2HX0A

Three-dimensional structure of the hypothetical protein from salmonella cholerae-suis (aka salmonella enterica) at the resolution 1.55 a. northeast structural genomics target scr59.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
138
Chain Sequence
HHNASTARFYALRLLPGQEVFSQLHAFVQQNQLRAAWIAGCTGSLTDVALRYAGQEATTSLTGTFEVISLNGTLELTGEHLHLAVSDPYGVMLGGHMMPGCTVRTTLELVIGELPALTFSRQPCAISGYDELHISSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the hypothetical protein from Salmonella cholerae-suis (aka Salmonella enterica) at the resolution 1.55 A. Northeast Structural Genomics target ScR59.
rcsb
source organism Salmonella choleraesuis
molecule tags Dna binding protein
molecule keywords Putative DNA-binding protein
total genus 33
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03479 DUF296 Plants and Prokaryotes Conserved (PCC) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.80 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Hypothetical protein, similar to alpha- acetolactate decarboxylase; domain 2 2hx0A01
3HTNA 2HX0A 2P6YA 2DT4A 4BT3A 2NMUA 1XV2A 4BT2A 3HWUA 4BT5A 2H6LA 4BT4A 4BT7A 4BT6A
chains in the Genus database with same CATH superfamily
1ONIA 1IV4A 3G4SF 2RHHA 5FNVB 2IG8A 1W57A 5DCVA 4O2BB 2BTQB 1KQSF 3CCLF 3JARB 3HKBA 3JAWA 2WALA 4LNUB 3HJWC 3B6NA 1CK2A 2MQEA 3CPQA 4LNUA 3JAWB 3C9SA 2HQSC 2QI2A 3Q8HA 5FJ4C 3MQWA 4R40B 3WJRA 3WPWA 4O4IA 1Z5VA 4HNAB 4ZHVA 5MN6A 2EWCA 3I56F 1KC8H 4M8IA 1W581 2Q1YA 3IMPA 1M90H 3J80M 4U39A 3AGKA 4O2AA 3UT5A 3KIZA 3HKDB 4F6RA 3CCQF 2PHNA 2R751 4TV9B 3HKCB 1RLUA 5CA1B 5ITZB 3WGLA 5MN5A 3FBAA 3ZP4A 3SIVA 5IJ0B 1XBIA 2KTUA 2RHOA 4B62A 3I55F 3VYTC 4BT3A 4I55B 5KX5B 3GYQA 3P10A 5LXTA 2Q1XA 3CCMF 2HP3A 4YJ2B 3S0YA 4ZHQB 3CCUF 4ZHWA 1JN1A 3S0HA 1SDSA 2UYNA 2HS0A 3JAKA 2VAMA 1IV2A 4DRXB 3WGJA 3WXMB 1W5AA 3PAFA 2LBXA 3E22B 4ERHA 3LWPC 3CXCF 5EZYA 2CVLA 3HKDA 4F6RB 1Z5WA 2CW4A 3FPIA 1TUBA 3NVKE 3K2XA 2HS4A 3CCSF 5EO3A 5HXZA 5G4UC 5GONB 3MCQA 4X1IB 4I4TB 3E22A 1W42A 3LDTA 1QAHA 2Z1FA 3CYQA 5C8YA 1Q86H 2UYNB 2BO1A 4O4IB 3ZO8A 3CCRF 1YIJF 4C8GA 1U43A 2ALEA 2CSLA 2H8CA 3QTYA 5LYJA 3RYHB 3CCJF 1YQNA 1Q7YH 5KMGB 3VYUC 1W40A 4O4HB 3CC4F 1COMA 5KMGA 3I7TA 2VGNA 1K73H 1YITF 1ODEA 3OBYA 3VO8A 3ZOPA 4X1YA 5EAZA 3RYIB 2KG4A 3ON1A 2ZOVA 1JFFA 3JATA 4NUTA 2ZF8A 5IYZA 5FLXM 4BT6A 5IJ9A 1U3LA 1VQNF 3C9UA 2OTLF 3MCAB 2VXYA 3M84A 4G88A 2GZLA 5B8FA 1NJIH 1W5BA 3RYFB 2YXZA 1XV2A 4G4WA 2UYJA 5LYJB 1VQ8F 4EB6A 4C8EA 3V7EA 3C9TA 3HTNA 2UZHA 3CG6A 5J2TB 1RQ2A 1RLGA 2VAPA 2Z1TA 3TD3A 5EYPB 5J2TA 4BVRA 2HX0A 3GTZA 1GX1A 1VQPF 3WGKA 2W8BC 3FD6A 1SA0B 1QU9A 4NQ3A 3ERNA 2RB9A 3QUWA 1FFXB 4O2BA 2N48A 5JH7A 4G4YA 5HXUA 1H7MA 2HP0B 5IJ0A 1ZWZA 1VHAA 5CA1A 1YI2F 5EZYB 4X1IA 4U3JA 1E7KA 1DT9A 2LBWA 4O2AB 3JASA 3UT5B 1KNJA 2ZVZA 2UYPA 4TZZA 5HP8A 4ZHYB 3D00A 3CMAF 1W5FA 2ZODA 5ITZA 3N4YA 3CCVF 3JVHA 1VQ9F 3JAKB 4YJ2A 4ZI7A 5HY1A 1GO1A 3K0TA 3K12A 1OAPA 4EI8A 5LXTB 3RA6A 5G4VC 3RYHA 2JNBA 1VQ4F 2YYEA 2AIZP 5FNVA 2RHJA 3G71F 4BT7A 5MN4A 1X52A 3HKCA 3MBMA 3RYCB 3G6EF 1VQMF 1VQOF 1RA4A 3MDOA 5CA0A 1JD1A 4IIJA 3F0DA 3VMFB 3P4EA 2FC3A 3JASB 3LYBA 2I6RA 5EB0A 3OW2F 3CC2F 3CD6F 4B46A 5JVDB 3JALA 3JCMM 3CC7F 2OHWA 2CHSA 3DC2A 1W59A 4IHJB 1YGYA 1VK3A 5LP6B 3F0EA 5GIPC 4IHJA 1X25A 3OONA 2NMUA 3LMEA 1T0AA 3IKFA 4WBNB 2GVIA 3S0WA 4X3MA 3VCZA 1KD1H 4WBNA 1VQ6F 4X20B 4EI7A 1PXWA 1TVKA 3KHNA 5AVMA 4EB6B 3N2KA 2IAFA 3LWVC 1T0KB 1UI9A 3SIUA 3S06A 4O4LB 5BMVB 4LCKA 4TV9A 4BW0B 3OBWA 3D54A 3P0ZA 3I3FA 1X7OA 2HP0A 5JVDA 1W41A 4U3JB 1JFFB 1YJ9F 4O4JB 1VQLF 4I50A 1VH8A 3WGNA 3N2KB 3WJPA 5JCOC 5LA6B 3S02A 3LWRC 3CYPB 5LOVB 3E1YA 1JJ2F 2HRUA 4FFBB 1VQ7F 1YJWF 2FGYA 1FSZA 5EYPA 3RE3A 1W3EX 3O85A 1U3PA 3NMUC 3F0GA 3EORA 1QD9A 3JAMM 1M1KH 2VAWA 1IPAA 5LP6C 3F0FA 3VIUA 3HWUA 1KNKA 3N2GA 4X1KB 4I4TA 1OFUA 5GINC 4KWEA 1Q8RA 3R0PA 2LCAA 2I6DA 3NVIB 4B5CA 2B33A 2H8EA 3ZP7A 3IEWA 1GZ0A 1FNKA 1S72F 3WJQA 3E20B 4BVTA 5EIBC 3VI6A 4YJ3A 4TV8A 2AIFA 1TUBB 4NWOB 5JCOA 4BVQA 1FFXA 3IR9A 1YHQF 5CA0B 4C8IA 4X1YB 3CPWF 2V9YA 4BT2A 4G4XA 4ZHQA 5GIOC 4RHAA 4BY9D 3LWOC 3L7QA 3VOBA 4G4VA 1H47A 3KJJA 3HKEB 5CB4A 5GAPK 4ZK7A 3TD5A 2Z1EA 5HY2A 3IKEA 4DXDA 1U40A 1UFYA 4ZI7B 4TV8B 4I50B 3WPXA 3D01A 2QTPA 2H6LA 3M1XA 4ZOLB 3RYIA 1W55A 4IIJB 3JATB 2F9ZC 3K14A 3BYQA 1SA0A 2LBTA 2HRYA 4HNAA 2K1SA 4BT4A 4ZOLA 1QVFF 1VQKF 1SZQA 1CLIA 5A2QM 2HS3A 4O4HA 3VYSC 1IV1A 2ZAUA 1NQ3A 3ESJA 3DDNA 3V4DA 2KTVA 3J7AR 3LFOA 4I55A 2BTUA 5GONA 3ELCA 1N8RH 5HP7A 5JQGB 2G9IA 5HY4A 2OZBA 4TUYA 3HAXD 2DYYA 5LA6A 3FFMA 4FFBA 5KX5A 2PMPA 1RQ7A 1QVGF 2R6R1 1Q82H 1JY8A 5GANK 3IEQA 1K8AH 4DRXA 3CB2A 3J81M 2CHTA 4TUYB 1VQVA 1VQ5F 4C4WC 5EWRA 1IV3A 3VOAA 4RQOA 4XCQA 3KE1A 5JH7B 4E6EA 2BTOA 5HY0A 3N4ZA 3PLAC 2Z01A 3NK7A 1CN7A 1PF5A 3HKBB 5LOVA 3M4SA 3RYFA 3U0OA 1W2BF 3JALB 4YJ3B 1XHOA 4O4JA 3CCEF 2KGWA 1GO0A 2CWJA 2Z1UA 2OTJF 2ZVYA 3LWQC 2VGMA 2P6YA 4PWTA 3GHZA 3CMEF 4C81A 2DT4A 5HWEA 2AMTA 2RHLA 1Q81H 3RA5A 4BT5A 2OTMA 5IYZB 1TVKB 3HKEA 5CB4B 2GLZA 5IT9M 1W5EA 4G4ZA 4O4LA 5BMVA 2L26A 1DBFA 4X3LA 1R1MA 1NMUB 3N2GB 4X1KA 1X7PA 4X20A 5J2UA 3T80A 3QHDA 5JQGA 3S03A 1H48A 2HVYD 5J2UB 3F6MA 5LP6A 1YJNF 1K9MH 4B45A 5C8YB 3VTIC 3JARA 3V3TA 2CZWA 5EIBD 3WGMA 4EI9A 1FNJA 3KJKA 3V7QA 3C9RA 4C82A 2QA4F 2QEXF 3TD4A 2UYKA 1J7HA 5IJ9B 3FD5A 3C8LA 1XRGA 4BVSA 3RYCA 2IQQA 3NK6A 5EB1B
chains in the Genus database with same CATH topology
3HTNA 2HX0A 2P6YA 2DT4A 4BT3A 2NMUA 1XV2A 4BT2A 3HWUA 4BT5A 2H6LA 4BT4A 4BT7A 4BT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HTN A;  2HX0 A;  2P6Y A;  2DT4 A;  4BT3 A;  2NMU A;  1XV2 A;  4BT2 A;  3HWU A;  4BT5 A;  2H6L A;  4BT4 A;  4BT7 A;  4BT6 A; 
#chains in the Genus database with same CATH topology
 1ONI A;  1IV4 A;  3G4S F;  2RHH A;  5FNV B;  2IG8 A;  1W57 A;  5DCV A;  4O2B B;  2BTQ B;  1KQS F;  3CCL F;  3JAR B;  3HKB A;  3JAW A;  2WAL A;  4LNU B;  3HJW C;  3B6N A;  1CK2 A;  2MQE A;  3CPQ A;  4LNU A;  3JAW B;  3C9S A;  2HQS C;  2QI2 A;  3Q8H A;  5FJ4 C;  3MQW A;  4R40 B;  3WJR A;  3WPW A;  4O4I A;  1Z5V A;  4HNA B;  4ZHV A;  5MN6 A;  2EWC A;  3I56 F;  1KC8 H;  4M8I A;  1W58 1;  2Q1Y A;  3IMP A;  1M90 H;  3J80 M;  4U39 A;  3AGK A;  4O2A A;  3UT5 A;  3KIZ A;  3HKD B;  4F6R A;  3CCQ F;  2PHN A;  2R75 1;  4TV9 B;  3HKC B;  1RLU A;  5CA1 B;  5ITZ B;  3WGL A;  5MN5 A;  3FBA A;  3ZP4 A;  3SIV A;  5IJ0 B;  1XBI A;  2KTU A;  2RHO A;  4B62 A;  3I55 F;  3VYT C;  4BT3 A;  4I55 B;  5KX5 B;  3GYQ A;  3P10 A;  5LXT A;  2Q1X A;  3CCM F;  2HP3 A;  4YJ2 B;  3S0Y A;  4ZHQ B;  3CCU F;  4ZHW A;  1JN1 A;  3S0H A;  1SDS A;  2UYN A;  2HS0 A;  3JAK A;  2VAM A;  1IV2 A;  4DRX B;  3WGJ A;  3WXM B;  1W5A A;  3PAF A;  2LBX A;  3E22 B;  4ERH A;  3LWP C;  3CXC F;  5EZY A;  2CVL A;  3HKD A;  4F6R B;  1Z5W A;  2CW4 A;  3FPI A;  1TUB A;  3NVK E;  3K2X A;  2HS4 A;  3CCS F;  5EO3 A;  5HXZ A;  5G4U C;  5GON B;  3MCQ A;  4X1I B;  4I4T B;  3E22 A;  1W42 A;  3LDT A;  1QAH A;  2Z1F A;  3CYQ A;  5C8Y A;  1Q86 H;  2UYN B;  2BO1 A;  4O4I B;  3ZO8 A;  3CCR F;  1YIJ F;  4C8G A;  1U43 A;  2ALE A;  2CSL A;  2H8C A;  3QTY A;  5LYJ A;  3RYH B;  3CCJ F;  1YQN A;  1Q7Y H;  5KMG B;  3VYU C;  1W40 A;  4O4H B;  3CC4 F;  1COM A;  5KMG A;  3I7T A;  2VGN A;  1K73 H;  1YIT F;  1ODE A;  3OBY A;  3VO8 A;  3ZOP A;  4X1Y A;  5EAZ A;  3RYI B;  2KG4 A;  3ON1 A;  2ZOV A;  1JFF A;  3JAT A;  4NUT A;  2ZF8 A;  5IYZ A;  5FLX M;  4BT6 A;  5IJ9 A;  1U3L A;  1VQN F;  3C9U A;  2OTL F;  3MCA B;  2VXY A;  3M84 A;  4G88 A;  2GZL A;  5B8F A;  1NJI H;  1W5B A;  3RYF B;  2YXZ A;  1XV2 A;  4G4W A;  2UYJ A;  5LYJ B;  1VQ8 F;  4EB6 A;  4C8E A;  3V7E A;  3C9T A;  3HTN A;  2UZH A;  3CG6 A;  5J2T B;  1RQ2 A;  1RLG A;  2VAP A;  2Z1T A;  3TD3 A;  5EYP B;  5J2T A;  4BVR A;  2HX0 A;  3GTZ A;  1GX1 A;  1VQP F;  3WGK A;  2W8B C;  3FD6 A;  1SA0 B;  1QU9 A;  4NQ3 A;  3ERN A;  2RB9 A;  3QUW A;  1FFX B;  4O2B A;  2N48 A;  5JH7 A;  4G4Y A;  5HXU A;  1H7M A;  2HP0 B;  5IJ0 A;  1ZWZ A;  1VHA A;  5CA1 A;  1YI2 F;  5EZY B;  4X1I A;  4U3J A;  1E7K A;  1DT9 A;  2LBW A;  4O2A B;  3JAS A;  3UT5 B;  1KNJ A;  2ZVZ A;  2UYP A;  4TZZ A;  5HP8 A;  4ZHY B;  3D00 A;  3CMA F;  1W5F A;  2ZOD A;  5ITZ A;  3N4Y A;  3CCV F;  3JVH A;  1VQ9 F;  3JAK B;  4YJ2 A;  4ZI7 A;  5HY1 A;  1GO1 A;  3K0T A;  3K12 A;  1OAP A;  4EI8 A;  5LXT B;  3RA6 A;  5G4V C;  3RYH A;  2JNB A;  1VQ4 F;  2YYE A;  2AIZ P;  5FNV A;  2RHJ A;  3G71 F;  4BT7 A;  5MN4 A;  1X52 A;  3HKC A;  3MBM A;  3RYC B;  3G6E F;  1VQM F;  1VQO F;  1RA4 A;  3MDO A;  5CA0 A;  1JD1 A;  4IIJ A;  3F0D A;  3VMF B;  3P4E A;  2FC3 A;  3JAS B;  3LYB A;  2I6R A;  5EB0 A;  3OW2 F;  3CC2 F;  3CD6 F;  4B46 A;  5JVD B;  3JAL A;  3JCM M;  3CC7 F;  2OHW A;  2CHS A;  3DC2 A;  1W59 A;  4IHJ B;  1YGY A;  1VK3 A;  5LP6 B;  3F0E A;  5GIP C;  4IHJ A;  1X25 A;  3OON A;  2NMU A;  3LME A;  1T0A A;  3IKF A;  4WBN B;  2GVI A;  3S0W A;  4X3M A;  3VCZ A;  1KD1 H;  4WBN A;  1VQ6 F;  4X20 B;  4EI7 A;  1PXW A;  1TVK A;  3KHN A;  5AVM A;  4EB6 B;  3N2K A;  2IAF A;  3LWV C;  1T0K B;  1UI9 A;  3SIU A;  3S06 A;  4O4L B;  5BMV B;  4LCK A;  4TV9 A;  4BW0 B;  3OBW A;  3D54 A;  3P0Z A;  3I3F A;  1X7O A;  2HP0 A;  5JVD A;  1W41 A;  4U3J B;  1JFF B;  1YJ9 F;  4O4J B;  1VQL F;  4I50 A;  1VH8 A;  3WGN A;  3N2K B;  3WJP A;  5JCO C;  5LA6 B;  3S02 A;  3LWR C;  3CYP B;  5LOV B;  3E1Y A;  1JJ2 F;  2HRU A;  4FFB B;  1VQ7 F;  1YJW F;  2FGY A;  1FSZ A;  5EYP A;  3RE3 A;  1W3E X;  3O85 A;  1U3P A;  3NMU C;  3F0G A;  3EOR A;  1QD9 A;  3JAM M;  1M1K H;  2VAW A;  1IPA A;  5LP6 C;  3F0F A;  3VIU A;  3HWU A;  1KNK A;  3N2G A;  4X1K B;  4I4T A;  1OFU A;  5GIN C;  4KWE A;  1Q8R A;  3R0P A;  2LCA A;  2I6D A;  3NVI B;  4B5C A;  2B33 A;  2H8E A;  3ZP7 A;  3IEW A;  1GZ0 A;  1FNK A;  1S72 F;  3WJQ A;  3E20 B;  4BVT A;  5EIB C;  3VI6 A;  4YJ3 A;  4TV8 A;  2AIF A;  1TUB B;  4NWO B;  5JCO A;  4BVQ A;  1FFX A;  3IR9 A;  1YHQ F;  5CA0 B;  4C8I A;  4X1Y B;  3CPW F;  2V9Y A;  4BT2 A;  4G4X A;  4ZHQ A;  5GIO C;  4RHA A;  4BY9 D;  3LWO C;  3L7Q A;  3VOB A;  4G4V A;  1H47 A;  3KJJ A;  3HKE B;  5CB4 A;  5GAP K;  4ZK7 A;  3TD5 A;  2Z1E A;  5HY2 A;  3IKE A;  4DXD A;  1U40 A;  1UFY A;  4ZI7 B;  4TV8 B;  4I50 B;  3WPX A;  3D01 A;  2QTP A;  2H6L A;  3M1X A;  4ZOL B;  3RYI A;  1W55 A;  4IIJ B;  3JAT B;  2F9Z C;  3K14 A;  3BYQ A;  1SA0 A;  2LBT A;  2HRY A;  4HNA A;  2K1S A;  4BT4 A;  4ZOL A;  1QVF F;  1VQK F;  1SZQ A;  1CLI A;  5A2Q M;  2HS3 A;  4O4H A;  3VYS C;  1IV1 A;  2ZAU A;  1NQ3 A;  3ESJ A;  3DDN A;  3V4D A;  2KTV A;  3J7A R;  3LFO A;  4I55 A;  2BTU A;  5GON A;  3ELC A;  1N8R H;  5HP7 A;  5JQG B;  2G9I A;  5HY4 A;  2OZB A;  4TUY A;  3HAX D;  2DYY A;  5LA6 A;  3FFM A;  4FFB A;  5KX5 A;  2PMP A;  1RQ7 A;  1QVG F;  2R6R 1;  1Q82 H;  1JY8 A;  5GAN K;  3IEQ A;  1K8A H;  4DRX A;  3CB2 A;  3J81 M;  2CHT A;  4TUY B;  1VQV A;  1VQ5 F;  4C4W C;  5EWR A;  1IV3 A;  3VOA A;  4RQO A;  4XCQ A;  3KE1 A;  5JH7 B;  4E6E A;  2BTO A;  5HY0 A;  3N4Z A;  3PLA C;  2Z01 A;  3NK7 A;  1CN7 A;  1PF5 A;  3HKB B;  5LOV A;  3M4S A;  3RYF A;  3U0O A;  1W2B F;  3JAL B;  4YJ3 B;  1XHO A;  4O4J A;  3CCE F;  2KGW A;  1GO0 A;  2CWJ A;  2Z1U A;  2OTJ F;  2ZVY A;  3LWQ C;  2VGM A;  2P6Y A;  4PWT A;  3GHZ A;  3CME F;  4C81 A;  2DT4 A;  5HWE A;  2AMT A;  2RHL A;  1Q81 H;  3RA5 A;  4BT5 A;  2OTM A;  5IYZ B;  1TVK B;  3HKE A;  5CB4 B;  2GLZ A;  5IT9 M;  1W5E A;  4G4Z A;  4O4L A;  5BMV A;  2L26 A;  1DBF A;  4X3L A;  1R1M A;  1NMU B;  3N2G B;  4X1K A;  1X7P A;  4X20 A;  5J2U A;  3T80 A;  3QHD A;  5JQG A;  3S03 A;  1H48 A;  2HVY D;  5J2U B;  3F6M A;  5LP6 A;  1YJN F;  1K9M H;  4B45 A;  5C8Y B;  3VTI C;  3JAR A;  3V3T A;  2CZW A;  5EIB D;  3WGM A;  4EI9 A;  1FNJ A;  3KJK A;  3V7Q A;  3C9R A;  4C82 A;  2QA4 F;  2QEX F;  3TD4 A;  2UYK A;  1J7H A;  5IJ9 B;  3FD5 A;  3C8L A;  1XRG A;  4BVS A;  3RYC A;  2IQQ A;  3NK6 A;  5EB1 B; 
#chains in the Genus database with same CATH homology
 3HTN A;  2HX0 A;  2P6Y A;  2DT4 A;  4BT3 A;  2NMU A;  1XV2 A;  4BT2 A;  3HWU A;  4BT5 A;  2H6L A;  4BT4 A;  4BT7 A;  4BT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...