4TV8B

Tubulin-maytansine complex
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
428
structure length
427
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title A new tubulin-binding site and pharmacophore for microtubule-destabilizing anticancer drugs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 169
structure length 427
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4tv8B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4tv8B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4tv8B01
4B45A 5C8YA 5MN5A 2VAPA 3JAWB 3HKCA 3JASA 5MN6A 5GONB 5KX5A 4EI7A 4F6RA 3VO8A 3M89A 4O4HA 5JVDA 3VOAA 5IJ0B 4ZI7A 3HKEB 5LOVB 4X1KB 4EI9A 5LYJB 4FFBB 4U3JB 1SA0B 1JFFB 3RYCA 2RHLA 5JQGB 2XKAA 3ZBQA 3RYHA 1W59A 3JALB 5LP6B 2RHOA 5LA6B 5BMVA 5EZYA 4WBNB 3WGKA 1W581 3RB8A 5CA0B 3N2GA 5EIBD 5IJ9A 4B46A 3RYIA 1RQ7A 4XCQA 4O2BB 5KMGB 4EB6A 4O2AB 5EYPA 5J2UB 3HKDA 3VOBA 4TV8B 4IIJB 1W5BA 5JH7B 5LXTB 4X20A 4ZHQB 4M8IA 5J2TB 2BTQB 3E22A 3WGMA 4TV9B 4I4TA 4E6EA 5CA1A 3JAKB 3HKBB 3RYFB 2BTOA 4HNAA 4I55B 4IHJA 4YJ2B 4X1IB 1TVKA 5C8YB 2RHJA 3HKCB 3JASB 4TUYB 5KX5B 5IYZA 3JARA 4YJ3A 1OFUA 2GVIA 1TUBA 4O4HB 4X1YA 4LNUA 4ZI7B 5CB4B 3V3TA 4WBNA 3N2KA 4KWEA 1FFXA 1Z5VA 5ITZA 1W5EA 4O4IA 4U39A 5MN4A 3JATA 3RYHB 1Z5WA 4O4LA 3CB2A 5FNVA 5BMVB 4O4JA 5EZYB 2R751 3ZBPA 3UT5A 3N2GB 4ZOLA 4DRXA 3WGNA 4I50A 5IJ9B 3RYIB 3JAWA 5JCOA 2VAMA 5GONA 4EB6B 2Q1XA 3VO9A 3HKDB 2BTQA 5IJ0A 3HKEA 5LOVA 4X1KA 1RLUA 5LYJA 4FFBA 4U3JA 5JCOC 1SA0A 1JFFA 4X20B 4F6RB 5JQGA 5JVDB 3E22B 3JALA 2RHHA 4I4TB 5LP6A 5LA6A 3VPAA 5CA1B 4TUYA 3RYCB 5CA0A 4HNAB 4IHJB 1W5FA 3WGLA 3R4VA 1TVKB 4EI8A 1W5AA 3WGJA 5CB4A 2XKBA 2VAWA 2Q1YA 5LP6C 4O2BA 5EIBC 5IYZB 3JARB 5KMGA 4O2AA 4YJ3B 5J2UA 2VXYA 3ZIDA 1TUBB 4X1YB 4TV8A 4LNUB 3C8LA 4IIJA 5JH7A 3N2KB 5LXTA 1FFXB 5EYPB 4ZHQA 5ITZB 4O4IB 5J2TA 1FSZA 3JATB 4TV9A 4O4LB 2R6R1 5FNVB 4O4JB 5M7EA 3JAKA 3HKBA 3RYFA 4DXDA 1RQ2A 4I55A 3UT5B 4ZOLB 4X1IA 4DRXB 4YJ2A 3M8KA 4I50B
chains in the Genus database with same CATH superfamily
1VBMA 5K8CA 1GIAA 3PGJA 4D8TA 1NTKH 1XHZA 2YFHA 2EJBA 2AL7A 3ICQB 3AETB 2GM3A 2ZRKA 2AXEA 4CCWA 4F4DA 1UKCA 2ZYGA 4KVGA 2I80A 1KEPA 4HUJA 1JNXX 2VUHB 5DGDA 1U3PA 1GNVA 2IXBA 3H6HA 1A8SA 3W5DA 4JXZA 3RHSA 1XZLA 4B32A 3O85A 3PFIA 1KEEB 1TM4E 1JJ7A 4Z9BA 4BGDA 2CVZA 3C90A 2CHFA 3M82A 1BSVA 3LL4A 2WYWA 3OLXA 3MCZA 1KYZA 2FUG1 3AR5A 2JF0A 3S0WA 2FPMA 3HAXD 4X5OA 5CB0A 1COWD 2O8NA 1M8GA 4MUHA 5BUZA 1E4EA 1AF7A 1PCXA 5FLEX 3PKJA 4JLUA 1WXGA 1DNPA 1V1MA 1NIJA 3U7EB 1ECGA 1ZMXA 3WRVA 5EE5B 3O0DA 2DHRA 4FFBB 4B3HA 3ZBQA 2Q1SA 4FVTA 4X24A 3E1GA 1HQYE 3ZU3A 2XIQA 3W8RA 3WZMA 3MELA 1NW6A 2Q6LA 3W06A 3PGA1 4BO7A 2AEEA 2XW6A 4X1OA 3AY6A 1WLEA 2XMGA 3GMDA 1P72A 3PUXA 4TZZA 3CNNA 3SEAA 3C85A 4QIWF 1M83A 4G1BA 2WFLB 4DNQA 1XNRO 5JVDF 4IIYA 1XZCA 4ER5A 2QTNA 4IFBA 1E6LA 4GOKA 3QKSB 4NE2A 2GN8A 4ZO4A 1WCV1 1UC9A 4HD8A 1L5OA 3JSNA 1G3QA 1KZ4A 3VOSA 2VJKA 3TGPA 3QVGA 3CUWA 2V7XA 1INLA 3HU2A 2W2KB 2Q28A 4EJ0A 3CPSA 2X3UA 3CN9A 2PMPA 2Q8PA 3WS7A 2YWEA 4TZTA 4MPRA 1CY8A 1PT6A 1L5SA 5FFMA 3WBFA 2XD9A 4JZKA 2CZCA 4WZAA 2C7BA 4YUZA 4JR1A 2JNBA 2GSDA 1T9HA 4XJVA 2XECA 4KDFA 3IFSA 3DCYA 4L0QA 1F8YA 2GEJA 4K1LA 1MQ9A 3H4IA 4LFAO 3A6EA 2B2NA 1NV8A 2FW8A 1S8OA 3V7NA 1JLHA 2DULA 5EWLA 3BXGA 5HZHA 4YR9A 1VKRA 1DQPA 1N9GB 1NKDA 1ZMOA 1GQQA 3ZHVA 3SPGA 3P71T 4F4HA 4Q0MA 1NI4B 1G5QA 3JCZA 5CPFA 1R00A 2OCGA 4PAGA 3NKFA 1TA4A 5FA6A 3G6WA 4Z2WA 3DV0B 4M76B 3BAZA 1BXKA 4B7EA 4CFSA 3AJ8A 1M8FA 2HUPA 5AOCA 1WZIA 1TD1A 3GQBA 4JSTA 3GDHA 3H7IA 1RJ9A 2QKCA 2FPIB 3NUZA 5ALKA 1C9JA 5AJZA 1W96A 2JEUA 1UQUA 1VQ1A 1QP4A 2PUEA 2LXNA 3V6LA 2P3QA 3R1IA 3V1YA 4X54A 4RIFA 1ZMRA 1Y1TA 1L4LA 5JNSA 3BMCA 2A79B 3KUKA 3T1TA 4BP1A 2GSMB 3HN6A 1IQRA 2MCFA 1UMDA 3PUKA 5TMPA 8MHTA 2ORYA 3D8NA 4J9ZB 5AHXA 3K0SA 1JIKA 3S6JA 5LBUA 4E4YA 1DF4A 1Z0IA 2D1RA 4UZFA 1UZLA 3EGWA 4EENA 4H3HB 2X0DA 4WLOA 3SOZA 3PYMA 1P61B 3I04A 5HFLA 4QKQA 1E1CA 3JD4A 1FYEA 3N2ZB 5BQPA 2P8SA 2GD0A 3WLTA 1BHJA 3RFUA 4MP6A 5DCYA 1WUYA 4HDOB 3CZ5A 1C0IA 2XVAA 1Q0HA 4M4SA 4TVBA 1Q82W 3AHCA 3OZCA 4JITA 1HW7A 3JXEA 3SSMA 1ECCA 1FXVA 4DIOA 1EN6A 1W0KD 3FAVB 4O02B 1GSOA 1OJ7A 1ZIDA 4HNUA 3JAMM 1AUOA 2E9SA 4QFBA 5JZOA 1QGYA 2PMDA 3FMOB 5HMMA 4CL3A 3SEFA 1T9BA 4QGBA 4CXMA 2G6BA 5KHKA 1VM6A 4FGLA 2VWHA 4DILA 3R5KA 1IV3A 1J42A 1ML4A 1QQAA 1PNVA 4MV8A 5IWAO 5JS6A 2HKIA 1TYEB 2ZKLA 1SVOA 1B3BA 4WK6A 1XREA 5C9ZA 1RLJA 3O4GA 2H1HA 4V38A 1UJ4A 2VN8A 3W7BA 1IL0A 1U8FO 5FJ4C 4C0WA 2GN2A 1ZUHA 4Q4HA 5KYXA 1Q7YH 4Q01A 2R9AA 1WNSA 2H2WA 3P4YA 2VHEA 2A7XA 5BN4A 2K2QB 4JLAA 1SQPH 1Z6YA 2OHVA 3JTMA 3ASOB 1U0HC 1GPUA 3NUQA 1FU8A 4D0GA 2DLNA 1P75A 1CS0B 3CIOA 1DJPA 3OCZA 3FD5A 3RFRA 5H02A 1H8HA 1HBJA 4R8MA 4TTQA 4GP7A 4RD1A 3N2KA 3F73A 3KZNA 1XU4A 2D5IA 1FU4A 3I05A 4LRXA 1M5IA 5KAMA 2RJ3A 3LFHA 4C4RA 1AKNA 5LDDC 2RCYA 5JNRA 3KV1A 3QW4B 3M9WA 3HWWA 4OGWA 1G1XB 1VHWA 1GNTA 3PNQA 1K92A 1VP7A 3EOZA 3OMXA 3O94A 4H1UA 2O23A 4HAWA 5CFMA 3FYHA 2AYYA 3JZDA 4MHOA 4F4CA 4MCHA 3L49A 2R44A 2FL4A 3KXKA 3EZ9A 5AKXA 1DOHA 3R3WA 3EVDA 3MCUA 3NHLA 2NSHA 2ADQB 3RASA 5AI5A 3AX6A 4K2AA 3ZXIA 5EJ9A 3RNOA 1IEXA 1TMGE 1ZLXA 4M9SA 2C8JA 4F71A 3CTMA 3TG8A 4BFSA 4O4LA 1SRRA 3PPWA 3ZHZA 5AI4A 5JCJA 4QJ4A 3FDZA 1VQ6V 1YQWA 2ET6A 3R3XA 3VDNB 2GEKA 4CT4B 2BMEA 3RSGA 3SIWA 3HDQA 2ZE7A 2A57A 7ADHA 3MN1A 1ZGJA 4OXNA 3UHJA 1BMFA 5CNIA 1NX6A 2JCXA 3OOJA 4MTXA 2Z5LA 1R3DA 4F9GA 3HBLA 4EUHA 4RE6A 2BH2A 4I1YA 1EAYA 2FETA 1RT9A 3UQYS 2G72A 1P7PA 1K9MW 3CHXA 3I8XA 3IUSA 2B1JA 3GLIA 1T34A 4DR3B 1IN5A 1O89A 4G6ZA 1HEUA 2ZYRA 5I9SA 2BEUA 5BPHA 3WISA 2Z2YA 4CV2A 1WMDA 1F23A 1FXHA 2RAFA 3AL3A 4EMBA 4RBNA 2P6YA 1BL8A 3HP1A 1NLMA 3P0IA 2WSSD 5AVXA 1ZU4A 3QNEA 5CW1A 2UYNB 3UFXB 1Z5ZA 5LQCA 1KY2A 3ZE7A 4DVGA 4D4HA 4RX1A 1GUZA 1QIIA 5JVDB 3JYLA 2VJMA 3DMRA 5KC8A 1CQIA 1UXGA 5B6PA 2VVTA 1DOAA 2EEZA 1F7UA 4MQLA 2BGNA 3B5IA 2VZEA 3IA7A 4OV6B 3OICA 1ISRA 1RWQA 4QZVA 4HYTA 4I0XB 3TTTA 3BMNA 1PZNA 4OO3A 2RHDA 2IZOA 2IXGA 3WDMA 3IE0A 1OVGA 1XKXA 3CUKA 1AILA 4KLNA 3TLXA 4RS3A 3OPNA 4MO9A 4BNXA 2LCFA 3ECSA 4Y2SA 3BXXA 3PZRA 4QYMA 5AJTA 2UXDO 3PXBA 5JS7A 4PYNA 5JXJA 1T3GA 1BMFG 2AKAB 1MC5A 4AFNA 4LFBB 5ED4A 3OCYA 3HSSA 2R3SA 3EXIA 3LC2O 7AT1A 4EB6B 2F23A 4AJ2A 1R5JA 6LDHA 1J2TA 5L6LB 4DY4A 4ZOEA 1ISPA 3S2FA 1T4GA 1RRFA 2B99A 1K8ZB 2IIBA 1RWXA 1H05A 4UMFA 1SBYA 3S1LA 3COJA 5BSMA 2GBGA 1Q91A 1YR8A 3GAAA 1CY7A 4B62A 1RRMA 1K4KA 2OK7A 4O4LF 1TAEA 2IU0A 1HV8A 4EI2A 4CF6A 2IIQA 3VSEA 1E9FA 1M72A 3VZRA 2YN2A 3MGCA 1QIDA 2A0UA 2LIVA 4YP0A 3PLAC 3K1YA 4M55A 2AHZA 4OQYA 4KIJA 2AHRA 1KY4A 2GARA 1DC7A 3CEPB 1TO1E 5A5FA 4IDGA 3IBGA 1T36A 4U0KA 3QOFA 4KN9S 4R9UC 3HTXA 1N75A 1NTOA 2O0LA 1M90H 3O8DA 1U28A 4FYHA 4YRJA 3SVTA 2QPLA 3AM4A 1H94A 5FWYA 4DSTA 3TIGA 1KE2A 2WT8A 4DSUA 1WF3A 3OE4A 1G5PA 3I9OA 1X7PA 2IWHA 2OCHA 2NG1A 2WINI 4NVRA 1W4ZA 2O5EA 2JEXA 5JG7A 4RE5A 2H8EA 2FFRA 5K0LA 2E5LO 4BNLA 3CZ9A 3OQHA 4TXJA 3TXXA 3IIEA 3GDGA 2ATIA 1NRXA 4IH1A 1Z36A 2RB9A 4FMTA 1XZ8A 1EFVA 5FDFA 3W7TA 1VE3A 4DSZA 2A1TR 1KP9A 1R8QA 2H6LA 3THWB 3HB4X 5K0ZA 1YJXA 3QUTA 1W6RA 4B6SA 5EI5A 1SMKA 3KNZA 2AOUB 1JYSA 3GZJA 3NO4A 3GNQA 2DAPA 2YXHA 4P3NA 3S02A 1QR8A 1B00A 3FETA 1XTQA 1IVYA 4NKRA 3BB3A 3R8CA 1SC6A 3DGFC 2HR3A 5B3KA 4CKCB 4OJKA 3ZW8A 2EX3A 1IX9A 2IGBA 1NYRA 4QDXA 1TJ4A 4WKCA 5EMLA 1AS0A 3LK6A 3WBKA 1CVRA 5JJCA 3VNVA 2XAGA 1NKVA 3AWIA 4NZ9A 2VDKB 1JXOA 3MB8A 4KWCA 5IULC 3R5JA 3KCXA 4OJNA 2WR8A 2JFHA 3F0EA 2OY0A 4KAJA 16PKA 4BEWA 2D7DA 1DAOA 1S2MA 3Q9NA 2Z9CA 1AOXA 5COBA 2VQ3A 3NFYA 3DUFB 2ZBPA 5BVHA 2IHJA 3KOMA 3TL3A 4W6QA 3CZRA 4FEYA 5CA1A 3W1VA 1C7RA 5AVYA 2I6RA 2JGIA 3L43A 4UEOA 1FBNA 1XQXA 1NOJA 1SHUX 4R6XA 5EG5A 3TM5A 1YA8A 2HEIA 2BKUA 4JJKA 1LVHA 4EJ6A 1IBLO 4Q47A 1EHCA 5KINB 4WJZA 2OGTA 2ZRDA 3K2XA 2HCRA 3ABRB 1PRYA 4BT6A 3AL2A 3DZBA 5CFOA 1QFYA 3F6BX 5J1SB 3HZHA 5FYQA 1DHRA 4NHOA 4HYOA 3U56A 1T4MA 3G7SA 5ALEA 1YA6A 3SZOA 3CN7A 2XZDA 1DFIA 5CA0F 3SCZA 4NU8X 2WWHA 2FKXA 1T10A 1MNQA 1GZVA 1YK1A 1Z3CA 2P0AA 5HS4A 4WWHA 4CF7A 2L17A 2YBDA 4TLDA 4LZWA 4MLCA 2WIGA 3EGDB 5F77A 3JD3A 3U7HB 3QVTA 3LHKA 2J5QA 2WU3A 4ARAA 2CAZC 4WFHA 4L73A 5CGZA 3WMFA 3BN3A 1F2DA 4GBJA 2CE2X 1DU4A 3TD6A 3UN1A 4RWZA 1V8BA 1R6VA 4Q3EA 1VGVA 5CBPB 3F7NA 4XA8A 3D4NA 3FMFA 2WLIA 2XDWA 2AZ0A 4X3OA 3ZWQA 3I64A 3S7TA 3BWCA 4QNRA 5EHZA 2R5WA 5KCMA 2PBFA 1W5AA 4G4JA 1TA9A 3RVRA 3F8TA 3I0NA 2OAEA 3JRXA 2XXJA 2G76A 4URFA 1FAFA 2N47A 5ELXA 3ZGXA 4JI4O 2ZXEA 4CMHA 3UMGA 4ENWA 4M54A 3W9SA 1Z22A 3VO8A 3VTIC 5B36A 5BR8O 3EODA 5IAGA 3E9RA 4BEVA 4XGQA 1QHHB 2H4HA 1ZINA 5J5AA 1NG1A 2M6YA 5IP5A 1W581 4E5PA 3MRXA 4AZSA 2A9QA 5B58T 3ZJUA 1WA8A 1T4CB 2F6RA 4BT3A 1XVIA 4PQFA 4P82A 2QD5A 1THTA 4ALJA 4R05A 1KI3A 2XGJA 4EHLA 4W9NC 4X3MA 1JXAA 5CBGA 1TQ6A 2E55A 2Z8ZA 3EIWA 2O19A 3Q4HB 4PO3X 3EA5A 4X97A 5CT8A 2XRZA 2BBSA 1OB5A 1OCZC 4NI5A 4CDGA 2ZF8A 4CUJA 3MJRA 2R47A 4J3JA 3KXLA 2CFOA 2P4EA 1R6UA 4CM9D 3MPUA 3K4HA 4MS1B 5CA1F 1Y5IA 5BSWA 2CD9A 4PG8A 2ZB4A 3KBBA 1NVXQ 3D6NB 2CWDA 3O8OA 1PD0A 2I7DA 3FF1A 5B1OA 4N5NA 1KOLA 1H2ZA 3GWGA 4BUJA 2HMUA 2DKOA 1E0KA 5HF9A 2H92A 2QLJA 1Y4AE 4IW3B 2PE5A 4LZOA 4IBOA 3KAKA 1T5BA 4EP1A 1HTWA 3G49A 3OETA 4C9BA 4XJSA 3C9SA 3OEHA 4Y2UA 5KYKA 2HLDA 1ZIPA 1LLDA 4UHEA 3TZQA 1Y5RA 1TZBA 3W5IA 2G28A 4HI0E 4IVRA 2JFBA 2VDWA 3RVQA 4GBMA 2N42A 1TKCA 4FGUA 2RAUA 2IYSA 1I7NA 3SYKA 4BL5A 1QG0A 4GUNA 2FP4B 1DDIA 4ZCLA 1MX3A 4GKKB 4YAUA 3NM6B 1I08A 2AMVA 1Q5PA 4YR7A 3RRYA 4DXAA 1W48A 4ZT4A 3SY8A 2R11A 3AEYA 2O14A 1E3DA 1F0YA 3IQFA 1TJ3A 1VIAA 3L4BA 2XNDD 2VEDA 4M7PA 2WJYA 1KMQA 4TXLA 3E58A 1ELOA 3R09A 2GD6A 3P0RA 3B78A 3OT5A 3OBYA 2JGFA 1PG2A 2ZAOA 2ESRA 3VYVA 1DCKA 2IM9A 3HR4A 1SBIA 4FE7A 3NAGA 3RS2A 3RS5A 1JAHA 3FOWA 2F1JA 2IX3A 2ZRGA 3U7GA 5ANRB 5K6RA 2W6QA 3HVUA 3RC3A 3E22A 3LUDA 3L7LA 1J1UA 3L7MA 1HNZB 3EZXA 2FLWA 4Z53A 5GM1A 4RXTA 2YJ4A 4F6EA 4H33A 3FKSA 1RWPA 5D84A 7REQA 1NF2A 1T25A 2DQYA 3SXJA 1YZ3A 4P7FA 2DFVA 2NV2B 3EGOA 3HCCA 5BSTA 5HIAA 4Z1MD 3GD7A 4F38A 3OZ7A 3SKVA 3GLIB 2VI5A 4NATA 1S2OA 2IV7A 3ZMUA 3TB6A 3OEHG 2HLDG 4J7JA 2G9RA 2HFKA 4R9RA 4JYPA 3LZCA 5KNBD 1R0XA 1Z6GA 3FPFA 1SXJC 2YIBA 2Y4TA 1CNFA 1BD4A 1KOFA 5ADHA 5CH8A 3B2EA 3T99A 3TR6A 4D6YA 4KGZA 1ETUA 4PTZA 3P19A 4Q66C 4RVFA 2D7JA 3JYQA 4YROA 3JQ9C 4TYNA 4P08A 5KLVH 3SYQA 1CQIB 4MLZA 4D5GA 4OYYA 1I7FA 5H81A 3FTCA 1FS4A 2Q5OA 1BDBA 2HF7A 4XR4A 2VWQA 4FGKA 4ZODA 3B3JA 4DZRA 3AG4B 1QAOA 3D0QA 3ZXSA 4ZAZA 3D8UA 3MTQA 4ND7A 5SZJA 1II8B 4WSOA 1KDPA 1EWVA 4BJHB 4UVGA 3ORSA 5H9WA 5LLSA 3SHTA 4LC1A 4DIBA 3VQYA 4GOXA 5B1NA 4LBZA 1PZGA 5CB6A 5EWRA 3LT0A 4FQ8A 5IKEA 2C5BA 2BR3A 2VA8A 2XBMA 4ZYUA 4A73A 3J7AU 3FZGA 4S1TA 3ZWMA 1C8LA 2GZ1A 1UZUA 2AI1A 3OW2F 3FKSG 2E89A 2VYQA 4RESA 4FLXA 2XNKA 3G9QA 4U1RA 1YQ9A 1RHJA 1KJYA 4GZ6A 4L5CA 2XBUA 5CIWA 5JSZB 1E64A 4JAVC 1RBQA 1MNAA 4EKIA 5IDQA 3E83A 1YUNA 3RAFC 3ZJVA 1U0RA 4DCPA 3GHHA 1X38A 2O5VA 4B4WA 3LDGA 1ENVA 4L4UA 5C1OA 4XQ9A 3WJ7A 5DBOA 3TLGA 4UUNA 1NJIW 5JECA 1HYEA 3T7KA 2R7AA 2XX3A 3T1QA 3ZRXA 5DI9A 3AINA 1HXHA 2X40A 2CTRA 1N2XA 1NPTO 5E7MA 4IYJA 4A2CA 5LQSA 3ITKA 2OV2A 4J94A 4JI1B 1CC1S 4GLJA 4UVCA 1U3TA 2HDNB 3TRFA 4GXRA 3RT9A 3IIMA 5CA0B 2VDMB 1N7GA 4UE3S 1MJHA 3CH5A 2OUIA 4PZ0A 3BT7A 2PZSA 1F7YA 1TT5A 2NT3A 3QEOA 3Q7EA 1KNKA 4TM7A 3A14A 4KLCA 3WL8A 2CC2A 3GJ7A 1NKSA 3AESB 2FZCA 5BV2P 1IPAA 1YK0A 4Q39A 1A8IA 1TU3A 3R9WA 2WJWA 3K6SB 4H7HA 4TMYA 2A5DA 4L9SA 1PL0A 1P4HA 1UFKA 2IZ7A 2JANA 5GZ1A 3CMAV 3HXMA 4NDZA 3KUDA 2WM2A 5K3EA 2DT4A 1L6RA 3A6LA 1NQUA 2P35A 3SF8B 2Y0DA 1T5EA 1EFVB 3M4YA 1VF7A 3L77A 3F8SA 1EA5A 4BFTA 5EOVA 2J6CA 3T5AA 1FF9A 2REBA 3CHYA 4AMVA 3B6ZA 4RF4A 4OM8A 4DFDA 3K70B 1ZWKA 3GJ5A 4TKVB 3WJAA 4R2KA 1I36A 2X4IA 3RU3A 1DIGA 3SNKA 5AM3A 3RR2A 3FCEA 1LI7A 5KO2A 3G13A 5AQEA 3A9RA 3T1NA 1MRSA 2R70A 4JQCA 2NNUA 3F78A 4YAGA 1AB6A 1L2TA 1OFTA 4YV2A 4GX5A 2QRNA 3OGIB 1IV1A 2IOQA 2VNKA 5JI2E 2BW0A 1F0NA 3GT7A 3MJFA 4FR0A 1KMMA 3WP1B 5KEIA 4U7NA 1A96A 1ZU5A 5K3FA 5CB4A 3NIDB 4LTMA 2XVMA 5B3SB 3E1SA 5AD1A 2ZWOA 2GETA 1AR5A 5BVHB 2G5GX 2PD6A 4FS8A 3OLQA 1NASA 4CMJA 3DLCA 3U37A 3L6DA 1GAXA 2VHQA 3TMYA 2X0JA 3UGKA 1U2EA 3DZKA 2X4LA 4OFWA 1NVVR 4MPPA 3GROA 4WFBV 1BROA 3TQHA 4DLVA 2YMPA 3PHIA 3OKCA 4RELA 3N4ZA 4F4LA 1QAHA 1N8SA 3BKWA 3AUUA 1CZHA 3AIIA 2AXPA 3KD2A 5CCDA 1CR1A 3GDFA 3TAHA 2P6MA 4CR7A 5TE9A 4F5ZA 4PI2A 5G53C 5COAA 3YASA 1KNQA 3NNDA 4RAOA 1H4QA 3EEBA 4OHUA 3PITA 2YRXA 3IEMA 3OSZA 1CEYA 2BFDA 5KNCH 4P5EA 4E4EA 2D2VA 2F1RA 4AJKA 1EDBA 2H07A 1UBFA 1T91A 4XZ3A 1NQTA 2X14A 3HE3A 4GE0A 2DY1A 4ZREA 4CIDA 4D0RA 2J41A 2PX4A 3O38A 1C14A 3KZKA 3HL0A 4F60A 2HIAA 1ADFA 2N1BA 1TVCA 4P0TA 3DZJA 5ALHA 1FX0A 4OXXA 4M53A 5F21A 2HNKA 1ZUNA 1YITV 2NQTA 3FYEB 1FDSA 3DVLA 2YUTA 2EOAA 4TV8B 2AMFA 3K8YA 5JMOA 5CIQA 5F52A 3H9CA 2V9PA 2BVNA 4WI1A 1M56B 3ZBHA 1TJ5A 1Y8CA 4DW1A 5FTJA 3PNOA 4M1OA 1QX3A 4LF6B 1AKRA 5BQXA 2KB1A 3LVFO 2PJDA 4OHMA 2FH5B 1K9SA 4EG4A 5DF1A 3BFXA 4Q4AA 3RUPA 3OURA 4W7IA 3RBXA 4RA6B 4GOLD 1YJAA 1KKLA 3EXHB 4BO8A 1XZHA 3EXFA 1KI7A 4NYJR 4YRTA 1GG2A 4YMWA 5AK3A 3ABMC 4HNHA 4K0RA 5A2QA 1DX4A 4NZYA 1QQ6A 3DLAA 4FYXA 1LFAA 5J9FA 4DV1O 1FIUA 1RPNA 2QSUA 2ZAMA 1M5RA 2Y9MB 5ICGA 2R7MA 1AZTA 3IUMA 3KB6A 4QQKA 1D1PA 1R0SA 1KD1W 1PJRA 5AP9A 1M1KW 4PA3A 3CR7A 5CB4F 3FMIA 4HNGA 1SC3A 4D8WA 4BAGA 1M0TA 5AM5A 2FXVA 3K30A 5MHTA 3O1HB 3K92A 4AY2A 1P1RA 5B55A 5BNWA 5EA2A 4P2BA 4Y2YA 3RRBA 3I55F 1AN0A 2WOJA 1Z12A 5BRJA 4PPNA 3ESQA 4O63O 5AW0A 4RZHA 5BSRA 4NR1A 3GJRA 3IJ5A 4U4AA 4RDIA 1SB8A 2HIMA 1EESA 1YL7A 1BC5A 4D7SA 4C01A 3R4VA 3G8YA 2IHUA 1Z2AA 3GFRA 4RPGA 3A3YA 2ALEA 4L8YA 3CPWU 3D6HA 4JP3A 4G07A 2HWKA 1QDEA 4Q82A 2JVJA 3COZA 3SPCA 3JQ6A 3LOQA 1NU8A 2AEJA 1Q1NA 4HWGA 5KNDH 4J4HA 4Z8YA 4A0SA 3D1LA 1CB0A 3DFZA 1EI9A 1W9HA 5GM2A 3KHTA 3FX2A 3D8RA 2ADOA 4ZGGA 3LLSA 4CLXA 3OJWA 3LGSA 3KSAC 4E6EA 2BTOA 1L6IA 2FMHA 4GLXA 1K86A 3OTQA 2HI0A 4DEYA 4PWTA 1H2EA 4G9GA 1ZIYA 2AMJA 2YQ5A 1IMOA 2O2EA 3EEQA 3EVTA 1PQYA 4G09A 2R6DA 4KXFB 3B5JA 3BK2A 4GNRA 5GONA 1P17A 2PSSA 5AW7A 3W78A 1FP6A 4AYXA 3VXKA 2DQZA 1DS6A 5JSKA 1RZRD 3SYOA 3JQAA 2BOVA 1USGA 3D7MA 3F74A 3KXPA 4JV5O 1FSPA 5HTKA 2C1ZA 3JARB 2V7EA 1I80A 1Q16A 3A2KA 4HXYA 1SQ5A 3ABIA 3OZGA 4Z4HA 2VF4X 1JUDA 5JAQA 3GEGA 4GZMA 1T35A 2B30A 5EINA 3WGQA 1CYDA 3KQTA 3CC7V 1QQ7A 3N86A 2E49A 2R2GA 1KAOA 1VE6A 4N0EA 4EPXA 2AS0A 3PXDA 4IHJA 4RVCA 3T52A 2H4XA 3PGVA 4P4UA 1CXZB 4FDUA 2FPGA 4DSNA 5LQKA 1J5EB 3Q8KA 1B73A 5TF0A 4ZTZB 1POXA 1M93A 3H5LA 2IDJA 3RSCA 3INGA 4JGSA 4R8CA 4KV7A 2D0DA 3GO4A 2JGDB 2ZUVA 2JFGA 2HN9A 4KFTA 1X92A 3B1YA 1H3FA 1KAMA 4I9NA 4PICA 3AG6A 3L6BA 4LYYA 4JL5A 4XX0B 2Y77A 1U0GA 4MJXA 3RADC 1B1CA 4TZ0A 4H1TA 4LF8B 3OZBA 3OLWA 2F95B 3KQLA 5IT9M 4BO9A 5JRZA 1U2TA 1UPBA 2MOKA 5EWJA 4FB5A 1Z7WA 1SVKA 3OFNA 4HXFB 1JLKA 3LQ2A 3NEJA 4U8HA 1E9RA 2AFHE 5KQGA 1RXUA 1Z5PA 4LXTA 4OHBA 4KI0A 4HXEB 5CDSA 1QCYA 4CBCA 5E7QA 3DAYA 3AY0A 2EW2A 3OZRA 3IQWA 4RSHA 1WMFA 4WN9B 4IGEA 1YDMA 1CX9B 1X7GA 3DTVB 5B4VA 3VISA 3LIIA 1C3OA 2QRJA 3GUZA 3HFRA 4LCJA 1CUUA 2G77B 3QBEA 4UU8A 1EVEA 3VO1A 1M34E 3ADPA 1R66A 1J21A 2DHEA 4OD0A 4QU9A 1SZPA 5JY6A 2WY2D 2QVZX 1XE3A 1EJ0A 4DV0O 1XZDA 1FA9A 3L07A 1V6SA 3FWYA 2AI2A 3PNSA 1DX6A 3WYAA 1NX9A 3RSQA 3ZCCA 1OYYA 1MOFA 3U7QB 5IEJA 2AZXA 2A3QA 3BFJA 4HDNA 3C4QA 2M9MA 1NY5A 4OX9Y 4DT1B 4WADA 2CUZA 1Q7EA 5T6MA 5GONF 4K9SA 4HGYA 4X94A 1CJMA 4TRMA 4JTDB 4AM8A 3EVGA 3AR2A 2JLUA 1N2HA 3CMCO 4OK3A 4NV3A 3BMQB 1YB6A 2WAOA 2P4HX 4RZSA 3WYCA 3SYAA 5BNTA 4K8XA 2X0LA 2QXTA 2RHMA 4UQOA 4C07A 2AC7A 1L5RA 3MBKA 3L6CA 5LZ8A 1WZ2A 2WTEA 2ZIEA 4WPGA 3GLHE 3AUKA 2JC3A 3ANTA 3N8NA 3HR7A 4BWAA 3OFNG 5A4KA 4LX8A 4GKVA 1ZM4A 1ZI8A 1UC5B 5D1HA 1CBUA 3V8NA 3PEYA 1SBCA 4KXQA 1JDBB 3ZS8C 4HX5A 4RORA 4IHJF 2HPHA 1H1LB 1V5FA 5H2FZ 1R9NA 1XRNA 1YIOA 4IIHA 2FMFA 3TTYA 4EHHA 5CITA 3QU2A 1OAAA 3Q72A 2YS8A 2MHCA 2ZXWB 3FCAA 1RXEA 1JPNA 1HG1A 3QOYA 5BPFA 1G9SA 2BTUA 3KOOA 5EXEA 3WP0A 1JS1X 3PX3A 4ZBMA 1WZNA 4F3YA 1MO5A 1PD1A 2G5CA 3EG9A 1XJWA 3NPAA 1XN4A 3ZBPA 1M57B 1JB1A 4HBNA 3E8GA 3RIHA 5HCUA 4L8GA 1UP6A 5EL0A 1CR2A 2HO4A 1EDZA 2AWOA 2YZ7A 3CRQA 4RY8A 3SQNA 5LJIA 1KS2A 2CLMB 3HK2A 3Q9SA 1SZTA 4FS3A 4RMJA 1MX5A 2WPDD 3BMXA 3OQ1A 5AJVB 5BSFA 1TX4B 4IQ8A 1E79A 4ROSA 4J4TA 2ZIZA 3SXUB 2QA4F 5KQSA 1BHBA 3C97A 1Y82A 2ZREA 3LC1O 1V11A 2BV3A 2FFJA 4E1BA 3ZTWA 4FK5C 1KVRA 2R8EA 3PC2A 1RM0A 1YDFA 2P9ZA 5HK8A 2J0QA 1GILA 2PCLA 4ICIA 1BS3A 4GU5A 4PRYA 3S03A 2YC4C 2C2HA 3B4SA 5HUJA 3OIDA 4D7TA 1KMHA 4BT2A 5TJ9A 5CB4B 1EJ6A 2ZP1A 3VZBA 1N1DA 3W90A 4S1OA 5BY1A 1LC0A 4Z7OB 3HY4A 4WCFA 3AGKA 3RHFA 1VB3A 5DRYA 2H5LA 3MOIA 4OA5A 2BISA 3IAUA 3OZEA 4QSHA 3O5AA 5B2ZA 3VR5A 2EQBA 2B6HA 3DE6X 4QXMA 3FUWA 4DLPA 3A3PA 3ASOC 3Q4GA 1OZFA 4O4IB 1FQOA 2C5AA 2CV0A 2OOKA 1N8RW 5B1DA 2CFCA 1A82A 1K73W 1OZAA 5SV2A 1GZ7A 3OJ0A 1XWWA 1O8CA 4AO7A 4PLTA 3HR8A 4RV4A 4DGQA 4F45A 2R5NA 4AJ1A 4WZZA 2IY7A 3K6KA 5EC8A 3RN4A 3AF4A 4CH5A 1P6UA 2LD4A 3KQWA 4FYPA 1AKTA 3GH3A 1Z2NX 1N4CA 3ROKA 2FHSA 4ZQCB 3G0IA 4RMHA 2P5YA 5E3IA 1EM6A 2WQZA 2NUTB 5JXGA 5MGBA 3I6MA 3RE3A 4J16C 1E79G 5K7SA 1QVGF 1H2FA 3AUAA 4M88A 2DYRB 1MJGA 4A92A 1QGUA 1MIHA 4BQOA 1VPWA 4UAVA 3L04A 1V9CA 3S0JA 4QHSA 1B8VA 5CUQA 3ZHBA 3KRTA 5BOSA 1FDRA 3KT6A 3PV0A 4NMHA 3C8DA 4BMVA 3IJ4A 2E1PA 3FPKA 1ONNA 3FYUB 3F6SA 4RK7A 1DQSA 1Y7HA 2WJHA 1L4NA 3K0EA 4JT2A 2WHPB 2PL5A 2X5NA 1KH3A 3OIGA 5LB2A 1AZLA 1NKTA 1HE3A 1GP2A 3QQPA 2XUDA 4WVFA 1WUIS 5JH7B 1AK2A 3WIUA 3QYPA 4WZBA 2IZ0A 4LE0A 2XZTA 1V7ZA 4Z4IA 4QL3A 2JIZD 1JN1A 3ZGZA 4JTCB 1JW9B 2JIDA 5HZMA 1SC5B 3IAXA 1D9ZA 2R68A 3ILVA 2EJRA 3KCNA 2IDKA 4M89A 2HP0B 1AXRA 2VHXA 3CZPA 4DNPA 1DXHA 1N5KA 3AJEA 1UADA 2HS4A 1TKAA 2C7VA 3OOEA 1NTZH 2BHLA 5JWHA 1D4OA 5GJWC 2IUSA 3K09C 5C8ZA 1U0LA 1SK8A 5CVDA 3LQYA 1D0VA 3BRWA 2OGWA 2OKGA 1XLUA 3QUQA 4V1CI 4R68A 4OOEA 4FFDA 5IMSA 3NR7A 2FXIA 5DM6V 4MO2A 5FBWB 2OYQA 1LX7A 1VG1A 4LFCB 1JIVA 5KX5A 1Q19A 4BV3A 1LBTA 3ZHSA 3QVOA 1Z88A 4FFRA 2GZSA 1LRKA 4GMHA 1J8QA 4Y0AA 2HF8A 2IXEA 1PFKA 1H9BA 1F3LA 1N5LA 2CLKB 3EIXA 3LCJA 1FE8A 1BCSB 1Q0TA 5B53A 2G80A 1M6WA 1OV9A 2N1MA 3NHFA 4P0PB 1KQ3A 3HP4A 1X39A 3WLIA 5HKKA 2AUMA 1RM1B 2FMKA 3TDKA 2DPGA 2BTEA 2HREA 4ETIA 1CQXA 2NVWA 2ZB7A 4C4AA 1U3CA 3LY9A 1ZMBA 2CFSA 3O95A 1N2ZA 1H4VB 1ZC3A 3B52X 3O4FA 3THRA 3HV2A 2WMOB 3FNEA 4ME6A 4B40A 3E7WA 3STXA 3SC2B 1K4CC 1XEWX 2GK3A 3CCEF 3AKCA 1I1QB 4P0QB 2JJ1A 4BO5A 2OG2A 3LTEA 1TJPB 2Z4TA 3F6RA 4WBSA 4TYQA 3UF0A 2NX2A 4LF4O 4JZGA 3RF7A 2Y9PB 2RKOA 3P2EA 1EFAA 3NWJA 3LWNA 4GQIA 5AKHA 4IDBA 1M8JA 3G3EA 3KSUA 2FLVA 3B51X 4CZ2A 4G26A 4EFKA 1GFSA 4X91A 3MAQA 4NXMO 1DB3A 3ELCA 1V2GA 4UCTA 2D0PB 2XEDA 1N1EA 1YRHA 3I5YA 1U04A 1R4AA 2C98A 3GRYA 1XJQA 4FLVA 1GN6A 2BJHA 4OKIA 5CBHA 4XJTA 4P3XA 4ZEMA 3I5XA 1PLKA 4C4XA 1GPBA 2YW2A 4U6QA 3L0CA 1DT9A 4WF9V 4Z0PA 4C3VA 2AK3A 4QGFA 4KQMA 3FH0A 3UBTA 5AUQA 1ZQ9A 2QKSA 1SOVA 3T2MA 1PYOA 4RYLA 1ZWLA 4H13B 3MBMA 1A9XB 5IXYA 4DWOA 1PT5A 3FI9A 4RQAA 2A4MA 3WYGA 2KBEA 4PG5A 1N0UA 1QYRA 5INTA 2CWJA 4N0DA 4MVZA 2FPPB 3I72A 1V25A 3FFMA 3JATB 3DE7X 5D8DA 4JODA 1NLUA 2PBLA 4PNZA 2Q68A 3UTDA 4MW3A 2A5YB 1DHTA 4UVHA 5P8WA 4LWSA 4PEVA 1MAVA 1HGXA 2XUJA 5JNWA 1KBZA 4A6EA 3QWIA 4N82A 1N8TA 3KXDA 1L0LH 3KLNA 3TW8B 3NM4A 1HZZC 4Z86A 5BZBA 3PYLA 3B85A 2V8BA 4OYLA 3LD9A 3PHLA 1D2HA 4KZKA 2EBHX 3F5WC 5EKDA 1R3IC 4BFXA 2CJFA 1XRGA 1S9HA 4NFHA 1AQUA 3CX5F 4FDTA 1RACA 2JJ1G 2QTWB 3F8WA 4HZ3A 3UMJA 1PJ2A 3GJ4A 4AN0A 1LBSA 1T3LA 3KTFA 1PUJA 2R25B 4X85A 1HFEL 1TECE 1VHDA 5WRFA 1Q7TA 1X1SA 2BGIA 1OGIA 1H8HG 2NYUA 5B37A 3K14A 2LKDA 3I56F 1TUBB 4OK5A 2Y1GA 3WRYC 5L9AA 3O8RA 4D8VA 4EG3A 2LIPA 1JVNA 4UHDA 1ZITA 3DTTA 3AHFA 1UWLA 3IHKA 1XVVA 3IESA 5I9TA 1YZNA 3O8NA 1T0PA 2XQGA 4R2XA 3LCMA 3IKFA 1AGXA 4E5NA 4CMIB 2VSYA 3OCJA 4YP6A 1OKKA 1XLWA 3JQ8B 2H2GA 2EGGA 1E1QD 2YX1A 1NYTA 1V37A 5HF8A 1JG4A 1B6RA 3R3SA 1F0KA 4INZA 1IBMB 2V9CA 1AK1A 2JLWA 2MSCB 3T4UA 3SX4A 1K3TA 1L0NH 1WBDA 4EMUA 2YNMC 4FW9A 4S04A 1W85A 3EJWA 5K0GA 1ISIA 3SQLA 3QEKA 1FY2A 3L1VA 5CDTA 1RA4A 2CLDX 3F5QA 1I3NA 2VP9A 3NTLA 3ESXA 5CNJA 1UBGA 4D4MA 2EGUA 3OR7C 2EAUA 4MAAA 1IG3A 1Q0LA 1ZESA 4W1PA 2N74A 3IRVA 1IWBB 4WNCA 3HPQA 8AT1A 3AKYA 1LDNA 4U7GA 4IMIB 2PSHA 4O1MA 2WLHA 2Q0XA 5CHYA 3AVWA 4M21A 4LDJA 5A0TA 5IH3A 1RU3A 3AF2A 1TTQB 4QD3A 3ZJYA 3ZV5A 3OQOA 1Z2PX 2HADA 1FYWA 3BD9A 3WSWA 3MD0A 3ML1A 3OQVA 3TL6A 1PEDA 5H6QA 2XWBF 5F73A 4BPRA 5IJ0A 5K09A 1YRQA 1VE7A 1XQ6A 4QJ3A 5D85A 1USIA 2P3OA 5EJIA 4QOJA 4W5RA 4KSYA 3O2QB 4MI6A 5A4DA 1UJ6A 4O0MA 1NHWA 3A1WA 1CUJA 4ZC1A 2J3DA 3G9TA 3V6MA 4D74A 4EOGA 4M49A 1L4MA 1YZBA 1TYCA 2UUAO 1WKVA 2QNRA 2FRDA 4AY4A 1AV6A 1AROP 2VP0A 2Y0PA 2VNSA 1VMEA 2PQ2A 3GTZA 3CR8A 4DMGA 1E4EB 1SKAA 1AR1B 4NMWA 4P86A 4F3RA 2FDXA 1V1MB 4QJFB 1WQ4A 4GX2A 4IVPA 3E4DA 2JLBA 2FI1A 2X6CA 4FKMA 2ATKC 2J07A 4LXXA 4JWKA 4WXPA 5HJEA 1KJ9A 4E15A 4UCSA 3HHPA 2OXEA 1EJ2A 3EDQA 621PA 1B3RA 1BMQA 1G2IA 2FPWA 3NYRA 3IEVA 2R9RB 3HA2A 2PS3A 5LHHA 5KHLB 1J20A 1R0YA 2HLNA 5EZSA 2PRZA 3DXYA 2YR0A 2XD4A 1QF9A 4BNKA 4JB8A 4WJLA 4HB0A 3P4UA 3C3TA 2HK9A 2GBPA 3T3NA 4JOSA 2WJGA 3T06B 2I34A 1P80A 3C39A 1NRIA 2HQSA 1GRRA 4KUGA 3QVGB 1PWEA 4FQ5A 3BL8A 4EG8A 2O2CA 3QV2A 4K9LA 4BBJA 1AA9A 2PLWA 1G38A 5L40A 2XNHA 2E0IA 3ZHCA 5IN5A 2AZ4A 2F48A 4IGIA 4Z3OA 1UOPA 3FGZA 4ZOQI 5JNTA 2Q46A 2WE7A 3UCSC 2O57A 4WZAB 2LWIA 2J0VA 1PLLA 4PXYA 4G88A 3CZAA 1F12A 1HA3A 3O1LA 4YGXB 1P7WA 4CTOA 5ADWA 4MB2A 3H6GA 3S70A 4QE3A 4F84A 2I8CA 1EP3B 3A31A 5EWLB 1IM2A 1A77A 2P41A 2EZ9A 1VLJA 4P33A 1GTVA 1P5JA 2HA3A 2NZYA 1NSTA 5HE8A 1PGJA 4ZAXA 4DY6A 1Z25A 2WTUA 3GRKA 4RVNA 4TWKA 3AEZA 3LXRA 3I2FA 4X7MA 3VV3A 4N54A 5JS2A 3GAMA 3IOBA 5DHUA 1TEVA 5B1IA 3IC7A 2PD4A 221PA 3DDWA 4WN3A 3B2QA 2E5FA 4EYQA 1JKMA 2VQFO 4G8BA 3MT0A 2CZQA 3ZI7A 1JJ2U 3CCLF 3GQBB 4UNNA 4AZ3A 2HA4A 1XZEA 4R1SA 3ZHUA 1RJ9B 4KWEA 1JSZA 2C96A 2C29D 3DCIA 4IG4A 2G9QA 2BZGA 3AVUA 1T6YA 1OAKA 3BPSA 1ZGBA 3JYNA 4C0AC 3R7WA 4L57A 3NOVA 4EBFA 4OK6A 3AEIA 2EZPA 5G3ZA 2I6UA 4A6DA 4MOWA 3DULA 3BMCB 1LW6E 4ZVVA 1Q86H 1YKFA 4RH1A 4MPDA 1PWHA 1UMDB 1QE0A 1RVV1 4REMA 1Q90D 3COYA 1P7GA 4YRNA 2AJLI 1II9A 1R0BA 3PGKA 1VIBA 1RM3A 3ICPA 1JB9A 1JHDA 1BKSB 5FADA 2ZRMA 2I2CA 3C3SA 1GAQA 2CUKA 4CMAA 5EUCA 4Q9KA 3QTLA 4C5BA 4ITVA 4X7RA 1S76D 5GINE 4UTPA 4G4ZA 4CNQA 1C0EA 1E1CB 3DW1X 3WGYA 4II2A 4JI6O 2Q4RA 1JI3A 3DSRA 3U19A 4PR3A 3WQSB 2R87A 4LS3A 2PKWA 3QXHA 4QJ5A 2ONKA 4DUGD 5K1XA 3K2QA 2QQ0A 3MJ4A 4RLHA 3BHNA 1P29A 2WBLC 1ZD5A 4QXAA 1WP8A 2W6JA 4DLUA 2FWIA 2Q27A 2NACA 3AUXA 5A02A 1YQNA 2UXCB 3G89A 4M2LA 4BLQA 3NVMB 5FUBA 2Z3ZA 1WQ3A 2HT6A 2C8KA 5HFAA 1ST2A 2R66A 2ZVZA 2FW7A 5D6NA 2Q8QA 4FLTA 3R3HA 4RACA 3OIUA 4YIKA 2Z58A 3V7YA 4B2YA 3J81k 5FLXN 2CYCA 2XMZA 1SDSA 2HGZA 3DQPA 3P2MA 1P1JA 3AG4C 3K0KA 4Q4HB 5KYXB 3V1TC 2Q41A 3HNRA 4XDJA 3K7EA 1E61A 2VWKA 5BN4B 5JAUA 3UHOA 3VVLA 4KI7A 1ZRMA 1IM8A 4MYTA 1YL5A 5FV7A 2YWCA 1AT1A 1MO2A 3ITNA 2W2MA 5DLYA 4YMIA 1QUFA 4WE3A 5KTSA 2I99A 4J76A 3P0FA 3KT8A 3UAWA 3PRHA 1WSAA 3EK2A 1H6BA 3DJFA 3OM3B 3BA9A 3N2KB 5HUQA 4BVAA 3QXGA 3DMHA 4GX1A 1QJCA 2M6SA 3E89A 3DBVO 1NNI1 2I55A 4N5HX 3H9BA 3NMUC 2Z1MA 1QGED 4ZXPA 1J99A 3RWOA 3MCVA 2W90A 1VLLA 4UB6Z 1P19A 3DC5A 3ABOB 4EJ2A 1EZ4A 1MA1A 5HY1A 3AJDA 2AG1A 4YAIA 5E4JA 2FK8A 2QE7D 4QOFA 2QLFA 1P2BA 3BJEA 2PTHA 3ZHXA 2W6JG 5A6SA 5CBKA 4Q37A 4WFKA 3PCXA 4LBVA 1SETA 5AKGA 1NVGA 1E62A 1JJFA 2D54A 1U7HA 2FZEA 1HP8A 1V4VA 2AW5A 5C3MA 4CL8A 2FSVA 3AKEA 2AX3A 4C5CA 2RGCA 3V4OA 4KQKA 4JSRA 3SJQC 1Q7CA 2X77A 3Q5EA 1VQ4F 4IQFA 6GPBA 3OQ6A 4O4LB 2GOYA 4G4VA 1DBSA 4IM7A 5M7EA 5L6MB 3WFVA 3AC0A 1KK2A 2DYKA 4B3DA 2GA8A 4MZXA 2I7CA 4X64O 4EI7A 3EPPA 3EGIA 3FDZB 1RQGA 4QUBA 2IG8A 2HHJA 4CT5A 1E7MA 3H5TA 5K4AA 1M7HA 3ZV3A 2CLOB 4FM1A 4BKMA 3K15A 3HKDA 4NJMA 1HDGO 2OV4A 3WLLA 1JY8A 4TYYA 4ZFNA 4G0YA 1N32O 2R6JA 3WL3A 4FX5A 1CTQA 5AW4A 3KJJA 2DLDA 1G20A 4AF7A 1U8CB 1Y1PA 1X1RA 4WD3A 2GJKA 2EWWA 4OBWA 2IXTA 2BEUB 3ANYB 3DOJA 3KVYA 4ENQA 2XOXA 3ROZA 3QPBA 2J9FA 3K70C 3K94A 2H3OA 3WQBA 3PE3A 3IIIA 3K9CA 3TLYA 3CX3A 2VP4A 3V4RA 2V7QA 1TIKA 5JS1A 4DJTA 1VMGA 4J0QA 4J8PA 2C4MA 3F9RA 2VP3A 2CTPA 2QW0X 3F6CA 3TJRA 2VYNA 3GYQA 4PS0A 1GU0A 1TC1A 3O4JA 4MSWC 4DR5B 2VJMB 1JAYA 1UBLS 4KQXA 5DPMA 2QV7A 5B1SA 4DQLA 3LDDA 2WA1A 1G5HA 5CT4A 4PPFA 4LXUA 3R7LA 4MWTA 5TX7A 2HPZA 5JEEA 2JBAA 4EF6A 1GPDG 3BMNB 4FMCF 3WXMA 1RR6A 2B5OA 2G3YA 1D1TA 1G6UA 1ZH6A 1YJBA 3OJFA 2IYQA 5KYVA 5GTHZ 7YASA 5NULA 1AUQA 1PI3A 2Q3FA 3H3FA 3FNQA 3KDSE 4HWPA 2FPXA 2QUAA 2DY0A 5M29A 4P6VF 5F64A 4GKJO 4HDSA 4NFSA 3UMMA 5G40A 1I9GA 3LF1A 3MXTA 1XNHA 1I7LA 4C81A 3HWSA 1KC8W 3EXIB 3JASA 5K3AA 3GUVA 4OI2A 2IV3A 1XFDA 4PO1A 1BQEA 1HO3A 1EGAA 4HS4A 4A8JA 2BUAA 2QWNB 4W5NA 4EGJA 4IJUA 2FJ0A 2BDUA 2CCGA 1OJHA 1EM1A 1Z6PA 3KOXA 4X44A 1E8DA 3PL5A 4EB0A 2ORVA 3ZWYA 2PUSA 1PPJH 1VQ7F 3UBMA 4BNJA 1WDMA 4YRBA 3PNYA 4ZKEA 4RQFA 1GNRA 5JDCA 3DHEA 5BSUA 5JMTA 4H7IA 2OQ2A 2ZRLA 2V7QG 5I9IA 3HY3A 3C1TA 2B78A 3O2JA 3EZ2A 3T80A 4UE2A 1JPXA 4D96A 1WAMA 5E6UA 5BWLA 3B48A 2IYPA 3G0OA 2GHRA 3QWAA 1ZG3A 3BXEA 1WJZA 5HEKA 3NHMA 4CKEA 1T36B 4B31A 3EE6A 4H17A 5DX0A 4B4UA 2OHOA 4G8JA 2Q9LA 2GCEA 1H2GA 2VBCA 5FWYB 3F2VA 3U7JA 4JNCA 1O6BA 1M56C 1ONOA 1M76A 3QXXA 4GPZA 4IDQA 1AHPA 3K20A 1C3XA 1KO7A 2EHJA 4OYHA 5C34B 4KXYA 2GBLA 3WLKX 1UEXC 2G9ZA 1I2CA 1S8AA 4G0UA 4ZJPA 5EFOA 3ULKA 3FHLA 3Q12A 3IIKA 2WM3A 2GN6A 1GZ5A 1K8RA 2ZBUA 3EXHC 4XWAA 6YASA 2GILA 1XR3A 4XDGA 4OI0A 4UHCA 1TD9A 4GI3A 3UT5A 3UEOA 3AR3A 2AN9A 4WOKA 3UC5A 2DFLA 3G1UA 3MMXA 2XT9A 1F4NA 3TX6A 2GYWA 1G5FA 4UMEA 1WV0A 3UW1A 2AQ8A 2B94A 2FDCA 2PGXA 3UM7A 4BT4A 4M60A 3FI0A 3K0CA 4KL1A 3AW9A 1DKQA 4J0HA 3FTFA 3HBFA 1XNQB 5AT1A 5JDIA 1RPOA 1ULHA 3BA6A 2VWJA 2AN4A 4HKTA 4OHWA 4WW0A 3DKIA 4C2TA 1OXXK 1Z56C 2P6RA 3DZIA 3D7RA 1VDMA 2VJDA 2ZSAA 1ZNQO 4QRHA 1E7SA 2VCHA 2GKOA 2XZPA 1B6GA 4XE5A 3A4TA 1OCOB 2HP8A 3QITA 1GPYA 2WIBA 3ZXYA 1SUBA 3D5EA 2ECOA 1YHYA 2IP2A 1T0HB 2ZDQA 2Q5CA 3AVYA 5CM2Z 1GAEO 1GL3A 2C4HA 4MYDA 4KJXA 3EB9A 5CA1B 2AC2A 3GC6A 4DMMA 4CH3A 2VAWA 3EXEA 1K2WA 2VT3A 2HCJB 3RA6A 1OX6A 4QE7A 2K7FA 4GIBA 1YC2A 1VSBA 3V33A 2XMRA 2J5XA 2VRWA 1FBTA 5K6TA 2P7HA 2FUG6 4DUYO 3FSGD 3AGQA 3MILA 4FT4A 1VC2A 2A0KA 3VC2A 3HCPA 2H17A 3LI2A 3JWEA 4MQFA 4R01A 4D9GA 1U9CA 2C4UA 2HHHB 2V5VA 3NTRA 1LGYA 5FWAA 5IX8A 2V6MA 1X3SA 2W4QA 1RYNA 3WO0A 1DXYA 4JHLA 2BPOA 3MRSA 4ZCMA 1ZVMA 1RJFA 3ROMA 1E7KA 4M1QA 3MSCA 3H7AA 4D9IA 2ODTX 3HNOA 4UBOA 4CEJA 1ZJZA 2EP7A 1OY1A 4RUFA 1PAUA 3C5EA 1XK6A 2I22A 1RI5A 2AB0A 2DHCA 4M37A 4ZPXA 4UHFA 3WAKA 4JCOA 4I9HA 3IT2A 1NL3A 3ZLBA 3GI1A 2DTEA 2PFKA 3OM8A 1EK2A 1OV4A 1UMCA 1ZP6A 4J0CA 3F4KA 2KMLA 1YJNV 2WLIB 1QTNA 2V7BA 2W6ID 3KX2A 4JP8A 4H0NA 2FG5A 3I7TA 2P6OA 4GXQA 1DO2A 1YWGO 4NX2A 1ZJWA 3OC6A 4BNIA 3TRHA 1P60A 1EMDA 1O03A 4GVLA 2RBEA 4R9NA 4DW0A 1JAIA 1EFDN 3CCQV 2VDPB 3M4SA 4YJ3A 2ACWA 3TVYA 4MKGA 5I7VA 3NEYA 3K9LA 3NVIB 5KSPA 2YOHA 3DDHA 3ZUPA 3ZY3A 5JCXA 2BZSA 1AGPA 3V4DA 2GHQA 2W22A 2BI7A 1WA8B 1SXGA 3INNA 4L8JA 4AB1A 4RK6A 4BJ1A 2QYTA 5EIEA 4CU5A 4ZC8A 4MTGA 4MIYA 1UPCA 3PUZA 4N03A 2RB5A 4K2HA 3CCVV 3AI1A 2ZIGA 4WA8A 1P81A 1CY0A 5B1BC 5CLJA 2NO9A 1KZ1A 4GZ3A 4KXUA 3UUFA 1QIHA 8ABPA 1YASA 5DHTA 1F06A 4US0R 1U5BA 1Q6YA 3PEVA 4PLWA 4TYMA 1HE8B 5FLYA 2PZBA 5CCXA 4JI0O 2YYYA 3TIXB 2RH5A 5IDWA 5F12A 2WA3A 2RARA 1GTL1 2ZUUA 4FDVA 1ORQC 2EJWA 3QH4A 3NBAA 3O75A 5T4BA 3O8OB 3RVSA 2XCSB 1YS7A 3P9YA 3ZU2A 2W93A 2EFHB 2DYYA 1JIUA 1GPMA 4R1TA 1PJ4A 4DA8A 1E1RA 2C2ZA 4HH3C 4NH4A 1G19A 4PU0A 5E2AA 1D07A 2QEXV 2CBGA 3EQ8A 5FQNA 2QVXX 3L7NA 1IJKA 2VDWB 4G01B 3PC3A 4QVIA 3OU6A 4B4KA 2HRRA 3ESDA 4TRJA 1KFCB 2RDMA 5FF9A 4BGIA 1RCTE 2BF4A 1XK7A 1QDUA 1JJOA 4BC1A 2WHQA 1CNMA 2YV3A 3TKLA 2QN8A 4RQUA 3ZVKA 3CS5A 2BMJA 3ON5A 4ZOBA 4CDNA 5CEEA 3CA8A 3QBTA 3IDFA 1KSFX 4HEA1 2YW9A 5ALFA 2BO1A 4YRZA 1JIIA 4DLNA 1Z33A 3BGVA 3DDZX 3CURA 2ZIVB 3W8DA 3JWIA 1NN1A 3VGPA 4L9AA 1JSRA 4G0XA 1QR6A 2CXHA 2DBYA 4BWGA 1JDBC 1NN3A 4H37A 2FEKA 3M33A 2C9MA 3I8SA 4HPWA 3FOCA 3E2PA 1PG0A 2QM4A 1QU3A 2B36A 2D3WA 5AKYA 3SR4A 3M5PA 2Q2QA 3DGEA 3UK1A 3KSRA 3E22B 2J9RA 3OZXA 2QG4A 3PHHA 2W2LD 3IEXA 3LWVC 5L95A 2ZXWC 4NFLA 4JENA 2YUAA 3GLRA 4UMDA 3WQRA 1W41A 1WSDA 7REQB 2XTAA 5CM8B 4A7PA 4XOUA 4RTQA 2GRUA 4ZEWA 3G4SV 4LV5B 4YJ3F 2DMXA 1AI6A 1LF5A 1OC4A 1HNNA 3U3DA 1Z4KA 2IPLA 2P5OA 4EHDA 1XGKA 2WVAA 2HK6A 1U8EA 1M57C 4J43A 1E1RG 5KYUA 3QUSA 2PLFA 3Q3IA 4LGMA 3QVUA 3G79A 1BIFA 2P3SA 3ETEA 2J9YB 1NZJA 1LRLA 1U7OA 1KJQA 2HJDA 3NWEA 3RGWS 4I4LA 3PFGA 1ONBA 2WALA 1LDBA 3M1IA 2W0SA 3AO0B 1QHSA 4FIPC 3FFBA 4HYQA 3CG6A 1EEHA 4QG7A 5B57C 2OFFA 5B58C 3JCUZ 1F9EA 1YGPA 4F5EA 4J75A 3RDPA 1DEAA 1T1RA 1O4VA 4IMJB 3FDIA 1C7ZA 2PWYA 5ECDA 3RC9A 2IPXA 3ZWOA 5I7RA 4KPGA 4F0JA 3I37X 1FNKA 3DP9A 1CJVC 2C20A 2H52A 3RYCA 3CUTA 2QMYA 2OFOA 5BMVA 1G7TA 4NNOA 3ABZA 3NS7A 1UM9A 3GYGA 1S2IA 2DQSA 4R8RA 3EVKA 2QP9X 1Q15A 5FPTA 4UM9D 2I2XB 1T5OA 3D3KA 3C87A 4WDQA 3DQQA 4C4SA 2GM5A 2FB9A 3F6MA 1ZZGA 9ATCA 1Z17A 4Z4EA 1YHNA 1DKUA 3N2IA 5CPBA 4NV0A 2FPSA 2G25A 2ZUCA 1RYBA 1FD9A 3GFTA 1WZCA 4ZJYA 2TMYA 5CYPA 3M6MD 4UXNA 4ZV9A 3BS4A 3GA7A 1EKXA 4WFIA 1R6KA 1XD8A 4MQ5A 1KFKB 4TVOA 4UDOA 2LP4Y 5LGNA 4OHZA 2A30A 5IDXA 4HT3B 4EH1A 5LSAA 4FYJA 4RXUA 3FR7A 5F7XA 4R3NA 3TLGB 4C7UA 1M2FA 3DZ8A 1J9GA 3BXFA 3ZEDA 4KXNA 2V7VA 1UXJA 1B2RA 4YT8A 4LZNA 1K98A 3H9QA 4ZANA 1KDRA 4P80A 5HCNA 2E76B 4Q9HA 2OO5A 3W0LB 1FPOA 3E03A 3AUYA 3NP9A 2N48A 2UVPA 2DYRC 4MKRA 2P9JA 2I1QA 1TVKA 3MUNA 1G42A 4PE5B 4BZWA 4PI0A 1YCIA 2VSXA 3PC6A 2OECA 3GPIA 1FMJA 2E87A 2GDJA 4L78A 2WFMA 3LHDA 1DRJA 3VM6A 3E15A 4X7BA 4X62B 3AI7A 1NC1A 1W42A 2XLBA 3FYUC 1Z7YA 4ZMBA 1TT5B 4CYMA 1SZXA 3BAAA 2A0LA 4H7FA 4C22A 1C4WA 3PEEA 4L2IA 3E61A 1IVSA 1XMIA 3FR8A 2JI8A 3OO1A 1DGQA 1DJMA 1AF4A 2BFBA 1ZL8A 1UC8A 3OMLA 3EW7A 1I94O 2YJGA 4ERHA 4MTOA 2Z6AA 1GFWA 3U13A 3QLVA 4DV7O 2YY5A 3ENVA 2AFIA 1M1UA 1BQZA 3SFZA 4FM0A 1PQ4A 2H2AA 4MQ4A 5TMDA 1N4AA 2V6BA 3PZBA 1N7JA 5IDJA 1DCMA 5BYAA 2CUTA 1Q1EA 4RQEA 1QCEA 3J7AR 2BONA 5JZ9A 3CRW1 5EC2C 4I7ZB 4RFSA 3QTCA 2ON6A 1GGKA 3K1TA 2X13A 4XYLA 3D0OA 4OGLA 4LV6A 4LJSA 1Z0KA 3PWTA 1DADA 4RY2A 3CLTC 4Y6LA 3M3DA 4H6VA 5BMVF 2PM8A 1FDTA 1MC8A 3DR3A 2CXNA 3K6RA 2I3ZA 3QVJA 4S2UA 3KWFA 2AJ8A 2QWQB 5A06A 4IL5A 4CLDA 4XB1A 3UGQA 2ZSIA 4G9EA 1CY1A 1VLZA 1GPH1 3LSQA 2P62A 1PU2A 5AXBA 1ORWA 3G2MA 3U62A 1N4DA 4RD3A 5E1OA 2HMTA 4A5UB 3R40A 1RM1C 2EKPA 3KOWA 1OVMA 2JK0A 5C4MA 3CO0S 1E1LA 3W79A 3TNDA 2ZQZA 1Q17A 1GJRA 3WGKA 4J90A 5K3FB 3LUHA 3ELDA 4DHEA 4QAJA 4UEJA 2P2ZA 2HJRA 3GFSA 3UUWA 1Z6ZA 2TMGA 2F90A 3AK4A 1VRCA 4RVHA 4PSVA 4Z0NA 3SZUA 3JR3A 3BCUA 5HXZA 1LDEA 1UAYA 2B4AA 1NR7A 3L8ZA 2FTKE 4AI8A 4LI3X 4KTVE 2BSKA 1WVIA 1V45E 2UZ0A 3ZI0A 3O26A 1E5QA 4E12A 1O94C 3X1ZA 3FB4A 3CMEF 3GVIA 4EHFA 3C41J 4A0RA 3AB8A 1SO8A 4NU5A 4GOND 3TOSA 1SIOA 2JGMA 3GCGA 3HV0A 3HBNA 3OUZA 3DOIA 5BYJA 1QGAA 3EY4A 5B3LA 4B85A 1Q7BA 4MKHA 4M6WA 5AVOA 1SULA 4HSGA 4RK4A 1ZSYA 1N0IA 3P5SA 2BFDB 3AH8A 3EHBB 2ZDIC 1HDOA 4FHCA 3WB9A 1A5TA 3W3AA 1NOKA 2VF5X 2H4YA 2DWQA 4G5OA 5CDYA 1TIBA 2IWRA 3O6VA 5AJHA 2WT4A 2EARA 3S5UA 3EZ7A 5HK9A 2O7NA 3KJXA 2JJ2A 1UFQA 4D7AA 1E6CA 4YVFA 2Z57A 2ZSEA 2V6FA 1OZGA 4JC8A 4ATNA 3IMEA 4CF3A 3O47A 1F4VA 1FX0B 3ETDA 1F4PA 1ZUNB 2QK4A 2REOA 4ASUD 1S3FA 4YAOA 2B9VA 2IHBA 1WXHA 1IPHA 5KNCD 3LUAA 5A04A 3GRAA 3CCFA 1WD7A 2QVLA 3T3EA 1NJFA 3E84A 4AJJA 1GN9A 3K72B 5I51A 4HWRA 1ZK1A 4J6FA 4U7FA 3I55V 4J1NA 4RKWA 4J7CA 1L1FA 1GHTA 3TF5A 4NNJA 4Q4AB 1JX9A 4B7XA 1Z28A 2G70A 3HYTA 1GVHA 4W7SA 1Y37A 4JAAA 4ZKDA 3WRXC 3TIIA 2X6TA 3UG6A 3EXFB 2EWMA 2PQ0A 5DNAA 2PUGA 3H05A 4UVBA 4DPKA 5DNUA 2XMBA 5DX8A 3HU5A 4A8TA 3SPHA 5EVCA 4Z3DA 4JVNA 1NT2A 2AEMA 2CLIB 3IUPA 3FBGA 5K3BA 3A6PC 1VF6A 2QIOA 1DJOA 1XDDA 5HE9A 4MLPA 4HRAA 3VTAA 2FEWB 1DRUA 3RUEA 3KJZA 2C8VA 5IUNC 5IXJA 2DOKA 1C2TA 3MWDA 3SX2A 4AICA 1PL8A 1X42A 1KR2A 2XTNA 1FTGA 3A9CA 3LCRA 1U5BB 2JKYA 2GDSA 2ZPAA 1YBHA 4PLPA 4GKBA 2J31A 4PG4A 1GT91 4DGSA 1CNEA 1ZKMA 4WOBA 4WY8A 1Y8RA 4JSYA 3KYCA 1F8GA 3DE5X 3IVRA 4UNSA 3VR6H 4Q93A 2JJ2G 2D5LA 2QR4A 2ZTVA 4KR6A 4EKGA 1RMQA 2ZT5A 2WSIA 2H1RA 3CXUA 1I3LA 2VBIA 5KREA 2BGLA 1E6UA 5DFAA 1JR4A 4NCJA 3VUEA 5HRCA 2H0AA 1UJWB 2BRUC 5JJIA 1XC7A 2YOFA 4S2EA 4D6PA 1ZD3A 2JDID 4R51A 5K8LA 4ZZIA 1YDEA 5LDGA 1AK9A 2EL9A 4RZQA 1FP4A 1Z4MA 3JVEA 2RN9A 4IDAA 1MC4A 3Q3GE 4RGBA 5KOYA 1BE3H 2C9BA 2MSDB 3NBMA 2ZT7A 2FR1A 3CFYA 2XAHA 1EQUA 4E30A 2MINA 4X90A 5ALYA 5KAFZ 1IAVA 5EIBC 1SPBS 2PHNA 2P4KA 2X9QA 2XWJI 4A6XA 521PA 2MIIA 3FFAA 2B8EA 5C1PA 3OMNB 5GONB 4NHEA 4RH3A 4OMCA 3KALA 3JQAB 2YCBA 3RB8A 4RCVA 4YRCA 1L7EA 1ZZEA 5CYOA 1XA3A 1JT2A 1QJ4A 4BLPA 1MU0A 4S35A 2BZ1A 2FJUA 3ZKWA 4D5EA 2AE2A 4M1MA 5A2GA 1M2KA 4MGKR 1HNWB 1P8JA 1Z2EA 2Q1TA 1ZFNA 1J0BA 3F4LA 2PXHA 3TTXA 2XDYA 2XQIA 4N9WA 3F6YA 3I1IA 4MIKA 1Z5VA 4H3KB 4HRXA 4I5IA 4NY1A 2HVKC 1QHXA 2D8AA 5J4KA 4D3YA 2CXPA 1B0AA 4G23A 1UFYA 1A3CA 3DHNA 3H86A 1UFOA 4DKJA 1A7JA 2CZGA 4GECA 1E3QA 3U4QA 3IPCA 3JALA 3EEIA 4ZPJA 4IHJB 2JS3A 2O8EA 4IOLA 1FFBA 2P4SA 3AMVA 3RJ5A 3QXCA 1FRZA 3THYA 2FPGB 1WY7A 2Y1EA 1DGSA 4EABA 2HCTA 4BNFA 2QXUA 4IXDA 3CEJA 5TARA 2ZATA 2QUZA 4HQFA 4PJ0Z 4DR6B 1H2XA 4URZR 2OV6A 2H1FA 4BB5A 3AEQA 1JILA 4WCVA 3HXOA 5BNIA 2D8MA 2ZRBA 2AG5A 3WYFA 1F5NA 5A5DA 2OCAA 4AF8A 4Y1RA 2ZULA 1OD6A 3V8EA 5KX5F 2VHJA 2X22A 5EWJB 2AXTZ 3BA8A 1YTFD 4HLUA 2D62A 1VYVA 1ULBA 1B41A 1LF0A 3AVVA 5K45A 4C0BA 2FZKA 2LJ2A 2B3DA 3FLAA 1DE0A 2QU7A 4BDTA 1DAEA 5EJEA 1M7BA 4Q1FA 3K1AA 4KO1S 2JGKA 2ZWVA 5JI3E 1S2NA 2QQEA 4CLOA 4QE9A 1Z38A 4L6CA 2QF7A 3TAUA 4JUFA 3KL4A 3HBJA 1GFZA 2KW5A 3RYCB 3H0CA 1C3OB 1NR1A 5G3YA 2IHVA 1FNBA 2H1CA 4DB4A 4ZRDA 2BLLA 2C94A 2JA2A 1S1CA 2ALJA 2WICA 3ZCXA 2FEOA 2WU1A 1I4DD 2ZUFA 4LN1A 3NV7A 4MW1A 2PYDA 1PXWA 5F2EA 1RDFA 4RY9A 1LSJA 4WCEV 1CS4C 2FSSA 2O2SA 1BRTA 4IYIA 3JVUA 4MUMA 1YCDA 3NHYA 3MTEA 1F4LA 4D25A 2A5GA 4L16A 5F5XA 1XDCA 3U39A 1S3IA 3LVRE 3ZU4A 2BHSA 1YJ5A 3Q1LA 2Q67A 2I6TA 1DDGA 1E5TA 3T7JA 3SJCA 5HY0A 1TCCA 4R2JA 2F4VO 1BDIA 1K2VN 3UIEA 4HDNB 1FUEA 2NLJC 4XCVA 2EQAA 4ZMSA 2YRWA 1RM5A 1R8JA 5JAMA 3UKMA 2WEKA 3KKKA 3DC6A 3AEXA 3DMTA 1OZHA 2PUVA 2I67A 2QMQA 4L5IA 1BVRA 5BQFA 1WABA 1K7YA 1ZN9A 2FPLA 4PYKA 3EPHA 3R20A 4FLWA 4G2NA 1EK5A 4IXMA 2V1UA 4JQSA 3IR6A 4YWHA 4PX5A 4IV0A 3N5KA 4X84A 1SHKA 1NVKA 1JQJC 2ATEA 1LDMA 4G1FA 5EJAA 4EGSA 2ZJ1A 3F3KA 1XHLA 3RQSA 2PRSA 3A58B 1A9TA 4DABA 4KOAA 3UWMA 5CB8A 1QVRA 4AVYA 1OX4A 4MW6A 4GO1A 4GWKA 2JJMA 3IODA 1E8MA 4RTRA 1GTOA 4EPYA 1CZLA 3ND9A 5C5IA 5BNZA 2O2XA 1W1UA 3KZMA 2FPOA 2P6JA 1A88A 2ZTHA 4J0DA 4FBMA 2IYVA 4YAKA 2CKDA 4QXOA 4G37A 3EF3A 2FW9A 1RBMA 4YMGA 2P2LA 5BRAA 2ZR9A 1E94E 4LNHA 4D45A 3KJGA 1Z0UA 5LM3A 3JS5A 1DBPA 3IEKA 3JSLA 3HPRA 2WWGA 2VH1A 5BR4A 3WLQA 4W63A 3H6KA 2ZS7A 5EJFA 1H69A 3HYLA 1QCCA 3GFGA 4RSGA 4GWGA 1LV7A 5DBGA 1QRRA 1SVSA 2ZYAA 4NYMQ 5D00A 1QNFA 3R44A 1G9TA 1QWOA 1ZVJA 2VXYA 2OCLA 4EFEA 4TSFD 5FBVB 3EG9B 2B83A 4TQGA 1Z7GA 4YCJA 5H3LA 1YQXA 1I6KA 4XFKA 1DEHA 3OJOA 3ZN1A 3WA6A 2BUCA 4KYUA 4M86A 1PZFA 4QTXA 4NOKA 4EGQA 5E9JA 5HP4A 3RUIA 3CINA 1HT2E 4CR6A 4BMNA 3ZDEA 5HM6A 3SYNA 4MDYA 1QRAA 1L7AA 3D3QA 1TB4A 1H2MA 5KI6A 3ZGYA 2PXAA 4HSEA 3QVXA 1L4HA 3DC2A 5KU1A 4H77A 1PWYE 2H94A 3A1TA 1WXQA 4ZGWA 1GAWA 1KPHA 3L5KA 4FK8A 1V11B 5DP2A 3JAMN 2YXZA 5K0CA 3D3IA 4JDPA 4BNHA 3B12A 4QAQA 3P20A 3DDUA 1PS8A 4AECA 2PJUA 4PCUA 4G0QA 5EHGA 1VBFA 4S24A 1KMHB 2CDYA 1WVMA 2OT3B 1VQVA 2P9CA 4GP9A 4QUHA 3D8CA 4HBZA 4LOIA 5K8VA 2ID7A 2C9CA 1TQ8A 1IY0A 4WCFB 1W3EX 3LSSA 1Q6IA 3ZU5A 1ZS9A 3D9QX 3NCHA 1MIOA 4JKOA 3RD5A 3GJTA 1ULTA 4YI5A 1R6NA 4PQEA 2QN3A 2H06A 2C4WA 2JIMA 2QR3A 4JKYA 2W70A 2QJRA 5E0OA 3CY6A 3CUSA 4U7JA 5EBMC 2SCUA 2ZBDA 4FGZA 5AVUA 3MBIA 5JEDA 4RULA 3CBQA 2WUGA 1C30A 4DUZB 2GX6A 3EFOA 4H60A 1VRVA 3W4KA 3GEBA 1IAQA 5AI0A 3GHYA 1R6TA 1S0VA 1SXJD 4JVSB 3IAM1 1E2MA 1BWRA 2HW8A 3RCBA 2V3WA 3LF2A 2OZEA 3NTXA 4ZMRA 2DUWA 1XI2A 4I1UA 1ZCJA 4IKPA 5C8XA 1XL1A 5DI3A 1WXIA 5DISB 3V00A 3N0WA 4F2WA 2FFBA 3RYFA 1BXGA 1GZSA 1KJIA 1W73A 3AUSA 4N0MA 3AEUA 1J4AA 1NXTA 1YRWA 2ZJYA 4WUVA 2WJ3A 2J46A 2YZNA 3DWGA 1QGUB 3OZVA 3QXSA 4YRDA 1KI2A 2H7VA 3HXQA 1GGEA 2AGAA 4NZZA 4LSZA 1UQTA 1Y6ZA 5BOSB 3TLMA 1EHYA 4I46A 1W5BA 1B1AA 2IZ5A 4DBLC 2IEIA 1EDEA 4RW0A 2FGYA 4DR3O 1DOZA 1KDZA 4A8HA 2BMDA 4LYDA 6ABPA 1KH1A 4HQKA 3BE4A 1AJPA 2HMAA 3AQIA 1GGFA 1CP9A 4F2GA 1A72A 3KPWA 4BO6A 3OECA 2JFFA 4DSAA 4WINA 5K2OA 1PV1A 2JRIA 2BE3A 4WZBB 3FPIA 2ORED 4ZK2A 2EKBA 1D8TA 4LWOA 4JVOA 3SXPA 4ETMA 2QAJA 1JWLA 3D36A 4NC9A 1DX9A 3PA6A 2WSMA 2WU4A 3L4JA 2RHBA 4A23A 1SD2A 5DP1A 4IXTA 2YV4A 3GNSA 2HHCA 4Y2TA 4TKMA 1D2AA 3FPGA 4WXYB 1R16A 4FWBA 1NXQA 2CLLB 5E6RA 4UTZA 1UMKA 1U2QA 2IJHA 4KRFA 3B36A 2CXRA 3UQ8A 3U4CA 5KX5B 1OFUA 1XQ8A 4KWIA 1U0EA 2FWAA 3BQNB 4X7PA 5DEOA 1HORA 4CL2A 4DCOA 2G09A 1PNMA 1Q77A 1C3JA 2BR5A 4JI5B 2ZRCA 1TADA 1R12A 3ADDA 3ZHTA 1JXQA 4NMLA 4EL5A 4PZPA 2YXDA 3ELYA 3GVXA 3HVHA 3C3AA 3SJ7A 5DGHA 3TXSA 2IYFA 4PG7A 2BC9A 5AKKA 2Z8YM 1ODJA 4DR4B 4JK3A 1PS9A 3CCCA 3X43A 4PIPA 3BDVA 1D6MA 3Q2IA 4DDHA 2V5UA 3LKVA 3U9LA 2Y1WA 2GVNA 1NULA 4A0GA 1ODEA 2R9VA 2ODAA 1NV9A 3TRKA 3G7UA 3R6WA 1RPRA 3SDSA 1QNLA 3IQHX 1CG6A 3TZHA 2JIPA 3LYLA 1R37A 1ZD2P 2JLCA 1BS1A 4OXIA 3NNNA 2WUEA 1J0AA 4IZIA 3EMBA 1KKCA 5ESXA 2QX4A 1WKCA 2XHBA 1H0KA 1HDZA 1X14A 3LWBA 3M5WA 4DDKA 4R50A 5IS2A 1A9PA 3EDRA 1MTOA 4KR7A 2FCAA 4HXGA 1E0JA 4K6OA 4HQNA 1EX7A 4DRXA 1JE0A 3FMPB 5ALNA 1BHSA 2JGUA 2V96A 2FW6A 4JT9A 1DWUA 5FUMA 1LS1A 1YE3A 2ZJZA 5CJJA 2Q4DA 5THQA 1L1RA 1GQ2A 5IUJC 5FPPA 2J3JA 4MP3A 3NTUA 4GMGA 4EHAA 1H42A 2OZLA 3KQKA 3HEMA 4QGPA 3CH4B 1PSDA 2XGMA 4CRWB 2IHKA 4HH4A 1KFBB 4G65A 1ANKA 4KXRA 4C3OB 1WBBA 2CFIA 1NUSA 5DECA 5HRUA 2F8LA 5CFLA 3ON1A 3D2LA 3RYIA 2Q6VA 1YTUA 1XJ0A 3EUWA 1MVOA 4XQEA 2WWXA 2GZMA 4P32A 2ZR0A 5GIPC 2X1LA 4BQSA 3RK1A 5ALJA 4D57A 2N05A 4CZZA 3SSNA 4LWSB 3PU6A 3C48A 1G60A 3JPWA 3OTGA 4PC1A 2BBOA 1MD9A 4Q02A 2BFFA 1YJ9F 5TRTA 1U28C 3R9IA 3THOA 4KO8A 4K8OA 3H1LH 1OLXA 3HJRA 5EP2A 4BFVA 5LBQA 2IA5A 1KL7A 2Z04A 3T12A 3L8HA 3LRXA 2PNJA 3J80N 3TDMA 4E4RA 4AJ9A 4XFDA 1VIYA 5L3VA 2RK3A 3PGXA 2OBFA 5AIAA 5TC4A 4OGFA 3M6AA 2EC5A 2X2EA 4K86A 2ZBEA 1Q43A 1F6DA 2OTJF 3DKKA 4KMSA 2G4VA 4P9OA 4ZI7A 1FDOA 3RWMB 3IUBA 4D46A 1B23P 4V0SA 4OQDA 5B4TA 3B82A 4TXHA 2R6AA 2WIAA 5JWPA 3N0VA 2ZK7A 2RK4A 1ACMA 2CYAA 4NG5A 4N3NA 3T5TA 3PIIA 3ZE1B 2YXEA 3N8GA 3LKZA 2X0IA 3OUFA 3RKRA 3A1VA 4CQMD 3D2AA 1CUXA 1L8LA 5DW3A 1P4JA 2JS5A 4RA9A 4WNYA 3BSSA 4AHCA 1VCNA 4PRKA 4O2RA 1MTZA 5H3CA 4LH6A 1DC3A 2ZZKA 2QHXA 4IX1A 4A2WA 1JL3A 4OQNA 5FNZA 4KLZA 1O8BA 4DV5B 2V1XA 2W2QA 4YRPA 2CDAA 1GPKA 3EH1A 1L7RA 1K27A 1V48A 4UTNA 2AZMA 2R4TA 3HR0A 3IE1A 2PBRA 4EY6A 1O6CA 1OCOC 2OHFA 5EWMA 3N07A 3PL1A 1ZJ5A 1PFGA 4N5LA 1C29B 3FNHA 1RVDA 1W85B 2RCNA 3BZBA 2WFZA 4P4GA 4QJBA 1G6HA 3LA8A 3ZEAA 2IH2A 1W55A 1K06A 4AJHA 5B3SC 1D2NA 1LZKA 4EVSA 3HJHA 3P52A 4JZYA 4ZYTA 5T3YA 2ZFUA 2I2BA 3KTDA 4MP8A 4BFYA 2I4LA 3QFSA 1SGWA 5IUKC 4FZ5A 2UZ4A 4B82A 3LQQA 2WFAA 3OF5A 4MUKA 4ITRC 4OH1A 3QNUA 1ACLA 4IMRA 3QO8A 4IO0A 4N23A 4RL6A 2Y92A 1NLYA 3D3WA 1UJ2A 4JI2B 4BBAA 3IPYA 2CNBA 2QTGA 4IGGA 3EIQA 4R2WA 1QTIA 2V97A 1FFDA 1Y67A 4OBXA 3FOAA 1H5UA 1Z4OA 3D4LA 2UYCA 4ZVRA 3CKYA 4Y1EA 3U3RA 1MLDA 2J0EA 2QGFA 4AL4A 4P81A 3QM1A 1RJGA 5IJ0B 1Y7LA 4C4PA 3JX9A 4BVLA 4K9KA 1MG0A 4AI6A 3WYDA 3GPBA 3RBZA 1KEUA 2HA7A 1MPXA 2VCYA 1XCBA 3QVWA 3CE6A 4NH0A 1QZTA 3EISA 3CJRA 1MENA 4J4BA 4ZWNA 4HB4A 8GPBA 1V5GA 2XYGA 2HR1A 5F9HA 2JPDA 2BGKA 5DB4A 3KT3A 1WPXA 1W0CA 3FKQA 1XJCA 1PD3A 3M5CA 2R751 3IAHA 5AW5A 2M6KA 4ZI7F 3TLEA 4Y2XA 1EVIA 2AZ2A 1DQZA 5CH5A 1W52X 2HG5C 1OBCA 1PTJA 4D26A 1FNCA 2OYCA 4HB3A 4CTNA 3A06A 2ODNA 2IFTA 4ZYXA 5T5QA 4E7OA 4U63A 1PFWA 4W7HA 4RPIA 2ZOVA 3VKUA 2VYVA 3BQMB 4KCGA 4II3A 4UZSA 2QYHA 3WG7B 3OR6C 4XLZA 1VI5A 2O2YA 4KHPO 2LFSA 4IS2A 2CEKA 3C4VA 4JI7B 3T61A 3L71H 4MAMA 3H18A 2ZETA 2E6UX 4H44B 4GPAA 2ZB2A 3H2KA 4E2ZA 5M2QA 3VDQA 3CUUA 1B6QA 5AFSA 4EHIA 1JVMA 4BT7A 4P31A 5EP4A 4DL9A 3GLVA 1FTSA 2CJWA 2WLJA 4CV1A 2VYCA 3AXSA 5LZ9A 1GOTA 5HPYB 2FMTA 2UYKA 1P1HA 2W48A 1EM8A 5BY2A 2B9EA 2ZJOA 4H3SA 3L92A 3SC6A 4UM7A 3FN4A 3P27A 4JI8B 1RFLA 2QM0A 3D8BA 4FBGA 3ZYZA 1U3VA 3IKLA 1UR5A 1N8KA 3VR4A 4AMUA 1GYPA 2A1UA 2YWFA 2FHPA 5CAEA 4RJ2A 4HMOA 2C7RA 1MAAA 3ZE8A 3MMPA 2HEGA 2D4AA 1QGDA 1YZTA 3AZOA 2C5FA 2BFPA 1ZR4A 5TS3A 5HUHA 1II0A 1ZRHA 4N41A 2ASVA 4ACAA 1EVKA 5IAOA 4WMLA 4F1WA 3GVPA 1QR9A 2X6AA 2EJ7A 3BOSA 4L8FA 1Z0AA 5IDVA 3ZNQA 3N39C 3IEPA 1F2UA 3IVCA 3I62A 5K8IA 1SQVH 2C9YA 4RD6A 1UT6A 5TSDA 2ZW9A 3D3JA 2FFHA 3AHHA 5JS8A 2XB8A 2VPWA 4UNRA 3CXCU 3MUEA 5J4YA 5REQA 4DV6O 4JU9A 2JFVA 1RBZA 1P7ZA 4J9YB 1J6UA 4ILKA 4GOOD 1NXOA 1GDHA 4OHVA 5LKRA 3IAEA 2GAAA 2P75A 3L0PA 1HNZO 2PQMA 4L87A 1KDOA 3UK0A 2P9BA 2AIZP 2J09A 2R1VA 3H1EA 4KKVA 2GLXA 1G8PA 3LY8A 1CF9A 4ZK6A 1NN5A 3ORRA 4URXR 5KJ1A 4KWHA 3QMVA 3P9RA 3RVDA 4AZ3B 5IAJA 3E5NA 1DQYA 3E8MA 3DP7A 2AQHA 2Z5FA 3L4BC 4EG7A 2VJCA 2TMKA 2WD7A 1NMZA 1FMTA 3ZWXA 4ENRA 3NHBA 3BYQA 3VZCA