4TV8B

Tubulin-maytansine complex
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
428
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
publication title A new tubulin-binding site and pharmacophore for microtubule-destabilizing anticancer drugs.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 169
structure length 427
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4tv8B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4tv8B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4tv8B01
4HNAA 4IHJB 5LXTA 1W59A 2BTQA 3JAKA 3VOBA 2BTOA 4EB6A 5JQGB 4EI8A 1Z5VA 3JARA 5EYPA 4I4TB 1SA0A 4I55B 4YJ3A 4ZI7A 4LNUA 5JVDA 4X20B 5IJ0B 4X1IB 4YJ2A 3N2GA 5EIBC 2R6R1 4O4LA 4TUYA 4U3JB 5MN6A 3RYCB 5J2UA 1TUBA 5M7EA 5KX5B 3VO8A 5JCOC 1W581 3WGKA 3VPAA 5CA1B 1JFFB 3HKDA 3HKEB 3RYIB 4ZHQB 5J2TB 2Q1XA 4X1KA 2GVIA 1W5AA 4O4JA 4TV9A 3E22A 3WGMA 4F6RA 1TVKA 2VAPA 3HKCB 4KWEA 5KMGA 1W5EA 3WGNA 5LA6B 4O4IA 1OFUA 1W5BA 5LP6B 5BMVB 4IHJA 3RYHA 3N2KB 5CB4B 3WGLA 5CA0B 4WBNB 2RHOA 5JCOA 3VOAA 3VO9A 4FFBB 3JALB 4IIJA 5EZYA 1RLUA 4O2AA 4I4TA 5IYZB 4I55A 4HNAB 2R751 3JAWB 1FSZA 2BTQB 4X20A 5LYJA 3C8LA 3RYFA 4X1IA 5IJ9B 1FFXB 1SA0B 5ITZB 4DRXB 4U3JA 4M8IA 4O2BB 1Z5WA 4O4HA 3RYCA 5C8YA 5JH7A 4U39A 3JATB 5KX5A 1W5FA 4I50B 3WGJA 5FNVB 5CA1A 4O4LB 4TUYB 3RB8A 1JFFA 4ZHQA 3HKEA 4ZOLB 3RYIA 5J2UB 5J2TA 5MN4A 4XCQA 4EI9A 5GONB 3JASB 4E6EA 5LOVA 3HKDB 1RQ2A 3HKCA 2VXYA 4X1YB 4TV9B 5JQGA 4TV8B 4EI7A 1TVKB 3HKBB 5LA6A 3UT5B 3ZBQA 1RQ7A 5LXTB 5IJ0A 5LP6A 3JAKB 5BMVA 4EB6B 3ZBPA 2VAMA 5CB4A 3M8KA 3R4VA 4WBNA 3M89A 3JARB 5EYPB 2Q1YA 4FFBA 3CB2A 3JALA 4YJ3B 4ZI7B 4LNUB 5JVDB 2XKBA 3ZIDA 5IYZA 3RYHB 5LP6C 3JAWA 2VAWA 4YJ2B 5IJ9A 3N2GB 1FFXA 5EIBD 4IIJB 5EZYB 2RHJA 4O2AB 5ITZA 4DRXA 5LYJB 1TUBB 4O2BA 3RYFB 2RHHA 3JATA 4I50A 5FNVA 4O4HB 4X1KB 4ZOLA 3V3TA 5C8YB 4O4JB 5JH7B 3E22B 4DXDA 5GONA 4F6RB 4B46A 3JASA 2XKAA 5KMGB 3N2KA 2RHLA 4X1YA 5CA0A 5MN5A 4O4IB 4TV8A 5LOVB 4B45A 3HKBA 3UT5A
chains in the Genus database with same CATH superfamily
1DCMA 2BGLA 2BKAA 4MS4B 4MWSA 4YCJA 1I2ZA 3BA1A 5MGNA 4I2NA 5HY4A 1X13A 4JODA 4WUTA 3HFJA 4JKIA 3P9KA 1NQAO 2Q7EA 2R44A 2IQ5A 5K0LA 2J4DA 4PX5A 4IKEA 4MVJA 3D2LA 5C3UA 4RW0A 1JU3A 4N9QA 1T5SA 3N2IA 3NHPA 3O6VA 3ICOA 4OOFA 5JISA 3TN7A 3CUWA 2CUNA 2Q7DA 2EKLA 1ENPA 3VDMA 3HV0A 4PJ0Z 2JHGA 2C9CA 5IHPA 1PR9A 3ELDA 1U11A 4AN0A 4MRRA 1KO5A 3GGDA 4QPCA 1BQZA 1YNOA 2GLZA 2VRCD 3QJYA 5C46F 5E7IA 1P4SA 3A1DA 3JARB 1YUNA 3W6NA 3SYNA 3C3BA 3EMBA 3AHEA 4DLTA 1YB4A 4A8HA 3DLBA 3PX7A 2C4KA 1K8ZB 2AEFA 5DK6A 3A0BZ 1FKAO 1K97A 5IVKA 3UKDA 4N5MA 1LSSA 2ZM6O 1JX9A 1OZFA 3SS8A 1WB8A 4D97A 5GZ1A 3LWQC 2OBMA 3FG9A 7MDHA 3R2JA 1W3EX 3MJSA 3IDAA 4MV4A 2ZI7A 3M9LA 3S28A 1VQ1A 1A7JA 4URWR 1MZFA 3CCRF 2XOEA 4RULA 3VYSC 4MAFA 3ICCA 4Q3AA 3KL4A 4D6YA 2GAIA 3S40A 1TVEA 2BR5A 3HPLC 3SLKA 1JG3A 3ZJUA 5ED4A 5JCZA 1R8XA 4HQRA 2V1UA 4PSAA 1PI3A 3OIVA 1T3SA 4JUFA 3OZSA 3OH8A 4JB0A 2DWEC 1Y1LA 1EJBA 2HLDA 4E22A 1P4RA 1XMQO 1CQPA 2XUGA 2Q2NA 4RJTA 2WAYA 1JPUA 4YQZA 4RIHA 1P75A 4BTLA 2WLNA 3C9UA 4G5RA 2XB2A 3REGA 2OFPA 3T7AA 3BJRA 3HPRA 1M74A 1U2RA 2JIBA 2P22C 3JQFA 2G7MC 1VRVA 4OLAA 3BGOS 1L5OA 3ZDQA 2Q46A 4WBXC 3N0VA 4TKLA 1N5OX 1X6VA 3DR5A 5AO9A 2ZVDA 2FU5C 4E4RA 3IMPA 2HHAA 4BJ6A 4I0XB 5C5CA 5EXXA 2P65A 3WG9A 2WZCA 1A5AB 3DC7A 4UB6Z 1U2QA 4J2TA 3TRIA 5HR5A 1DRVA 1UPXA 5FR2A 2Q9UA 5AP9A 1A9RA 4CIVA 5C8YA 4D3ZA 3A1SA 4D9CA 2F90A 5EJ4A 1SCQA 1ND5A 1BKDR 4AJ9A 3RAFC 2JAPA 2WHPA 4NDNE 4F5WA 3SEZA 1HYEA 1M34A 1IEVA 2QPTA 1XROA 4MKIA 1H1LB 4BN5A 1UDCA 4RZUA 2BN4A 1N2SA 1MB9A 2IYWA 5FOXA 2PZFA 4ARZB 4F38A 4ER5A 3JRWA 4D3SA 4K87A 4YHHB 1BS9A 1G20A 1EA7A 4HB3A 2VKTA 2E1RA 2HBZA 4QEDA 2XEDA 2QROA 1LVUA 5EXTA 4JA2A 2HF7A 2Q0OC 3D7MA 3AJ9A 2Z83A 3JQGA 2J31A 1YQEA 4KMRA 5IKXA 2ZSDA 3KDAA 3RIYA 3QUBA 5ICGA 1Q84A 3VKWA 4HB0A 2ST1A 4KV9A 2AZ4A 4BLVA 1F60A 3DP7A 1R4MA 2V7TA 1U0BB 1PNMA 1GRVA 1KU6A 2HT1A 3S2YA 4LY9A 3CXUA 1EXDA 1KD1W 3R0VA 1YXMA 5DDIP 5SZHB 1YUMA 2W6ID 2F55A 4ZODA 1KSJA 4MVXA 2IHVA 3L6OO 2Z0MA 4DWWA 1SCUA 3W2TA 4IQ4A 3U10A 4LFBO 1UM8A 4EB3A 3SU8A 4D02A 1VJDA 1OJ7A 2O5VA 1P5ZB 2Q6IA 1NVAA 4XLLA 1SBIA 3EHEA 2O54A 3DQZA 5FXMA 5B2EA 1ZMXA 3NNNA 2HNAA 3E3LA 2YVUA 4ERNA 4PTZA 4LSMA 5DEOA 2WW8A 2E7ZA 1BDIA 2QL9A 2ZDGA 1KZ7B 3ODPA 4O1HA 5A06A 3DKVA 1AGNA 3GPDG 4G6ZA 2X8JB 4JEHA 4DR2B 4HQ0A 4IWNA 3MYYA 1T3ZA 2VK1A 1IUKA 5LYJA 2Y2VA 3C3YA 3EXFB 1QIEA 2IY8A 2J5RA 2FEAA 3CINA 4YJGA 2QVGA 3IDZA 2I22A 5CXUA 2I6UA 1V1MA 5H82A 3A6FA 9ATCA 4DUYO 2ODBA 1E79A 2DPMA 2BBOA 1M6NA 1JQLB 3QPAA 2Z1FA 4QBKA 2ZUVA 4GL2A 3LHKA 4NHOA 4Z3KA 3JVEA 1IBMB 3HA5A 5EE3A 1NT2B 1GQYA 2GN0A 1U4OA 1EGVB 4GC5A 1ZD4A 5AW9A 4TT3A 4ITUA 3ERNA 2EFEB 1TQ8A 5CU7A 3ICWA 4HUQA 4YJ3A 2YCBA 4DIOA 1GZ6A 3HV2A 3GN2A 1N6PA 5AJXA 1Z08A 3LFHA 4AKIA 4X65B 4FLEA 4R01A 1Y6RA 5KTNA 1I3NA 3UUWA 2XECA 2GJKA 4HQLA 1GG5A 4H0CA 3RPEA 1T2CA 3I76A 4R1OA 3J81k 1R6NA 2VZ8A 1Y3BE 3WGOA 4J7JA 1JMKC 4RHUA 2OCAA 5DGTA 5EHIA 1GNPA 3QI7A 5AI8A 5LKRA 3FDJA 2ZJ7A 3JATB 1VCNA 4N47A 2V3VA 3K9QO 2DAPA 1A9XB 2K1SA 4FP9A 4DQ0A 2YINC 2Q5ZA 1R5BA 1Y5RA 1AJEA 1D2CA 3E9RA 2NU7B 4MQEA 2NO4A 2ISSD 4QM7A 3ZCUA 2C2GA 2K7ZA 5DX0A 5G4UC 4YUAA 4UKDA 5H4GA 3NM5A 5TEWA 3WLSA 3DZGA 1RSOB 4NXMB 1VJCA 3EH1A 2JFUA 2Y1GA 4X6YA 4GGOA 1VLQA 1TTQB 1WZIA 2YASA 3AK2A 4HYEA 3H65A 4NZOA 1HMYA 3LOQA 1QORA 3C6MA 4R1QA 4MWBA 4J41A 3C1TA 3V97A 4DLPA 1JX6A 2UZHA 2O0MA 2DJIA 2BHNA 1ZC3A 1R3IC 4BEWA 3MGBA 4GI3A 2X5NA 1X1RA 3WO0A 1MP0A 2QD1A 3QVTA 1XAHA 1J1UA 1UC9A 2FMKA 2BSAA 1RQLA 4DBLE 1DMSA 1F4LA 5DX8A 1E9DA 3UGTA 4H17A 1EFLA 2D0OB 4ZYXA 2WT8A 3T1YO 2AD1A 1DOHA 3I0ZA 1XRQA 4Q4AA 2ZJ5A 1E7YA 1ZL8B 4MW5A 2JFXA 5EXSA 3VQYA 1SUAA 5JNRA 4CLHA 2O8EA 2QYHA 2B9EA 4I99A 4ND8A 2W6OA 1EDZA 3O82A 1FPOA 3G02A 2C7RA 3OSUA 1I3KA 4RXMA 3F6SA 3V00A 3G13A 3GJ5A 3QVGA 3U44A 1QNFA 1MG5A 2XMZA 3NHRA 3OT5A 4AM8A 4INOA 3QEBZ 1K9MH 4BUJA 1GOTA 2W4IA 3USZA 4YACA 3LWRC 4ZT6A 1U28C 1IBCA 4IFIA 2V7UA 4FYHA 2IEZA 4BLUA 2JG3A 4OL0A 1N6OA 1LQTA 4D9GA 1JXAA 1P84F 3CFYA 1DP4A 5ALOA 1EFRG 2POCA 3TAUA 3KAKA 4R1MA 1WMDA 5B1AB 4CG2A 4P38A 1I01A 2CFOA 3RFXA 1JPNA 3WAJA 3PUVA 4GZ5A 2D1TA 4HXEB 3CONA 1YR1A 3L75H 1U7PA 2QTRA 2CWDA 2XT9A 3H5OA 1N77A 2FQQA 2NYAA 4KRXA 4ERXA 2I3AA 4G1FA 3V1YA 1QYRA 3W5BA 2UUBO 4M1SA 2QLMA 1E2QA 3G9QA 3RKUA 1OWOA 1TUEA 4TL9A 4RFSB 1CIJA 4DXDA 5C51B 1U1DA 4FEGA 3PGKA 2GKSA 2GVDC 1RFLA 4B3TB 3U4HA 2YWFA 3L6UA 2CSLA 3ZY4A 1IN6A 2GETA 4L78A 1XX6A 4H3KB 5EJ6A 3BCSA 4H6WA 5HDBB 3O94A 4CE6A 4QU5A 4HB2A 1M5IA 4X7PA 1XU4A 4PAMA 1Y3AA 4UAJA 4AIIA 3MRSA 3O8QB 1LQ2A 5DYYA 2AEJA 4MZDA 1J7JA 1IBRA 1WXEA 4WT7A 2F9LA 4C7OA 4QU8A 1RQGA 4N0MA 5EMHA 4IICA 1VQ6F 2IF0A 4R2LA 4ZVNA 1ONIA 5BUSA 2PRYA 4IFBA 5LL6P 4L5IA 1QRAA 2ZRGA 3VFDA 1KQGA 5LJIA 2ZCUA 2H9YA 1LV7A 4C14A 3OWOA 4R6XA 1KO4A 3U48A 1AQNA 1GFIA 2BKEA 3RNOA 3ZUGA 4M7PA 3ENVA 3TMYA 2PGLA 3U13A 5BMVA 2JK1A 1YCFA 1L4HA 3ZE6A 5EP1A 5BSHA 2BFPA 3OZAA 1Q44A 3JWHA 3HVIA 4YT2A 4N3BA 3Q2KA 1TX4B 1GZVA 3NIBA 3K0DA 1T9KA 2P2SA 1WKBA 1EJ0A 4XQCA 3CF4G 1KH1A 4P4SA 4OHCA 2MMCA 3U9TA 3W6ZA 3P2OA 2PEZA 3B1FA 2B5UA 1L8XA 3A4NA 2XBMA 4LOIA 4AQDA 1WQ4A 1XRLA 1XD2A 3V1KA 2P4UA 1MEOA 2ZB3A 2PO7A 4EFNA 4A2WA 1SIWA 3F5QA 2IU6A 2X2OA 3F9RA 2ON6A 1P0QA 1GP2A 5CT9A 4JLNA 5ILOA 3G2QA 4J4TA 3FGPA 1U0FA 2MWMA 1AF7A 1GRCA 2HA4A 3LVRE 1FSPA 4TL8A 5J59A 4YX9A 3VYSB 3Q0IA 4J90A 1VECA 4JZGA 4BGUA 3U9SA 1V26A 4KR9A 4MP8A 4RADA 4F97A 1Q0ZA 4RS3A 3L0PA 1T36B 2HZ7A 5HP8A 1BX1A 1OH8A 4S1WA 5DTQA 5E6SB 2PUEA 1HE2A 4GOND 3N9IA 1BN7A 3GIWA 1FVHA 3C41J 3V4RA 1VC2A 4AKTA 1M2WA 2HA7A 3T7IA 2WYHA 4HTFB 3WXMB 1VMIA 1NBWB 5JS1A 1CT9A 8AT1A 5LWQA 1KJ8A 1A2OA 3TGPA 5CM8B 5ALXA 3LZDA 4GMDA 3TPCA 3L06A 3U3MA 1VQNF 3R4VA 2GI4A 1FZQA 2A0WA 3I8XA 1C3XA 4MVSA 4KXLA 4P0QB 1AR5A 4EHDA 5EIBD 3OGIB 3RC3A 4DCJA 2O7RA 1Q0RA 1GGVA 3INNA 2NX2A 2HHJA 5JH7B 4F91B 2D5BA 2V7EA 3IO5A 1I6WA 3PRJA 5F35A 2F4NA 2Q5LA 3OZVA 3L1IA 3V7EA 3ZCXA 1U2TA 3OQMA 3H75A 1XVIA 5EPEA 3CG0A 3EVKA 2VPPA 1GM9A 1YRBA 1QLJA 5K0JA 3HBMA 4CHGA 1X1QA 3HKEB 3LOPA 1ISGA 3I8SA 3K9GA 5CURA 1SC5B 3EW7A 1U4SA 1K5GA 2E89A 3HFSA 5BNZA 2QTWB 1FW6A 1CV2A 3B5IA 5G0TA 1GPAA 2DMXA 4P22A 3QO8A 1UEJA 2RGRA 5CT4A 1FNKA 4I2VA 4YRDA 1Z2CA 4YIKA 2Q28A 2ZFUA 3LHDA 3L3BA 3FJYA 2EX0A 3F6PA 3ZGLA 4NNJA 2H06A 2O14A 2XB6A 3K0AB 1PFQA 3M89A 4YCBA 1CY4A 3ZE7A 1ZITA 2F3RA 3FNQA 2BFAA 3O3MB 2AHZA 4CFSA 1WVGA 3HXPA 2DETA 5CCEA 3G2IA 2IEBA 4D45A 2B0JA 4GQBA 2PWZA 3MT9A 4GYCB 4QXPA 3RC9A 5U9CA 5B30A 3UMRA 2P9QA 3NHAA 3V8VA 3UGQA 5HZHA 5KX5B 3BUSA 3U5TA 1E4EB 4LZZA 5KU7A 2H4HA 3LG2A 3HY3A 3WYDA 1VRCA 5FIUA 4U63A 2MMGA 4BX0A 4C89A 5JFOA 4R7CA 1CIVA 2D6FA 2XA9A 3N74A 2ENUA 3UOWA 2I7DA 2ANBA 3ZWWA 3GRPA 2B92A 2ETVA 3L0BA 4RVNA 1YDXA 1XPUA 1I9CA 3TZHA 1NSFA 3PDCA 4YP0A 1HYBA 3Q9LA 4ZQGA 5C37A 4PWTA 1UZMA 3FYUC 3OO0A 3M4SA 1M2FA 2ZBUA 3UJ7A 4MVJH 3SHOA 2GEBA 2ZSAA 4LJLA 1KP3A 2LKCA 5EK0A 1AA9A 1JEJA 3CN7A 3BXGA 2HSZA 1UFIA 3HYSA 4F93B 2BEJA 1G6UA 3D59A 3ZU5A 4Y1FA 2G4CA 1PKXA 2PD4A 3TETA 4P53A 2YDXA 3OR6C 4O4LA 3QU7A 4EDFA 4C1BA 4OQLA 4ZYWA 3ROXA 3GJSA 2XI4A 2ZI6A 2GO1A 1MRZA 4C4WC 4HN9A 5SY4A 3LSQA 1Z16A 2QMHA 2DUUA 4BFTA 3ZE9A 1QRRA 3KR2A 1JQ0A 4NZZA 4PBTA 1IYZA 4OYLA 2WIAA 1HDRA 2YXNA 3KPYA 3QKSA 3TD6A 5T8KC 3M84A 1Q7TA 1S76D 3GP8A 3KJQA 4H37A 2N1MA 1R6KA 4F1WA 4C6RA 3AWDA 3JD1A 2RDMA 2H1CA 2X7XA 1QUEA 3TR6A 5H83A 3U6BA 3EFEA 1Y9JA 2QNIA 2CSUA 2H07A 3D8NA 1FNMA 3R0IA 2QV7A 4WGFA 5EB0A 3T0FA 2HG5C 2DB3A 1VE5A 5HY0A 4RKRA 5DCLA 4ZK7A 1ISIA 1GN4A 1WDTA 2VEDA 1HM5A 2GK4A 5A7HA 3QPWA 4DNOA 5FOTA 4TYNA 1Y4ZA 4OB6A 4U8GA 3RRBA 2QQGA 1NQUA 4OU4A 3ZWAA 1TZKA 3DOOA 4BJHB 4BBZA 5BV1A 2R8PA 4GI1A 1LPNA 1VP3A 2VQSA 2ZR8A 1NULA 3K5HA 2ZQZA 4KLCA 3IEQA 3I2YX 3D8HA 1EQUA 4ESEA 2ZAUA 2DEUA 1BCRA 4DLSA 4AY4A 1R3KC 1HDIA 4RTMA 1OAKA 1EK0A 4I19A 3Q6MA 2BRUA 3D4IA 4TTVA 3AEZA 2H2DA 3AI7A 4ZEOA 1USVA 4CR8A 1SCBA 3OPVA 721PA 1UXKA 1X77A 2AXEA 2O59A 3UKOA 1SQQH 2VQDA 1IJKA 4KQEA 2QZ9A 4IX1A 3UUGA 1J8MF 4C0QC 2O5CA 4URZR 1BL8A 4O1IA 2ATEA 4WBNB 5D85A 1U02A 1AK9A 4J0FA 5JYCA 1C7ZA 2ZI3A 5TVKA 3GHYA 2TMYA 3BRWA 5E2BA 3AINA 3OE1A 5KYUA 5ALQA 1XXHB 4TV8B 4MV6A 1XZBA 2F1OA 1RHJA 3K94A 3ZY6A 1LPSA 1CNEA 2GZDA 3NETA 4EPWA 2Q5QA 5BNWA 4FNAA 4BE7B 1J4AA 1I24A 1ZX3A 5TQJA 3SBXA 1GNSA 2BM1A 1O95D 4CLEA 2AV6A 4JQZA 4DW1A 3EFOB 4BQFA 5JHGB 3AK3A 1K4KA 4Q02A 3LDHA 4O0MA 3VR3D 4RPJA 4HWKA 5LZ8A 1PJZA 5JAMA 3BA6A 1QH0A 2X5OA 2EULA 4B4WA 3FF4A 4I5FA 2IPLA 5A3QA 1WULS 2RK4A 2GFQA 4V3CA 1KK1A 1Q6YA 2FFBA 1Q21A 4ZHQB 5EUQB 1ZOPA 5GTHZ 3W7WA 2YHIA 4RMGA 2ZBEA 3B9PA 1YQTA 4HDNB 3I0NA 2YUAA 2OAGA 4LRYA 5ALZA 1U1EA 1KI8A 2RGNA 2HRUA 1D7OA 5KU1A 1OGIA 4KRFA 4F3RA 1QYVA 3BEOA 4IUCS 1NVBA 5DWDA 3GVHA 1VQ8F 3E3AA 2V9PA 1ESMA 5KYYA 5HGXA 1BMFG 4JYCA 3NBFA 4CF6A 4DR2O 2WHRA 1QM5A 3HO6A 2WKPA 1UFYA 2NSYA 1WW3A 2RAUA 2BLLA 5JBNA 3FB6C 5AVJA 4WBSA 3WHLA 5IXJA 4OGLA 4DZTA 3FUUA 4U2BA 4IRMA 3WWPA 3FLBA 1NW6A 2AXNA 2CE2X 3H1FA 4KUHA 4K46A 1B0AA 3D0OA 1LC3A 2XRFA 3IURA 2F67A 2FOLA 1NAIA 2IKSA 5JWPA 1V7QA 1ADGA 4YWHA 4PPGA 3BMQA 1N36O 4KUEA 1NC1A 2QTZA 3B2EE 7REQA 2B1JA 1QGUA 1IBMO 3R9IA 3LYHA 4CCYA 3BRCA 1OLSA 1Z5PA 4E5NA 2I6GA 1QYCA 5AICA 4JC8A 3NAZA 3ZZNA 5ALFA 1H66A 1Z4NA 4MUFA 3B3QA 1GILA 2KGWA 2JH3A 4X65O 3RS8A 3S0HA 5KVVA 3VU9A 3ETCA 4HH4A 2XA1A 1KQSU 3WS7A 4TKMA 2H1VA 3GFGA 1WMEA 3LO5A 2OFOA 1ZI9A 3TE7A 1NMQA 1TIBA 1Q86W 4KXUA 3OIYA 4NYKA 1OQAA 2VWGA 3JTEA 1KZYC 3R75A 4RA9A 1EB8A 1R8QA 5BXQC 2CB0A 1XK6A 4XEHA 1CQJA 1YVEI 3QQ5A 3G2KA 4P35A 1UPBA 1JJ2U 3I9NA 3ESXA 4F06A 3P9IA 5GJWC 1Y98A 3FB4A 3E1YA 2BFOA 4M2LA 2PUWA 4PZPA 3DT9A 3GLUA 1QFSA 5CIQA 3ABZA 2DUNA 2OYRA 5ALMA 3I4LA 3FZQA 2V6GA 3WYNA 3A1NA 1JAYA 2YVKA 4XSHA 1JAHA 2LFRA 4CM9A 5TQVA 3L4KA 2CHQA 2ZEJA 2F3PA 3KYBA 3L6DA 1GV1A 4TS4A 3GCWA 1QR9A 2HNKA 4GYJA 1NX9A 2UYQA 3OE7G 1DWQA 2LO1A 4RAIA 3UUFA 3MS4A 3OETA 4J3FA 5AVMA 3RVPA 2DCMA 2IIBA 2MTBA 2BDEA 1PQWA 1ZOOA 4WW0A 1DIBA 4RK5A 4FC7A 4RHYA 4NTYA 3RSHA 2VWHA 1R9MA 1KDOA 3K20A 4NTXA 3I9JA 4JUIA 4KDEA 4QGFA 3ZWKA 1B6TA 2QDOA 4LOHA 4ZVMA 2DWUA 3R0QA 4PIMA 4PFQA 3GWGA 1LX6A 5TPZA 4Q9HA 3ETJA 5AHWA 1L7EA 3A1FA 5JW6A 4P4TA 5BVHB 2EKBA 1YIDA 3RS2A 3LT5A 2O20A 4PXSA 1Q6HA 3ESZA 4JLJA 1KA9H 1VCMA 3U7EB 5HVNA 3DDCA 5ITZB 3N4YA 1JNYA 3L0SA 2G82A 4DLAA 5B1EA 1WMAA 3F4KA 4JENA 2VPWA 3GXOA 1IATA 1SM4A 2P9EA 5DHQA 3QFHA 1YJBA 2XMRA 4GOMD 2J1LA 3VTIC 2C1XA 4Z4IA 3ESQA 2VI5A 4KO2S 2IIPA 2VUIB 1YJ8A 2IYYA 3FMVA 2JAXA 2IOFK 3H9EO 3GLFB 5T3YA 1SZPA 2Z57A 2NSJA 2Q3DA 4LMBA 5EWMB 1Y6XA 1IULA 3PWTA 1C80A 4ZMRA 2IVZA 2ZINA 4N4AA 2GYUA 4AJ2A 4B81A 2XOKG 1LTHR 4P2BA 3LX6A 1CZHA 2HHCA 3AR5A 4JJ8A 3AEKB 2O19A 4J0EA 4JLPA 2C5LA 3O7WA 2B4AA 3HB0A 2JHFA 1HA3A 4B3TO 1XDUA 2HBQA 2ZSHA 5BW6B 2H7CA 1ORIA 4R0VA 4ZVTA 1I4EB 1I7DA 1VL5A 4AULA 4U39A 4LSZA 2B9ZA 5CM2Z 3SPGA 2WU4A 2QUHA 4RTRA 3BVPA 2FDXA 4AQ7A 1Q0LA 1AKNA 1TT5A 3W5SA 1HYGA 4B6FA 4LK3A 1IXKA 5FPHA 3DCIA 3PEEA 3M3HA 2B30A 3SSAA 3A1WA 1M2OA 4WZZA 1Y82A 2CEKA 3RBXA 2QWRB 2G5CA 1I5OA 2Y1CA 4LWSB 2O2JA 4YN3A 4PV7A 2YN2A 4GX2A 1D2RA 2O3QA 1A5ZA 3R09A 4KR6A 2GPWA 2OHVA 3JVIA 3GOQA 2Z3VA 3TLJA 4B6RA 1R6BX 3FLAA 5H0IA 4HQFA 3EZ2A 4AKSA 1JDJA 4B83A 1YQQA 5K3BA 3LQ2A 4D43A 4EB8A 3S44A 3N53A 4QGGA 3O84A 3KEFA 1YBFA 2FPUA 2J9GA 4OXXA 4MP3A 1CE8A 4RTQA 2NUPA 5CA3A 3CLTC 2WJHA 4JKOA 2KG4A 2K9PA 2GZMA 4D81A 3D4PA 1KFJB 2EJRA 4YJDA 3PUWA 2WLKA 3QEMA 3ONVA 1I1HA 2HU5A 2HHLA 1XQXA 5KVCA 2J3EA 2FNAA 1XG5A 3QV2A 1OD6A 4WFBV 3BK2A 1AX9A 1XVLA 3GV0A 4DW0A 3OJEA 3OEEG 4FHDA 3PFBA 4PG6A 2DJ5A 3ZHQA 2ZRFA 1RYDA 1WCIA 1RM1B 2IBMA 1EJ6A 4UHHA 1LBEA 1GQRA 3FCEA 1XMOB 4GT1A 3VU0A 1I0IA 1XZFA 4XPZA 1RYZA 4EJSA 5HSGA 3DB2A 1QO0A 4FCTA 2JI8A 1BS2A 1PHRA 4R0NA 4QTUB 3OEHG 2P7IA 4GLJA 3F7MA 4PO3X 4G5QA 2JGRA 1TEZA 1FMLA 1YS1X 5GONB 1ISSA 4F2DA 4CT4B 3JV7A 2EZ4A 4TOIA 1R5OA 3MTGA 1KWKA 3LOUA 4DMGA 4D41A 1L1RA 2BEVA 3WL3A 1XJWA 2WWFA 2PSJA 4U9IS 4CBVA 1RZUA 5FV4A 5B55A 3SC6A 2XA2A 4D3XA 2AN1A 3GEBA 1YZHA 4C6TB 3L4BC 4GP9A 1T5LA 1ISJA 5GJBA 4B75A 3NC4A 4DCOA 1T9DA 3OICA 1E3TA 3A3PA 3PRKE 5JVDA 3CZPA 1G5QA 1PZXA 2ZRCA 1N1DA 3TUZC 1Q1QA 2BGMA 5KTOA 4NBKA 2XNKA 2DYKA 3ND9A 4O5AA 3OKAA 1TB4A 4DSAA 2KG7B 2C5HA 3EF3A 3R6GA 1Z18A 1V5FA 1AB3A 5IKPA 1P4JA 3KDPA 4B2IA 3D6TB 3IGFA 4KXVA 4D0LB 2Q5OA 5DO9A 4G09A 2QX4A 3TXSA 4HGQA 1DZIA 4OAPA 2QI9F 1V2HE 3LKZA 1QZUA 2UZIR 3OM8A 3SX4A 3EEQA 3CNHA 3LMKA 2XDAA 3KTFA 1CUHA 2QN3A 2LP4Y 4MJ7A 4A27A 1P7YA 3KKLA 3ZRSA 1QC5B 3P4YA 3CEAA 1S72V 3DXRB 1X8KA 3DC5A 2CVOA 1OZ0A 1X4TA 3DLPX 3RK1A 4F9TA 1BDBA 5AXDA 5K1ZA 4KOAA 2PA3A 2JKZA 4MIYA 4TL6A 3S1AB 2CTPA 2YMPA 4Z5XA 3QOXA 2FRVA 4C4RA 4RPCA 1CUDA 3I6BA 3FHOA 5CHEA 1QS0A 4PYIA 1NU1H 2RGBA 3C5EA 3QBDA 1WA8A 2ZOSA 2ZT9B 4LCEA 3CLSC 3F6RA 2JJ1D 3RGGA 4ZCQA 2OBBA 2IZ5A 5ABPA 4FEYA 1JSXA 4HNSA 4U1RA 4WZAA 1Q5OA 3R23A 3BFPA 4L72A 3UHPA 5FKJA 3A6JA 1NQTA 4JT4A 2WD8A 3KPJA 5EQTA 4CDMA 4AD8A 2NYRA 5D01A 5C1DA 3IO3A 3RUAA 1C9KA 2YY7A 5LP6C 3FBGA 1FP7A 5C5DA 3EFBA 2DUWA 2WIGA 3HM9A 4R68A 3D5TA 1JWLA 1E2PA 1DE0A 3REOA 4AUMA 1TPZA 4BAYA 4K8ZA 1Y8QA 1AGRA 2P7TC 1ECBA 4G24A 4LG1A 4URHA 1N5DA 5T3UA 4DXHA 3AG6A 4UFZA 4J7KA 4BLRA 3WMEA 3UKMA 3M34A 5FNZA 2ZZKA 5A4MS 3G6EF 3UWMA 2HMWA 1UK9A 3TNDA 5B1NA 2OGWA 1GJRA 4P58A 3GLGE 3AHFA 1Z2EA 4M36A 2PZ8A 2B83A 1EVJA 3DLHA 2CF6A 1M8GA 3PX2A 3WNBA 2YC0A 2O2XA 3LL7A 1A50B 4L4ZA 3D31A 5DU2A 4AJJA 3PNPA 2HB6A 5HQ3B 2FWRA 5B1AC 2IPOA 4Y9UA 5FOWA 1YGYA 2C82A 4RFVA 1J24A 3RVQA 3K4HA 1EVQA 2JIRA 4EVRA 2CYAA 2V03A 4CM4A 2WHEA 4URFA 1R5JA 2GV9A 3CLUD 1EK2A 1XMPA 4RZSA 1F51E 3AKEA 2O2GA 2Y1WA 4AG6A 4IXWA 4KQ1A 1YHQF 1U3CA 4RANA 3K0FA 1V95A 4F2GA 5LB4A 4MCJA 2BTOA 4IXTA 4IFEA 1WUTA 1FU8A 1ICIA 3FB5C 4U00A 5A4DA 3PQ7A 2C5FA 1LI7A 3VPHA 1T35A 3WJAA 4DVJA 3R74A 1WVMA 2MHCA 3ENQA 3OBIA 1SZXA 3FUVA 1PCXA 2D2XA 4C04A 3T7JA 4ZCIA 2J41A 5HIMA 2CL5A 4R0MA 4IHJA 2OSBA 1TM4E 2ORIA 3NM4A 3TQFA 1R3LC 4MIOA 3MN1A 3OF5A 2PBZA 1NR1A 2ESRA 1T2NA 2PRKA 4KGZA 4RJKA 5C1BA 3QHAA 2C00A 4L4UA 1LLFA 3CGWA 1W75A 2QTSA 2CY0A 4Q1BA 3H8WA 3IOEA 4RCZA 1KJJA 4Y2XA 4UHKA 4LJ8A 4OI4A 3H5TA 2DW4A 2UYCA 3I4CA 1K66A 2ERXA 1A82A 4BWYA 4CIXA 4OK3A 3IALA 3K70C 1EK5A 2EZTA 1ZD9A 1XDBA 1U80A 1A7AA 4HQKA 3AG7A 2J33A 4N18A 2I76A 5FO0A 2X58A 1UM9A 4JX8A 4N82A 2GZHA 2DT8A 4RTOA 3A2FA 1GCGA 3NEJA 3WZ2A 2PA0A 3OCUA 2ZYGA 3A9WA 1YVRA 3NANA 1SKYB 3X1KA 3C8UA 4EGQA 5HIIA 3K72B 1OXKB 5ER6A 3SKXA 3JVUA 4E7PA 4MQMA 1XCGB 2RGYA 2A6PA 4IXMA 4MI3A 4JJGA 4QEZA 1OCRC 2VYVD 4GI2A 4N0PA 1CCWA 5BW8A 3ZBTA 2XQGA 4G01B 2C9OA 4XIYA 2V7XA 2RB5A 2NO5A 1JQDA 4NKRA 5HRAA 2CBZA 2W2OA 4NR0A 5GZ6A 1M0EA 1JB1A 4IQ0A 1GHTA 4B80A 5B1SA 1Q6ZA 5K3EA 1DC6A 4NBVA 1YCGA 2R70A 4RHFA 3EVDA 3LNMB 4RAOA 3IKEA 1CBUA 4QASA 3QUAA 2UU9B 1Y33E 4BP1A 4ZCMA 5IXSA 4C9BA 4ERHA 5DN6D 3WY9A 3JZAA 3CV3A 5EWLB 1Z6YA 2OCYC 1KI2A 3VPDA 1UPGA 2X0FA 2OZLB 2P6RA 2GK6A 4JR0A 3D7NA 2R751 2PQ2A 4WZBA 1EUZA 1JVMA 3D8UA 3E1KA 5B5EZ 1GFSA 3M6VA 2PUDA 1RADA 3ELUA 1F9AA 4L0MA 2QBYB 5ARBA 3FKSG 3M5WA 1E1QD 1OA0A 1OTYA 3SIRA 1IVYA 5HMMA 4L5CA 4HYYA 3EQ7A 1UBTS 2XTMA 4Y2HA 5FNVA 4Y6GB 4WFQA 4ENTA 3JQ9A 1FAFA 3C3TA 3HB7A 2REQB 2FJUA 3VR5D 5EC1C 1NE2A 3PNYA 3EPJA 1THZA 2HWXA 3JYLA 1WW2A 3RANA 4MB6A 4MV0A 3E9ZA 1CS4C 1IOWA 5TXGA 3V2IA 1BW9B 2H0QA 4NCHA 3TF5A 3AV3A 4AXBA 3I9MA 4CH3A 3U5ZB 5AW2A 1KR5A 3IUYA 1KPIA 3H2YA 2KQXA 4QRIA 3VZDA 3AM4A 1HLGA 1U1FA 4AMYA 5ICMA 3FI0A 3G5TA 3FWYA 3ASYA 3NTQA 3OMNB 1VYTA 4Z4QA 4CEHB 3L0ZA 2HJRA 3UWSA 4HNQA 2AE2A 1ZN9A 1C1XB 1NRJB 1W29A 4MR8B 1OU4A 1Z6TA 2OCPA 2QGZA 3TK1A 4RLFA 2WJ6A 3T3DA 1VSQA 2ZSJA 4FGJA 3CUEF 4P80A 2A1TR 4QUGA 1OWPA 5ALKA 3CEJA 2D1YA 4EB0A 2RH4A 5T6BA 5ECDA 3I52A 4M0DA 3WMXA 4MLPA 1RMTA 1I7QB 2BMJA 1HDOA 5F2EA 4GM0A 4CT5A 2XCOA 1II0A 4QU9A 3C3JA 3EASA 3TE6A 1AY0A 1UKYA 3WGQA 3L8YA 2IEIA 1V9PA 1HX7A 3F8SA 5IPFA 1ZHHA 3ZY2A 5A5GA 2D06A 1S2IA 3WGMA 1Y67A 4LTMA 5CB0A 2JLXA 3V8PA 1ULZA 1UBRS 3B8NA 1D2MA 1MO3A 3AILA 1CFJA 1J2RA 2PUAA 3RYFA 2WUFA 2ES4A 5DMHA 5L3SA 4XD2A 3J81M 2ZE8A 1LW6E 2P2DA 4KH1A 2NT3A 1QGOA 2ZT6A 3NXSA 3BABA 1XVVA 3IBSA 5EUCA 1XAIA 1FU4A 1NIPA 4QJBA 2D74A 3DKKA 5BVGA 4ZI7B 3DW3X 5CAEB 1UL1X 1T3GA 1RFGE 3UW3A 1AJNA 2IYPA 2JLQA 4E2WA 3L05A 2AOUA 1C0PA 3NPMA 4IF4A 3BSYA 2OENG 1PX0A 1RCUA 1YFKA 1M7BA 5EEHA 3KKEA 2PT7A 4FT4A 4XR9A 2EFYA 5CHYA 3CZRA 3BKWA 1I1OA 3V7NA 3HGMA 2YQ4A 3LGAA 1ARZA 3PNBA 3WLHA 2H1LA 2AKEA 5CLQA 2PGGA 5EL0A 4UUJC 3R76A 2ZCVA 3T9AA 4TL7A 4HNAB 4DMHA 4I50F 1JV2B 4G0VA 3O5AA 1TM5E 3ETLA 4RHXA 2M9MA 4KQKA 4EF5A 4FW8A 2AG6A 2C2KA 2BL4A 3FLEA 1E1CB 2PYZA 2IGBA 3ABRB 3HDYA 3ODGA 3AJEA 4N6OA 2HUPA 3ANXA 1R64A 4BQSA 3GJRA 2W2LD 5IT9N 4DM4A 4V0ME 1QAOA 4XPIA 4AUEA 3JWGA 3QA9A 2Q3EA 2A4KA 3OQJA 4U8HA 5BYKA 1IEXA 3I2IA 3E82A 5KLVH 3SFTA 3IHKA 2GTAA 3X1XA 3OQVA 3JZIA 3NATA 1G1MA 2I33A 1Q3KA 5J2UA 1JQ5A 4ANFA 3DO5A 3BXHA 2WLMA 1A71A 1G2PA 5EP4A 2UAGA 1E32A 2B61A 1I80A 4M1EA 2BSQA 2B8JA 3VU1A 4DTIA 1H9BA 1QR2A 1AKEA 4EX7A 4M0KA 5TB5A 1LK7A 2Y48A 3O1JC 3UHFA 3AKYA 1D03A 1Z2NX 3Q6NA 5JU6A 4E88A 4MWEA 1PSZA 3H3FA 1SRQA 1DXYA 5IN5A 4X3LA 2DWCA 4ZZ2A 3TIFA 1RC1A 3DLIA 3EPKA 1G8AA 5TPWA 5B1YA 4YLGA 4QGBA 2ZBDA 4QDTA 5D1NA 4JXXA 3NTLA 3WLNA 2GILA 2BBSA 5F77A 2ZTVA 2WYWA 5AK3A 121PA 1KOFA 1PN3A 2X5KO 1CJMA 4A0RA 2FOIA 2WB4A 2WBLC 1RJWA 4BAUA 3GZJA 4L85A 3KQLA 2P5SA 2N42A 4DSZA 3TI9A 1OBHA 4QNMA 1LRKA 3ONDA 4BW0B 2FP4B 2PVSA 4JU9A 1AKWA 2ZIXB 3SZLA 4RPHA 3OA2A 3C70A 2GBIA 1QOZA 2HU8A 2WE8A 1F4NA 1PL0A 5HF5A 3Q3EA 1ECCA 2FPIB 2BHRA 4H3HB 1H2XA 1HV8A 3VOTA 1ZG3A 1JLKA 5LP6B 3FCAA 5PGMA 2JATA 1KIMA 3FSEA 2QMUA 3GD5A 2ONZA 4LE2A 1Z5NA 2I55A 3ILYA 1CDEA 3MXOA 1NM5A 3AR2A 3ESAA 2RC6A 1SNYA 3T3IA 1VIYA 4BPBA 3OQ1A 1IXBA 3LX4A 1NVPD 4LGYA 3WA6A 3HU2A 1AB6A 1SVWA 2ZXFA 4BQQA 5BQ3A 2GZRA 2XR1A 3E15A 4XRGA 4K40A 4OHXA 1BGXT 3OQPA 5CVVA 2ZUDA 3AEUA 2WM2A 2UUCB 5J1TB 3CRMA 1ORHA 1GCOA 5CBGA 1W9MA 3D6HA 4YNBA 5C53B 1C4OA 3KALA 2O2SA 5CLLA 4WJLA 3G1TA 3IP9A 3AVUA 4RORA 1G21A 4HAWA 4HDRA 1P44A 1GK9A 4A5OA 3LDUA 1NBMD 4QDZA 4MLCA 1ZSPA 5GIPE 3KZOA 4FHEA 2QQFA 1IZ8A 1UT5A 3EA0A 1OC4A 1MU0A 4DDWA 5IAAA 3FCOA 5KAPA 3FDZA 1B1AA 5G1OA 5DVZA 3PU6A 2CWJA 3OUTA 4GPTA 1Y5NA 4JBHA 5K0SA 1MT0A 4IM7A 4FFKA 1Z33A 3OAAG 3TTWA 1IXZA 2ZRDA 5T67A 3WXBA 2A7XA 2N9UA 4O2BB 1ZH2A 1V4VA 4MT8A 2R60A 5U4XA 1DXOA 4UHBA 1XMOO 1DBWA 2HXYA 1YR2A 1L5HB 3C5HA 2PUSA 3OZGA 3OX2A 4MVUA 3VUFA 4L27A 3FGOA 4LGMA 4IJ6A 4BNWA 1HR0B 3VOSA 3KT6A 4DJTA 5FUXA 3RSFA 4FI3C 2HT6A 3QO5A 1DADA 1J33A 1SXGA 3WNZA 2XUIA 3S81A 1NYRA 2GCGA 3KUDA 2VZLA 3OJXA 3FZNA 3BB1A 5L4LA 3DHWC 3ACBA 3T95A 4L8WB 3AIIA 2ZRHA 3BREA 1YF3A 4TTIA 4TKZA 5J5VA 3BAFA 4IDOA 1V7CA 1IAVA 1D9ZA 2R6JA 3L7IA 3KX2A 2BOCC 1BXRB 1ZH0A 4KI0A 2WLSA 2P8SA 5KPJA 1COMA 1UMKA 1PGNA 2Z2XA 5HPYB 3MMXA 4UUQA 1YZGA 1VIBA 1KY4A 3K70B 3DUFB 4CEIB 2XAHA 4AC9A 4BAZA 1Z6ZA 2JGAA 5GMOA 1OPXA 4R40A 3R6DA 4ZAWA 4KL1A 3RH0A 3IKFA 4YUWA 2FE4A 2R5FA 3AL2A 3MLEA 3RS0A 1EKXA 1WXDA 3I3FA 5LIRA 2X2EA 2PZKA 4DT1B 2LE0A 3DBIA 3B38A 2DPLA 1I0ZA 1QUFA 3P0EA 4X84A 3PJRA 1QHTA 4UOEA 1PYDA 3DAHA 4PGGA 4JTCB 3A9RA 3BWDD 3DEFA 2LV8A 2WR8A 5F7ZA 3TL2A 3RTAA 5LBTA 2ZSIA 1C29B 1QTNA 2IS6A 1OCRB 3W4KA 1LPPA 5HFMA 3KE1A 4LJYA 2G1KA 3K3WA 1TM3E 2YQZA 2E37A 1H85A 1XI2A 2YZKA 1ORWA 3W7SA 3L1VA 4H08A 2YIMA 3HI4A 1CP3A 1IZZA 1CUYA 1H2KA 4OXIA 1J99A 1P39A 3V8RA 1TF5A 3KEOA 3C3AA 2OCGA 1J2UA 3SJQC 3UFXA 3VQXA 1JBEA 1X8LA 2CAZC 1TXGA 4LJ5A 2FPGB 4TN1A 3RM3A 1JJVA 3J81N 3HCRA 3HG7A 1GXSA 3C6ZA 1I4TD 1VXRA 3DWEX 3T1HB 5ADUS 3G9UA 3UAXA 3PVZA 3GFQA 1MC1A 2LBXA 2VEOA 2BI8A 2H3EA 3DLCA 1A8SA 4AJNA 3HL0A 2B21A 4ER6A 4LF9B 5KWVA 3PUYA 2JI9A 3GZNA 2WWWA 3CLRC 1RYBA 4HDMB 4PGFA 4HEA6 5IYZB 1R0YA 2JLZA 5GQSA 5FQNA 3ZC3A 2R2GA 4Y6SA 4OUDA 1LB1B 1D8TA 3UK0A 2NUAB 5M5BA 2EX1A 1XNHA 1P19A 1RC0A 2PBRA 2YSUB 2B82A 1US8A 4FFPA 4YBRA 4NJEA 1HORA 2IU0A 1OGYA 3DONA 3P8ZA 5E9QA 2FZKA 2I87A 1KJIA 4QO7A 4PZUA 5IZCA 5KKAA 2ZCEA 1JKJA 3U4QB 4K8OA 3D6NB 1YJNF 1SZQA 2RH9B 3QW4B 3B77A 5FAKA 1CNMA 9MHTA 4WFKA 3KJHA 3URMA 1PFGA 4QARA 1EHIA 3O7MA 1N6RA 4L08A 2PVPA 5LMUB 2D3TA 2VP6A 1CB0A 2QD5A 3WJPA 2J9RA 2EFHB 4CLRB 1YHNA 1C1YA 2XYVA 3H04A 4YMUA 2WTNA 2ZE6A 3L7YA 4FLXA 4OI1A 2AUTA 5CBPA 2GXUA 2OM6A 1RSZA 4ZHSA 5JXIA 3OZIA 2WYUA 1WR8A 2G67A 4M1TA 1M1XB 3B1JA 2YEVA 2B20A 1KMMA 1N9ZA 3EVBA 4YS6A 1ADJA 4BB5A 3RSGA 3CJHA 5ELMA 1ULTA 3D8TA 1R3UA 4B3JA 3LWBA 2PGOA 1YZKA 4WEOA 1K3FA 1N3IA 1FA9A 1LPBB 3M3DA 3ZK9A 2AR9A 1MX3A 1SZTA 1EE9A 1NJSA 3PJEA 3IUEA 5B12A 4UAVA 1KMIY 1ZL2A 5GP1A 3WL4A 4M1QA 4G65A 3EQ9A 3BJZA 5G41A 2RGXA 2DFNA 4HWOA 2Q07A 3MLBA 5L9AA 1IHPA 4GBGA 2ZSBA 1P7ZA 2FSIA 3HA2A 2W0MA 1PX2A 1VCHA 2VBIA 4BWAA 4D0NA 2MR6A 1NP7A 4G0OA 1I4OA 3DLAA 4G5OA 3VDQA 4PM4A 3IQZA 3V4FA 1U5BA 2VJNA 1C7IA 1DCTA 3KXDA 3SS9X 3F5SA 4TM8A 5THQA 1PGPA 4JLVA 4EHLA 2G06A 1QHSA 5E2IA 3VKHA 1PL4A 4BKQA 4OD0A 4FOTA 3W9UA 1W1WA 3B9QA 1YAHA 3PDWA 1S0UA 4C4YA 2H0RA 4IF6A 4YRZA 3EMVA 1IMJA 2UZ1A 4G36A 4HX5A 3F6MA 2R68A 4ZXFA 2YI9A 1RI1A 4X1OA 4X44A 2YJ4A 4BN4A 2GARA 1UINA 2IFTA 3LF1A 2IZ1A 1ZIYA 2I3ZA 4YAEA 3HUUA 1LLCA 4RTSA 4JDUA 2V5AA 2JHAA 1FFCA 4FLTA 4PG5A 1OASA 3N87A 3EIFA 2Z6VA 1DT9A 5AQ1A 1RM1C 3OR7C 1F2DA 3L8CA 4X6XA 2PUCA 1JI3A 3P9SA 2XYRA 5AVOA 3LF2A 4TXHA 2UU9O 2AXQA 4TKVB 1TLFA 3KTDA 4YDSA 2QWPB 2XUMA 4DV6B 1WNFA 1WIWA 1I5YA 1NG1A 2RBEA 4RE5A 4G2KA 1EXNA 1QV6A 2A3RA 4AG5A 1FXWA 1E2NA 2LW7A 1SOUA 2BGWA 5DTRA 2VHVA 1S2GA 1UK6A 4MR9B 1CRPA 1BHJA 2MSLA 2BELA 2JEXA 3DAYA 2EIHA 3UMJA 3B6JA 4FM9A 1THTA 4PW0A 1M2NA 3L6EA 5KHGA 4FYXA 3FSGD 5EIEA 3ZS8C 3NRBA 2ZRAA 2VK4A 3NWBA 4N6NA 1SA0A 4Y6OA 2Q3JA 1ABBA 3TZQA 5BN5A 1D5WA 3LQ4A 2XWBF 3FHCB 4O08A 1I51A 3KUXA 3HY4A 4QOIA 2H85A 1TO1E 2UVPA 1YRLA 4K88A 3EXHA 4DAEA 3FWKA 2SHKA 3M5DA 2EP5A 3OM9A 2P9GA 3VC1A 3GRRA 3OESA 4JOCA 2ZZMA 2JBWA 4ZQHA 1PZNA 1DJLA 1MC5A 3A10A 2XXJA 1Y76B 2Y9PB 3RK4A 3OCWA 4OEHA 1P1HA 4P81A 5LOVA 1X59A 3TR0A 1TFUA 1YMVA 4JP3A 3EVTA 4Z2WA 1ZVVA 3P94A 1YIAA 2JVKA 3MJEA 3O90A 5K7SA 3BH7A 3QVLA 2RGAA 1KFEB 1D1TA 2GCIA 4WRRA 3A2NA 1AU9A 3NGLA 4TMKA 2ZVPX 2XRYA 2PFSA 2ZJ4A 4LC1A 1WLYA 4YHHO 3ML1A 2I6RA 2EERA 1F17A 3AY7A 5IMSA 1JN1A 4GOLD 5CCDA 2H9AA 1M2VA 4I4IA 2GTIA 2Q1XA 4QZVA 3JQAD 2RFLA 3SQDA 4KQHA 1XP5A 2ZSUA 4L0DA 3X0DA 4FXPA 4ICGA 1WU7A 4R1TA 4XIJA 4CM8B 3T5GA 3LDEA 4HFJA 2ICAA 4IUBS 4EZBA 1DAMA 1ORVA 2G4VA 4BLOA 1XTBA 3RWBA 5B7QA 1FJ2A 4X3CA 3BAZA 3GAZA 2NNWB 4PIPA 1XTZA 3B48A 1E7QA 3KKQA 2JGDB 4ND7A 1OROA 5DT9A 4CQMB 1VHJA 5F5NA 4XWOA 2ZJZA 3QPVA 3BKXA 3CPSA 1KFKB 4P08A 3NIGB 2WJJA 3EIQA 1COWA 3GDFA 3THWA 2CL0X 3G8CA 4IWXA 2VOJA 1N1GA 4TSFG 2UDPA 2KWIA 1BQ4A 4LA4A 1YB6A 4GOXA 4CMCA 1TJ5A 5DP1A 2EJ7A 3R7SA 4D0RA 4DSTA 3EG9B 5ADHA 3NM6B 4I5GA 1QCZA 4EX6A 3QNEA 3NYRA 2PT9A 3FZYA 4NF2A 4UTNA 3ZNPA 4K1XA 1C9DB 2ZUUA 2JBHA 4TMZA 3M5PA 3ADBA 4Q82A 2HK8A 3HVHA 2G3YA 2RHOA 4OOEA 1SHKA 3WHPA 1UT8A 1H93A 2ODQA 2P0YA 4NPHA 1JB9A 4FWTA 1JY8A 1UKBA 2YXPX 1AMUA 1GSIA 2QW0X 3EGCA 3PLAE 1XTKA 1KNQA 3OG9A 4X8AA 3O1HB 1XZIA 4LOLA 4QVKA 1U8EA 2CFRA 5K1XA 3KZCA 6NULA 2GSMB 1KKLA 3LQRA 2J45A 3IR7A 3LKDA 1A4XA 4YJ2B 3EGXB 3NT4A 4YREA 2H7XA 1UQTA 1E5DA 1QXSA 4ZDJA 2NMUA 1RDFA 1Q3EA 3ROTA 3UM9A 1REQB 1JKMA 1DNPA 5CDFE 1Q81H 2JJ2D 4H18A 4DLVA 5TQ2A 3FCXA 1E8MA 4QDXA 3ZHBA 2DOSA 2VZ9A 3NHSA 1HSZA 3HI6A 3CUUA 2CV1A 3RR2A 1KSGA 1VHLA 3TBHA 1R37A 3SMQA 4TXJA 2V3WA 3AF3A 5IAGA 3RC7A 2IBZH 5EUBA 1ADYA 2GXSA 3QW2A 5I47A 1MA3A 1BRTA 4QYXA 3K0CC 1AILA 4UVGA 2Q45A 3CPJB 1LZKA 5LC1A 1UKCA 2HEGA 3G5AA 3WLIA 3KOWA 3PWZA 3BCCH 4YO7A 1KO8A 2B94A 4BRSA 2QRGA 4DCUA 3HXLA 4R2KA 5HFNA 5BUQA 3KUCA 3AXTA 4NOLA 3LC0A 4BQPA 1WB7A 2R8OA 4NXMO 3M8AA 4M8LA 3GG9A 2AJ8A 4B2LA 1FMJA 3LQQA 5IC5A 4OFZA 1HRDA 3ETHA 3IE2A 3UJBA 3N1UA 3ZX6A 3GO4A 5EIWA 1QYWA 1XL1A 5C32A 2FE1A 4WXMA 4Z2YA 2EG9A 3VAAA 4QUHA 3FCUB 1JLRA 1D4ZA 2OXEA 5TDHA 5CFOA 1LTKA 3V3KA 4F4IA 4U7FA 3W5JA 1R6XA 2G07A 2P75A 3F4LA 2GM3A 3T61A 2N74A 1RR6A 3IJ5A 1RLGA 4TWZA 1I7SB 3GG2A 4TMYA 3A6PC 1SGWA 3T5DA 2D2VA 2H2IA 2CLCX 1G2OA 3WBKA 1ECJA 5CB4A 1LH0A 2J3MA 4MPPA 4JJKA 4Z9BA 4NCJA 4Q5IA 3UAYA 4MEAA 2VBFA 2Z0AA 1RHKA 2O57A 4A16A 2YYSA 4YRPA 3G0HA 2DXIA 1W4ZA 4M9XA 4S1PA 2X8BA 1QGYA 1O3YA 3IBYA 3QUSA 4MRSA 3HK2A 4WECA 3M99B 2EZ8A 4Z1MA 3RO7A 4C4OA 4RD6A 2UUCO 2CZWA 1CY8A 4IZOA 5DCUA 1L8LA 2BDTA 1TCBA 3PRYA 4JGGA 4MQ5A 5EMNA 2GWHA 4WH0A 3ZJVA 2FW6A 2QE7D 5EIXA 3U3ZA 4PLCA 4DDVA 1R6AA 1YDWA 1YITF 1ZN2A 1OLUA 1U3VA 4V24A 1ZESA 1I08A 1E3DA 2XJ9A 5HHTA 1GTJ1 5ED0A 2R86A 1O57A 3R7DA 3BFRA 3UWKA 2QZZA 1P1CA 4AJKA 2FKNA 4DANA 2Q9BA 2C5GA 1GKLA 3KBBA 2XKKA 5CW2A 1KQOA 2I6TA 4Q3LA 1KRWA 1GUYA 3REQB 1W42A 4M6WB 3TLKA 2FK7A 2C0CA 2QVBA 1YI2F 3HR8A 4CKEB 4FWBA 4DR7B 1TA8A 4GX5A 1ECLA 3P2YA 1VGQA 1F48A 2D59A 4ZQBA 4HZUA 3IEVA 4QUBA 3WRYA 4XUCA 2G9ZA 5D7NA 1OHHG 5KUMA 3RAPR 2IYRA 2HRZA 4YR7A 1HR0O 2M98A 1K8QA 3CCSF 4K2AA 4AF6A 2J0QA 1VSVA 4FIPC 3NHLA 4X7BA 3N2KB 4JI7B 3KYDB 1FC0A 1SUFA 4FFNA 3PKIA 2NVUB 2FLKA 3UJ8A 1X86B 1AHPA 1W0JA 4V0RA 1H3EA 1SVKA 3LUGA 2I1QA 2FN4A 5JQGA 2V7PA 1PO7A 3ZBQA 4ZT7A 4NXNB 4PS1A 3RBZA 3KKPA 3HXMA 5H81A 5K3AA 3QYPA 3CIFA 1CEZA 3G2OA 3DL7A 4UFNA 2NN3C 3PICA 4YCCA 5J9FA 2UXXA 2GK7A 4IW3B 3G88A 2IS2A 1TYEB 2QW8A 2SNIE 4OHUA 4JASA 5AKJA 1SKAA 4DQKA 3W7AA 5BN4B 4AZSA 3EQZA 5I7VA 3QFRA 4IPTA 3WSVA 5CLHA 3CVUA 3GPLA 2VCYA 4KQ2A 2PAAA 2AIZP 3WB0A 2YMMA 1N5MA 4HYTA 2OG2A 3N6XA 1XZGA 2EYUA 1FU7A 3WDSA 1ZVQA 4GS5A 1G7SA 4KIWA 1VYUA 1E6LA 4G0NA 1G98A 2GGSA 2RKWA 1XHXA 2CHUA 1BWRA 3VZCA 1NRWA 1TEHA 3CCUV 4MQLA 4BFCA 5LLTA 2VNHA 1AS2A 2BCEA 2QDXA 4HFNA 1SUDA 3CA8A 5F52A 3D1JA 3IIIA 4DZZA 2RBKA 3GGOA 1M1YA 3K5MA 3UVEA 1T4CB 3T06B 3TB6A 4WK6A 1BWQA 4LHVA 1O6CA 3CCVF 3SR0A 1EVZA 4M88A 2R3SA 4CLOA 5I7AA 3UYKA 4FBGA 2NXCA 2L18A 1CXZA 2ZXEA 4WFGA 1NXPA 4IDAA 5JATA 2H1IA 5FWDA 3D6FA 3T1HO 2CJWA 5BQXA 1CVLA 1IRXA 3LZ6A 3OJCA 1VE1A 4IGEA 3Q3IA 4FLZA 2OHJA 4QREA 5CYFA 2DG2A 5L51A 2OO5C 3FAVA 4PHGA 5DI9A 1SZCA 4M0UA 4LFCB 1HKHA 2HA0A 5DM70 3EEFA 3U7QA 4LCBA 4FB5A 4LF9O 2VKQA 3HR0A 3VI4B 3ZGXA 3PC7A 2YS8A 4MMYB 4NS1A 4FUQA 2BSKA 1Y8CA 2BHLA 1LLQA 3MOGA 1D5AA 2B8WA 5JS7A 1UH5A 2ZD9A 2RHBA 3PFHA 3GJXC 1MZPA 4BIMA 4LF5B 4RA6B 4B46A 5DLEA 3V2UA 2PMDA 1AUOA 2BGTA 3DQPA 5EBMC 1I0HA 2OB1A 5AVUA 1OXMA 1N34B 2XAAA 4KUMA 2ODMA 1BQ3A 2E55A 1NNLA 1CULC 1HOTA 4QOEA 2D7DA 2PAFA 1ORTA 4JBNA 3PFKA 4RQUA 1T0JB 4QYTA 3M6XA 1OZGA 1AG9A 5B37A 4G37A 2X0EA 5KTTA 2WSLA 2XCTB 1QFMA 5LQKA 4IJ5A 4RESA 4DY6A 2NLOA 5LMUO 3E5HA 3ZI7A 4G84A 3VPSA 5LQUA 4K9DA 3KXPA 2Q0QA 3ZDRA 4X61A 5DSXA 1ODKA 2A14A 3FNEA 3AG4B 4R8MA 1R0WA 4DQUA 4WCVA 4AKHA 2O50A 3SZOA 2PWYA 3EPRA 4MTOA 4RPIA 1RD4A 4R5MA 1N1MA 1FFXA 2QAGC 1AS0A 3QU9A 4DCCA 2N46A 2J30A 4EA8A 1ZR2A 3VM6A 5LHGA 3KC2A 4NYJR 2GCOA 4UUNA 3TJTA 4W1PA 3LYLA 1OE0A 4II3A 1YS4A 3ETNA 2YVAA 3FFAA 5IW8A 1NSTA 2FSVA 1F2TB 3AUTA 1LVHA 2NNUA 2VSXA 5J4KA 1PBTA 4II2A 4OQPA 5DEDA 2JS5A 5HZKA 2O4UX 4GOKA 2CHFA 4TKUA 1JWAB 5HJ5A 4XGKA 2PI4A 3TSOA 1Q74A 1KU0A 1KI6B 5J2TA 4P4GA 4CV2A 3AESB 4G0QA 3H1JH 2BEUA 2H3OA 4ZYYA 2JVJA 3RTEA 3GLIB 2UXCB 3IAYA 5TGDA 3M81A 4REQB 4EP1A 3FIUA 2OT3B 3EULA 4TLEA 3WQSB 3TS1A 1YJXA 5HTKA 4OBXA 1RKXA 1BXKA 3EN0A 4QOHA 2R97A 3LSUA 3FPSA 2NU8B 3M1LA 2G71A 3NMUF 2VH2A 4U0JA 2FMHA 4YV1A 1F8XA 3A4IA 4MW7A 3SHFA 3ZHYA 3D2CA 4A1FA 1C0EA 3BXFA 2PGXA 3DVQX 4EL5A 4DBZA 1OCEA 5B3AA 2P6JA 3WE7A 2NZJA 4FILA 5FPOA 3HABA 1SWVA 1O94C 3ZD9A 3QKUA 4QT0A 4WN9A 3ZHOA 1TC2A 4YV2A 4F2WA 1A9YA 5FJIA 1UMDB 2PANA 5JANA 3L73H 3IPCA 1KVQA 4INPA 3SC2B 2VYNA 3QX7A 1ISFA 3WWDA 4YP6A 4BDTA 1KVTA 1ZJ4A 3ZTWA 3AETB 1QO7A 2FFAA 1E64A 3FHTA 1OUMA 4FR2A 1X1TA 5KBYA 1OBVA 1G0NA 3K9HA 1ZNXA 4BCCA 4R5HA 1E2FA 3E70C 5LLSA 3CWQA 4QTTB 4DHWA 1IN4A 4EGFA 1VI2A 4JZYA 3DM5A 2MSEB 1Z3CA 3DOFA 2BFCB 4GPZA 3RFUA 1YTFD 1R0CA 4DV6O 3LY9A 4QBFA 3HKBA 2JNBA 1ZIOA 1DL5A 4EPRA 4CTNA 4PBSA 4G5YA 2BFBB 3NVIB 4RF3A 1XF1A 3FH0A 2C42A 4RD4A 5JZSA 5BOSB 5KA5A 2RI6A 1AKYA 1VQPF 1RPZA 2PD6A 3UICA 4BMVA 1XHFA 1O6GA 2G17A 5IEJA 4LF6B 3WLOA 4C21A 3VBCA 1I33A 4WGGA 2G9IA 4DHEA 5HY2A 4OXNA 2X8AA 2FMUA 4A6DA 1ECGA 1O58A 1ZJ6A 3THXA 1LC0A 1J0DA 2ONYA 4UE6A 4DCMA 5K8VA 3LECA 4EUNA 4FS8A 1JDTA 4KFRA 4O8CA 3AFNA 3HJCA 3U11A 2M6SA 2ATVA 4F4UA 1DFIA 1X7ZA 3H42B 4QDUA 5LL6Y 4NJMA 1Z8HA 3RLFA 2WF7A 3NHMA 4HK4A 1JXQA 3JQPA 3P2JA 4JIMA 4L4XA 2O8CA 2WALA 1PUIA 3E18A 4HNHA 1ZJWA 5DW0A 4PSUA 5GGXA 2PSEA 2FSUA 3V5NA 2YXEA 3A32A 3D3WB 3QNWA 2JGEA 4V1CI 3DNMA 3CLKA 5TS3A 5C7IO 4QHTA 2IQQA 1JL3A 2AFHB 4NFLA 2G70A 4AS2A 3P0ZA 1NG9A 2PQ0A 1ZGJA 1DOZA 1T15A 4UU7A 2Z4TA 3UF0A 3PD7A 2FSGA 4IMIB 1UJ2A 2IOFA 3FVVA 3H8JA 2JD2A 3GTZA 1TD1A 5KQGA 1OMOA 2B25A 3HKDB 1I5RA 5GOTA 3G2JA 4JIGA 4D2IA 3LXRA 1BRMA 4RK7A 4XGRA 1QU2A 3OBBA 2VBGA 5EFZA 4ON9A 4F9GA 1L7AA 2VBCA 4O4HB 2VO1A 4TSRA 1L7MA 1L5ZA 2AG1A 3AIMA 4EUFA 1VXOA 4RZHA 1VF5B 2ECOA 5H9WA 3OTFA 2SBTA 1Z68A 5DK4A 1EDEA 4GQAA 2Z5LA 1L5KA 1GU0A 4DG9A 2X4GA 3IVAA 4B35A 2I4OA 3SC3A 4DIBA 3TLMA 5HE8A 1W0KD 5KDLA 2TSYB 2P0EA 1LDGA 4W5NA 2UZ3A 2HAEA 1DQSA 1PS9A 5A9RA 3TTUA 4RVHA 2BE3A 3GAAA 4DDUA 1EVLA 3THOA 4DUZB 3GHZA 3C43A 2VHJA 4CKBA 3PT5A 4BRZA 3HTNA 2BVNA 4CNQA 3FBTA 4DEXA 1YDHA 3I58A 3BL6A 1UZAA 4RYLA 4IOMA 1KQFA 4PLZA 1E9FA 3DOEA 1EE1A 3PCTA 1QU3A 4IX9A 2FSFA 4TVBA 4OQYA 4HBGA 3K0TA 1JDZA 2YY5A 1B41A 3LBIA 3FPHA 3FRJA 1Z2PX 9LDBA 2D5IA 2A2ZA 4ECEA 1BJRE 4MS3A 1KAGA 2WFMA 2ZJ6A 3DDHA 2AZMA 3CT6A 1L5VA 3RVBA 2E0IA 1UBUS 1E18A 1KXZA 4UBOA 4HADA 3G2MA 3JD3A 1I9GA 1AMOA 3L8DA 3V34A 5F73A 4TRRA 1VZ2A 4MR7A 2G8LA 3WU2Z 2R5NA 4QE9A 3RFCA 2C2XA 3MDSA 2ZWOA 3H9UA 3K9SA 1NN3A 1O6FA 3LUDA 5HF6A 4CTKA 4TVKA 3GFOA 1MGPA 1UDBA 4FD2A 3W3AA 3FTEA 1KDTA 5E0OA 5EIOA 3ZN2A 5FPSA 5DH9A 1E20A 2M2IA 4RTKA 4JEUA 1P3Y1 4YMHA 1JQKA 4DMRA 3KQNA 1JIJA 3GEEA 3HCWA 3R9XB 2ANCA 2C2YA 5F76A 1QTQA 4QWMA 3DJYA 2PPLA 3PPXA 3QEAZ 1MABG 4L51A 5ERGB 5LQRA 1T2DA 1E1KA 5TT0A 1FDIA 5DGHA 3C4JA 1K8AH 4AZWA 3OPMA 4BNHA 1KOLA 1CQIB 2C61A 3V4OA 3WQHA 4WPGA 1AUPA 1YOVA 3ND8A 3WLKX 1MX9A 3JQ8A 2OTLF 4WXHA 3H0KA 4IMPA 3B60A 4KG7A 2O0JA 1QCCA 4JC5A 3HN2A 4C78A 3K1YA 3WFVA 1YCDA 1BQEA 1JW9B 4CV0A 2BMAA 2A06H 1XYVA 1T8RA 3BBLA 1H9CA 2ECKA 5E4YA 3QMWA 1YKSA 2EFJA 3BK7A 2IU3A 2WLIA 1WZ2A 5FFFA 1VQMV 4MINA 4LXQA 2FR0A 1MQAA 1CUWA 4Q1CA 4TS1A 5L3FA 1GVNB 3TM4A 4Y9SA 1VIVA 5K3FA 4IGKA 5LKAA 5IJWA 4YAFA 1OYYA 2WA4A 1X80B 1L1QA 4QJ5A 4EUKA 1VF6A 4TTQA 3WFJA 1ZW6A 4JT2A 2WD9A 4JL8A 4ENWA 4UXHA 2ROQA 1YWGO 4FTWA 4LJKA 3SJBA 3QKTA 5GV7A 3SYTA 2CDCA 2C7OA 2R6DA 3RSLA 1Q0SA 2E87A 3NI2A 3RRYA 1Q6IA 1NH2B 3LS2A 3DOIA 3SZMA 2Z6QA 2PNFA 2DR3A 1KMIZ 1VLHA 1QG6A 4N1AA 1KR2A 2J5QA 2CXNA 4FONA 4DYHA 2Q4TA 1SVMA 4NYIQ 4MUYA 4KFSA 1CR4A 2FPMA 3EZ6A 3WYFA 2XUQA 2Z5UA 3B6KA 4NAUA 3HJAA 1MCZA 1SK8A 4D8TA 1YS9A 2F6RA 2PL9A 4QEKA 4RUFA 2GBOA 4J94A 1WDLA 3LGSA 1Z4JA 1U3PA 4AL4A 2IS4A 4A6EA 4N40A 4RTNA 4QQ8A 4MRAA 4H6VA 1L1FA 3PSAA 1WZEA 5EJGA 1LQUA 4Q19A 2RHCA 3DE2X 1XA3A 1HSOA 4BU0A 4MIEA 3JTMA 3ST7A 2VNAA 1Y1TA 2JGFA 1I3OA 4DMUB 1JR3D 1EVIA 5E6RA 2IYNA 5DGCA 1J8DA 2YRFA 4DR7O 4P93A 1PGQA 2QAGB 3N59A 1VIMA 1WPXA 1KZGB 5H02A 3NUQA 3FYTA 2L17A 1WETA 5HF9A 5KSWB 3D02A 5DT2A 4UU8A 4LDQA 2AWNA 1T6ZA 2W6IG 2YR0A 3NO4A 3QTTA 4ZREA 4ZV4A 5C31A 4CU5A 2EBHX 1R1BA 3DHYA 3IT0A 1F23A 4JI7O 1L8OA 1F0YA 3QQPA 1ZONA 2OQVA 1G6Q1 3FD9A 1U6IA 3O2JA 4M21A 3E22B 3KAQA 3DZBA 3ZE2B 4P5PA 4I55F 5BWNA 1JHRA 3X3HA 1UJ6A 1OGJA 3CLSD 2VHXA 3UHJA 4G9GA 3JAKA 4NXNO 3DT6A 5JADA 2XZDA 1Y74B 4DV5B 3WGUA 3ZS9A 1BWPA 1GZ7A 2OECA 2H51A 3SAJA 1E9EA 3OZRA 5DCWA 1V5GA 4ETIA 3HCCA 4IGIA 1PNOA 5CXSA 4HNVA 2V7GA 4QIWF 1ZD8A 4EY7A 1YA4A 5IX8A 1V37A 1XLTC 5AW7A 1M73E 3UCEA 2OXCA 2HSGA 4KXQA 3KOUA 1S0VA 1R6VA 4K8RB 4P4LA 4BMSA 3H1AA 1FFAA 2H7YA 1JR4A 2JVDA 2R47A 3S8YA 3RS4A 1SR8A 5AI5A 1TF7A 1B06A 2WZDA 4LC0A 5C2JB 4KJXA 3E9NA 4Y18A 1D07A 3HAXD 1DCFA 4OSEA 4UTPA 2FY8A 5GINC 2WA1A 5HRCA 1K63A 1T3HA 4I1UA 3AR3A 1ENOA 3DP9A 1EIZA 5AUNB 3KJIA 4JHXA 4I08A 4PAWA 2G83A 1DB3A 5A0TA 5KZMB 1VP9A 1RRFA 2YVLA 2QVCA 5EO3A 2CJXA 3OECA 2LKDA 4C0WA 2PWBA 2Q49A 3CYFA 2VJMA 3EXG1 2J6HA 4EITA 1YB2A 4BFVA 2OILA 4UUOA 3F6YA 2DBVO 2ZVYA 3B1WA 4M1KA 3LBFA 2FW7A 4DSUA 1ZM2A 2FB5A 4N3AA 2PD3A 2I5PO 2I4IA 3NP9A 3PXBA 4PLVA 5LHIA 1FS4A 3C5VA 3IODA 4U9UA 3JYCA 2ZDHA 3CZ5A 1BIFA 2VJOA 3RUHA 4KOEC 3NYWA 2XAUA 1BG6A 1KZHA 2F66C 1B42A 1UBCA 1A8QA 4MWCA 2CDNA 3ZKAA 3FLMA 1DX6A 4ZANA 3GRCA 4E51A 2ZUBA 1J5XA 3LPMA 1T9GS 2L6LA 2PS0A 1IN5A 4L4RA 3NKVA 1ECFA 1XCLA 1IB0A 4K9RA 1NUPA 3H84A 1UJBA 3VHXB 5I51A 2DSNA 3GYBA 4JLKA 3UJCA 4UNRA 4LF5O 4A0FA 1N2CA 1MJGM 1CZUA 2A9FA 1CS0B 3EORA 1P1JA 1KL7A 3WGLA 4N8SA 2AFVA 1N34O 1KFCB 4YUVA 2IOHA 3IQHX 3GP5A 3LY7A 4UD6A 3PPWA 3B2QA 2CC2A 2P5OA 3B7GA 1P31A 1IY2A 3HSKA 4JP1A 4OHWA 2J3HA 3C9RA 2UXDB 1QPZA 4JYPA 4RQEA 4WE3A 3CKLA 2GBCA 3WBBA 1XTJA 4OL9A 2HPHA 1KC8H 4X63A 3CTMA 4KODA 3MCVA 4NABA 3IVCA 5I5GA 3C7KA 4KX5A 4QFDA 1Q0UA 2QAIA 3I05A 3RVLA 2SKDA 3BGDA 4ITRC 4RDIA 1ULBA 2ITCC 4UNPA 5LZ5A 5AIBA 3AFIA 5LU8A 1BA3A 2Y76A 3IPRA 4NKGB 3VH1A 5KYKA 1A4IA 3VAYA 4JC0A 3JD2A 1UANA 4TZKA 3QPBA 3SVLA 3MIIA 5LMZA 1TEXA 2V54A 3L6RA 4YONB 3COJA 1BROA 5BYJA 4F6EA 1AI4A 1HGXA 1P61B 3I55V 3UO2A 1P1FA 1QTRA 4E46A 2C1ZA 1SFRA 1E1RD 3DA8A 1L0BA 5LQMA 1FXVA 1ONOA 1JKFA 4J1NA 4YASA 2PZAA 3Q5DA 4WKBA 1Z17A 3D6VA 1TU3A 5JCXA 1BEEA 5HEKA 2VSOA 3KJJA 3ABMB 1B23P 1W5FA 1O96A 4G4XA 1KECA 2JCGA 4NP6A 4CMGA 1H6AA 1C3LA 1NF2A 1ODCA 4MVCA 1PSDA 2QRZA 1NR7A 1U0SY 2WI8A 1C9YA 4WOKA 4DRXA 2H08A 4WWHA 2RCVA 4NULA 3SFZA 1V3TA 1BT8A 4EG3A 2P6OA 4RH3A 1FBTA 2AOTA 5L95A 2IZZA 3SCZA 2AFRA 2VP4A 4L0CA 1IIBA 2CUGA 1XPJA 4LI0A 2PIAA 2UXCO 1FLDA 4KE9A 5B6JA 1KHTA 3DR3A 1W1IA 2Y4NA 3PQ4A 4KFUA 4G1CA 1NQWA 4QYIB 1AGYA 1WBDA 4GD3Q 3O3OB 1GV0A 3D1VA 1Y3CE 3NTUA 1SXPA 4MKZA 4JB2A 1RJ9A 3PC8A 1KAOA 1MOFA 1P74A 2EWMA 2CMHA 2FCRA 2EGUA 2XASA 2DKFA 3KTOA 2JKYA 2Y68A 3U4AA 5KTRA 2CE4A 3EVCA 4NOMA 4EQ6A 2FP3A 2ZBGA 4TMTA 3ADDA 4QQRA 4Q37A 1PL7A 2CWWA 4ROTA 5J1SB 2O1WA 3FFXA 4R3WA 5AHKA 2FG6C 1O77A 3LL4A 5EHZA 1LU9A 1ZU5A 1VQ7V 1DBSA 5CX1A 1Z45A 5FYDA 5CLGA 4RM3A 5LQAA 4GVXA 4FX5A 3NWEA 3R9WA 2IBTA 2IH2A 5JS2A 4BO8A 1DXHA 3KPUA 2PKEA 4IH4A 4OIFA 3ORHA 3TLCA 1NIJA 1JJIA 4JR1A 1BEUB 1NJ2A 4D4JA 1A2KC 3GUVA 1NQ5A 2HBYA 2E18A 2WM8A 2AEMA 5G4KA 2FN8A 2QWXA 3WO1A 5ALPA 4GLLA 4FC6A 2HJ9A 2GWRA 2WSYB 1N0UA 3KR1A 4K03A 3UXHA 3Q6IA 3VNSA 1DRKA 1P2UA 3BIWA 5FTLA 4HEA1 2JGLA 2ZB2A 4IP0A 3GR6A 1G20B 4DCTA 1S89A 5GOZA 1EAYA 4LF6O 1M7HA 5TQ0A 5KNBA 3L70H 1K2VN 5BRAA 4KN8A 2V7QA 2FA9A 3RYHB 1IN1A 4Q18A 4BKRA 4G4GA 3LDDA 1MXHA 2PCJA 5AH0A 2P7HA 1JQBA 3GLHA 3KB8A 2SKCA 2I67A 3L7NA 3APQA 4K0KB 5HJ2A 5KNCD 3D9QX 2QN2A 3O8NA 3ITKA 5CMLA 4YAKA 3TD3A 3QE4A 4KPFC 2ERCA 3QXJA 5IJAA 3STYA 2P6PA 4P34A 1ZCAA 1R4MB 3L6CA 1HK7A 1SUCA 4DLYA 3FDIA 1GZ5A 3D0KA 4GPD1 4ACAA 2BC9A 4WKPA 1QIJA 4PC1A 1EP1B 1XT6A 2JEUA 5ALNA 4Z9AA 4DV7B 3A0HZ 7GPBA 3GH1A 4H2DA 1VDZA 4A15A 4CTJA 4B4UA 1SCUB 5D6OA 3OFKA 3U31A 1TUGA 4JN6B 1VKJA 2PY5A 5AVTA 5DJ5A 1K92A 1QJ4A 3NEPX 1XZPA 4BZZA 5IK2D 3OU2A 2DERA 4PYMA 1VQKF 1UBFA 3L7KA 3A26A 5K6AC 4H4DA 4ZU1X 3O91A 4PQGA 2GRAA 2MSNA 3EE6A 2Q0SA 3A6ZA 3DHNA 2XDYA 2Q3HA 2HFJA 2AI2A 4KLZA 5EJMA 3TZEA 1XNRB 1RPTA 4HCJA 5B3JA 1VH8A 1XKQA 2XYHA 3ENWA 2RSLA 2M32A 2Y99A 2AWOA 1QSGA 2V0GA 1GRJA 5AI4A 4YJGB 5LA6F 2VSQA 3E05A 3FA2A 2NP6A 1JQJC 4U4AA 2OO7A 1HDGO 4OHPA 1N8RH 2VCHA 4MPRA 5CT5A 3ZGNA 1OV4A 4RF4A 1O97C 3TLZA 1O87A 1R6UA 2FZGA 5FBRB 3R0PA 3O9OA 4YAWA 1FNSA 4PD4F 3LP6A 4X97A 4FGKA 1SUSA 2H2WA 4I46A 3OX4A 3MRVA 4LYYA 4HUQB 3WGVA 4YJ3B 2OYCA 4FNMA 3JCMM 3CCLF 4JLSA 3ZXIA 4S1NA 1PIWA 5JBIA 4MJLA 2HBRA 2CHEA 3ELBA 3WZMA 4MGZR 4GC9A 3DE4X 4DUZO 1VPWA 2DBYA 3Q3JB 2UYYA 4CMBA 1G2QA 2C8JA 2IWHA 4TT8A 3VDXA 4ND4A 3DVRX 2WSSD 1DJOA 3F1KA 3LT1A 5FBHA 1I2DA 3Q3VA 1KARA 2OLJA 4R54A 4Y0AA 4X90A 5AHXA 1GADO 1V9CA 2AHOA 3MBKA 3H1EA 4EW1A 4BT3A 4LZAA 1R74A 4LDPA 1GM7A 3AM1A 2NO1A 2RKOA 1CYEA 4DG8A 4L5JA 1B26A 3CUSA 3G0CA 3GFBA 2DHDA 2MYNA 4MQEB 1HNXB 2XUJA 5TJ9A 1GM8A 4ND3A 1FB5A 2CXXA 2FHSA 2K87A 1VGRA 2HK9A 1CUFA 4HWRA 1J20A 5CNJA 1X87A 4B31A 2HJFC 5ALRA 2BMVA 3NWJA 4BVBA 4OKIA 4UHJA 3WB1A 3PNKA 3AG4C 1XRMA 2GEFA 5LVAA 1HDEA 1JEDA 3B20A 2DFVA 5K6RA 2VHZA 3PXDA 4BRWA 3H19A 4V1CA 3CF6R 5AMXA 1KKCA 2PKQO 4L76A 3W3AH 3I56V 5KYWA 2F9ZC 4OVKA 3MUNA 4G4SO 4QG7A 3JWIA 4Z7OB 1USKA 1TQ2A 4AP9A 3ILHA 1CY6A 2A7QA 2XGSA 3IGAC 4YT4A 1YC2A 1M9NA 2AQHA 4QPNA 4RL6A 4A92A 2IE0A 3FROA 3M70A 4OBEA 1CF2O 2O8EB 1FTYA 1N2BA 3FTNA 1UI9A 4ND8B 3MPUA 4JSTA 3MK31 3E9EA 2BIFA 3LVBA 3IAXA 3D8RA 4ZGBA 3K12A 1WDKA 3KVVA 4CH6A 2ZYDA 4LZOA 3ED1A 4M76B 4B7XA 1OW3B 5ALHA 2HP0A 1F8GA 3SJZA 1D2DA 3CG4A 2KKWA 1S4QA 3NORA 2Q6OA 1FYXA 4TWKA 5G0VA 4Z7QB 5DF1A 3IFSA 4KXYA 4YCAA 2I7TA 4C05A 1C2TA 3A6DA 1ZISA 2C3MA 1AHIA 4ZMBA 3S2FA 4B84A 1B3QA 3G85A 2IITA 4WIAA 2VDWB 1ATZA 3K9AA 3VNAA 4DJDC 1H6DA 5EMKA 2IELA 4Q3EA 4EMTA 3AY6A 1SBCA 3H2BA 4NLLA 4MCHA 1P0IA 4E2XA 4I4CA 2GFHA 3KR9A 3TQSA 1DC3A 4PQRA 2QVLA 5F9FA 4EZEA 4P2GA 3SOPA 4FQ7A 2IHZA 2F64A 3UHAA 1TUEB 2GZ1A 4FGZA 2ZT7A 3P4UA 1XALA 3NHWA 3K09A 3V7FA 4DJAA 1LR1A 2P9HA 2XBUA 1R9NA 1YSCA 4CC5A 5AUOB 5EQFA 2ZATA 1DTEA 2B7CA 2BKVA 2Y05A 2ZBPA 3INTA 2HV8A 3C6KA 2IEDA 4C2BA 4NONA 1WCWA 2IW1A 1RZRA 2J0SA 3DC2A 1RM0A 3GA7A 4C7OB 2O3UA 3O73A 3I9FA 4YRKA 2P06A 2JEYA 5LYYA 4BEVA 1ANKA 1E5TA 3SR3A 4GOJA 3W5HA 2G6TA 3FTQA 1PQUA 1GPBA 1DEXA 1DWOA 3I5UA 1L8AA 2ZJOA 3QU4A 1X8JA 1N2IA 1XEWX 2ODPA 4HRAA 1WXIA 1X3SA 1GQOA 1ESEA 3W3ZB 4TYYA 5BMVB 4H35A 3WL8A 3RF6A 2YDEA 1XNGA 4NU8X 3LT2A 5EFOA 3U16A 1O08A 3VTZA 2C57A 4BZWA 4QUIA 1Q7CA 3NALA 1A1SA 3V33A 1YU9A 1YZ3A 3IB6A 4P4SB 2MQEA 2P67A 1PW7A 4HQOA 2ATIA 4PHFA 2GHTA 4RUEA 2YOHA 1J5PA 5DISB 1SJ9A 3MJFA 4R2HA 5IFLA 2AW3A 1BGWA 4ALLA 1ZN8A 5E1BA 1XD2B 3ICPA 4RK1A 2AXPA 5HKBA 2G80A 3C2QA 4TQUS 5EWJA 4N65A 4ENVA 2BFDA 3W9BA 4HH1A 4IIEA 1XQ8A 3IBCA 1VI6A 3COWA 2A0KA 2V55B 2ZWIA 4AMVA 1I7PA 4IEFB 2PFKA 1H38A 1AM4D 2A59A 4O3FA 3ZN0A 3W7XA 1SUPA 1RRPA 1SCIA 2Y1OA 4MV1A 3U37A 4KXMA 3AVQA 1MKYA 4LFAB 2BGKA 3DKRA 3W1VA 4IJMA 3R7BA 3Q9SA 5GWXA 3VUEA 4FE4A 4NB5A 5JTUA 5BN1A 1DPGA 1JDUA 2QV0A 5K8UA 5CA1A 4JU8A 2F8SA 3BSWA 4DV5O 5EG5A 5KVSA 1WZUA 1IHYA 1M90H 1N7JA 1KKMA 4QICA 3CCQV 3S29A 2EAUA 3DWIA 4DRZA 2JKVA 4RAQA 3I5XA 3R1IA 3M6MD 4RO0A 1O5OA 4M99A 4RQTA 1ZIDA 4F72A 1DUVG 4IGAA 1V3UA 3FFWA 3E8HA 1KUQA 3HPQA 2GR9A 4M0EA 2HD4A 4QJ4A 3CLRD 4YMSA 1FTQA 1ATIA 1IMOA 3R44A 2RHMA 1HH4A 5L3CA 3VR1A 4LNUA 3RABA 1VLMA 1ISPA 3HN7A 2CVHA 3JRXA 2A5GA 3ILXA 4PDMA 4D6TH 1IPHA 3UAVA 1AK2A 4LIPD 3L43A 5ELXA 4CR7A 2QLTA 2IHBA 1P1IA 3MGAA 4Q12A 4ZJPA 1DO0A 821PA 5MFPA 1Q2UA 3HB5X 1Z37A 3LDCA 1HE3A 2BD0A 3QM1A 3KQHA 3CWZA 1THMA 5KINB 1CUEA 3IYLW 1RXVA 1Y9DA 4OYHA 4NX2A 3RV3A 3U62A 3I0MA 4RE6A 1FYJA 4ENPA 3PEVA 5EGSA 3ZU3A 4NBTA 3P19A 2OXIA 3GVIA 4FDVA 4JEMA 2CXQA 2GD6A 1ZH8A 3LO8A 1FEZA 5FTWA 1RAFA 1OREA 3WJ2A 3KSAC 4PRKA 3HXOA 4DV3B 1M6YA 1S2MA 4MGHA 1MUUA 3PENA 2VRWA 5ES4B 3ONFA 3UJ3X 3OA0A 4H0NA 2IZ0A