2HX0A

Three-dimensional structure of the hypothetical protein from salmonella cholerae-suis (aka salmonella enterica) at the resolution 1.55 a. northeast structural genomics target scr59.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
138
Chain Sequence
b'HHNASTARFYALRLLPGQEVFSQLHAFVQQNQLRAAWIAGCTGSLTDVALRYAGQEATTSLTGTFEVISLNGTLELTGEHLHLAVSDPYGVMLGGHMMPGCTVRTTLELVIGELPALTFSRQPCAISGYDELHISSRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative DNA-binding protein
publication title Three-dimensional structure of the hypothetical protein from Salmonella cholerae-suis (aka Salmonella enterica) at the resolution 1.55 A. Northeast Structural Genomics target ScR59.
rcsb
source organism Salmonella choleraesuis
molecule tags Dna binding protein
total genus 33
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03479 DUF296 Plants and Prokaryotes Conserved (PCC) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.80 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Hypothetical protein, similar to alpha- acetolactate decarboxylase; domain 2 2hx0A01
4BT6A 4BT7A 2H6LA 3HWUA 2HX0A 4BT5A 1XV2A 4BT4A 2DT4A 4BT3A 3HTNA 2P6YA 4BT2A 2NMUA
chains in the Genus database with same CATH superfamily
4BVQA 3IEQA 4HNAA 5IYZB 2VAWA 5KMGB 5EIBD 4C8GA 4ZOLA 1ODEA 1FSZA 4ZHWA 2OTJF 3RA5A 3V3TA 1IV2A 5IT9M 1W57A 3N2GB 2QI2A 1VQ6F 4YJ3B 5JH7A 2YYEA 4ZI7A 5GONB 2Z01A 3JAWB 4X1IB 3HWUA 1RA4A 3F6MA 3IEWA 4YJ2A 1CLIA 4G4WA 4DXDA 3D00A 2DYYA 5CB4A 3LWRC 2RHLA 1VQ5F 4LNUB 3WPWA 2AIFA 4FFBA 2VGNA 4BT7A 4O2AA 1Q82H 3C8LA 1FNKA 3JASB 3RYIB 2AIZP 4O4IA 2FC3A 3QHDA 4EB6B 1UFYA 3ZO8A 5LXTB 5EO3A 5GIOC 3CCSF 3T80A 1Q86H 1TUBA 1XBIA 3OONA 1VQPF 3E20B 4BW0B 1DT9A 2VAPA 5BMVA 1Q81H 1YQNA 3VO8A 4IHJA 3FD5A 4B46A 4EI7A 4EI9A 1JFFA 3S02A 1CK2A 5LYJB 2LCAA 4TUYB 1U3PA 1SDSA 1FNJA 1R1MA 3TD4A 3LWPC 2RHOA 3NMUC 3K12A 3LWVC 2VXYA 3UT5B 4C8IA 4C81A 1X7PA 5ITZB 3SIVA 1QU9A 4I4TB 2PMPA 1U43A 5HY2A 3VMFB 2HQSC 3GTZA 1ONIA 3N2GA 5LA6A 4YJ3A 5JCOC 2KTUA 1JD1A 4XCQA 5GONA 4BVSA 3JAWA 1YIJF 3JAKB 2UYJA 1QAHA 3KIZA 2Q1XA 1VHAA 3VOBA 2CW4A 1J7HA 1W2BF 1S72F 1T0KB 1VQNF 3RYIA 2Z1FA 2CZWA 3IR9A 3CC7F 2UYNB 2HVYD 3S03A 1YJ9F 2Z1UA 3ZP7A 3MBMA 5MN4A 2BTUA 2ZF8A 3KJKA 3C9TA 4U3JA 4NUTA 4IIJB 3CC4F 3RYFB 4LCKA 5LYJA 5LP6C 1IV4A 4TUYA 3JCMM 3WJPA 3CYQA 3LDTA 5KX5A 4E6EA 3G6EF 3K0TA 4PWTA 1KQSF 2Z1EA 3IMPA 3CXCF 1VQ8F 3HAXD 2EWCA 1VQKF 5GINC 4B45A 3EORA 3WPXA 4I4TA 3G71F 2BTOA 5DCVA 2ALEA 3CMEF 2VGMA 4O2BA 3FFMA 3D54A 1W581 1GO0A 1KD1H 2R6R1 3HKEB 4NWOB 5HY1A 4NQ3A 3E22B 3I3FA 1SA0B 3K2XA 3JAKA 1RLUA 4TV9B 5EYPA 1IPAA 2HRUA 4TV8A 5J2UB 1QVGF 2W8BC 4BT2A 2HS0A 3RYHB 4DRXB 3CCRF 5B8FA 3M4SA 3N4ZA 5GAPK 4X20A 2UYNA 3NK7A 3CCLF 2GVIA 3KJJA 3RA6A 3WJRA 1KNJA 4G4YA 3DC2A 4C82A 3HKCA 5A2QM 4IIJA 2H8EA 1PF5A 5CA0A 3RYFA 4EI8A 5JVDA 4BT4A 4ERHA 3WGMA 2I6RA 2GLZA 3CCUF 3C9UA 1QVFF 3V4DA 4ZHQB 2HS3A 3L7QA 2UYKA 1H7MA 3ESJA 1IV1A 3RE3A 4F6RB 1DBFA 4BVRA 3HKDA 4U39A 4X1YA 5IJ9B 3VYSC 5IJ0B 3CCMF 2YXZA 3GHZA 3HKEA 1VQ7F 1VQMF 1VQLF 3E22A 1VK3A 1NQ3A 4ZK7A 3VYTC 3JATB 1COMA 2HRYA 3M1XA 3N2KA 3WGNA 2QA4F 3P0ZA 4R40B 2LBXA 2P6YA 1H47A 2BTQB 3LWQC 5J2UA 4O4JB 5EWRA 1PXWA 5IYZA 5KMGA 1W5EA 4WBNB 3G4SF 4B5CA 3PAFA 2ZAUA 1OFUA 4KWEA 5EZYB 4X3LA 2RHJA 5FLXM 2NMUA 1FFXB 2ZOVA 2HX0A 4X1IA 3MCQA 1M90H 1OAPA 5HP8A 3GYQA 4ZHVA 4LNUA 3ZP4A 2OHWA 3R0PA 1KC8H 1YI2F 3ERNA 5LOVB 3CCVF 2OTLF 1U3LA 2ZVZA 3D01A 5FNVB 3JASA 3JARB 4BY9D 1M1KH 1RQ2A 3C9RA 4M8IA 2MQEA 4EB6A 3JALB 4I55B 3TD5A 5JQGB 2KG4A 4ZHQA 1X7OA 3CPWF 5LXTA 1X25A 3JVHA 3CCQF 5EB0A 2HP0B 3VIUA 3F0GA 5AVMA 4B62A 5HY0A 5IJ9A 1K8AH 5IJ0A 3VI6A 3E1YA 3I7TA 2RB9A 3WXMB 3LWOC 1VQ4F 4HNAB 2UYPA 3CMAF 3CCJF 3J80M 1NMUB 3JATA 4ZOLB 3J7AR 5EB1B 3NK6A 4O4JA 3MDOA 1IV3A 5EIBC 3UT5A 3HTNA 5JH7B 1YJWF 5ITZA 5MN6A 2IAFA 3KHNA 2L26A 5EZYA 2RHHA 3NVIB 4YJ2B 2VAMA 4C4WC 4O2AB 3N4YA 3M84A 4BVTA 1Z5VA 2F9ZC 3VCZA 2ZODA 5HY4A 5C8YB 5EAZA 5LOVA 3ON1A 1T0AA 2GZLA 2LBWA 2R751 3B6NA 1W41A 1VQVA 3CC2F 4I55A 5HP7A 1N8RH 3QTYA 3IKEA 1RLGA 2OTMA 5FJ4C 2HP0A 5BMVB 4G4XA 3OW2F 2CWJA 1W59A 3K14A 2H8CA 4RHAA 4O4HB 1JFFB 2QTPA 2IG8A 5GIPC 2I6DA 5CA1B 1VQ9F 4BT5A 3ELCA 1Q7YH 1E7KA 2CVLA 5LP6B 1SZQA 4C8EA 1XRGA 3U0OA 1GZ0A 4X3MA 5LA6B 3WGLA 3CYPB 3VTIC 3P10A 3CB2A 2H6LA 5MN5A 3BYQA 2HP3A 1YHQF 5JCOA 3HJWC 1W5BA 2DT4A 2FGYA 3O85A 4I50B 1YITF 5J2TB 2OZBA 2Q1YA 1SA0A 3V7EA 4TV9A 3CG6A 5C8YA 1YJNF 3CD6F 3I55F 4X1KB 3WGKA 3RYHA 3OBWA 2AMTA 3S0YA 4DRXA 3LMEA 1W3EX 2LBTA 5HXUA 4ZHYB 3TD3A 5HWEA 4RQOA 1W5FA 3FPIA 3MCAB 4U3JB 2KGWA 3HKBB 2B33A 3VOAA 1RQ7A 3FBAA 4O4HA 2CHTA 3F0FA 1QD9A 3MQWA 5CA1A 5KX5B 2N48A 3C9SA 2JNBA 5LP6A 4O4LB 2KTVA 1Q8RA 1W5AA 3V7QA 2K1SA 3SIUA 1TVKB 5G4VC 5G4UC 3F0DA 3P4EA 2Z1TA 2V9YA 4O2BB 3DDNA 3WGJA 1X52A 2WALA 3RYCB 5HXZA 1K9MH 4F6RA 3ZOPA 3Q8HA 4G4ZA 1XV2A 3CCEF 3PLAC 5EYPB 4I50A 1ZWZA 4TV8B 5J2TA 3FD6A 1VQOF 1GX1A 2CSLA 3CPQA 4X20B 3J81M 4X1KA 1JY8A 1JN1A 4WBNA 4ZI7B 3KE1A 3I56F 2BO1A 4BT3A 4G88A 1YGYA 2UZHA 3HKCB 5CB4B 1W55A 3S06A 1Z5WA 3HKBA 5CA0B 1FFXA 1UI9A 3QUWA 4FFBB 2PHNA 1CN7A 3F0EA 5JVDB 4BT6A 3JAMM 3IKFA 4G4VA 2IQQA 4O4IB 1VH8A 5GANK 2G9IA 3OBYA 4O4LA 2CHSA 3S0WA 5FNVA 3JARA 2QEXF 3S0HA 1K73H 1TUBB 1TVKA 1W40A 2ZVYA 3HKDB 1NJIH 4X1YB 3JALA 3WJQA 5JQGA 3AGKA 1GO1A 1JJ2F 3RYCA 4TZZA 2HS4A 1U40A 3LYBA 3VYUC 3NVKE 3LFOA 4IHJB 1KNKA 1W42A 1H48A 1XHOA 3N2KB
chains in the Genus database with same CATH topology
4BT6A 4BT7A 2H6LA 3HWUA 2HX0A 4BT5A 1XV2A 4BT4A 2DT4A 4BT3A 3HTNA 2P6YA 4BT2A 2NMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BT6 A;  4BT7 A;  2H6L A;  3HWU A;  2HX0 A;  4BT5 A;  1XV2 A;  4BT4 A;  2DT4 A;  4BT3 A;  3HTN A;  2P6Y A;  4BT2 A;  2NMU A; 
#chains in the Genus database with same CATH topology
 4BVQ A;  3IEQ A;  4HNA A;  5IYZ B;  2VAW A;  5KMG B;  5EIB D;  4C8G A;  4ZOL A;  1ODE A;  1FSZ A;  4ZHW A;  2OTJ F;  3RA5 A;  3V3T A;  1IV2 A;  5IT9 M;  1W57 A;  3N2G B;  2QI2 A;  1VQ6 F;  4YJ3 B;  5JH7 A;  2YYE A;  4ZI7 A;  5GON B;  2Z01 A;  3JAW B;  4X1I B;  3HWU A;  1RA4 A;  3F6M A;  3IEW A;  4YJ2 A;  1CLI A;  4G4W A;  4DXD A;  3D00 A;  2DYY A;  5CB4 A;  3LWR C;  2RHL A;  1VQ5 F;  4LNU B;  3WPW A;  2AIF A;  4FFB A;  2VGN A;  4BT7 A;  4O2A A;  1Q82 H;  3C8L A;  1FNK A;  3JAS B;  3RYI B;  2AIZ P;  4O4I A;  2FC3 A;  3QHD A;  4EB6 B;  1UFY A;  3ZO8 A;  5LXT B;  5EO3 A;  5GIO C;  3CCS F;  3T80 A;  1Q86 H;  1TUB A;  1XBI A;  3OON A;  1VQP F;  3E20 B;  4BW0 B;  1DT9 A;  2VAP A;  5BMV A;  1Q81 H;  1YQN A;  3VO8 A;  4IHJ A;  3FD5 A;  4B46 A;  4EI7 A;  4EI9 A;  1JFF A;  3S02 A;  1CK2 A;  5LYJ B;  2LCA A;  4TUY B;  1U3P A;  1SDS A;  1FNJ A;  1R1M A;  3TD4 A;  3LWP C;  2RHO A;  3NMU C;  3K12 A;  3LWV C;  2VXY A;  3UT5 B;  4C8I A;  4C81 A;  1X7P A;  5ITZ B;  3SIV A;  1QU9 A;  4I4T B;  2PMP A;  1U43 A;  5HY2 A;  3VMF B;  2HQS C;  3GTZ A;  1ONI A;  3N2G A;  5LA6 A;  4YJ3 A;  5JCO C;  2KTU A;  1JD1 A;  4XCQ A;  5GON A;  4BVS A;  3JAW A;  1YIJ F;  3JAK B;  2UYJ A;  1QAH A;  3KIZ A;  2Q1X A;  1VHA A;  3VOB A;  2CW4 A;  1J7H A;  1W2B F;  1S72 F;  1T0K B;  1VQN F;  3RYI A;  2Z1F A;  2CZW A;  3IR9 A;  3CC7 F;  2UYN B;  2HVY D;  3S03 A;  1YJ9 F;  2Z1U A;  3ZP7 A;  3MBM A;  5MN4 A;  2BTU A;  2ZF8 A;  3KJK A;  3C9T A;  4U3J A;  4NUT A;  4IIJ B;  3CC4 F;  3RYF B;  4LCK A;  5LYJ A;  5LP6 C;  1IV4 A;  4TUY A;  3JCM M;  3WJP A;  3CYQ A;  3LDT A;  5KX5 A;  4E6E A;  3G6E F;  3K0T A;  4PWT A;  1KQS F;  2Z1E A;  3IMP A;  3CXC F;  1VQ8 F;  3HAX D;  2EWC A;  1VQK F;  5GIN C;  4B45 A;  3EOR A;  3WPX A;  4I4T A;  3G71 F;  2BTO A;  5DCV A;  2ALE A;  3CME F;  2VGM A;  4O2B A;  3FFM A;  3D54 A;  1W58 1;  1GO0 A;  1KD1 H;  2R6R 1;  3HKE B;  4NWO B;  5HY1 A;  4NQ3 A;  3E22 B;  3I3F A;  1SA0 B;  3K2X A;  3JAK A;  1RLU A;  4TV9 B;  5EYP A;  1IPA A;  2HRU A;  4TV8 A;  5J2U B;  1QVG F;  2W8B C;  4BT2 A;  2HS0 A;  3RYH B;  4DRX B;  3CCR F;  5B8F A;  3M4S A;  3N4Z A;  5GAP K;  4X20 A;  2UYN A;  3NK7 A;  3CCL F;  2GVI A;  3KJJ A;  3RA6 A;  3WJR A;  1KNJ A;  4G4Y A;  3DC2 A;  4C82 A;  3HKC A;  5A2Q M;  4IIJ A;  2H8E A;  1PF5 A;  5CA0 A;  3RYF A;  4EI8 A;  5JVD A;  4BT4 A;  4ERH A;  3WGM A;  2I6R A;  2GLZ A;  3CCU F;  3C9U A;  1QVF F;  3V4D A;  4ZHQ B;  2HS3 A;  3L7Q A;  2UYK A;  1H7M A;  3ESJ A;  1IV1 A;  3RE3 A;  4F6R B;  1DBF A;  4BVR A;  3HKD A;  4U39 A;  4X1Y A;  5IJ9 B;  3VYS C;  5IJ0 B;  3CCM F;  2YXZ A;  3GHZ A;  3HKE A;  1VQ7 F;  1VQM F;  1VQL F;  3E22 A;  1VK3 A;  1NQ3 A;  4ZK7 A;  3VYT C;  3JAT B;  1COM A;  2HRY A;  3M1X A;  3N2K A;  3WGN A;  2QA4 F;  3P0Z A;  4R40 B;  2LBX A;  2P6Y A;  1H47 A;  2BTQ B;  3LWQ C;  5J2U A;  4O4J B;  5EWR A;  1PXW A;  5IYZ A;  5KMG A;  1W5E A;  4WBN B;  3G4S F;  4B5C A;  3PAF A;  2ZAU A;  1OFU A;  4KWE A;  5EZY B;  4X3L A;  2RHJ A;  5FLX M;  2NMU A;  1FFX B;  2ZOV A;  2HX0 A;  4X1I A;  3MCQ A;  1M90 H;  1OAP A;  5HP8 A;  3GYQ A;  4ZHV A;  4LNU A;  3ZP4 A;  2OHW A;  3R0P A;  1KC8 H;  1YI2 F;  3ERN A;  5LOV B;  3CCV F;  2OTL F;  1U3L A;  2ZVZ A;  3D01 A;  5FNV B;  3JAS A;  3JAR B;  4BY9 D;  1M1K H;  1RQ2 A;  3C9R A;  4M8I A;  2MQE A;  4EB6 A;  3JAL B;  4I55 B;  3TD5 A;  5JQG B;  2KG4 A;  4ZHQ A;  1X7O A;  3CPW F;  5LXT A;  1X25 A;  3JVH A;  3CCQ F;  5EB0 A;  2HP0 B;  3VIU A;  3F0G A;  5AVM A;  4B62 A;  5HY0 A;  5IJ9 A;  1K8A H;  5IJ0 A;  3VI6 A;  3E1Y A;  3I7T A;  2RB9 A;  3WXM B;  3LWO C;  1VQ4 F;  4HNA B;  2UYP A;  3CMA F;  3CCJ F;  3J80 M;  1NMU B;  3JAT A;  4ZOL B;  3J7A R;  5EB1 B;  3NK6 A;  4O4J A;  3MDO A;  1IV3 A;  5EIB C;  3UT5 A;  3HTN A;  5JH7 B;  1YJW F;  5ITZ A;  5MN6 A;  2IAF A;  3KHN A;  2L26 A;  5EZY A;  2RHH A;  3NVI B;  4YJ2 B;  2VAM A;  4C4W C;  4O2A B;  3N4Y A;  3M84 A;  4BVT A;  1Z5V A;  2F9Z C;  3VCZ A;  2ZOD A;  5HY4 A;  5C8Y B;  5EAZ A;  5LOV A;  3ON1 A;  1T0A A;  2GZL A;  2LBW A;  2R75 1;  3B6N A;  1W41 A;  1VQV A;  3CC2 F;  4I55 A;  5HP7 A;  1N8R H;  3QTY A;  3IKE A;  1RLG A;  2OTM A;  5FJ4 C;  2HP0 A;  5BMV B;  4G4X A;  3OW2 F;  2CWJ A;  1W59 A;  3K14 A;  2H8C A;  4RHA A;  4O4H B;  1JFF B;  2QTP A;  2IG8 A;  5GIP C;  2I6D A;  5CA1 B;  1VQ9 F;  4BT5 A;  3ELC A;  1Q7Y H;  1E7K A;  2CVL A;  5LP6 B;  1SZQ A;  4C8E A;  1XRG A;  3U0O A;  1GZ0 A;  4X3M A;  5LA6 B;  3WGL A;  3CYP B;  3VTI C;  3P10 A;  3CB2 A;  2H6L A;  5MN5 A;  3BYQ A;  2HP3 A;  1YHQ F;  5JCO A;  3HJW C;  1W5B A;  2DT4 A;  2FGY A;  3O85 A;  4I50 B;  1YIT F;  5J2T B;  2OZB A;  2Q1Y A;  1SA0 A;  3V7E A;  4TV9 A;  3CG6 A;  5C8Y A;  1YJN F;  3CD6 F;  3I55 F;  4X1K B;  3WGK A;  3RYH A;  3OBW A;  2AMT A;  3S0Y A;  4DRX A;  3LME A;  1W3E X;  2LBT A;  5HXU A;  4ZHY B;  3TD3 A;  5HWE A;  4RQO A;  1W5F A;  3FPI A;  3MCA B;  4U3J B;  2KGW A;  3HKB B;  2B33 A;  3VOA A;  1RQ7 A;  3FBA A;  4O4H A;  2CHT A;  3F0F A;  1QD9 A;  3MQW A;  5CA1 A;  5KX5 B;  2N48 A;  3C9S A;  2JNB A;  5LP6 A;  4O4L B;  2KTV A;  1Q8R A;  1W5A A;  3V7Q A;  2K1S A;  3SIU A;  1TVK B;  5G4V C;  5G4U C;  3F0D A;  3P4E A;  2Z1T A;  2V9Y A;  4O2B B;  3DDN A;  3WGJ A;  1X52 A;  2WAL A;  3RYC B;  5HXZ A;  1K9M H;  4F6R A;  3ZOP A;  3Q8H A;  4G4Z A;  1XV2 A;  3CCE F;  3PLA C;  5EYP B;  4I50 A;  1ZWZ A;  4TV8 B;  5J2T A;  3FD6 A;  1VQO F;  1GX1 A;  2CSL A;  3CPQ A;  4X20 B;  3J81 M;  4X1K A;  1JY8 A;  1JN1 A;  4WBN A;  4ZI7 B;  3KE1 A;  3I56 F;  2BO1 A;  4BT3 A;  4G88 A;  1YGY A;  2UZH A;  3HKC B;  5CB4 B;  1W55 A;  3S06 A;  1Z5W A;  3HKB A;  5CA0 B;  1FFX A;  1UI9 A;  3QUW A;  4FFB B;  2PHN A;  1CN7 A;  3F0E A;  5JVD B;  4BT6 A;  3JAM M;  3IKF A;  4G4V A;  2IQQ A;  4O4I B;  1VH8 A;  5GAN K;  2G9I A;  3OBY A;  4O4L A;  2CHS A;  3S0W A;  5FNV A;  3JAR A;  2QEX F;  3S0H A;  1K73 H;  1TUB B;  1TVK A;  1W40 A;  2ZVY A;  3HKD B;  1NJI H;  4X1Y B;  3JAL A;  3WJQ A;  5JQG A;  3AGK A;  1GO1 A;  1JJ2 F;  3RYC A;  4TZZ A;  2HS4 A;  1U40 A;  3LYB A;  3VYU C;  3NVK E;  3LFO A;  4IHJ B;  1KNK A;  1W42 A;  1H48 A;  1XHO A;  3N2K B; 
#chains in the Genus database with same CATH homology
 4BT6 A;  4BT7 A;  2H6L A;  3HWU A;  2HX0 A;  4BT5 A;  1XV2 A;  4BT4 A;  2DT4 A;  4BT3 A;  3HTN A;  2P6Y A;  4BT2 A;  2NMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...