2HX0A

Three-dimensional structure of the hypothetical protein from salmonella cholerae-suis (aka salmonella enterica) at the resolution 1.55 a. northeast structural genomics target scr59.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
138
Chain Sequence
HHNASTARFYALRLLPGQEVFSQLHAFVQQNQLRAAWIAGCTGSLTDVALRYAGQEATTSLTGTFEVISLNGTLELTGEHLHLAVSDPYGVMLGGHMMPGCTVRTTLELVIGELPALTFSRQPCAISGYDELHISSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative DNA-binding protein
publication title Three-dimensional structure of the hypothetical protein from Salmonella cholerae-suis (aka Salmonella enterica) at the resolution 1.55 A. Northeast Structural Genomics target ScR59.
rcsb
source organism Salmonella choleraesuis
molecule tags Dna binding protein
total genus 33
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03479 DUF296 Plants and Prokaryotes Conserved (PCC) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.80 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Hypothetical protein, similar to alpha- acetolactate decarboxylase; domain 2 2hx0A01
4BT6A 1XV2A 4BT7A 3HWUA 2DT4A 4BT5A 4BT4A 4BT2A 2HX0A 2NMUA 4BT3A 3HTNA 2P6YA 2H6LA
chains in the Genus database with same CATH superfamily
3HKDA 1KNJA 2MQEA 3WJRA 3CYQA 5HY4A 3D00A 5EB0A 4BT4A 1RQ7A 2OTJF 1VK3A 3SIUA 4U3JB 5JVDB 4B5CA 2R6R1 2CSLA 4EI9A 1W2BF 2PHNA 4U3JA 5EWRA 5EZYB 4YJ2B 5JVDA 1VQ4F 5HP7A 5GONB 2L26A 3HKCA 1IPAA 5EZYA 2Q1XA 1Z5VA 5HY0A 2HVYD 1IV3A 4ZHVA 3K0TA 2GZLA 3V7EA 3OBYA 2HS0A 2RB9A 3F0EA 1K9MH 3I56F 3NVKE 2UYNB 3LFOA 1JD1A 3Q8HA 1VQLF 1VQ7F 2UYNA 3ZO8A 1X7OA 1W41A 2GVIA 1RA4A 3OBWA 1IV4A 1YHQF 1GO1A 3ESJA 2VGMA 1T0KB 3K12A 3PAFA 3S02A 3G71F 3ZOPA 2PMPA 3P4EA 1YIJF 4I4TB 1XHOA 3JAWA 1VQVA 4LNUB 3G4SF 2ZODA 5EYPB 5KX5A 1FSZA 5IYZB 3ELCA 1YJ9F 2ZAUA 1U40A 3JARB 1W42A 3I55F 5IYZA 3S03A 4TZZA 1VQMF 5HXZA 4C81A 3JARA 1UFYA 3LWOC 4LCKA 2DYYA 1T0AA 5FNVB 5CA0B 3RE3A 3OONA 5IJ9A 5GIOC 3VMFB 3RYIB 1YJWF 1VQ8F 4G4VA 1QVGF 2UYPA 4TUYB 2ALEA 2CHTA 1X25A 4TUYA 1OAPA 1NMUB 4C4WC 3N2GB 5EO3A 1VHAA 4NQ3A 1RLUA 2N48A 4FFBA 5JQGB 3N2GA 4EI8A 2IG8A 4O4IB 2CWJA 3CPQA 3KHNA 3F0DA 4O4JB 4O4IA 5EIBD 3T80A 2LBXA 3UT5A 4O4JA 1GO0A 1KC8H 2VXYA 3F0FA 3JASB 3S0HA 3CC2F 1N8RH 4ZOLB 2I6RA 2H8EA 4EB6A 1CLIA 3VYSC 3JASA 3LMEA 1S72F 1NJIH 1UI9A 1U43A 2G9IA 1VH8A 2GLZA 3VYUC 3LWQC 1QAHA 1W55A 5LP6B 1RLGA 5ITZB 1ZWZA 1Q86H 5ITZA 1ODEA 1K73H 3HKBB 3P0ZA 3RA5A 3RA6A 4YJ3B 3QUWA 3L7QA 3CCLF 4YJ3A 4BT5A 4G4ZA 1ONIA 2ZVYA 3CC7F 5LXTA 4O4LB 4TV8A 3G6EF 3CCRF 5MN4A 3LWRC 2Z1UA 1VQPF 2RHLA 1KQSF 2QTPA 4G4XA 5J2UB 3KIZA 3J81M 3VIUA 3F0GA 5HY2A 4DXDA 5GINC 3TD5A 2OTMA 2QI2A 4RQOA 1QD9A 3D01A 3VOAA 2UZHA 3KJKA 1VQ6F 1W57A 4HNAB 4YJ2A 5GONA 1SA0B 3P10A 5JH7B 4ZI7B 3U0OA 3JATB 1E7KA 1SA0A 3I7TA 1FNKA 2LBWA 3OW2F 4BVTA 3JATA 5CA1B 3M4SA 4I50B 3JAKB 3VYTC 3WGJA 3CCSF 3JAKA 5FJ4C 3NK7A 4G88A 3WPWA 2UYKA 1W40A 3RYCB 1VQOF 1GZ0A 4EI7A 1SZQA 4O2BB 3WGMA 3V7QA 4O2BA 4DRXB 1Q82H 5KMGB 4IIJB 4B46A 4DRXA 5IJ0B 5KMGA 2YXZA 3EORA 1XBIA 2AIFA 1IV2A 3ERNA 2LBTA 5IJ0A 4I4TA 5MN6A 1Q81H 1H48A 2QEXF 4LNUA 2H6LA 3MCAB 5EYPA 2RHJA 2IAFA 3E22B 3S0YA 3FD5A 1W5AA 4XCQA 5LA6B 2LCAA 3IKEA 3JVHA 3QHDA 5FNVA 5CA0A 1GX1A 2ZOVA 3M1XA 5HXUA 4BY9D 3RYIA 4E6EA 3VTIC 3VOBA 5GAPK 4O4HB 3C8LA 3HWUA 4X1YB 4ZHQB 1Q7YH 5LYJB 1X52A 3N2KB 5JQGA 3GHZA 1FNJA 2HRUA 1M90H 4M8IA 4X1KB 3CYPB 3IMPA 5HWEA 3RYFB 4X1KA 1R1MA 3V3TA 1QU9A 3K2XA 1CK2A 5EB1B 4ZOLA 3RYFA 2BTUA 1Q8RA 1U3PA 4BW0B 3VCZA 1W59A 5J2TB 3D54A 3FBAA 5LP6A 5IT9M 3JALB 2QA4F 3JALA 2K1SA 3NK6A 1TUBB 3IKFA 2B33A 3HKBA 5DCVA 1TUBA 4ZHYB 3DDNA 4BT2A 5JCOA 1VQ9F 4I55B 4O4LA 1YI2F 1JN1A 3CXCF 3E1YA 2V9YA 4PWTA 4ZK7A 5HP8A 2CW4A 3E20B 3V4DA 1W581 3FFMA 1OFUA 4C8EA 5C8YB 2HS3A 4IHJB 5C8YA 3I3FA 5J2UA 5CB4B 3CCMF 3DC2A 5CB4A 2HS4A 2CHSA 4TV9B 3WJQA 2KTVA 5BMVB 2Q1YA 2HQSC 3B6NA 5LP6C 4C82A 3HKDB 5BMVA 4HNAA 3WGKA 3C9UA 3S0WA 1U3LA 3R0PA 2OHWA 3CCVF 5G4UC 5JH7A 2HP0B 3IEQA 4ZI7A 2VGNA 1TVKB 3LWVC 2HP0A 3MQWA 3CD6F 3WXMB 1YGYA 1TVKA 3CCJF 1YJNF 5CA1A 4BVQA 3HJWC 3PLAC 4I50A 1H47A 1RQ2A 3HKCB 3C9RA 5JCOC 4BT3A 1QVFF 2EWCA 3LWPC 3S06A 3CCUF 4WBNB 1W5BA 2KG4A 4RHAA 3RYCA 1DT9A 4BVSA 1XV2A 4ZHWA 4WBNA 2CZWA 5FLXM 2W8BC 4O2AB 3M84A 2HP3A 3ON1A 4IIJA 4O2AA 2HX0A 4ERHA 1YQNA 3CC4F 2YYEA 4NWOB 4BT7A 2Z1EA 1XRGA 3E22A 3CB2A 2OTLF 3RYHA 3C9SA 2BTOA 5LA6A 3SIVA 3JAWB 3TD4A 4B62A 5KX5B 2BO1A 2WALA 3WPXA 3JCMM 5LOVB 4B45A 1W5EA 2NMUA 4U39A 5LOVA 2UYJA 4O4HA 1H7MA 5EIBC 4R40B 3MDOA 4X1YA 4ZHQA 4BT6A 2KTUA 3VO8A 3ZP7A 5A2QM 5LYJA 5IJ9B 5B8FA 3N2KA 3C9TA 1JJ2F 2P6YA 1M1KH 2H8CA 4X20B 3AGKA 3O85A 3MBMA 2IQQA 2AMTA 1SDSA 1PF5A 3CPWF 4X20A 5AVMA 1X7PA 3QTYA 3VI6A 3CMEF 1IV1A 2FGYA 3NVIB 3LYBA 4FFBB 5G4VC 3N4ZA 1VQNF 4X3LA 4X1IB 2DT4A 4BVRA 3FPIA 3JAMM 4X1IA 4KWEA 1K8AH 3UT5B 1PXWA 5J2TA 2JNBA 3KE1A 4C8IA 3NMUC 4F6RB 2OZBA 2KGWA 4EB6B 1KNKA 3HAXD 2CVLA 3HKEB 4F6RA 3KJJA 1FFXB 2ZVZA 4G4YA 3HKEA 1FFXA 1JFFB 3HTNA 2F9ZC 4C8GA 3N4YA 1DBFA 5GANK 3MCQA 3WGLA 1JFFA 1CN7A 2HRYA 2I6DA 3FD6A 3LDTA 3GTZA 3IR9A 1VQKF 3CG6A 3J80M 1Z5WA 3J7AR 4X3MA 2Z1FA 2VAPA 5EAZA 4I55A 4NUTA 3ZP4A 1W5FA 4G4WA 3CCEF 2AIZP 3CCQF 2VAWA 2FC3A 3TD3A 3WJPA 3BYQA 2VAMA 3WGNA 3CMAF 1J7HA 3IEWA 4IHJA 5LXTB 2RHOA 4TV8B 1YITF 1COMA 1W3EX 1VQ5F 1JY8A 2R751 2Z1TA 1NQ3A 5GIPC 2RHHA 3GYQA 1KD1H 3RYHB 4TV9A 5HY1A 2ZF8A 2BTQB 2Z01A 5MN5A 3F6MA 3K14A
chains in the Genus database with same CATH topology
4BT6A 1XV2A 4BT7A 3HWUA 2DT4A 4BT5A 4BT4A 4BT2A 2HX0A 2NMUA 4BT3A 3HTNA 2P6YA 2H6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BT6 A;  1XV2 A;  4BT7 A;  3HWU A;  2DT4 A;  4BT5 A;  4BT4 A;  4BT2 A;  2HX0 A;  2NMU A;  4BT3 A;  3HTN A;  2P6Y A;  2H6L A; 
#chains in the Genus database with same CATH topology
 3HKD A;  1KNJ A;  2MQE A;  3WJR A;  3CYQ A;  5HY4 A;  3D00 A;  5EB0 A;  4BT4 A;  1RQ7 A;  2OTJ F;  1VK3 A;  3SIU A;  4U3J B;  5JVD B;  4B5C A;  2R6R 1;  2CSL A;  4EI9 A;  1W2B F;  2PHN A;  4U3J A;  5EWR A;  5EZY B;  4YJ2 B;  5JVD A;  1VQ4 F;  5HP7 A;  5GON B;  2L26 A;  3HKC A;  1IPA A;  5EZY A;  2Q1X A;  1Z5V A;  5HY0 A;  2HVY D;  1IV3 A;  4ZHV A;  3K0T A;  2GZL A;  3V7E A;  3OBY A;  2HS0 A;  2RB9 A;  3F0E A;  1K9M H;  3I56 F;  3NVK E;  2UYN B;  3LFO A;  1JD1 A;  3Q8H A;  1VQL F;  1VQ7 F;  2UYN A;  3ZO8 A;  1X7O A;  1W41 A;  2GVI A;  1RA4 A;  3OBW A;  1IV4 A;  1YHQ F;  1GO1 A;  3ESJ A;  2VGM A;  1T0K B;  3K12 A;  3PAF A;  3S02 A;  3G71 F;  3ZOP A;  2PMP A;  3P4E A;  1YIJ F;  4I4T B;  1XHO A;  3JAW A;  1VQV A;  4LNU B;  3G4S F;  2ZOD A;  5EYP B;  5KX5 A;  1FSZ A;  5IYZ B;  3ELC A;  1YJ9 F;  2ZAU A;  1U40 A;  3JAR B;  1W42 A;  3I55 F;  5IYZ A;  3S03 A;  4TZZ A;  1VQM F;  5HXZ A;  4C81 A;  3JAR A;  1UFY A;  3LWO C;  4LCK A;  2DYY A;  1T0A A;  5FNV B;  5CA0 B;  3RE3 A;  3OON A;  5IJ9 A;  5GIO C;  3VMF B;  3RYI B;  1YJW F;  1VQ8 F;  4G4V A;  1QVG F;  2UYP A;  4TUY B;  2ALE A;  2CHT A;  1X25 A;  4TUY A;  1OAP A;  1NMU B;  4C4W C;  3N2G B;  5EO3 A;  1VHA A;  4NQ3 A;  1RLU A;  2N48 A;  4FFB A;  5JQG B;  3N2G A;  4EI8 A;  2IG8 A;  4O4I B;  2CWJ A;  3CPQ A;  3KHN A;  3F0D A;  4O4J B;  4O4I A;  5EIB D;  3T80 A;  2LBX A;  3UT5 A;  4O4J A;  1GO0 A;  1KC8 H;  2VXY A;  3F0F A;  3JAS B;  3S0H A;  3CC2 F;  1N8R H;  4ZOL B;  2I6R A;  2H8E A;  4EB6 A;  1CLI A;  3VYS C;  3JAS A;  3LME A;  1S72 F;  1NJI H;  1UI9 A;  1U43 A;  2G9I A;  1VH8 A;  2GLZ A;  3VYU C;  3LWQ C;  1QAH A;  1W55 A;  5LP6 B;  1RLG A;  5ITZ B;  1ZWZ A;  1Q86 H;  5ITZ A;  1ODE A;  1K73 H;  3HKB B;  3P0Z A;  3RA5 A;  3RA6 A;  4YJ3 B;  3QUW A;  3L7Q A;  3CCL F;  4YJ3 A;  4BT5 A;  4G4Z A;  1ONI A;  2ZVY A;  3CC7 F;  5LXT A;  4O4L B;  4TV8 A;  3G6E F;  3CCR F;  5MN4 A;  3LWR C;  2Z1U A;  1VQP F;  2RHL A;  1KQS F;  2QTP A;  4G4X A;  5J2U B;  3KIZ A;  3J81 M;  3VIU A;  3F0G A;  5HY2 A;  4DXD A;  5GIN C;  3TD5 A;  2OTM A;  2QI2 A;  4RQO A;  1QD9 A;  3D01 A;  3VOA A;  2UZH A;  3KJK A;  1VQ6 F;  1W57 A;  4HNA B;  4YJ2 A;  5GON A;  1SA0 B;  3P10 A;  5JH7 B;  4ZI7 B;  3U0O A;  3JAT B;  1E7K A;  1SA0 A;  3I7T A;  1FNK A;  2LBW A;  3OW2 F;  4BVT A;  3JAT A;  5CA1 B;  3M4S A;  4I50 B;  3JAK B;  3VYT C;  3WGJ A;  3CCS F;  3JAK A;  5FJ4 C;  3NK7 A;  4G88 A;  3WPW A;  2UYK A;  1W40 A;  3RYC B;  1VQO F;  1GZ0 A;  4EI7 A;  1SZQ A;  4O2B B;  3WGM A;  3V7Q A;  4O2B A;  4DRX B;  1Q82 H;  5KMG B;  4IIJ B;  4B46 A;  4DRX A;  5IJ0 B;  5KMG A;  2YXZ A;  3EOR A;  1XBI A;  2AIF A;  1IV2 A;  3ERN A;  2LBT A;  5IJ0 A;  4I4T A;  5MN6 A;  1Q81 H;  1H48 A;  2QEX F;  4LNU A;  2H6L A;  3MCA B;  5EYP A;  2RHJ A;  2IAF A;  3E22 B;  3S0Y A;  3FD5 A;  1W5A A;  4XCQ A;  5LA6 B;  2LCA A;  3IKE A;  3JVH A;  3QHD A;  5FNV A;  5CA0 A;  1GX1 A;  2ZOV A;  3M1X A;  5HXU A;  4BY9 D;  3RYI A;  4E6E A;  3VTI C;  3VOB A;  5GAP K;  4O4H B;  3C8L A;  3HWU A;  4X1Y B;  4ZHQ B;  1Q7Y H;  5LYJ B;  1X52 A;  3N2K B;  5JQG A;  3GHZ A;  1FNJ A;  2HRU A;  1M90 H;  4M8I A;  4X1K B;  3CYP B;  3IMP A;  5HWE A;  3RYF B;  4X1K A;  1R1M A;  3V3T A;  1QU9 A;  3K2X A;  1CK2 A;  5EB1 B;  4ZOL A;  3RYF A;  2BTU A;  1Q8R A;  1U3P A;  4BW0 B;  3VCZ A;  1W59 A;  5J2T B;  3D54 A;  3FBA A;  5LP6 A;  5IT9 M;  3JAL B;  2QA4 F;  3JAL A;  2K1S A;  3NK6 A;  1TUB B;  3IKF A;  2B33 A;  3HKB A;  5DCV A;  1TUB A;  4ZHY B;  3DDN A;  4BT2 A;  5JCO A;  1VQ9 F;  4I55 B;  4O4L A;  1YI2 F;  1JN1 A;  3CXC F;  3E1Y A;  2V9Y A;  4PWT A;  4ZK7 A;  5HP8 A;  2CW4 A;  3E20 B;  3V4D A;  1W58 1;  3FFM A;  1OFU A;  4C8E A;  5C8Y B;  2HS3 A;  4IHJ B;  5C8Y A;  3I3F A;  5J2U A;  5CB4 B;  3CCM F;  3DC2 A;  5CB4 A;  2HS4 A;  2CHS A;  4TV9 B;  3WJQ A;  2KTV A;  5BMV B;  2Q1Y A;  2HQS C;  3B6N A;  5LP6 C;  4C82 A;  3HKD B;  5BMV A;  4HNA A;  3WGK A;  3C9U A;  3S0W A;  1U3L A;  3R0P A;  2OHW A;  3CCV F;  5G4U C;  5JH7 A;  2HP0 B;  3IEQ A;  4ZI7 A;  2VGN A;  1TVK B;  3LWV C;  2HP0 A;  3MQW A;  3CD6 F;  3WXM B;  1YGY A;  1TVK A;  3CCJ F;  1YJN F;  5CA1 A;  4BVQ A;  3HJW C;  3PLA C;  4I50 A;  1H47 A;  1RQ2 A;  3HKC B;  3C9R A;  5JCO C;  4BT3 A;  1QVF F;  2EWC A;  3LWP C;  3S06 A;  3CCU F;  4WBN B;  1W5B A;  2KG4 A;  4RHA A;  3RYC A;  1DT9 A;  4BVS A;  1XV2 A;  4ZHW A;  4WBN A;  2CZW A;  5FLX M;  2W8B C;  4O2A B;  3M84 A;  2HP3 A;  3ON1 A;  4IIJ A;  4O2A A;  2HX0 A;  4ERH A;  1YQN A;  3CC4 F;  2YYE A;  4NWO B;  4BT7 A;  2Z1E A;  1XRG A;  3E22 A;  3CB2 A;  2OTL F;  3RYH A;  3C9S A;  2BTO A;  5LA6 A;  3SIV A;  3JAW B;  3TD4 A;  4B62 A;  5KX5 B;  2BO1 A;  2WAL A;  3WPX A;  3JCM M;  5LOV B;  4B45 A;  1W5E A;  2NMU A;  4U39 A;  5LOV A;  2UYJ A;  4O4H A;  1H7M A;  5EIB C;  4R40 B;  3MDO A;  4X1Y A;  4ZHQ A;  4BT6 A;  2KTU A;  3VO8 A;  3ZP7 A;  5A2Q M;  5LYJ A;  5IJ9 B;  5B8F A;  3N2K A;  3C9T A;  1JJ2 F;  2P6Y A;  1M1K H;  2H8C A;  4X20 B;  3AGK A;  3O85 A;  3MBM A;  2IQQ A;  2AMT A;  1SDS A;  1PF5 A;  3CPW F;  4X20 A;  5AVM A;  1X7P A;  3QTY A;  3VI6 A;  3CME F;  1IV1 A;  2FGY A;  3NVI B;  3LYB A;  4FFB B;  5G4V C;  3N4Z A;  1VQN F;  4X3L A;  4X1I B;  2DT4 A;  4BVR A;  3FPI A;  3JAM M;  4X1I A;  4KWE A;  1K8A H;  3UT5 B;  1PXW A;  5J2T A;  2JNB A;  3KE1 A;  4C8I A;  3NMU C;  4F6R B;  2OZB A;  2KGW A;  4EB6 B;  1KNK A;  3HAX D;  2CVL A;  3HKE B;  4F6R A;  3KJJ A;  1FFX B;  2ZVZ A;  4G4Y A;  3HKE A;  1FFX A;  1JFF B;  3HTN A;  2F9Z C;  4C8G A;  3N4Y A;  1DBF A;  5GAN K;  3MCQ A;  3WGL A;  1JFF A;  1CN7 A;  2HRY A;  2I6D A;  3FD6 A;  3LDT A;  3GTZ A;  3IR9 A;  1VQK F;  3CG6 A;  3J80 M;  1Z5W A;  3J7A R;  4X3M A;  2Z1F A;  2VAP A;  5EAZ A;  4I55 A;  4NUT A;  3ZP4 A;  1W5F A;  4G4W A;  3CCE F;  2AIZ P;  3CCQ F;  2VAW A;  2FC3 A;  3TD3 A;  3WJP A;  3BYQ A;  2VAM A;  3WGN A;  3CMA F;  1J7H A;  3IEW A;  4IHJ A;  5LXT B;  2RHO A;  4TV8 B;  1YIT F;  1COM A;  1W3E X;  1VQ5 F;  1JY8 A;  2R75 1;  2Z1T A;  1NQ3 A;  5GIP C;  2RHH A;  3GYQ A;  1KD1 H;  3RYH B;  4TV9 A;  5HY1 A;  2ZF8 A;  2BTQ B;  2Z01 A;  5MN5 A;  3F6M A;  3K14 A; 
#chains in the Genus database with same CATH homology
 4BT6 A;  1XV2 A;  4BT7 A;  3HWU A;  2DT4 A;  4BT5 A;  4BT4 A;  4BT2 A;  2HX0 A;  2NMU A;  4BT3 A;  3HTN A;  2P6Y A;  2H6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...