2HX0A

Three-dimensional structure of the hypothetical protein from salmonella cholerae-suis (aka salmonella enterica) at the resolution 1.55 a. northeast structural genomics target scr59.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
138
Chain Sequence
HHNASTARFYALRLLPGQEVFSQLHAFVQQNQLRAAWIAGCTGSLTDVALRYAGQEATTSLTGTFEVISLNGTLELTGEHLHLAVSDPYGVMLGGHMMPGCTVRTTLELVIGELPALTFSRQPCAISGYDELHISSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative DNA-binding protein
publication title Three-dimensional structure of the hypothetical protein from Salmonella cholerae-suis (aka Salmonella enterica) at the resolution 1.55 A. Northeast Structural Genomics target ScR59.
rcsb
source organism Salmonella choleraesuis
molecule tags Dna binding protein
total genus 33
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03479 DUF296 Plants and Prokaryotes Conserved (PCC) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.80 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Hypothetical protein, similar to alpha- acetolactate decarboxylase; domain 2 2hx0A01
2H6LA 2NMUA 1XV2A 4BT4A 4BT2A 4BT3A 4BT6A 2HX0A 4BT5A 4BT7A 3HWUA 3HTNA 2P6YA 2DT4A
chains in the Genus database with same CATH superfamily
1VH8A 4U3JA 5EAZA 1W581 2LCAA 3F0FA 5CB4A 3WGKA 5IT9M 1YGYA 1E7KA 1ONIA 3N4YA 2ZVYA 4ZOLA 3RYIA 3UT5B 3P0ZA 2VAMA 4G4XA 3QTYA 3JAWA 1RQ2A 3LMEA 3OBWA 5IJ0B 1SZQA 3JAKA 5JH7B 4ZI7A 1GO1A 1JY8A 1NJIH 3G71F 3N2KA 2KG4A 3G6EF 3NMUC 4DRXB 1GZ0A 4B5CA 4YJ2B 5IYZA 4X1IA 3HTNA 5GIPC 1W3EX 2OTJF 4B45A 3M4SA 5GANK 1N8RH 2RB9A 4RQOA 4O2BA 1W57A 2HRUA 4TUYB 1VQVA 2GLZA 1KD1H 4U39A 1IV4A 2Z01A 4NQ3A 2HRYA 2W8BC 5EIBC 4G88A 3I7TA 4EB6A 3M84A 4BVRA 2H6LA 2VGNA 4O4IB 2QEXF 5GONA 2VAPA 2VGMA 4BT3A 1JFFB 3DDNA 1W40A 1UI9A 2EWCA 3GHZA 3RYCB 3ZP7A 1RLGA 4X3MA 5JH7A 3VYUC 2YYEA 2CWJA 2Z1UA 5HP8A 1JJ2F 3K2XA 3CCVF 3CD6F 5AVMA 1YI2F 1VQKF 2OZBA 4O4JB 4WBNB 4DRXA 4IIJA 4YJ2A 4ZHVA 4G4YA 1XV2A 4BT6A 5MN6A 5HP7A 3K14A 3GYQA 1JD1A 3J81M 4NUTA 2F9ZC 4F6RA 2H8EA 3E22A 3CPQA 3IKEA 3WPXA 1YIJF 4PWTA 2ZAUA 4I50B 3RYIB 3RYFA 5MN4A 5HY0A 3FFMA 5J2TA 2QA4F 3JAWB 3LFOA 4BY9D 3JAKB 5JCOA 5EO3A 5KMGA 4E6EA 3VYTC 4C8IA 5A2QM 2UYNA 1JFFA 4TV9A 3CMEF 3ZO8A 1IV3A 3N2KB 1FSZA 3KIZA 3LDTA 4DXDA 2I6RA 3K12A 1OAPA 3HAXD 1W5FA 1DBFA 3BYQA 2ALEA 4BT5A 3I56F 3KE1A 3S0WA 1RLUA 2RHHA 5CA0A 4ZK7A 3IMPA 4X1KA 3JASB 1FNJA 1U3LA 4O4JA 1VQ9F 3CB2A 1Q8RA 3ERNA 4NWOB 4BT4A 1COMA 3WJPA 4B46A 1W59A 4G4WA 1TUBB 3JALA 2LBWA 4EB6B 2CHSA 1U40A 2HP3A 2IQQA 3CMAF 4I55A 3ZP4A 1DT9A 5GONB 2Z1EA 4O4LA 3CCEF 2IG8A 2ZVZA 3CCJF 4I50A 1IPAA 3Q8HA 5BMVA 3LWOC 1NQ3A 4YJ3A 3ZOPA 4ZHWA 5HY2A 5GIOC 1X7PA 1PF5A 3HWUA 4HNAB 4O2AA 3LYBA 1Z5WA 2RHJA 4ERHA 3CG6A 4C8EA 1CLIA 3R0PA 2HS3A 3OBYA 3ELCA 5EYPA 2L26A 4IIJB 3L7QA 4C8GA 3CXCF 3VMFB 3JAMM 2HS4A 3NK6A 5EZYA 1QVGF 3MCQA 2ZODA 3JATA 4IHJB 5LYJA 2B33A 3HKCA 2AIZP 3M1XA 2UZHA 4F6RB 3E22B 3JASA 2R6R1 3IEWA 3E1YA 1YJWF 1K8AH 2FC3A 2Q1XA 1W55A 1X52A 3RYFB 2MQEA 2OHWA 1VHAA 1TUBA 1FNKA 2KTUA 5J2TB 4R40B 3CCRF 2PMPA 5G4VC 3FD5A 1W5AA 1Q86H 5KMGB 3G4SF 1R1MA 1SDSA 2UYNB 5HY1A 4TV9B 5GAPK 2CHTA 5B8FA 3NVIB 2HX0A 4BVSA 4BT7A 3CCSF 3C9SA 1SA0A 3RE3A 3VO8A 1K9MH 4HNAA 3O85A 2QI2A 5FJ4C 3F0DA 3CC4F 2ZOVA 1Z5VA 5CA0B 1Q82H 2NMUA 3MCAB 5LOVB 1YJNF 4X1KB 1VQNF 4ZHQB 2IAFA 4M8IA 3KHNA 3WXMB 3C9RA 3CCUF 3QHDA 4O4HA 1CK2A 3VOBA 3JALB 4IHJA 5HWEA 2BTOA 1FFXA 2Z1TA 3NK7A 4I55B 1YHQF 4O4LB 2UYJA 3IR9A 1Q81H 3I3FA 2WALA 3NVKE 3CC2F 3V3TA 5BMVB 1IV2A 3PLAC 4C82A 4RHAA 4YJ3B 1QD9A 4X1YB 2VXYA 4B62A 1PXWA 1YQNA 4O2AB 4I4TA 3WPWA 2HVYD 1H48A 3C9TA 2AIFA 3IKFA 1VQ5F 3MQWA 1JN1A 4BVQA 3HKDA 2HQSC 2GZLA 1VQ7F 5EIBD 5EYPB 3FD6A 4XCQA 1W2BF 2G9IA 3IEQA 1XBIA 3DC2A 1U43A 5MN5A 1M1KH 5EZYB 1VQMF 1S72F 4BW0B 2LBXA 3HKEB 4FFBA 3JATB 5LYJB 3JVHA 3HKCB 2ZF8A 3ESJA 3WGNA 3MDOA 3RA6A 5LOVA 5EB0A 3V4DA 1J7HA 1GO0A 2RHOA 1XRGA 4ZHQA 3QUWA 3CPWF 2OTMA 1VQOF 1H7MA 4LNUA 4BT2A 3J7AR 2FGYA 3C9UA 2YXZA 3HKBB 3FPIA 3J80M 4G4ZA 1VK3A 3VCZA 3CCMF 3WJQA 4EI9A 1TVKA 5JQGB 2LBTA 1RQ7A 1H47A 3CYPB 3SIVA 5HXZA 3SIUA 4X1YA 1SA0B 3S03A 1M90H 1OFUA 2HP0A 2VAWA 3S02A 1QAHA 3PAFA 5C8YA 5G4UC 2Z1FA 5JVDB 2GVIA 3WGJA 1W5EA 1ODEA 4O4HB 2Q1YA 2KGWA 5EB1B 3WJRA 1YITF 3E20B 1QU9A 2QTPA 3LWRC 1CN7A 1ZWZA 3HKEA 3FBAA 1FFXB 4TV8A 2CW4A 2DYYA 3LWQC 3AGKA 3VYSC 3C8LA 3T80A 3RYHB 3WGLA 2CSLA 3I55F 3N2GA 5J2UB 2I6DA 2R751 5KX5A 3CC7F 2JNBA 5LP6A 2P6YA 3RA5A 1YJ9F 2DT4A 5CA1A 1VQLF 3HKBA 4I4TB 5LP6C 3TD3A 3F0GA 5ITZB 3VTIC 1IV1A 3HKDB 3MBMA 3LWVC 1RA4A 2H8CA 5JQGA 3CCQF 3HJWC 4EI7A 3N4ZA 4EI8A 5IJ9A 5LXTA 1UFYA 4TZZA 2UYKA 1W42A 1KNJA 2BO1A 3JARA 4FFBB 5FNVA 3VI6A 4X20A 3D54A 3KJKA 2KTVA 1K73H 3WGMA 5JVDA 3GTZA 1XHOA 5EWRA 4LNUB 5LA6B 1VQ8F 3UT5A 3F6MA 4KWEA 5IJ0A 3RYHA 1VQ4F 3V7EA 3TD5A 3CCLF 3KJJA 1TVKB 4C4WC 3VOAA 5J2UA 2CZWA 2HP0B 1Q7YH 1X25A 5GINC 2AMTA 3D01A 5ITZA 3LWPC 1QVFF 5C8YB 4G4VA 4U3JB 3OW2F 3F0EA 2OTLF 2RHLA 3K0TA 5CB4B 2BTQB 3VIUA 3B6NA 4C81A 4TUYA 3JCMM 4ZHYB 3OONA 1VQ6F 4ZOLB 2N48A 1W5BA 2V9YA 2BTUA 3P4EA 5HXUA 1GX1A 1KNKA 5HY4A 4TV8B 1KC8H 3D00A 3S0YA 2PHNA 2K1SA 4O4IA 3N2GB 4ZI7B 1KQSF 3EORA 1U3PA 3CYQA 5KX5B 5LA6A 3P10A 5JCOC 5LP6B 5CA1B 4LCKA 3RYCA 1X7OA 5FLXM 5IYZB 4X1IB 4BVTA 3ON1A 4X3LA 1NMUB 3TD4A 4O2BB 2HS0A 2CVLA 5IJ9B 5LXTB 2UYPA 3V7QA 4WBNA 3S0HA 1W41A 3JARB 5DCVA 5FNVB 3S06A 1T0KB 4X20B 1T0AA 1VQPF 3U0OA
chains in the Genus database with same CATH topology
2H6LA 2NMUA 1XV2A 4BT4A 4BT2A 4BT3A 4BT6A 2HX0A 4BT5A 4BT7A 3HWUA 3HTNA 2P6YA 2DT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6L A;  2NMU A;  1XV2 A;  4BT4 A;  4BT2 A;  4BT3 A;  4BT6 A;  2HX0 A;  4BT5 A;  4BT7 A;  3HWU A;  3HTN A;  2P6Y A;  2DT4 A; 
#chains in the Genus database with same CATH topology
 1VH8 A;  4U3J A;  5EAZ A;  1W58 1;  2LCA A;  3F0F A;  5CB4 A;  3WGK A;  5IT9 M;  1YGY A;  1E7K A;  1ONI A;  3N4Y A;  2ZVY A;  4ZOL A;  3RYI A;  3UT5 B;  3P0Z A;  2VAM A;  4G4X A;  3QTY A;  3JAW A;  1RQ2 A;  3LME A;  3OBW A;  5IJ0 B;  1SZQ A;  3JAK A;  5JH7 B;  4ZI7 A;  1GO1 A;  1JY8 A;  1NJI H;  3G71 F;  3N2K A;  2KG4 A;  3G6E F;  3NMU C;  4DRX B;  1GZ0 A;  4B5C A;  4YJ2 B;  5IYZ A;  4X1I A;  3HTN A;  5GIP C;  1W3E X;  2OTJ F;  4B45 A;  3M4S A;  5GAN K;  1N8R H;  2RB9 A;  4RQO A;  4O2B A;  1W57 A;  2HRU A;  4TUY B;  1VQV A;  2GLZ A;  1KD1 H;  4U39 A;  1IV4 A;  2Z01 A;  4NQ3 A;  2HRY A;  2W8B C;  5EIB C;  4G88 A;  3I7T A;  4EB6 A;  3M84 A;  4BVR A;  2H6L A;  2VGN A;  4O4I B;  2QEX F;  5GON A;  2VAP A;  2VGM A;  4BT3 A;  1JFF B;  3DDN A;  1W40 A;  1UI9 A;  2EWC A;  3GHZ A;  3RYC B;  3ZP7 A;  1RLG A;  4X3M A;  5JH7 A;  3VYU C;  2YYE A;  2CWJ A;  2Z1U A;  5HP8 A;  1JJ2 F;  3K2X A;  3CCV F;  3CD6 F;  5AVM A;  1YI2 F;  1VQK F;  2OZB A;  4O4J B;  4WBN B;  4DRX A;  4IIJ A;  4YJ2 A;  4ZHV A;  4G4Y A;  1XV2 A;  4BT6 A;  5MN6 A;  5HP7 A;  3K14 A;  3GYQ A;  1JD1 A;  3J81 M;  4NUT A;  2F9Z C;  4F6R A;  2H8E A;  3E22 A;  3CPQ A;  3IKE A;  3WPX A;  1YIJ F;  4PWT A;  2ZAU A;  4I50 B;  3RYI B;  3RYF A;  5MN4 A;  5HY0 A;  3FFM A;  5J2T A;  2QA4 F;  3JAW B;  3LFO A;  4BY9 D;  3JAK B;  5JCO A;  5EO3 A;  5KMG A;  4E6E A;  3VYT C;  4C8I A;  5A2Q M;  2UYN A;  1JFF A;  4TV9 A;  3CME F;  3ZO8 A;  1IV3 A;  3N2K B;  1FSZ A;  3KIZ A;  3LDT A;  4DXD A;  2I6R A;  3K12 A;  1OAP A;  3HAX D;  1W5F A;  1DBF A;  3BYQ A;  2ALE A;  4BT5 A;  3I56 F;  3KE1 A;  3S0W A;  1RLU A;  2RHH A;  5CA0 A;  4ZK7 A;  3IMP A;  4X1K A;  3JAS B;  1FNJ A;  1U3L A;  4O4J A;  1VQ9 F;  3CB2 A;  1Q8R A;  3ERN A;  4NWO B;  4BT4 A;  1COM A;  3WJP A;  4B46 A;  1W59 A;  4G4W A;  1TUB B;  3JAL A;  2LBW A;  4EB6 B;  2CHS A;  1U40 A;  2HP3 A;  2IQQ A;  3CMA F;  4I55 A;  3ZP4 A;  1DT9 A;  5GON B;  2Z1E A;  4O4L A;  3CCE F;  2IG8 A;  2ZVZ A;  3CCJ F;  4I50 A;  1IPA A;  3Q8H A;  5BMV A;  3LWO C;  1NQ3 A;  4YJ3 A;  3ZOP A;  4ZHW A;  5HY2 A;  5GIO C;  1X7P A;  1PF5 A;  3HWU A;  4HNA B;  4O2A A;  3LYB A;  1Z5W A;  2RHJ A;  4ERH A;  3CG6 A;  4C8E A;  1CLI A;  3R0P A;  2HS3 A;  3OBY A;  3ELC A;  5EYP A;  2L26 A;  4IIJ B;  3L7Q A;  4C8G A;  3CXC F;  3VMF B;  3JAM M;  2HS4 A;  3NK6 A;  5EZY A;  1QVG F;  3MCQ A;  2ZOD A;  3JAT A;  4IHJ B;  5LYJ A;  2B33 A;  3HKC A;  2AIZ P;  3M1X A;  2UZH A;  4F6R B;  3E22 B;  3JAS A;  2R6R 1;  3IEW A;  3E1Y A;  1YJW F;  1K8A H;  2FC3 A;  2Q1X A;  1W55 A;  1X52 A;  3RYF B;  2MQE A;  2OHW A;  1VHA A;  1TUB A;  1FNK A;  2KTU A;  5J2T B;  4R40 B;  3CCR F;  2PMP A;  5G4V C;  3FD5 A;  1W5A A;  1Q86 H;  5KMG B;  3G4S F;  1R1M A;  1SDS A;  2UYN B;  5HY1 A;  4TV9 B;  5GAP K;  2CHT A;  5B8F A;  3NVI B;  2HX0 A;  4BVS A;  4BT7 A;  3CCS F;  3C9S A;  1SA0 A;  3RE3 A;  3VO8 A;  1K9M H;  4HNA A;  3O85 A;  2QI2 A;  5FJ4 C;  3F0D A;  3CC4 F;  2ZOV A;  1Z5V A;  5CA0 B;  1Q82 H;  2NMU A;  3MCA B;  5LOV B;  1YJN F;  4X1K B;  1VQN F;  4ZHQ B;  2IAF A;  4M8I A;  3KHN A;  3WXM B;  3C9R A;  3CCU F;  3QHD A;  4O4H A;  1CK2 A;  3VOB A;  3JAL B;  4IHJ A;  5HWE A;  2BTO A;  1FFX A;  2Z1T A;  3NK7 A;  4I55 B;  1YHQ F;  4O4L B;  2UYJ A;  3IR9 A;  1Q81 H;  3I3F A;  2WAL A;  3NVK E;  3CC2 F;  3V3T A;  5BMV B;  1IV2 A;  3PLA C;  4C82 A;  4RHA A;  4YJ3 B;  1QD9 A;  4X1Y B;  2VXY A;  4B62 A;  1PXW A;  1YQN A;  4O2A B;  4I4T A;  3WPW A;  2HVY D;  1H48 A;  3C9T A;  2AIF A;  3IKF A;  1VQ5 F;  3MQW A;  1JN1 A;  4BVQ A;  3HKD A;  2HQS C;  2GZL A;  1VQ7 F;  5EIB D;  5EYP B;  3FD6 A;  4XCQ A;  1W2B F;  2G9I A;  3IEQ A;  1XBI A;  3DC2 A;  1U43 A;  5MN5 A;  1M1K H;  5EZY B;  1VQM F;  1S72 F;  4BW0 B;  2LBX A;  3HKE B;  4FFB A;  3JAT B;  5LYJ B;  3JVH A;  3HKC B;  2ZF8 A;  3ESJ A;  3WGN A;  3MDO A;  3RA6 A;  5LOV A;  5EB0 A;  3V4D A;  1J7H A;  1GO0 A;  2RHO A;  1XRG A;  4ZHQ A;  3QUW A;  3CPW F;  2OTM A;  1VQO F;  1H7M A;  4LNU A;  4BT2 A;  3J7A R;  2FGY A;  3C9U A;  2YXZ A;  3HKB B;  3FPI A;  3J80 M;  4G4Z A;  1VK3 A;  3VCZ A;  3CCM F;  3WJQ A;  4EI9 A;  1TVK A;  5JQG B;  2LBT A;  1RQ7 A;  1H47 A;  3CYP B;  3SIV A;  5HXZ A;  3SIU A;  4X1Y A;  1SA0 B;  3S03 A;  1M90 H;  1OFU A;  2HP0 A;  2VAW A;  3S02 A;  1QAH A;  3PAF A;  5C8Y A;  5G4U C;  2Z1F A;  5JVD B;  2GVI A;  3WGJ A;  1W5E A;  1ODE A;  4O4H B;  2Q1Y A;  2KGW A;  5EB1 B;  3WJR A;  1YIT F;  3E20 B;  1QU9 A;  2QTP A;  3LWR C;  1CN7 A;  1ZWZ A;  3HKE A;  3FBA A;  1FFX B;  4TV8 A;  2CW4 A;  2DYY A;  3LWQ C;  3AGK A;  3VYS C;  3C8L A;  3T80 A;  3RYH B;  3WGL A;  2CSL A;  3I55 F;  3N2G A;  5J2U B;  2I6D A;  2R75 1;  5KX5 A;  3CC7 F;  2JNB A;  5LP6 A;  2P6Y A;  3RA5 A;  1YJ9 F;  2DT4 A;  5CA1 A;  1VQL F;  3HKB A;  4I4T B;  5LP6 C;  3TD3 A;  3F0G A;  5ITZ B;  3VTI C;  1IV1 A;  3HKD B;  3MBM A;  3LWV C;  1RA4 A;  2H8C A;  5JQG A;  3CCQ F;  3HJW C;  4EI7 A;  3N4Z A;  4EI8 A;  5IJ9 A;  5LXT A;  1UFY A;  4TZZ A;  2UYK A;  1W42 A;  1KNJ A;  2BO1 A;  3JAR A;  4FFB B;  5FNV A;  3VI6 A;  4X20 A;  3D54 A;  3KJK A;  2KTV A;  1K73 H;  3WGM A;  5JVD A;  3GTZ A;  1XHO A;  5EWR A;  4LNU B;  5LA6 B;  1VQ8 F;  3UT5 A;  3F6M A;  4KWE A;  5IJ0 A;  3RYH A;  1VQ4 F;  3V7E A;  3TD5 A;  3CCL F;  3KJJ A;  1TVK B;  4C4W C;  3VOA A;  5J2U A;  2CZW A;  2HP0 B;  1Q7Y H;  1X25 A;  5GIN C;  2AMT A;  3D01 A;  5ITZ A;  3LWP C;  1QVF F;  5C8Y B;  4G4V A;  4U3J B;  3OW2 F;  3F0E A;  2OTL F;  2RHL A;  3K0T A;  5CB4 B;  2BTQ B;  3VIU A;  3B6N A;  4C81 A;  4TUY A;  3JCM M;  4ZHY B;  3OON A;  1VQ6 F;  4ZOL B;  2N48 A;  1W5B A;  2V9Y A;  2BTU A;  3P4E A;  5HXU A;  1GX1 A;  1KNK A;  5HY4 A;  4TV8 B;  1KC8 H;  3D00 A;  3S0Y A;  2PHN A;  2K1S A;  4O4I A;  3N2G B;  4ZI7 B;  1KQS F;  3EOR A;  1U3P A;  3CYQ A;  5KX5 B;  5LA6 A;  3P10 A;  5JCO C;  5LP6 B;  5CA1 B;  4LCK A;  3RYC A;  1X7O A;  5FLX M;  5IYZ B;  4X1I B;  4BVT A;  3ON1 A;  4X3L A;  1NMU B;  3TD4 A;  4O2B B;  2HS0 A;  2CVL A;  5IJ9 B;  5LXT B;  2UYP A;  3V7Q A;  4WBN A;  3S0H A;  1W41 A;  3JAR B;  5DCV A;  5FNV B;  3S06 A;  1T0K B;  4X20 B;  1T0A A;  1VQP F;  3U0O A; 
#chains in the Genus database with same CATH homology
 2H6L A;  2NMU A;  1XV2 A;  4BT4 A;  4BT2 A;  4BT3 A;  4BT6 A;  2HX0 A;  4BT5 A;  4BT7 A;  3HWU A;  3HTN A;  2P6Y A;  2DT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...