2HX0A

Three-dimensional structure of the hypothetical protein from salmonella cholerae-suis (aka salmonella enterica) at the resolution 1.55 a. northeast structural genomics target scr59.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
138
Chain Sequence
HHNASTARFYALRLLPGQEVFSQLHAFVQQNQLRAAWIAGCTGSLTDVALRYAGQEATTSLTGTFEVISLNGTLELTGEHLHLAVSDPYGVMLGGHMMPGCTVRTTLELVIGELPALTFSRQPCAISGYDELHISSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Putative DNA-binding protein
publication title Three-dimensional structure of the hypothetical protein from Salmonella cholerae-suis (aka Salmonella enterica) at the resolution 1.55 A. Northeast Structural Genomics target ScR59.
rcsb
source organism Salmonella choleraesuis
total genus 33
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03479 DUF296 Plants and Prokaryotes Conserved (PCC) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.80 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Hypothetical protein, similar to alpha- acetolactate decarboxylase; domain 2 2hx0A01
4BT7A 4BT4A 3HWUA 4BT3A 2NMUA 1XV2A 3HTNA 4BT6A 2DT4A 4BT2A 2H6LA 2P6YA 4BT5A 2HX0A
chains in the Genus database with same CATH superfamily
5LA6A 1VK3A 3RA5A 5C8YB 2IQQA 3OONA 4PWTA 3JAKA 5HY1A 3P0ZA 3C9SA 1VQ9F 1SA0A 1FNJA 3N2KB 3Q8HA 4I55A 4EB6A 3S02A 1ONIA 1UFYA 5HWEA 1KNJA 3RYCB 4EI7A 1H48A 4X20B 1TUBA 1R1MA 2ZVZA 5EZYB 3MDOA 5J2UA 2KG4A 1VQ6F 3N4ZA 5GIOC 4HNAB 1Z5VA 4O4LB 1Z5WA 2CSLA 4BW0B 4F6RB 1DT9A 1GO1A 3E20B 4O2AB 3L7QA 2OZBA 4U3JA 3BYQA 2IAFA 3V4DA 5MN5A 3B6NA 3HKDB 2HVYD 4X3MA 3KJJA 1VQVA 2N48A 1CLIA 3EORA 3HWUA 3FFMA 3LWVC 2P6YA 5JCOA 4WBNB 5HP8A 1VQ8F 2R6R1 4TV9A 5JQGB 5LP6B 3CC4F 3NVKE 5JH7A 2QI2A 1QVFF 3HTNA 1VQ7F 5LOVB 4BT5A 3TD5A 5LYJA 3MBMA 2BTOA 5A2QM 5LA6B 3G71F 3WJRA 3JAKB 3VYTC 3G4SF 3JCMM 4EI9A 3J80M 3JVHA 1Q8RA 1YI2F 1Q86H 2ZVYA 4U39A 2CZWA 3RYIA 5GAPK 3C9RA 4R40B 4I55B 4EB6B 5J2TA 1IPAA 2V9YA 4O4HA 2L26A 5IT9M 4NQ3A 1J7HA 5CB4A 2LBXA 3IKEA 1E7KA 3VYUC 3UT5B 2EWCA 2G9IA 3VOAA 3ZP7A 3LWRC 3ON1A 5B8FA 2CHTA 3HKCA 5FNVA 4BT6A 2H8CA 2JNBA 1RA4A 4FFBA 4NWOB 3ESJA 1YQNA 2YYEA 4X3LA 3VO8A 1X7PA 4O2BA 4E6EA 1GO0A 2K1SA 3DDNA 3QTYA 4YJ2A 4U3JB 4X1YA 3M4SA 1VQ5F 2VAWA 5IJ0A 3D54A 1S72F 3WJPA 2GLZA 1QU9A 1JD1A 1KC8H 4TV9B 3I3FA 3CCQF 5JH7B 3C9TA 1TVKA 2OTLF 5GONB 5LYJB 2UZHA 3JALA 3S0HA 3S0YA 3NMUC 2RB9A 5GINC 3K14A 1U3PA 3S0WA 4DRXA 2FGYA 1IV2A 5JCOC 2F9ZC 5EO3A 4ZOLA 3U0OA 5BMVA 3RYIB 1FSZA 1X52A 5J2TB 4RQOA 1FNKA 5AVMA 3I55F 4O4HB 4XCQA 1Q7YH 3ZOPA 1RQ2A 4TUYB 1KD1H 3T80A 3AGKA 4TV8B 4BY9D 4IIJA 3LMEA 4C8EA 3FD5A 3MCQA 3NK6A 3E22B 5HXUA 3HKCB 2HQSC 2WALA 4G4WA 4FFBB 1W581 5HXZA 4O4JA 1W59A 5MN4A 4LNUA 4YJ2B 3LWOC 1JY8A 2ZOVA 3O85A 5IJ9A 4G88A 5CA0A 3CYQA 1QVGF 1X25A 5IJ0B 4B62A 2PHNA 1ZWZA 3RYHA 2CHSA 1W5EA 5KMGB 1VQPF 3LWQC 1Q81H 2QA4F 2HS3A 1TVKB 1UI9A 2Z1UA 5KX5A 2DYYA 4I50A 3F0EA 2B33A 2HP3A 3GTZA 1RLUA 3OW2F 4ZHQA 2I6RA 1GZ0A 4DRXB 3CCLF 3FPIA 3F6MA 1KNKA 1W2BF 2BO1A 1U3LA 4ZOLB 2ALEA 1COMA 1T0KB 3WPWA 2CVLA 3IEWA 3CYPB 3HKEA 4X1IA 3OBWA 2OHWA 1FFXA 1PF5A 2VXYA 4B45A 2R751 4G4VA 5EIBC 2VGMA 2LBTA 4ZHYB 4IIJB 1SZQA 3CCMF 2RHOA 1Q82H 3JARA 1ODEA 4I4TA 3JATA 3JAMM 1SA0B 3RA6A 4BT7A 2OTMA 2UYPA 5HY0A 1NMUB 4G4ZA 2ZODA 5CA1A 1PXWA 4B5CA 3WGNA 2UYKA 1TUBB 3DC2A 2VAPA 5J2UB 5JVDA 5EYPA 3HJWC 1N8RH 1VQNF 3RYHB 3J7AR 3I56F 3VOBA 1RLGA 3ZP4A 3QUWA 3J81M 3MCAB 1W55A 3G6EF 3FBAA 5KX5B 3CCRF 2ZAUA 3PAFA 4I50B 3NK7A 2QEXF 2QTPA 3ZO8A 1VH8A 1JFFA 5FJ4C 1CN7A 2IG8A 4YJ3A 4ZHQB 3CCJF 3V3TA 3PLAC 3VIUA 4M8IA 2HS0A 4ZK7A 3HKEB 4O4IA 2KTVA 1W57A 2HS4A 1YJ9F 3CCSF 3JAWA 1YHQF 3KHNA 3N4YA 2NMUA 3RYCA 1XHOA 5DCVA 3F0FA 3JARB 4BT4A 4I4TB 3JATB 3LFOA 1W5BA 3SIVA 1VQOF 5CB4B 1OFUA 5CA1B 3CD6F 4IHJA 3NVIB 2GZLA 4KWEA 1K8AH 5ITZA 3HKDA 1XRGA 4G4XA 5JVDB 1CK2A 2HP0A 3GHZA 5FNVB 4ZI7A 1YJNF 3IKFA 1H47A 2H6LA 3P4EA 1JJ2F 3CMAF 1W41A 3WPXA 2MQEA 4O2BB 5G4VC 3VI6A 3WGLA 3N2GA 3ERNA 4X1YB 3V7EA 3VTIC 2BTUA 3WGJA 3D00A 1IV4A 2CWJA 4C82A 1JFFB 3LDTA 4YJ3B 3MQWA 1W5AA 2VGNA 1RQ7A 1IV1A 5MN6A 1U43A 4EI8A 3SIUA 3R0PA 4BVSA 4BT3A 2Q1XA 4C4WC 5G4UC 1IV3A 4BVQA 4RHAA 5GANK 1M90H 3C8LA 3KE1A 3IEQA 4O4IB 3CPQA 1VQ4F 3D01A 3HKBA 3JALB 3JAWB 4BVRA 3UT5A 2UYNA 3GYQA 3WGMA 3WJQA 5LXTA 4TZZA 1W42A 1NJIH 1VQKF 2GVIA 3CCEF 2OTJF 1U40A 1YGYA 3FD6A 5HP7A 5BMVB 5GIPC 3TD4A 4BVTA 4ZHVA 3CXCF 2I6DA 4IHJB 5IYZA 1T0AA 1W40A 3RE3A 3KIZA 3RYFA 1XBIA 1OAPA 5ITZB 1VQMF 2HP0B 3CMEF 1DBFA 2Q1YA 3M1XA 4NUTA 4X1KA 3VMFB 4ZI7B 4C8GA 5EB0A 4B46A 1SDSA 4O4JB 5HY2A 2HRUA 3V7QA 4LNUB 3N2GB 5IJ9B 3CG6A 1YITF 5CA0B 2AMTA 1QAHA 5GONA 2CW4A 3VCZA 1VHAA 4G4YA 3S03A 3CC7F 2Z1EA 2Z01A 1QD9A 2Z1FA 2AIZP 3C9UA 3K2XA 5LP6C 2RHJA 3E1YA 3F0GA 2H8EA 3JASA 2LBWA 3HKBB 1K9MH 5C8YA 4TUYA 2YXZA 2UYNB 3CC2F 4TV8A 3K0TA 2PMPA 3P10A 2KTUA 5LXTB 2DT4A 3E22A 2AIFA 3N2KA 1YJWF 3HAXD 2RHHA 4LCKA 1W5FA 3CPWF 3KJKA 4X1IB 1KQSF 2Z1TA 3F0DA 1FFXB 2W8BC 3IMPA 5IYZB 1XV2A 3VYSC 4C81A 4ZHWA 5HY4A 3IR9A 4X20A 3QHDA 3RYFB 1H7MA 5EZYA 5FLXM 3WXMB 4BT2A 4C8IA 4HNAA 3K12A 3CCUF 3S06A 3TD3A 4X1KB 4O4LA 5KMGA 2ZF8A 3CB2A 4DXDA 2RHLA 4F6RA 2KGWA 1VQLF 4O2AA 1GX1A 5EIBD 1JN1A 5EWRA 2FC3A 3WGKA 2HRYA 2HX0A 3LWPC 1W3EX 3OBYA 5EYPB 3I7TA 1X7OA 1M1KH 5EAZA 3CCVF 3LYBA 2VAMA 4ERHA 2LCAA 3ELCA 2BTQB 4WBNA 2UYJA 1YIJF 1K73H 5JQGA 5LP6A 1NQ3A 3M84A 5EB1B 3JASB 5LOVA
chains in the Genus database with same CATH topology
4BT7A 4BT4A 3HWUA 4BT3A 2NMUA 1XV2A 3HTNA 4BT6A 2DT4A 4BT2A 2H6LA 2P6YA 4BT5A 2HX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BT7 A;  4BT4 A;  3HWU A;  4BT3 A;  2NMU A;  1XV2 A;  3HTN A;  4BT6 A;  2DT4 A;  4BT2 A;  2H6L A;  2P6Y A;  4BT5 A;  2HX0 A; 
#chains in the Genus database with same CATH topology
 5LA6 A;  1VK3 A;  3RA5 A;  5C8Y B;  2IQQ A;  3OON A;  4PWT A;  3JAK A;  5HY1 A;  3P0Z A;  3C9S A;  1VQ9 F;  1SA0 A;  1FNJ A;  3N2K B;  3Q8H A;  4I55 A;  4EB6 A;  3S02 A;  1ONI A;  1UFY A;  5HWE A;  1KNJ A;  3RYC B;  4EI7 A;  1H48 A;  4X20 B;  1TUB A;  1R1M A;  2ZVZ A;  5EZY B;  3MDO A;  5J2U A;  2KG4 A;  1VQ6 F;  3N4Z A;  5GIO C;  4HNA B;  1Z5V A;  4O4L B;  1Z5W A;  2CSL A;  4BW0 B;  4F6R B;  1DT9 A;  1GO1 A;  3E20 B;  4O2A B;  3L7Q A;  2OZB A;  4U3J A;  3BYQ A;  2IAF A;  3V4D A;  5MN5 A;  3B6N A;  3HKD B;  2HVY D;  4X3M A;  3KJJ A;  1VQV A;  2N48 A;  1CLI A;  3EOR A;  3HWU A;  3FFM A;  3LWV C;  2P6Y A;  5JCO A;  4WBN B;  5HP8 A;  1VQ8 F;  2R6R 1;  4TV9 A;  5JQG B;  5LP6 B;  3CC4 F;  3NVK E;  5JH7 A;  2QI2 A;  1QVF F;  3HTN A;  1VQ7 F;  5LOV B;  4BT5 A;  3TD5 A;  5LYJ A;  3MBM A;  2BTO A;  5A2Q M;  5LA6 B;  3G71 F;  3WJR A;  3JAK B;  3VYT C;  3G4S F;  3JCM M;  4EI9 A;  3J80 M;  3JVH A;  1Q8R A;  1YI2 F;  1Q86 H;  2ZVY A;  4U39 A;  2CZW A;  3RYI A;  5GAP K;  3C9R A;  4R40 B;  4I55 B;  4EB6 B;  5J2T A;  1IPA A;  2V9Y A;  4O4H A;  2L26 A;  5IT9 M;  4NQ3 A;  1J7H A;  5CB4 A;  2LBX A;  3IKE A;  1E7K A;  3VYU C;  3UT5 B;  2EWC A;  2G9I A;  3VOA A;  3ZP7 A;  3LWR C;  3ON1 A;  5B8F A;  2CHT A;  3HKC A;  5FNV A;  4BT6 A;  2H8C A;  2JNB A;  1RA4 A;  4FFB A;  4NWO B;  3ESJ A;  1YQN A;  2YYE A;  4X3L A;  3VO8 A;  1X7P A;  4O2B A;  4E6E A;  1GO0 A;  2K1S A;  3DDN A;  3QTY A;  4YJ2 A;  4U3J B;  4X1Y A;  3M4S A;  1VQ5 F;  2VAW A;  5IJ0 A;  3D54 A;  1S72 F;  3WJP A;  2GLZ A;  1QU9 A;  1JD1 A;  1KC8 H;  4TV9 B;  3I3F A;  3CCQ F;  5JH7 B;  3C9T A;  1TVK A;  2OTL F;  5GON B;  5LYJ B;  2UZH A;  3JAL A;  3S0H A;  3S0Y A;  3NMU C;  2RB9 A;  5GIN C;  3K14 A;  1U3P A;  3S0W A;  4DRX A;  2FGY A;  1IV2 A;  5JCO C;  2F9Z C;  5EO3 A;  4ZOL A;  3U0O A;  5BMV A;  3RYI B;  1FSZ A;  1X52 A;  5J2T B;  4RQO A;  1FNK A;  5AVM A;  3I55 F;  4O4H B;  4XCQ A;  1Q7Y H;  3ZOP A;  1RQ2 A;  4TUY B;  1KD1 H;  3T80 A;  3AGK A;  4TV8 B;  4BY9 D;  4IIJ A;  3LME A;  4C8E A;  3FD5 A;  3MCQ A;  3NK6 A;  3E22 B;  5HXU A;  3HKC B;  2HQS C;  2WAL A;  4G4W A;  4FFB B;  1W58 1;  5HXZ A;  4O4J A;  1W59 A;  5MN4 A;  4LNU A;  4YJ2 B;  3LWO C;  1JY8 A;  2ZOV A;  3O85 A;  5IJ9 A;  4G88 A;  5CA0 A;  3CYQ A;  1QVG F;  1X25 A;  5IJ0 B;  4B62 A;  2PHN A;  1ZWZ A;  3RYH A;  2CHS A;  1W5E A;  5KMG B;  1VQP F;  3LWQ C;  1Q81 H;  2QA4 F;  2HS3 A;  1TVK B;  1UI9 A;  2Z1U A;  5KX5 A;  2DYY A;  4I50 A;  3F0E A;  2B33 A;  2HP3 A;  3GTZ A;  1RLU A;  3OW2 F;  4ZHQ A;  2I6R A;  1GZ0 A;  4DRX B;  3CCL F;  3FPI A;  3F6M A;  1KNK A;  1W2B F;  2BO1 A;  1U3L A;  4ZOL B;  2ALE A;  1COM A;  1T0K B;  3WPW A;  2CVL A;  3IEW A;  3CYP B;  3HKE A;  4X1I A;  3OBW A;  2OHW A;  1FFX A;  1PF5 A;  2VXY A;  4B45 A;  2R75 1;  4G4V A;  5EIB C;  2VGM A;  2LBT A;  4ZHY B;  4IIJ B;  1SZQ A;  3CCM F;  2RHO A;  1Q82 H;  3JAR A;  1ODE A;  4I4T A;  3JAT A;  3JAM M;  1SA0 B;  3RA6 A;  4BT7 A;  2OTM A;  2UYP A;  5HY0 A;  1NMU B;  4G4Z A;  2ZOD A;  5CA1 A;  1PXW A;  4B5C A;  3WGN A;  2UYK A;  1TUB B;  3DC2 A;  2VAP A;  5J2U B;  5JVD A;  5EYP A;  3HJW C;  1N8R H;  1VQN F;  3RYH B;  3J7A R;  3I56 F;  3VOB A;  1RLG A;  3ZP4 A;  3QUW A;  3J81 M;  3MCA B;  1W55 A;  3G6E F;  3FBA A;  5KX5 B;  3CCR F;  2ZAU A;  3PAF A;  4I50 B;  3NK7 A;  2QEX F;  2QTP A;  3ZO8 A;  1VH8 A;  1JFF A;  5FJ4 C;  1CN7 A;  2IG8 A;  4YJ3 A;  4ZHQ B;  3CCJ F;  3V3T A;  3PLA C;  3VIU A;  4M8I A;  2HS0 A;  4ZK7 A;  3HKE B;  4O4I A;  2KTV A;  1W57 A;  2HS4 A;  1YJ9 F;  3CCS F;  3JAW A;  1YHQ F;  3KHN A;  3N4Y A;  2NMU A;  3RYC A;  1XHO A;  5DCV A;  3F0F A;  3JAR B;  4BT4 A;  4I4T B;  3JAT B;  3LFO A;  1W5B A;  3SIV A;  1VQO F;  5CB4 B;  1OFU A;  5CA1 B;  3CD6 F;  4IHJ A;  3NVI B;  2GZL A;  4KWE A;  1K8A H;  5ITZ A;  3HKD A;  1XRG A;  4G4X A;  5JVD B;  1CK2 A;  2HP0 A;  3GHZ A;  5FNV B;  4ZI7 A;  1YJN F;  3IKF A;  1H47 A;  2H6L A;  3P4E A;  1JJ2 F;  3CMA F;  1W41 A;  3WPX A;  2MQE A;  4O2B B;  5G4V C;  3VI6 A;  3WGL A;  3N2G A;  3ERN A;  4X1Y B;  3V7E A;  3VTI C;  2BTU A;  3WGJ A;  3D00 A;  1IV4 A;  2CWJ A;  4C82 A;  1JFF B;  3LDT A;  4YJ3 B;  3MQW A;  1W5A A;  2VGN A;  1RQ7 A;  1IV1 A;  5MN6 A;  1U43 A;  4EI8 A;  3SIU A;  3R0P A;  4BVS A;  4BT3 A;  2Q1X A;  4C4W C;  5G4U C;  1IV3 A;  4BVQ A;  4RHA A;  5GAN K;  1M90 H;  3C8L A;  3KE1 A;  3IEQ A;  4O4I B;  3CPQ A;  1VQ4 F;  3D01 A;  3HKB A;  3JAL B;  3JAW B;  4BVR A;  3UT5 A;  2UYN A;  3GYQ A;  3WGM A;  3WJQ A;  5LXT A;  4TZZ A;  1W42 A;  1NJI H;  1VQK F;  2GVI A;  3CCE F;  2OTJ F;  1U40 A;  1YGY A;  3FD6 A;  5HP7 A;  5BMV B;  5GIP C;  3TD4 A;  4BVT A;  4ZHV A;  3CXC F;  2I6D A;  4IHJ B;  5IYZ A;  1T0A A;  1W40 A;  3RE3 A;  3KIZ A;  3RYF A;  1XBI A;  1OAP A;  5ITZ B;  1VQM F;  2HP0 B;  3CME F;  1DBF A;  2Q1Y A;  3M1X A;  4NUT A;  4X1K A;  3VMF B;  4ZI7 B;  4C8G A;  5EB0 A;  4B46 A;  1SDS A;  4O4J B;  5HY2 A;  2HRU A;  3V7Q A;  4LNU B;  3N2G B;  5IJ9 B;  3CG6 A;  1YIT F;  5CA0 B;  2AMT A;  1QAH A;  5GON A;  2CW4 A;  3VCZ A;  1VHA A;  4G4Y A;  3S03 A;  3CC7 F;  2Z1E A;  2Z01 A;  1QD9 A;  2Z1F A;  2AIZ P;  3C9U A;  3K2X A;  5LP6 C;  2RHJ A;  3E1Y A;  3F0G A;  2H8E A;  3JAS A;  2LBW A;  3HKB B;  1K9M H;  5C8Y A;  4TUY A;  2YXZ A;  2UYN B;  3CC2 F;  4TV8 A;  3K0T A;  2PMP A;  3P10 A;  2KTU A;  5LXT B;  2DT4 A;  3E22 A;  2AIF A;  3N2K A;  1YJW F;  3HAX D;  2RHH A;  4LCK A;  1W5F A;  3CPW F;  3KJK A;  4X1I B;  1KQS F;  2Z1T A;  3F0D A;  1FFX B;  2W8B C;  3IMP A;  5IYZ B;  1XV2 A;  3VYS C;  4C81 A;  4ZHW A;  5HY4 A;  3IR9 A;  4X20 A;  3QHD A;  3RYF B;  1H7M A;  5EZY A;  5FLX M;  3WXM B;  4BT2 A;  4C8I A;  4HNA A;  3K12 A;  3CCU F;  3S06 A;  3TD3 A;  4X1K B;  4O4L A;  5KMG A;  2ZF8 A;  3CB2 A;  4DXD A;  2RHL A;  4F6R A;  2KGW A;  1VQL F;  4O2A A;  1GX1 A;  5EIB D;  1JN1 A;  5EWR A;  2FC3 A;  3WGK A;  2HRY A;  2HX0 A;  3LWP C;  1W3E X;  3OBY A;  5EYP B;  3I7T A;  1X7O A;  1M1K H;  5EAZ A;  3CCV F;  3LYB A;  2VAM A;  4ERH A;  2LCA A;  3ELC A;  2BTQ B;  4WBN A;  2UYJ A;  1YIJ F;  1K73 H;  5JQG A;  5LP6 A;  1NQ3 A;  3M84 A;  5EB1 B;  3JAS B;  5LOV A; 
#chains in the Genus database with same CATH homology
 4BT7 A;  4BT4 A;  3HWU A;  4BT3 A;  2NMU A;  1XV2 A;  3HTN A;  4BT6 A;  2DT4 A;  4BT2 A;  2H6L A;  2P6Y A;  4BT5 A;  2HX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...