;  1QVF F;  3J80 M;  1TVK B;  4ZK7 A;  4X1Y B;  1PF5 A;  4FFB A;  4ZHV A;  4YJ3 A;  4WBN B;  3DC2 A;  5FJ4 C;  4BT6 A;  5CA0 A;  5MN5 A;  3N2K A;  3V4D A;  4B46 A;  2HQS C;  2Q1X A;  1XHO A;  2Z1T A;  3D01 A;  3CPQ A;  4WBN A;  2LBT A;  4E6E A;  1IV2 A;  3CYQ A;  3E1Y A;  3N2G B;  3J81 M;  3WJQ A;  1COM A;  3BYQ A;  1U40 A;  2KTV A;  3CB2 A;  5GIO C;  1H47 A;  3V7Q A;  3VCZ A;  3ZP7 A;  3CMA F;  1RLU A;  1VQ5 F;  1VQ7 F;  5IT9 M;  3DDN A;  1J7H A;  4HNA A;  3HKE B;  4X1K B;  3WJR A;  4G4X A;  5CB4 A;  4TV8 A;  1W57 A;  3C9S A;  2HX0 A;  5J2U A;  2CW4 A;  3F0G A;  2KGW A;  3WGM A;  3CPW F;  3HKE A;  3VYU C;  3HTN A;  1VQK F;  3KHN A;  1VQP F;  5HP7 A;  4IIJ A;  1KNJ A;  4C4W C;  4DRX B;  5HY1 A;  2P6Y A;  5LA6 B;  3WPX A;  1M1K H;  2G9I A;  4BVQ A;  3K2X A;  3MCQ A;  4YJ2 A;  3WPW A;  2RHJ A;  3N2K B;  2MQE A;  5ITZ B;  2UYJ A;  2AIF A;  1QVG F;  3FD5 A;  4B45 A;  3CCE F;  1FFX A;  4O4I B;  2JNB A;  1FFX B;  4O4I A;  1VHA A;  4BY9 D;  3N4Y A;  2VGN A;  3CCQ F;  5IJ0 B;  3ZO8 A;  1JJ2 F;  1W3E X;  1Z5V A;  3RA6 A;  2I6R A;  3MDO A;  1GZ0 A;  4BVR A;  3UT5 A;  5KMG B;  3WJP A;  3LWR C;  1E7K A;  1UFY A;  1X7P A;  2PMP A;  1Q8R A;  3CD6 F;  3I7T A;  4PWT A;  5EYP A;  2Q1Y A;  3OBY A;  2OZB A;  3QUW A;  3MCA B;  2AMT A;  5LP6 B;  3CCJ F;  1XBI A;  2QTP A;  5KX5 B;  3NK7 A;  5FNV B;  4X20 B;  3HKC B;  3E22 B;  4I50 B;  3V7E A;  5B8F A;  4BT5 A;  3IKE A;  4ZOL A;  2UYN B;  3ZP4 A;  4ZOL B;  5JCO C;  3JAL A;  4G4Y A;  5JVD B;  4O4J A;  2R75 1;  3IMP A;  1W55 A;  1Q82 H;  1VQV A;  1M90 H;  3JAM M;  1RLG A;  1YIT F;  3KJJ A;  4C8E A;  2CHS A;  2ZAU A;  3GYQ A;  3CC7 F;  5EIB C;  1NQ3 A;  4I55 B;  1FSZ A;  3AGK A;  3WGL A;  4FFB B;  3R0P A;  4I4T B;  3K14 A;  5CA1 B;  5IYZ A;  1R1M A;  4RQO A;  1KC8 H;  3G4S F;  4BT3 A;  1XRG A;  2LBX A;  2ZVY A;  4X3M A;  3CXC F;  3MBM A;  2H8E A;  3IKF A;  3M1X A;  3ZOP A;  3RYF A;  5GIP C;  4ZHW A;  2RHH A;  3PLA C;  5J2T B;  4B5C A;  2DT4 A;  3SIU A;  2OHW A;  2RHO A;  1VQ9 F;  1IV1 A;  1SDS A;  3IR9 A;  3HKD B;  3JAR B;  1NJI H;  1VQO F;  3VI6 A;  1W42 A;  2H8C A;  1CK2 A;  1QU9 A;  4F6R B;  4IHJ A;  2HP0 A;  2L26 A;  1H48 A;  2IG8 A;  1KQS F;  5J2U B;  3VOA A;  1RQ2 A;  1TUB A;  1YHQ F;  3KJK A;  3IEW A;  4O4J B;  2H6L A;  4X1Y A;  3K0T A;  4ZI7 A;  4O2A B;  3RYH B;  3ESJ A;  4O2A A;  3RYH A;  4O4L A;  1IV4 A;  3CCL F;  1OAP A;  3P0Z A;  4O4H B;  4ZHQ A;  2GLZ A;  2VAP A;  3NVI B;  4DXD A;  4B62 A;  1GX1 A;  1W5A A;  4X1I A;  4O2B A;  1SA0 A;  3JAW B;  5EZY B;  3RE3 A;  1YJN F;  1W58 1;  5IJ9 A;  5JQG B;  1RA4 A;  4KWE A;  1GO1 A;  1W41 A;  2HVY D;  3HKD A;  1UI9 A;  3N4Z A;  4YJ3 B;  5EAZ A;  3L7Q A;  1JFF B;  1XV2 A;  3RYI A;  4NUT A;  3OBW A;  3CCU F;  3HAX D;  3NVK E;  2ZOD A;  1X25 A;  4X1K A;  1YJ9 F;  4U3J B;  3ON1 A;  3KIZ A;  2ZF8 A;  3M84 A;  1ODE A;  3S0H A;  4BT2 A;  1QAH A;  2NMU A;  1YJW F;  2YXZ A;  2BTO A;  5KX5 A;  2Z01 A;  1W40 A;  3EOR A;  3VOB A;  5LXT A;  3FPI A;  4R40 B;  5EWR A;  1W2B F;  1Q86 H;  5GAP K;  2R6R 1;  2OTM A;  3FFM A;  2RHL A;  4YJ2 B;  3LFO A;  4XCQ A;  3P10 A;  1TVK A;  3CC4 F;  1Q7Y H;  4IIJ B;  5JH7 A;  3CC2 F;  1U3P A;  4G4Z A;  2B33 A;  4TV9 A;  4NWO B;  3CYP B;  2HP3 A;  3JAS A;  1YQN A;  4TZZ A;  3JAS B;  5GIN C;  4ERH A;  2IQQ A;  1GO0 A;  3CG6 A;  1FNK A;  3LWV C;  5LP6 A;  1IV3 A;  3GTZ A;  3JCM M;  5MN4 A;  2N48 A;  2PHN A;  2Z1U A;  5EYP B;  1VK3 A;  5HXZ A;  4LCK A;  4BW0 B;  4G4V A;  4BT7 A; 
#chains in the Genus database with same CATH homology
 2NMU A;  2P6Y A;  1XV2 A;  3HTN A;  4BT6 A;  4BT3 A;  2DT4 A;  4BT4 A;  4BT5 A;  2HX0 A;  3HWU A;  2H6L A;  4BT7 A;  4BT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...