4TV8B

Tubulin-maytansine complex
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
428
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title A new tubulin-binding site and pharmacophore for microtubule-destabilizing anticancer drugs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 169
structure length 427
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4tv8B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4tv8B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4tv8B01
3M8KA 4I4TB 5LXTB 5LYJB 3HKDA 4X20B 1RLUA 5JCOA 1JFFB 3JAWB 5LA6B 1W581 3VOBA 5JCOC 5MN4A 4O4HB 5CA0B 2RHLA 3VO9A 4O2AB 3WGNA 4TUYA 4I55A 2Q1XA 5LP6A 4LNUA 4I50A 5ITZB 1W59A 4I4TA 4E6EA 5LXTA 5LYJA 4O2BB 3RYCB 3WGKA 4X20A 1JFFA 3JAWA 5LA6A 4B45A 4EI7A 1Z5VA 4O4HA 5CA0A 5EIBC 4O2AA 2XKBA 4EI9A 3ZBPA 3R4VA 1W5AA 3CB2A 5ITZA 5CB4B 5KX5B 4ZOLB 1TUBB 4TV9B 3VOAA 3C8LA 4IIJB 4O2BA 1W5FA 3HKEB 3RYCA 5LOVB 2VXYA 1OFUA 3VO8A 3V3TA 4O4IB 3ZBQA 4X1IB 2VAPA 3JALB 5IJ0B 4DRXB 4U3JB 3M89A 5KX5A 5EIBD 5CB4A 4ZOLA 1TUBA 4TV9A 5J2TB 4IIJA 3HKEA 3HKCB 3UT5B 5LOVA 5EZYB 1FSZA 4O4IA 2BTQB 2R6R1 4X1IA 3E22B 5CA1B 3JALA 5JH7B 4YJ2B 4O4LB 5IJ0A 4O4JB 4DRXA 4ZI7B 4U3JA 4EI8A 5J2UB 3JATB 1W5EA 3JARB 5IJ9B 3RB8A 5KMGB 5M7EA 3WGMA 3ZIDA 3N2GB 3RYFB 4B46A 4XCQA 4X1YB 5J2TA 5GONB 4X1KB 3HKCA 3UT5A 5JQGB 5EZYA 1SA0B 3RYHB 4F6RB 4M8IA 5MN5A 3E22A 4YJ3B 5CA1A 5JH7A 4YJ2A 4O4LA 4O4JA 1W5BA 2GVIA 4ZI7A 2RHJA 5J2UA 3JATA 3JARA 5IJ9A 3HKBB 5KMGA 2R751 2Q1YA 3N2GA 3JASB 3RYFA 4HNAB 4WBNB 4TV8B 4U39A 4X1YA 1Z5WA 4X1KA 5FNVB 5BMVB 5JQGA 5IYZB 3RYHA 3JAKB 4F6RA 3VPAA 1FFXB 4YJ3A 3RYIB 4ZHQB 2BTOA 3HKBA 1TVKB 5C8YB 4DXDA 3JASA 3N2KB 4FFBB 4HNAA 4TV8A 5JVDB 4IHJB 4WBNA 2RHOA 5EYPB 2RHHA 2VAMA 5FNVA 5BMVA 1RQ2A 2XKAA 5IYZA 4EB6B 2BTQA 5LP6C 3JAKA 1FFXA 4KWEA 3RYIA 3HKDB 4ZHQA 3WGLA 3WGJA 1TVKA 5C8YA 3N2KA 4FFBA 4TUYB 4I55B 5GONA 4IHJA 5JVDA 1RQ7A 5EYPA 5LP6B 4LNUB 5MN6A 4I50B 2VAWA 1SA0A 4EB6A
chains in the Genus database with same CATH superfamily
1R88A 3HU3A 3MAQA 1K9SA 1YNOA 2HT6A 2QRPA 4PLWA 4EVSA 3M34A 4Y6PA 2AZDA 2ZP1A 2WLLA 4B7CA 2P9YA 2PMDA 1FY2A 4FKMA 4V2IA 2P6JA 2B94A 5CIYA 2D59A 3QEMB 4K35A 1O95A 3OETA 2UXXA 2C9DA 4FDUA 4MOWA 4BQNA 4IIJA 2IHNA 2GZHA 4M4SA 2EV9A 1PXWA 1QCDA 4QTZA 2HXSA 2ZJ2A 4MS4B 3DHNA 2CNWA 1WQ3A 3KPJA 4ZQFA 1ZJJA 16PKA 3KKNA 4Y30A 3L9WA 4DWWA 5AQ1A 4BB9A 1XKLA 4NPCA 2E89A 2QRLA 3QVTA 4R16A 2BH9A 1NNEA 1VQ1A 3EG9A 3O82A 4BJ6A 1M9NA 3OESA 2ZVJA 4ZCLA 4B40A 3ZJYA 1EFHA 4ZAXA 5ER9A 4DV7O 2FY8A 3TW4A 1PYDA 4LZWA 4RESA 4K3AA 1Q21A 4PV1B 3CCSF 2JLBA 4DABA 2L6LA 3VMMA 1GFIA 2IYQA 2F62A 2RHDA 2HS0A 3NHMA 2IOYA 3NK7A 3L4EA 4IF6A 2QE7D 3ZBPA 2Q45A 3K0AB 2AG0A 3FDIA 3C70A 1U2DA 5EP2A 1QB8A 3FPGA 3U3XA 5ALQA 1UKEA 3OWXA 3TINA 1D2AA 2PT9A 1XDCA 1CVLA 4B82A 3FMOB 1H38A 2ZJ6A 4PG8A 1N8TA 4MYRA 4KXVA 4CG0A 1Q3HA 4OQLA 5FPOA 2W6PA 1SS3A 4ODIA 1L4MA 3LVBA 5F5NA 1JFRA 1A7JA 5DZSA 4M54A 1EFPB 2CLFB 1E0AA 2Z56A 1VLLA 1CUSA 1XYVA 5AXDA 5ALOA 1DJQA 3EMDA 3WL3A 5A5DA 2BHTA 3HDYA 4QPCA 1XCPA 2EZPA 4YRPA 4J9YB 5ITZB 4Y2RA 4M0CA 3KPYA 5BN4A 2VH1A 4RY8A 4MVCA 5C46F 2K7ZA 2A8YA 1IMOA 3ZV6A 2Z1FA 4OUDA 2JD2A 2I9KA 4B6FA 3Q3JB 1W94A 5AOCA 1V11A 1FUIA 1AMNA 4JI2B 4OI1A 1DKPA 3UN1A 1D2NA 3LBYA 1NI4A 4G63A 1FLDA 1XMPA 2V7BA 1TU4A 2OHGA 1DBQA 2W4MA 1Z4LA 4AYWA 2Y6VA 1TRKA 3K0CC 4EGCB 4B35A 1D1SA 1TLLA 3NPMA 1ZOPA 1GZVA 3ZHYA 3ABKC 1X7YA 4EPYA 4C6RA 5CEEA 2VPIA 3RLFA 1MB9A 2VAXA 3W4JA 3O85A 2FMUA 1EAMA 1GG8A 1OCZC 3CD6V 1KAMA 3WFZA 2EWMA 2QSUA 4KVAA 1XVLA 4PRYA 1GO2A 4G27B 4MRNA 3R66A 1QLEB 1DHTA 5CDHA 1G5PA 2P06A 3BA6A 2ZAUA 4KI0A 1KR2A 4CQJA 2BOCC 4G1MB 1AJQA 5BW4A 4DWOA 1YC2A 4POAA 4BO1A 3OCJA 3SZMA 2XTJA 3L8YA 4ZU3A 3KIPA 4J9VA 3U56A 2BTQB 2QZSA 5EIEA 5BR4A 3O74A 2P2LA 2VDMB 1CUWA 2RMKA 5ITSA 5B12A 4I9WA 4YY3B 2HL6A 2AJBA 3ICVA 3AM3A 3HTXA 2XYVA 5BMVB 1ATZA 4PA6A 4MUEA 2JHGA 1BHBA 5AJVB 5HFAA 4BDSA 1CNMA 3NBAA 4RJIA 3ABLB 1Y7IA 2I9PA 1O89A 4AULA 1W49A 5L95A 5EMHA 3JQ7B 4GSYA 3OZAA 4JYZA 1QQ5A 2VWHA 3RC9A 3O3CA 4DA8A 2NQ2C 1A5TA 5LXTA 1PQ4A 4JLDA 2A4MA 4MR7A 1QHSA 4XB1A 3CS3A 1XJQA 1A9TA 3ESBA 1ARZA 1DG3A 1M1ZA 1SOWA 2R72A 5EWLB 2Z57A 4JKYA 4IGIA 4HZ3A 1FUEA 1UEJA 2YYEA 2KHZA 1IZ3A 3SI7A 1PGPA 1XYYA 4MTOA 3DV9A 4PD4F 4PYJA 1C5KA 2C7PA 2PS0A 1M2NA 3KR1A 2C4KA 4C0JA 5FOTA 4RD6A 5KQGA 1RHJA 1DE0A 1FVHA 2O20A 4YQYA 5JMTA 1TL7C 1VF5B 2ZU0C 1ZX3A 2G0TA 5A4KA 4FFPA 3MT7A 2PWBA 3KYCA 5AHOA 3Q0TA 4NV1A 3HNRA 4AECA 3TXAA 3DH0A 3B7WA 1QIMA 4WJKB 3L75H 2E2WA 2NACA 1I4WA 4E5NA 3PXEA 3U1VA 2RGRA 1IH8A 3QNWA 1HPLA 4ZJPA 5KJCA 5TQVA 3O31A 4H7JA 4A6DA 1DUVG 4OAQA 1Q83A 1XHEA 5DP1A 3WNQA 3K0SA 5KIAA 1NXVA 2D5CA 5DN6D 1X80A 1Y98A 1NPYA 3OT4A 1FXUA 1GPDG 5FX2A 2I55A 2Q0HA 3N76A 4MR8A 4PDRA 3ZIDA 4AKSA 2X8WA 5BN5B 4IQ4A 5CFOA 1NZFA 3OU2A 1CYDA 5ADWA 1IBSA 3L7CA 1U8XX 4PO8A 1XCBA 3SKVA 3GWOA 1RXIA 4WNAB 1V5EA 6CHYA 5IBRA 3HBAA 4M8NE 1HQCA 2QJ1A 3TF5A 3K5IA 4WADA 3V1TC 3L9DA 1BHJA 5JQGF 3U48A 2R8RA 3VNRA 1ORDA 2YXDA 4L9RA 2ERCA 4MICA 1L5GB 1SCDA 3MRVA 3A0RA 3AI2A 2GJKA 2QAGC 3F4KA 3U60B 3OT5A 2VJYA 1U2EA 1POWA 3TUZC 1XEWX 2ZCEA 3VU9B 2Q3LA 3PYLA 5A0TA 5JRZA 1MD9A 1NRWA 1Q91A 1W4AA 4W5JA 5J40A 2Q1TA 2Q4EA 2AC4A 3IT3A 1EDDA 3WNCA 2NZ8A 4LGCA 2GN0A 4PIMA 3AVUA 2RBKA 1FJGO 1I4OA 3KJFA 1S2GA 3R40A 2WA2A 5CDFA 3PGA1 4MA5A 1EWRA 5C3MA 3P0RA 5LHIA 1CRZA 4FOPA 3N5CA 5ISMA 1Z22A 3RRMA 2AKYA 4DV0B 1ZD9A 3CE9A 4AZSA 2Q50A 1O8CA 1XN4A 4JSRA 5JALA 3QTTA 2PUVA 2NU7A 4IDQA 2PZFA 3DLCA 5L3QB 4FEEA 1LDGA 1L5VA 1F3OA 1YHNA 3LKBA 3T7JA 2Z5FA 3OTWA 1ZESA 1WJGA 3NTXA 3AVYA 5JJCA 3VZRA 1MHPA 4RD3A 3RGWS 4CV1A 3N07A 3GEPA 2PI5A 4Z4FA 2WM2A 3FYIB 3RAJA 5GJWC 2WM8A 1GVNB 1YI1A 2E18A 1G2PA 4ZARA 3B4SA 2YDYA 1I5XA 4KKXB 3G2KA 3M3PA 4AIIA 4NR0A 3WRXA 4HDNA 4JBXA 1DNPA 4DG5A 3L4BC 3EZ7A 3C24A 3FAZA 2DUMA 5JI3E 2DB3A 5A9SB 2GJSA 1Z2AA 2PJRA 1DSSG 3BE5A 1XRNA 4CFYA 3HKDB 2GK3A 1QH8B 1P1RA 1XBTA 3QJGA 4EAQA 3X1ZA 3VKGA 2CUGA 4FCTA 2JLWA 4IZOA 2I80A 2H48A 4TS9A 3AETB 5G0UA 3P9SA 4UVCA 1M6HA 3AOEC 1YVPA 2MU1A 1I10A 3DLAA 1CJVC 1A97A 2Z8ZA 4OLAA 2OGUA 3I05A 5BWMA 3LPNA 4ZVSA 1ADGA 3HSKA 2VPXA 1XQYA 5DF1A 1SK9A 1R3LC 4V0NA 3GLRA 3IUSA 4N3GA 3KEMA 4FMTA 1EVQA 3FD5A 1UC5B 3GXBA 3GY0A 3IELA 5JAOA 3LCRA 4FHGA 3L4JA 5DH9A 3WFVA 4A8JA 1ACLA 3ZD6A 3D7RA 1Z12A 4ERNA 3JQAB 1JRLA 3IOYA 4CQMA 3AUYA 5HMLA 4TTVA 4J76A 4S2UA 1O4VA 1U7OA 5JTUA 2GYYA 2YUTA 1Z63A 4P0PB 5EJEA 1UMDB 4I55B 1GPH1 3I64A 2KLBA 4L15A 2UZAA 2GN1A 4JVSB 1WZNA 1EBOA 4UDOA 2W5UA 4WZZA 2X2PA 1OIXA 4UNPA 1NKTA 3SJAA 4ZQEA 2IDZA 4EJ0A 4L6IA 1JTVA 4PC1A 3PE4A 2XYPA 1TA0A 2BFCB 5GM1A 1IXYA 4YRNA 1WBBA 1P72A 4RO0A 3K9BA 1E2NA 3A0UA 2QDOA 1AM4D 5DM4A 1GX1A 3G2OA 5ESDA 4R1QA 4ASUA 1QU9A 1X77A 4AMVA 4RZUA 2HCFA 3BH0A 2C54A 3DC5A 1GQOA 4QOEA 1N9GB 3PF9A 4X7MA 1RI5A 1MQAA 4MUHA 3SNKA 2OEPA 4ANFA 1N6RA 3ETEA 2OAP1 5KUTA 2HEGA 4D7AA 3L6CA 2E74B 4R01A 4RWUA 4GOXA 9LDBA 2VQFB 2CL6X 4WKCA 3KFXA 4KFTA 2MSCB 3RVZA 1ZGHA 3EHBB 4YWJA 3Q2IA 1JSRA 2BW0A 2HCJB 3QVVA 4H7PA 3SYMA 2AMLA 4B48A 2HSDA 1V1MA 1ZM7A 3IGFA 4JP1A 4RSRA 4XVQA 5AHRA 3F1KA 4XX1A 4RZ3A 1EVZA 1ZH6A 2XHEA 3G2PA 3E1GA 1IQ0A 3QU2A 3GGJA 3JQ9C 2PMBA 3C9TA 1TNDA 4HNGA 1ZK0A 4FUTA 1G60A 1OUMA 4GYJA 4YJGA 1ADFA 4NTXA 3CVWA 2Q8PA 3JR3A 2ZBGA 1RRFA 1B6GA 1CF2O 1SG6A 3IC5A 4GBMA 3LWVC 1PZMA 4YPOA 3ZWMA 4UNIA 4AT1A 3QJYA 3WIVA 1GNQA 2HU5A 3NM4A 2VYVD 4Z0NA 4FYYA 2UXDB 1LLUA 1EFLA 4HRXA 1R0ZA 4A6EA 4A15A 3AP2A 2ERXA 4PQRA 4GBED 4KOEC 2YJ6A 1UBNA 2HJWA 2EBUA 3HLYA 3H05A 1M2GA 1EJ6A 1ZXXA 5CA0B 1KKCA 2I7DA 1IRIA 1NHGA 2CEKA 4QUJA 1D2CA 1VPDA 4MCAA 4D3SA 1U96A 3NWBA 4F2GA 1ZOIA 4CG3A 1ST3A 4RGQA 5HKAA 1XI1A 3CCFA 5C81A 3PE6A 4AW9A 1ESEA 1Q82W 1OFHA 3K20A 1DS6A 1REQA 2HRQA 4MYDA 4X9QA 2DYSB 1E92A 1KJIA 4LDAA 4NP6A 2RAFA 4IH4A 1SXIA 2FMHA 5IWCA 3HYTA 3SM9A 2HBYA 1ONPA 4E2FA 2FSVC 3ZLUA 1NP7A 6REQB 3OW2U 1CK4A 2RGBA 4P4LA 5E7IA 1VIAA 2R48A 5LMUO 2XA1A 1OHHA 3E58A 3RS3A 3FB7C 3G68A 4MB6A 4H4DA 4XDZA 1MA0A 4P92A 3N8DA 4IIHA 4G0UA 2AI2A 4Q1VA 1KXZA 1J2YA 4MKHA 3MJVA 3IKTA 1G4UR 3G13A 1DWQA 3P0EA 1FVXA 2YWFA 5CDFE 1XXHA 2Q9BA 3L79A 2WU0A 2HA2A 2D0PB 2WSSA 2RJ3A 4Q5IA 1WE2A 2ZYUX 4F3KA 2AXNA 1G42A 1MV8A 4LSGA 2HF9A 5DYWA 3ZR4B 4OXSA 5HKBA 1OKKD 3MHTA 2BR5A 3N28A 3DOFA 4EUFA 2QUJA 4QWMA 2G9NA 1Q7YW 3UJHA 1JU4A 1PR3A 4MRMB 2CE4A 1LF0A 4RD2A 1VQ9V 1E77A 4YBZA 1YS1X 3QPAA 1G19A 1EUDB 1TVKB 4G2TA 2FFAA 2XJ4A 2HH9A 5K4GA 3BORA 4ZV9A 2ZWAA 4LQ4A 3HO8A 5T67A 3D2AA 3VPSA 4B9EA 3M7MX 5ERYA 2R87A 1HEUA 4O0LA 1FEZA 1XRLA 2YTZA 3I7TA 2VQEO 1QAHA 1AHHA 1UM9B 2OTCA 2QLMA 4I50A 3HCDA 1CB7A 1GIAA 3H1AA 2IUSA 5FQNA 4KR0A 3R74A 4NF2A 3A27A 3CZAA 3FCSB 2OHOA 3IKEA 1KZ6A 1FDTA 4J4BA 1SVUA 1JHUA 2Q2WA 1FDRA 4WXRA 4YAOA 1P4SA 4FK8A 3L41A 1BAPA 2DKOA 2OE2A 3UO8B 4GVLA 2TMDA 2ZIZA 1MV5A 3T3IA 3AEZA 1FFYA 1Q7GA 1OOEA 1Y9EA 1EG7A 2PPVA 4G5FA 5U4XA 1VDZA 4LF5B 5FWAA 3B6ZA 5BOSB 3LK7A 4QIWF 1T5BA 3K5NA 4NYJR 1DRUA 2IJJA 3E0XA 1QX4A 1H65A 1W0JG 3RC7A 4RMJA 5IZCC 2RGAA 1ZL8A 1QYRA 3DG9A 3ETCA 3AJEA 2C84A 3CVUA 3HP7A 3KFLA 5SV2A 5LMCA 2A9QA 2A4KA 1R0LA 5LA6A 3SJBA 3EZ6A 3ZK8A 2DT4A 2FW8A 5FV4A 1N0NA 1BVUA 1EM1A 4NSNA 2FL4A 3MTQA 1Z18A 3C8HA 2CXUA 1FQJA 1QO7A 1K73H 3BRWD 2QMZA 4K8RB 1ZK2A 3HV0A 5CEFA 3SX2A 4ZMSA 3HLTA 5JBQA 2ZQZA 1MFPA 4ALNA 5LP1A 2O9JA 1CIVA 3FTCA 4FFLA 3RYIB 1GARA 2X0RA 1YVEI 4L8VA 1D3AA 4R2HA 3H83A 4LC0A 5LBUA 4GOOD 3HCRA 3LWQC 5IH7A 2ZJ8A 4QJIA 4PYRA 1DGSA 2QBYB 2VP0A 4J16C 5HTKA 3DXZA 4MVUA 1TAEA 3WQBA 3MS4A 5K3EA 1O97D 2V55B 1YHQF 4P34A 5AXBA 2CXOA 1M6YA 4M1WA 2C9MA 3FFXA 4TUYF 1NG9A 1AILA 1LFAA 1M8JA 2HFJA 4XD7A 3D7SA 1GEGA 3WSWA 1O0BA 3KQMA 2O8BB 1ML4A 4QXOA 4CV0A 3TZHA 2XLBA 2QMQA 3KD2A 2IZ1A 4RF3A 2C8JA 3OLWA 4YJ3B 3QUAA 5FTNA 2I1VB 2OZKA 4TSFG 3QLVC 2QR2A 3HZOA 4BGIA 4RJLA 4JSTA 4EW1A 2AJTA 2OPHA 4HNQA 4KI7A 1AUOA 1ZQ9A 1NJIW 4W5RA 4V0RA 2IUUA 3EAQA 4KE7A 2X8JB 4Q18A 4RIIA 3SGIA 1X1SA 1QQ6A 2D62A 2KI5A 4OK3A 2PLAA 7REQA 3HU2A 2ORIA 1EZJA 5LYJF 1DJMA 3PX3A 1YITV 3JZAA 4MWEA 3N2EA 3DQZA 1C7RA 1GAWA 4MAAA 4QGFA 1VQ4F 1Z15A 4WBSA 3E3MA 3IRVA 3ZHVA 4X3OA 5JUWA 4UDYX 3ZV3A 3HKEA 4C8EA 2CDAA 4BX8A 4O2AF 4NENB 1UC8A 1Z0DA 3EY4A 1D0IA 1N2HA 1QPBA 5L3EA 3VV2A 5IK2D 2DKNA 4G4WA 5HOQA 5DBOA 4PRKA 3KE9A 4HUQB 4DDKA 4TXJA 4K1XA 4DXDA 1DO0A 3WL5A 4BP3A 1PJBA 1HE1C 5T57A 4BNIA 4HQRA 3CEMA 4JLVA 4ESVA 1VQNF 4M1QA 2O2SA 3M5CA 5IJWA 5HCIA 3QVMA 3VSBA 4K9QA 3EZXA 1Z6QA 1CY0A 4IF4A 3KKPA 1NU1H 1Y4SA 1BA2A 3R4CA 5AESA 4LX0A 1YJ9V 2R70A 3TDNA 4YAJA 3SC2B 2GO7A 4ND8A 1M33A 3TD3A 1TC2A 4IJMA 3RJ5A 5JJKA 3CUYA 1EFCA 4RS3A 2L17A 2PLFA 3MD0A 2FVYA 2FQQA 1VGVA 4QLAA 3WGTA 2HG5C 2B0JA 5B30A 3ROXA 1WR8A 1HDJA 4UEQA 4G88A 2AYXA 2BTEA 1MUUA 3HK2A 2VH2A 2XMBA 4NBUA 4Z3KA 2ZYTX 2YS6A 2XVZA 3T5DA 5GAJA 3ZRSA 1T5LA 3BL6A 3PGLA 2DYYA 4L95C 1PHRA 3U7QB 5L7WA 2TMKA 4A5UB 2C29D 4E2YA 4BO3A 4TXMA 1Z5ZA 3ITKA 2H0QA 1UC4B 3K12A 1CZOA 3W8NA 4RF5A 4FLXA 2VKQA 3CUEF 1U5BA 3SX0A 1OAOA 5CH5A 3A6LA 3HNPA 2DECA 4AZ3B 3FD9A 2RH4A 4NLLA 2G1JA 4JAUA 1P4RA 3OSUA 4IILA 1PV4A 3PF8A 3NRCA 2BGRA 4OM7A 4MW5A 1IPFA 4UNNA 2HWKA 3BFJA 3AUJB 2Z0AA 4AF7A 2HLPA 3HCWA 4JTAB 1RRPA 1KMIY 4URXR 3VH4A 1MAHA 1P4AA 2DQ3A 3P9PA 3SZRA 3TNYA 2ZB7A 5AW2A 3E83A 4LHZA 1E7WA 3ZTTA 3JXEA 1Z0JA 3PU6A 3UM7A 3LBHA 4IPTA 4J0CA 3QXHA 4CNBA 1GPMA 4ZCIA 3EVKA 4MV6A 3RW9A 1B8VA 1XT6A 2ERYA 1GCGA 1TPYA 4FEAA 5HJ5A 4CXMA 1QYDA 1IBLO 3MCWA 2ONJA 5IEJA 1GQSA 2WT4A 2VF5X 1KJ9A 1K68A 3E8HA 5CYFA 2E6KA 1HDYA 1L4YA 2Y76A 4MPTA 3WDKA 4PDMA 1HO3A 2HMUA 4P5DA 1G9SA 4PHZA 3IKLA 3FFQA 1G0OA 3NH6A 2B8NA 4IV0A 2HTFA 5CAEA 2NU9B 4XR9A 1OCRC 2XTAA 2FJPA 2IPXA 3PENA 1II9A 4FNAA 2UYQA 3VC2A 4FM0A 4WY8A 1TUGA 1UMBB 1WCIA 3FWPA 2PSHA 1SC4A 1JDBC 3RYHA 2DPHA 1AGXA 3PCTA 4ZVTA 4WBNA 4PV7A 3C5WP 5TX7A 3FR8A 2OOKA 3DPIA 2OM2A 1JHRA 2O8EA 2C88A 3AL0C 3BMOB 3E7XA 2YFKA 4KSBA 4R7TA 2AT1A 1SA0A 1X1EA 1U3FA 4RWEA 3FLEA 3KJQA 4IDDA 3HWRA 3THWB 2FPGA 3E2IA 3UMMA 4C5BA 3FD8A 2BL4A 8ADHA 1EN6A 1J5EB 2FFQA 4DRYA 1KH2A 3U3OA 3MAAC 4UTVA 2A0FA 4OV6B 4V39A 2XDAA 5JDCA 2A7WA 4R8MA 5L3FA 5H59A 3A7EA 3CTMA 4UAUA 5BR1A 2PGJA 2BP7A 4OJMX 3ZPXA 2WIBA 1JAZA 1DOAA 4HR7A 3PD0A 3CONA 5K2OA 4FOTA 2NT3A 1XQVA 1QP0A 1EFRG 3KL2A 1JU3A 3LCJA 4Q1EA 3A25A 1B2RA 1XFAA 3G49A 3TEFA 4B2YA 4W9NC 3ZWDA 1AH2A 3GJQA 1H0KA 1OFTA 3RJ9A 3HR8A 4D0NA 1VE7A 2AOUB 3QIAA 5CW1A 4BBZA 1CJBA 3JAWB 1ULHA 4KO2S 2NLOA 2FPRA 2I1QA 5FWXA 4J0FA 2P40A 3AI3A 3CUTA 3C3YA 5AI5A 1EX1A 3L8FA 3IX7A 5HWEA 5DI3A 4CC5A 1MIHA 4P9OA 3S0YA 3CYFA 4PHCA 5B58T 2V6JA 4ACBA 4UV8A 1C8KA 3KZCA 4BO0A 1OAPA 4C0XA 3T8YA 4O4LB 4BNYA 2JJ1D 2XKKA 2HA5A 2NT4A 1IM8A 2G9RA 2CKDA 4XWGA 5ADHA 1U7PA 3O91A 4UFPA 4U7JA 2PYZA 1JX9A 5F12A 4FM9A 2VK8A 5DNCA 2Q6LA 5KNBH 4AXXA 4NH0A 3ZZ0A 2ZB3A 3EXFB 2XEXA 2J33A 4J75A 3FBWA 5E79Z 4FYWA 2QV7A 5DGIA 1P7ZA 3PC8C 3IKVA 3S55A 3I1JA 3PK0A 2YICA 1UOQA 2Q5FA 4C7UA 3M49A 1FW6A 4W5HA 3B2QA 4FQ5A 3QBJA 4QGPA 1IPEA 2QDXA 1LSJA 3HXOA 3CP1A 2C1EA 1YJAA 2NXWA 3FVRA 2FI1A 4JOCA 4N3NA 4HRAA 4A92A 3SMQA 1TGVA 5TISZ 2F23A 2XEDA 3DBRB 3LD9A 1O6CA 3ZDCA 4ZGBA 1NQ5A 3ETHA 2DWDC 3KOMA 1KI6A 1T2UA 5JWHA 3NCHA 1QANA 1MHTA 1MG5A 4Q3BA 2IPOA 4UMVA 1X52A 3RVPA 2J7PA 3ZH2A 2H1CA 5LHHA 1SBHA 5AR1A 3TLKA 4CIDA 4B84A 5BR8B 4DA9A 4K9RA 5B6IA 3PHJA 3OU7A 5EHGA 4YX9A 1AB6A 1K3FA 5EMJA 4BW5A 4JC0A 2B1JA 3F73A 4KDRA 3OR6C 2PZKA 4ZJUA 3JVHA 3DC2A 1L5HB 3N2YA 1WTCA 1HFJA 4K26A 1E1CB 4DG8A 1S5LZ 1XZJA 3N4YA 3O0TA 3C15C 4KFUA 3LWNA 4M9SA 2WSBA 3ONEA 1VARA 2VPYA 4FN5A 4OHWA 3C9RA 3Q8WA 4DM3A 1F2DA 1Q0SA 2VP9A 4R1PA 3TRFA 4Q9HA 1GUAA 3FCYA 4R4JA 3D6AA 3P2JA 3AWIA 3GZTB 1LDNA 2B4YA 3MW8A 5IBPA 3OTOO 3UPTA 4OXYA 2GBLC 4D6YA 2C8LA 1AE1A 3FKSA 1H0HA 4KGZA 3GZNB 1EP3B 4ZI7B 4YRFA 3KB6A 1MN6A 3GBPA 5KCZA 1DT5A 3QKUA 4EY4A 1QGUB 4LVOA 2V1DA 2L69A 4BVFA 4IXMA 4PG7A 3CVYA 5BP7A 4GPZA 2JFUA 2ZRNA 3G0IA 2P77A 1V9CA 4CF5A 3PJDA 4JYMA 4A1OA 3ZMTA 3M6AA 4HGPA 4BQIA 4CMKA 1W88A 4I14A 4DR4O 1OV9A 3G59A 1RXVA 2YFHA 4OXIA 3TIFA 3TTUA 3CSDA 3NBFA 3ZE7A 2AJCA 2H9IA 3O8RA 4I0XB 2J3IA 2JGFA 3PV0A 3G0DA 1E69A 2H07A 4OB7A 3TZEA 1DEOA 2WD7B 5GV8A 2FFBA 5BRNA 3O4VA 3DR3A 3H4IA 3CTPA 3TEMA 1N6PA 4XPIB 3RVQA 1NE2A 1A77A 3VKHA 2QTRA 3SAJA 2J1LA 2RJZA 4FDMA 4RVHA 5I51A 4C4RA 1AN0A 3EISA 5AUNB 4BP9A 1FJHA 4YO8A 3RW0A 4BBAA 2HAEA 1AJEA 4KXRA 1CR2A 1L5LA 4OATA 4F4HA 4MWDA 4A2WA 3RNLA 2PGNA 2ITCC 3D5EA 3UMRA 4BNTA 3U17A 2FW1A 4DEYA 4P08A 1ORTA 1CCWA 3O75A 1MXHA 5E9AA 4RV5A 4XGNA 5LFAA 3F7OA 3B13B 1W8IA 2AD1A 4FDTA 2G38A 5JCOA 4N0MA 4KQ6A 2QLTA 4ZXPA 2Q3FA 1WV0A 3Q2KA 3IEUA 4JLSA 5JAHA 2B4RO 3F8SA 3OU6A 2WPNA 2IXAA 1RXWA 3PUIA 3CMEF 4YHHB 4LBVA 2LUOA 3DB2A 2J45A 2JGUA 4DT1B 3P9NA 1F8XA 2ZUCA 4X6LA 8ATCA 2ZCJA 3D7LA 3JYLA 4XW2A 1B0PA 2FXIA 1ZM2A 1O03A 5FWDA 2ZYRA 2J0UB 1B8OA 4FWIB 2Y71A 1SCUB 2GN6A 2OVBA 2RHMA 1QIKA 4D41A 1DRKA 3VPAA 2BCGY 3NDJA 2XYQA 1KVTA 3LY5A 5IUJC 5A4DA 4Y2VA 1VG9B 4N48A 1YAJA 4AJ1A 4ENPA 1IN6A 4Q9IA 5F51A 1N4AA 3LXXA 4N5MA 3UKOA 2OHIA 4EMTA 3MBIA 1E2EA 2ZRJA 2J9GA 5F3RA 1JS1X 1X0XA 3ZG6A 4FYIA 3VYTB 4M6WA 1QR9A 1IXKA 1XMSA 2GM4A 1F6DA 2JZCA 2HJFC 1D4OA 4IOMA 4NNOA 1FTSA 4DYDA 4Z8XA 4UDNA 2H51A 4C4OA 1GN3A 4C5AA 2Q7HA 2DRIA 5REQB 2Q6AA 1M8PA 4IMRA 2CB9A 3V7UA 1W0KA 2CWDA 2VT7A 2LGQA 2OCKA 3M84A 3IC9A 4HYEA 3K1AB 1V8FA 1I7FA 1D7AA 121PA 4N8DA 2WYWA 4Z1MG 2AYYA 1E9AA 2W2KA 2YOHA 4KH1A 3PEEA 3CG6A 1X70A 1N5DA 1II0A 2ZROA 1BGVA 4HMQA 3MJRA 4Y1EA 4AF8A 4EFEA 2VCHA 4Q7JB 1JSLA 3GFQA 5GY7A 2P22C 3VQWA 3S5JA 2Q7XA 4P82A 1A32A 1A2OA 1RXYA 2A06H 2W58A 3EJ6A 1JALA 5IUKC 3WGNA 5DNWA 3LYHA 3KOZA 3GAMA 1AUQA 1E9SA 1ZSYA 1GKIA 4I3HA 3CH7A 1CR1A 3N8NA 3GN1A 2PAFA 1YDMA 1TJYA 1N5OX 1SG0A 4Z1VA 2JBAB 1IK6A 4NBWA 2LD4A 1TW3A 3LH5A 1GLGA 4J3NA 2V4DA 3GP5A 2X6QA 3V32A 1P31A 1ORIA 4EJSC 2GN4A 4EYGA 4G4SO 1TEZA 2YXHA 1UMCB 3WA7A 5B1BB 1AKYA 3BGIA 2YZ2A 3G0GA 1A9ZA 1PZEA 4R69A 3RJMA 3FYUC 2ZUFA 1H2KA 1HOXA 4XB6B 1QG6A 4RKWA 1YD7A 3NVKE 2Q7DA 2AVNA 4KU4A 13PKA 4C08A 1DAHA 2O2IA 1ZJ6A 2P9CA 3LGAA 4B3IA 1DQNA 1N92A 4J91A 3MS2A 1PJRA 5GONF 2CMKA 4NRDA 1G8HA 1RYFA 2Q3CA 1BS9A 1FNBA 1COWG 4O5AA 4PHHA 4XLLA 4N6GA 4PDLA 5IC4A 3ZS8A 5I6DA 2XASA 3SP1A 1PDOA 3WIEA 2BZSA 1FXSA 1P8AA 4HQOA 4JLBA 3LAWA 2ZTLA 1ZEJA 5J2TB 3H1LH 3H84A 1XAHA 5E1AC 1OWOA 5JYDA 5EQJB 3WWPA 3Q5DA 2Y3IA 1CY6A 3OQNA 5BUQA 3NRJA 4QUKA 4PLZA 4WK4B 5G1PA 4R31A 2ZBEA 1TDJA 3TIGA 4KE9A 1FL9A 4AO8A 5DYYA 4AROA 4HV4A 1E2LA 2FW7A 2IPNA 3I2FA 7MHTA 1T3ZA 5E9JA 2JAWA 1G0NA 1Z4QA 4IVRA 2J9XB 3HB9A 2GAFA 1FCJA 4ZYWA 3L1JA 2GCGA 2X58A 2X5OA 3PLNA 3TTYA 4KH0A 3VR4D 4FHDA 1S4MA 2WLIB 1A9QA 3R76A 1ZM4A 4R68A 1BYUA 1V55B 4EY7A 5DCVA 2ZSBA 1EK0A 2WYUA 1IWBB 2ZULA 1AK1A 1Z3CA 1LRKA 1G4YB 2MT9A 4C2AA 1D07A 1WDTA 3L73H 2WSIA 5AI8A 1H8HG 3GT7A 3DVAB 4B7XA 4DJFC 2VNJA 4YGYA 5E6UB 3BCCH 2YVUA 4Q9AA 4B62A 3K4PA 1R6BX 4YI3A 2HHCA 1PGJA 2NAFA 3R8XA 1YF2A 2IYYA 3SCZA 3VDRA 4BX3A 2BJVA 3EXHA 3WNDA 5DTEA 4CR8A 4G4ZA 5C1DA 1L4GA 2HJVA 2GXAA 1R3DA 1R16A 1N0UA 2P6NA 3PC3A 5J23A 5IH3A 2RONA 3UY4A 5TSDA 1HGXA 3SS9X 3WWYA 2DJVA 5I7UA 2JBHA 4LK3A 3LHKA 5E1OA 1FP1D 1ULAA 2AHYA 4UCQA 1LBTA 1EB8A 3OR7C 2EBFX 1U9IC 3ZTYA 2ZSIA 1U7XA 3ZCUA 3AVWA 2FCAA 2D1FA 4TRRA 1NUUA 1GU7A 5DYNA 3SIWA 3NBKA 4BMPB 4D26A 4UVHA 4LCKA 4QRDA 2ZB2A 3I5MA 1JFFB 1IK4A 2VDJA 2IUYA 3HUTA 1PJ2A 3DAYA 4RH3A 221PA 2WT8A 3DLPX 5KNBD 5ELMA 4LFCO 3QV1A 5DWDA 1V16A 4NKGB 1MVLA 1PBTA 3KPWA 3FIUA 1VIYA 3WZMA 4NYMR 4HTAA 2VF7A 3CRQA 3ITNA 3RU7A 4N3CA 1TUBA 5K3FB 4BQQA 2XMQA 5E6RB 3WKCA 3KFVA 1S6YA 2PX6A 3T1HO 2G9IA 4N5IX 3FFBA 3MIZA 5BN3A 1VRWA 3B9RA 3P10A 3EBOA 2PMWB 3W7VA 3LQ4A 3MCAB 4UCXA 2F3UA 2IS4A 1A3CA 3DDSA 1E6MA 3IVGA 4N6OA 4TRMA 1C9EA 2JGLA 2P9JA 3F90A 4P2ZA 5IBQA 1F0YA 1WG8A 1PS0A 3ZY2A 4KO4S 1OLSB 3ICWA 4ERHA 4JOBA 3W5UA 2FR1A 3RUAA 4HNUA 3VYVA 4OGGA 2Z1UA 2A2ZA 3IQWA 1OWLA 3QE0A 4UVGA 2JJQA 3ZQJA 4DJTA 1RDFA 1EB9A 4CS4A 2R6FA 3C1AA 3ZE1B 5CDTA 1YZQA 2BMFA 2VFAA 3V2UA 1HL3A 4OFBA 4BMYA 2FZEA 3FWKA 4FLWA 3ZDBA 4NYJQ 1UIMA 1TYZA 4PLYA 3GCGA 1G64A 2N1MA 4OGKA 3RF7A 4CKEB 3JQPA 1YA4A 4Y9TA 5J2UA 4MVYA 4YASA 4I5SA 4RHEA 1G8KA 3ORSA 1DMSA 2ZYWX 3JV7A 4O4IF 3FTNA 2J7KA 4BASA 3X2QB 3TMYA 3M33A 3APOA 1RADA 1D9ZA 1M7GA 4C9BA 3TAHA 4H0FA 4FDLA 1VYTA 4DJAA 3H0KA 4G5HA 2Q6IA 1G5HA 3KQOA 1NBMG 1E3WA 1N3BA 3VJMA 3JYOA 1H66A 1WW2A 1HKHA 4ARAA 4PSVA 5KU7A 5D3ZA 1BRTA 1YDWA 2XUDA 1FMCA 4XE5A 5LR6A 1Z2NX 3KR0A 3UW3A 3HG7A 1OSNA 5D1HA 1PN3A 1FFEA 3RTEA 2QORA 4BNDB 1C7FA 1DFHA 1QHHA 2BGWA 5L4NA 4B32A 1NSFA 2WINI 1ODLA 3EUAA 1DAFA 2ODTX 2R68A 3TN7A 4UUPA 2IS1A 2NO9A 3FNFA 1FX0A 4TT3D 4DOMA 3WPWA 2G71A 2CCKA 2I5PO 4DTIA 2KYRA 2EJRA 4EVRA 3RWMB 2EFEB 4ZRMA 4YP7A 4B3HA 3Q3HA 3H0EA 1NXTA 4MQFA 1NVFA 1Q20A 3BKWA 2KBFA 3JQAD 3ASYA 9GPBA 4XDYA 3PL1A 5MF6A 3M99B 4CEIB 2O2CA 2PTMA 5EVJA 2A94A 5JI2E 3ANNA 3QSGA 1GZ3A 1UBLS 5AW4A 1ZC3A 1C3OA 1AA9A 1KIFA 4UCTA 5KSYA 2H9YA 3OGIB 3ESJA 3RT7A 4CKCA 2ZS8A 1VE3A 5B3KA 5L53A 2Q5QA 5F23A 4NS4A 4L22A 3UXHA 5DXAA 1RAIA 5KVAA 3HWWA 4B45A 1AQYA 5KTKA 4MKIA 4QFMA 3TSYA 4W7HA 1OLOA 4QQNA 3DZJA 4D0GA 2JLCA 4IGGA 4DCPA 1GD1O 5EJIA 4BV2A 4JKIA 5THKA 1NOJA 1OXBB 3WTCA 2IYOA 4DV2B 1QGOA 4X1IA 5CCDA 5TMBA 5C53B 3S0JA 1X1DA 3I83A 3GRUA 4G1UC 1O9BA 4U7PB 2OFFA 1BCSA 3G2HA 4CIYA 3K30A 3HI4A 2GZ3A 3KDSE 3G23A 2KSDA 3MGBA 3ZWXA 1VLJA 3UA4A 5H02A 4FMDB 2Y6UA 1GGHA 4DZRA 3PXCX 1E0KA 4AM8A 2A0YA 5C4MA 4CHTA 3U3ZA 5AUPB 2P8SA 2P4EA 2OGSA 3PICA 2EG9A 1GTRA 3P9YA 3ZHOA 3GNLA 4ZHYB 4AY3A 3A28A 4XSGA 721PA 1FP2A 1EFDN 2WLLB 1KTIA 4E31A 3QUWA 4ND7A 4G0QA 1I7PA 4GRAA 2PAAA 3ZDFA 1NJ6A 2DSNA 2Z3VA 3FOZA 3FOBA 3MGAA 3KB1A 1Y1PA 3TXSA 1AJPA 2EIKB 4IIJB 3ODPA 5KWIA 3GP3A 2WFAA 2PN1A 3HDHA 1GCAA 3WIOA 3OQJA 1YZLA 2G1KA 5B7PA 3RTCA 3OM3B 1A1VA 2G72A 5TPZA 1ISGA 4LJKA 4AJ9A 5AK5A 1VHAA 4ESEA 1SZJG 3P19A 1RYNA 2BE3A 3I5UA 4HQKA 4BW0B 1KMIZ 3EG9B 5THXA 1IY0A 3D9QX 2HOQA 3ROEA 5P8WA 3JVVA 1H2NA 3ZS9A 4DV6B 5CDGA 2YFQA 5JRJA 3MF4A 1QYIA 2ZVPX 1JEAA 1T3SA 2OMEA 2VVTA 4AP9A 1OH6A 2ZOSA 3I12A 1RWXA 4URVR 3ZTWA 2L42A 1K7XB 1ZLXA 2WWIA 3BK7A 1JA0A 3IV7A 2ATCA 5JFGA 1N9KA 5EVCA 4FT2A 1AT1A 3PFBA 3OPYA 4MHOA 2BSKA 4ZT7A 2ZVZA 1USVA 1PJSA 2JGNA 2XB9A 2IXEA 3E2EA 1GZSA 1VK3A 4EY6A 5ADUS 5KUMA 2O3UA 2CH7A 3F0TA 4HN4B 1DXHA 1TQDA 3W6ZA 4O4JA 4DUZO 3V4OA 3H19A 2WDZA 2J31A 2QZPA 2PT6A 3S7ZA 3DMRA 3LDDA 2FSGA 3PSHA 2GXSA 4NMHA 1UJMA 2WZDA 5D8DA 2DM6A 5F52A 4Z4CA 4INJA 4GOND 2A3RA 2ECQA 4PLVA 3DOOA 4PGFA 1K5DA 1RWWA 5BN4B 1R50A 1T4GA 2XA9A 3CC7V 5ICGA 4PAGA 3AR4A 4KFSA 3K1TA 2QW0X 3E7FA 3A1WA 1P1IA 3IEWA 5DOZA 3HI6A 3BJRA 4J0HA 4OUDB 5BNTA 1Y5IA 2E75B 1KQNA 1ID8A 1V11B 3G5MA 3VPBA 1NI8A 2G6BA 2E4AA 3A36A 4TPKA 4B09A 3QO7A 1MX9A 2CBZA 5SZJA 1F5NA 1NI4B 1SU4A 1MU0A 1YZFA 4I3FA 2O3RA 2IYSA 3BXGA 4KLRA 4WN3A 2WWYA 1TM2A 4X7BA 3RA5A 1XL0A 3SPCA 3IDOA 3CCEF 2FG6C 3VC1A 4JNCA 1XWFA 4FYMA 1UBFA 1Z6AA 2ZYVX 1X7YB 2PSDA 4JI0B 4JJAA 2O3JA 3OQOA 3K79A 5FF9A 3KHKA 4LJ5A 2CE2X 3CCJV 3FRHA 3K15A 2D0OB 3DEFA 3VKVA 3REQA 5C8YA 2FEOA 3O9OA 2LP4Y 3DOCA 2WICA 5K0ZA 3D3QA 3BHIA 2VRCD 3GARA 3SE0A 1QLEC 3ZKAA 3LMEA 3ZRVA 4DUPA 2C92A 3KOWA 3OE7A 3ZGLA 3EWAA 3MB8A 2N74A 3LYBA 3G8YA 1JI3A 3ZX6A 1ZG3A 3BMQA 5TMPA 4WUTA 5B55A 5I7SA 2RMKB 3BMCA 2QT9A 1PR2A 4XM1A 5FLYA 3IYLW 4UQLA 2EFHB 1QIIA 1V4VA 3LPCA 1GZ6A 3UOGA 5B2FA 5AUQA 2G67A 4BMXA 3TJMA 3M8AA 4HRYA 1KI9A 4I7EA 5B2EA 3C5VA 4B3BA 2ID8A 1XAJA 3UK7A 1K0FA 1K34A 1R6NA 3E15A 2R1VA 1S5HC 3ABLC 3UWMA 4LDRA 4S05A 5JXJA 2ARHA 2VC2B 4WLOA 5EB0A 1YDFA 5KVSA 3O1JC 3SHVA 4MWGA 4CF6A 2VAVA 5ALYA 1FTNA 3KCYA 5LXTB 4MR7B 3DYVA 5LQKA 2Z01A 5AM2A 4GF5A 4DTCA 5BMVF 4F46A 2OC4A 1CUDA 3BKXA 3SPHA 4BB0A 2Z5UA 1X8KA 4HNTA 4MW0A 4UFOA 1QOQB 4X00A 3A2NA 2PUWA 1E79A 1XNRO 3KSUA 4M2LA 1KAHA 2O14A 2IHBA 2OO5A 3G8AA 1YVWA 1M90W 1SKQA 1C1YA 1WX1A 4ZVPA 2EIMB 1C9JA 3LJKA 4MNTA 4EH1A 2YWGA 2BRUA 1R0KA 4J3JA 3QPWA 5J63A 3RVLA 1TI7A 2A3NA 3WWOA 3OJEA 4DIOA 3KYCB 4CMJA 5ALIA 3OM9A 3RUHA 1P4JA 1N8RH 1JE0A 3JW8A 3UM9A 3IUQA 2QA4F 5BRAA 3PEVA 4B4VA 3JYHA 4K0RA 1CUXA 3CS5A 4E13A 1KPHA 3FSJX 1XV5A 1M1YA 1E89A 1Y4DE 5BV7A 2FFJA 2JD0A 4UDXX 1IY8A 5LZ8A 4QL3A 3M4YA 1SJ9A 5A5GA 2IYPA 2HMTA 4L4XA 4CMGA 4C7XA 2I6FA 1Q1AA 1LK0A 1CUZA 1X80B 3K2XA 1BG6A 4HWOA 4Q12A 5B1NA 3H3FA 3MTDA 2ACWA 1BYIA 4G8JA 4MR8B 1NVAA 2WQ7A 1GY8A 1T3GA 1E1RG 4PYIA 2EJBA 3V34A 1AV6A 3ITDA 2ICAA 5DE3A 4RO2A 1O5OA 1VL2A 4OP2A 5TF0A 3B8MA 1GNVA 5KTPA 2X0IA 4JJKA 4G5SA 2YJGA 3N6VA 2GV9A 2UYGA 5BSFA 1HFKA 3PIDA 1BVHA 2A84A 5JECA 1DV2A 4PU0A 2CXRA 1KDVA 4WFEA 2A7XA 4TVSA 2V6GA 3RS7A 4CQMD 3KKEA 3A0RB 4MI6A 4BC1A 1TJ5A 1M6WA 5EGSA 3M6MD 1WNFA 3JTEA 1QIHA 3LDAA 2XNSA 3S3WA 3MZ0A 3IO3A 3NGMA 1XNGA 4WUVA 2WR8A 3M6UA 3Q7SA 2GEBA 5C1OA 1NLUA 3HY3A 4OJKA 3HXKA 4PCLA 4FN4A 2EBWA 1QTRA 5DV9A 3TW6A 3OY7A 2FMKA 4JT9A 1IY1A 2WWXA 1WNTA 4LOIA 3WLAA 3NTVA 2UUBB 2VHZA 4PQFA 4LF7O 4R81A 2Z6VA 3MILA 1IX9A 3LF2A 3L0DA 4PGGA 1XILA 2FK7A 1QIFA 5GVRA 2HRZA 4ASUD 1JY8A 3B1JA 1Y9ZA 3V7FA 3SDLA 1OX5A 2MIIA 4Q01A 1LA2A 5I3CA 2PBRA 4NAHA 2D1QA 4Q3DA 1PFVA 2NU7B 4LKOA 2Q1UA 1L2TA 1V1JA 2RI6A 3L8EA 5DBGA 1XA0A 3ORFA 4J6FA 1U0HC 1U7HA 1BHO1 1VJGA 5DX1A 2TYSB 1GGNA 5JEDA 5EUCA 4XCXA 3D6TB 4UARA 1YA6A 4DANA 5KVCA 3UT0A 1KA9H 4XRGA 3CCMV 1VMIA 1Y6ZA 1QFJA 2ORVA 3GCWA 5JXHA 5TJHA 3DFFA 1PZGA 4HYTA 1YFJA 1T5EA 1CQIA 3NANA 1XZ8A 1B14A 1RCTE 5JDIA 3D6VA 5BYKA 4HEQA 3EEIA 1I7LA 1GLVA 3K7EA 2VLBA 1PTJC 3RHTA 4HDNB 1Z4IA 1UMKA 5HRCA 3T5GA 3DCNA 4Q4DA 5CT5A 3M9WA 1UL1X 3V1KA 2PX3A 1N5MA 3WGYA 4BGVA 1DINA 5AKEA 3H5TA 2X5JO 3PQ3A 3PHLA 1DT3A 4NEQA 4BQFA 3N6RA 1M83A 2CFRA 4F5YA 3DMNA 3R6DA 3L6BA 1PL7A 4YAUA 5EMKA 3BCRA 1T25A 2FUG1 1GKLA 1S2OA 4DF3A 2HW8A 1MC4A 1VHQA 1J5XA 1WOMA 3U7HB 4RSMA 3OFNA 4XYLA 2GD1O 3NYIA 2VXCA 1NZJA 1KEEA 1JDVA 1R6AA 2YV2A 2B9EA 1C9MA 2VWGA 1WDWB 2WOJA 4R51A 3EGDA 1ADJA 1OLUA 4XA8A 1QRDA 5JSYA 2JAHA 3I8SA 5HNKA 1VSQA 1J39A 1R0BA 4UNSA 4A8JB 2KKWA 2NLJC 4LOHA 4ZTZB 3C9UA 2VYCA 4RJTA 3IERA 4CQMB 4ZVMA 3QPDA 3SQWA 2VZ8A 3N2GA 2DXIA 4DBVO 3OF3A 3NHYA 1XZMA 2ZWVA 4REQA 4MRSA 4ND2A 1VF6A 1BDMA 1XBLA 5ESXA 3OEEG 4RVOA 1OHHD 2G5GX 4RDIA 1YHYA 3IVRA 4GRDA 4BVKA 2RK3A 3MD9A 1N75A 3QTBA 3ZOKA 2MR6A 3ADKA 3K9GA 2QY9A 4EO9A 2W90A 3KSAC 3P1JA 3F3YA 3HWX1 2IOFA 3VI4B 1TF7A 3AHHA 2ES4A 2CUTA 1FAFA 1YRLA 4PONA 3WQQA 3VNBA 3DGEC 1E9VA 4V0LA 4C14A 2WSSD 2G5TA 3L6EA 2A92A 2PKWA 1LXCA 4RETA 4KO1S 3W1EA 3ZE8A 4CN8A 2OCIA 2GZ1A 1BFUA 4ZRNA 4WK2B 3FFMA 1U40A 3W79A 3QKRA 2QVZX 1BHAA 2PUHA 3GCXA 1SIUA 5JVDF 1UDCA 1V1MB 3ZEAA 3Q7RA 1W87A 2GRUA 2XAJA 3WK5A 4YIOA 2AOXA 3K9AA 5B8FA 5B58C 4FSHA 2ZBUA 2YXBA 2PD3A 3AG4B 2IIVA 1LD3A 1PRYA 4CF4A 5B1HA 4JU8A 4WKGA 4GOKA 1S89A 4FZVA 5HY4A 3VO8A 4LVNA 1X4TA 2HSJA 4EHAA 5TMEA 2XUAA 5AM4A 1RC8A 1M1YE 5WRFA 4JWKA 3GQBA 1LDMA 5K0BA 4I36A 4GOMD 1N25A 1PM9A 3I2JA 4HY3A 4QU8A 4JUBA 2QTGA 3AF4A 2DFPA 3WLOA 5FOQA 1TOAA 3FPJA 3BY6A 2XUKA 4IDOA 4XTRA 3BEHA 1FD9A 4P54A 1KC8H 2A67A 1J9ZA 4MMZB 1J70A 1KU9A 4MGYR 4DCJA 5F35A 3RJTA 1Z56C 5KHJA 4LI3X 1OH5A 2C4UA 4B6GA 4P3NA 4OJYA 4LNUA 2Y0PA 2QRHA 4CS2A 3V2IA 4Y2JA 1WABA 3LLSA 1REQB 3OLVA 3UTDA 1UFIA 2DYSC 3L04A 1SXJA 1DT9A 4GM1A 3W7BA 4RADA 3TD9A 4B3TO 2ZRMA 2FZ5A 3IDFA 3ETQA 2H5EA 1GKUB 3EUEA 3CRCA 3DDWA 1L5MA 1WHTA 1T4CA 4TN5A 2AVDA 2BBTA 1OFIA 1USIA 4AJ2A 3FDXA 4NZMA 3I01A 3B1YA 1QH0A 1IUKA 3PGXA 3PGVA 1LI7A 3OMNB 2F1RA 1Z8HA 1JHMA 3WISA 1T1GA 2LXNA 5K1XA 3OAAG 3LOUA 4ARSA 3EIHA 1VQ5F 3ZWPA 2GJ8A 3RB8A 3JS5A 1D5AA 3QY0A 4GZLA 1Y80A 2XHZA 1GGEA 4RMIA 3LFUA 1P6XA 4EPVA 1RLOA 1XXHB 3T3NA 1WLSA 3NHUA 1KVSA 2WKQA 2FR8A 3A4YA 3HBNA 2FEKA 2YWEA 1U0LA 4I9GA 2OCDA 2JJMA 4Z4QA 3TQOA 2Z5GA 3W5IA 4CIXA 4LSZA 3Q41A 3IB6A 3I5AA 1W5TA 1WN7A 1KI2A 3BEDA 2V45A 4OJTA 2R7LA 1RWKA 3K9QO 3UWKA 3KJXA 3WLPA 4RDCA 1YR9A 3OWOA 3UCEA 2YMPA 5CVEA 3SJUA 4KUGA 2P3SA 4M76B 4ILKA 4FLEA 4FS3A 5CJ2A 4ZT2A 5HZKA 2G88A 4OXQA 3CNOA 4Q34A 1H94A 1K89A 1W47A 1BQZA 5HRUA 2RN9A 3EXIB 1XEQA 4BAZA 5DTIA 1Q7EA 3EHEA 4RAOA 1DIAA 1OU0A 5J4LA 1X7ZA 3MQ4A 1AS2A 2O6HA 4JBNA 3ZGYA 4RL4A 5L6LB 2RHHA 1FF9A 2NSJA 3DLIA 1L5SA 4B6SA 3R3UA 1FP4A 5C7YA 4CBCA 1E1KA 2AS0A 2GTSA 1ZD4A 4I50B 3IQIX 1QF9A 1M6NA 1VPLA 4GE0A 1DTWA 4HNRA 1R9NA 1PZXA 1P2FA 1NS1A 4A3SA 1RYEA 4KJZA 2W98A 4IH1A 3UJ3X 2ZAYA 4HO1X 2O8NA 1P45A 1YR2A 4ZCQA 3QVUA 2A9KA 3VR4H 3WYAA 3MMXA 1WAMA 3T7KA 1JLMA 3SZGA 4JC4A 4X6UA 4KG7A 2FJUA 5EB1B 5F2OA 3ST7A 3FDJA 4QPNA 2IYUA 1ZUQA 3PNSA 2IOQA 3HXQA 3WGMA 3L6DA 2OTJV 5CA1A 3RSSA 1YJNV 1R6KA 3CXUA 3NKVA 3QNEA 3NFYA 5TQJA 4CWAA 5K99A 1JEQA 2IYZA 3G80A 4MWZA 1ZR2A 1G59A 4NYMQ 5T8KA 3IKJA 5DVZA 3TD4A 5F77A 2G1PA 4XVRA 4AUNA 5K4AA 3BUSA 2RB5A 4QUGA 2HLDA 2A6PA 3LX6A 1ZL8B 1CUHA 4ZK7A 1A27A 4EG1A 1IJKA 4U2DA 2Z5VA 5LA6B 2CLDX 3C0KA 4QSHA 2O2DA 1SVLA 1MABA 1W55A 3OCYA 1K0UA 1RPRA 2HJ9A 1NRIA 3QYJA 2PX2A 1OPXA 1KI1A 1EA7A 5J4YA 1P4GA 4CZZA 5K6RA 3HJNA 3CEIA 1FKAO 4HDOB 2Q2VA 3A9WA 4S1WA 3HZZA 2I4LA 3CPJB 4J0KA 1KE1A 5GINE 1ISJA 2A0UA 3D59A 2GUZA 4H17A 1L5RA 1W30A 1N33B 2CLCX 1UJ6A 5HP7A 2ZS9A 1RRCA 2JFGA 3O8LA 3R8CA 3AESA 1X87A 1RMTA 2FWMX 4FC7A 2DQYA 3JASA 2PJZA 1WVMA 2B92A 2FQYA 2VJQA 1SESA 1S2LA 1FZTA 3QHDA 2IL1A 1A50B 3KALA 4KPFC 1HE5A 4RDHA 3WZ2A 4D8TA 2GR9A 2V4UA 2PKYX 2GVDC 3A31A 1YF3A 1QHXA 2ATIA 2WPDA 2E1PA 2C4VA 1ADBA 4CKYA 4N7JA 2B5UA 3QVXA 1L7VC 1Z38A 4XI9A 5FULA 4WVFA 1CXZA 2OYSA 3LNNA 5AVVA 3QEBZ 2ZFUA 2QT1A 4CL2A 4X60A 1NLZA 2W0SA 1Z07A 3M6XA 3D64A 1MVNA 1O7JA 3C6XA 5EKUA 3AG3B 4BP8A 4CUZA 1QLNA 2E4ZA 4AO6A 3VO2A 1F0NA 2XGSA 1SCBA 4U5XA 4D4MA 3ELCA 4ZODA 5L3CA 5G02A 4YRQA 4Q4CA 4BT3A 1G6Q1 2QM3A 5EP1A 2XTZA 1X8XA 1WPGA 3DZCA 3U0ZA 2HUNA 1G8MA 5COBA 1U28A 3OPXA 1YK1A 3MQ2A 5KHIA 1XMQO 2PV0A 1U2GC 4HOYA 3PWZA 2WU8A 5B1AB 2A5GA 1M8KA 3HEBA 2V1UA 2C03A 2VL7A 4FB5A 4P3YA 3LUTB 5DEIA 3HGMA 1GGMA 3CXCF 3INRA 3AEIA 1O94A 3QI7A 3ZHTA 1V4NA 4TLMB 3DHEA 7REQB 4YJ3F 2AK2A 3AL2A 3CNQS 3BCSA 1U0OC 2FE4A 4TL7A 1OLXA 2C3OA 4UU8A 3DAGA 2BZ1A 3E9EA 2KQXA 2IXFA 1V1RA 2NN3C 1LQ2A 4O33A 1X7GA 4KW7A 4F3YA 3EVAA 2WU1A 2NXCA 3HKEB 4KMSA 5AKYA 4BNJA 3QX9A 1H22A 2P3LA 3THRA 1XPRA 3RK0A 3WL4A 3ZDQA 1ZHHA 3C3WA 1E58A 5JY6A 3MCZA 4F6CA 3Q15C 3HU5A 2I3GA 1L4NA 3QFRA 1M2KA 1R8SA 2BUAA 1VG0B 5EZYA 1QU3A 1ZIDA 4YJ2A 1Y1RA 1SXJE 3OQPA 3M6VA 4OB6A 1PLKA 4PYKA 1X7XA 1ZFNA 1UEIA 3KUDA 4L75A 3A3KA 1U7ZA 2WUDA 2QUIA 2JVDA 1YB7A 4QO8A 1GN9A 4B3FX 2G9ZA 3OZGA 1UDRA 1HK7A 2HYDA 3EFEA 5JMPA 4J0QA 1TM3E 1W19A 1SHUX 3KKLA 5GPBA 4GWKA 1GL9B 1NSYA 1P1KA 3V6MA 1QP7A 3V6LA 3G2NA 2JFNA 2GD6A 1BD3A 2AKEA 4DR6B 2Q9AA 2AXQA 3IBTA 4IDAA 1RWBA 4L4ZA 3J81A 4DM4A 2ONYA 1QUEA 1K75A 3LWPC 4NFSA 1NURA 3L6RA 3SIUA 1B23P 1IBKB 3JAMA 5M2QA 1JKIA 4NDNE 4E4TA 2EP5A 3D8NA 4KVGA 5LB4A 5JO9A 3EZLA 3GLQA 1TZMA 1LBQA 8LDHA 1EFTA 1WZCA 5DM6V 2JCGA 4KXQA 4FEYA 5KSWB 1KZ1A 3BD8A 1EZ4A 3LT1A 3VVMA 1O97C 2VBGA 2ZYSA 2DQ4A 2SECE 4D80A 2RHRA 4PSCA 1MAWA 1D6JA 1GM5A 2XHBA 2IU3A 3DHYA 3DNFA 1LW6E 1FMFA 1XU4A 3GGSA 1V43A 2CD9A 4HGRA 2EGGA 2OPBA 3ZQUA 1SDSA 4PWYA 3B40A 2BOBC 2FRVA 1FYJA 2IP4A 3AY7A 4R2WA 2OAEA 3FCOA 4LUCA 4RMHA 1U5BB 4X0EA 2VDLB 2PFSA 1F4PA 2TRSB 2IELA 4BVGA 1WETA 5EZSA 5B6PA 4EIWA 1O58A 1PTKA 4YCSA 3BPZA 3FXAA 3OQBA 3Q9NA 4X3MA 1U8FO 2BFAA 4QDUA 4HLCA 3K0EA 3B1VA 2A86A 1V6CA 2X5NA 4RNCA 1RLTA 2Q49A 2HQSC 1O5IA 3M1YA 4MUKA 4MWBA 1SVNA 2WYIA 4OQZA 4I1OA 1YZTA 2NXJA 3D1LA 1BQ4A 1OIVA 1UBTS 4URZR 3KTFA 3OIYA 1M8FA 4HVTA 4RTPA 1P7YA 2ZSEA 4MVJA 2OQ2A 1YONA 2UYHA 3AY3A 1YQGA 1EFAA 2GAJA 1FRFS 4HWKA 2NVUA 2ITDC 3UWOA 3B6NA 1ZCBA 4RH0A 3D7NA 1IJEA 1VJCA 3KJKA 3V1YA 2CMGA 1FRZA 1KH3A 4LSWA 5KVVA 1JPNA 4CEJA 1YT5A 3EW7A 1DQZA 1GADO 4W6ZA 1W581 4Y6QA 5FI1B 1XFDA 2A0KA 1ZWLA 4F4FA 3T1VA 2YWCA 2R2GA 4QJ5A 1I9CA 4Z51A 3UKDA 1SMKA 1SC5B 3PJFA 4TQ9A 2YNMA 3FZNA 4DK0A 2MYPA 1KEPA 5CAEB 1DDIA 1J09A 2QRVA 1MNGA 3QU7A 2AFVA 3P5SA 4TWJA 5DK6A 1ORWA 4UHJA 5K0SA 4LRSB 3GVCA 3M9XA 2E5WA 1WCIB 2ZBRA 1R3JC 4KQFA 4A10A 3HU1A 4ND4A 5DPMA 3RYHB 4BP1A 1A88A 3DFKA 2ZTVA 5KYUA 2JLYA 3L0OA 3DJFA 4WBNB 2DY0A 1P29A 2J7PD 2QW8A 4IWNA 3F5DA 2F9FA 2O8EB 4NYIR 3ISVA 4EL0A 4CTOA 1ENYA 3RVOA 4LZJA 3AI7A 3IA7A 2B8JA 2OZPA 2ADMA 3PE3A 4ZOBA 2FPGB 2Z43A 3TXQA 2XB8A 1X9GA 2XZOA 3Q5GA 4OYRA 3CXCU 5FPRA 4LFAO 4WFGA 4LY9A 3E8FA 4ZOQI 1F1JA 3UIEA 4O4HA 5CLIA 5AKGA 2V6MA 1JYEA 1PV2A 1CS4C 2D3TA 4RWZA 3QMVA 1JEOA 3OFJA 1HDOA 1CY7A 2W48A 1GP2A 2PI4A 1P0MA 2R8OA 4NEHB 2KTVA 3QWHA 2BP7B 3DT8A 1H2AS 3EIXA 4GAEA 4FNGA 4WFHA 2ILTA 3BREA 3DXRA 2IU4A 2R8PA 2ZD9A 1B00A 2AE1A 1YCHA 3A37A 2V7GA 4C4XA 4B47A 2PIAA 3I4LA 3DLHA 4O63O 2RJNA 2VUSA 1ZEMA 1VKJA 4NNPA 1N1MA 4I66A 2JFBA 3DZKA 4ZQBA 3KEQA 2YINC 3NEAA 3QTCA 1S3FA 2FQ1A 3ND5A 3DEZA 5FWXB 1O77A 5I5GA 3SXPA 2M1XA 4EY8A 3LLUA 3H87A 5DI3B 4TS3A 3B1FA 4H60A 1GMGA 3LUHA 4UXHA 4RD1A 2ZZKA 2HJGA 3JQFA 4BE9A 3JWIA 2P1DA 1ZKMA 3M3DA 1XF1A 3QGMA 1ZK3A 3JWHA 4KPUA 2Y0BA 4NNJA 1QHYA 3I92A 4WASA 4EPXA 2C2BA 1H48A 5EHZA 1BEZA 3BA1A 3TL6A 5FEUA 1GZDA 1JAYA 4CL0A 4BUJA 1ADYA 3OBIA 2Z30A 1KF0A 3OMWA 2CE7A 4P5PA 1ACJA 4PNEA 1TMKA 3GGDA 1JIUA 2QXTA 2XYHA 3HVIA 3LT5A 1CZNA 4XQ9A 4IGAA 3FPSA 2FOLA 3LXRA 1XGKA 3P0IA 4MO9A 4O4LF 1GG2A 4HDKA 3ZIAA 5LGTA 4MWCA 2OV8A 4G07A 3CUVA 3K8ZA 2QKYA 5AHXA 1CQXA 1NYQA 4GI5A 4WESA 3D2BA 4YYEA 5FLXA 4EATA 2G77B 2H8GA 4J1TC 5KAMA 1QP4A 1E5XA 1KI6B 3SS7X 2FETA 2C83A 2ODNA 3SJZA 1PJQA 1VRVA 2Y0CA 1KIAA 3FLBA 4AWAA 1QM5A 5HKOA 3I61A 2TS1A 4OPAA 5HIJA 1T4MA 4I1SA 1P2VA 1T2DA 2QTTA 3GJYA 3AG3C 3P0JA 3U9SA 4C7OA 2VJKA 3HP1A 4M1OA 2MYNA 1IM2A 4RK4A 5G3ZA 4ABYA 3BYZA 2WFZA 1ODKA 2UYKA 1ADCA 1BS2A 4B8ZA 2A59A 1VECA 1N2OA 5B6JA 2HBRA 1AB3A 1VJRA 4TLDA 4BQPA 4IFBA 3VISA 2VYFA 2VPZA 3WL6A 3PI7A 3TSAA 4Q66C 4OI0A 5B1AC 4OMDA 4B5KA 4YI5A 2R6GA 2K1SA 3LUPA 4JLMA 4MHTA 3TW8A 3ADDA 5HY2A 5BPFA 3SQLA 2AH5A 4ID9A 3FDZA 1HNZO 1L4UA 2BMEA 3SF0A 2ZDIC 3O3OB 3LCCA 2WVJA 1ZU5A 1Z2OX 3FFTA 4B0OA 1ODIA 4QOHA 5KC9A 4EO7A 3IP3A 3KBOA 2HA0A 4D42A 2OV4A 1Y1QA 3SZ3A 3DOEA 3STLC 1JTFA 2GZRA 2GDJA 1KSGA 2GAOA 2OB2A 1U7WA 1RXSA 1QO0A 1YIDA 4G0OA 4R6ZA 4KP7A 5HJEA 4CGZA 4WNYA 2FPPA 1Q7BA 1QNLA 3ZH9B 4F4JA 3JU3A 1W88B 1W0KD 2PGLA 1JBQA 4FFKA 3T0IA 3I2HA 3OEHD 1CD5A 4RKQA 1NMQA 1MQSA 3OHSX 4Q05A 4RMGA 3NGXA 5F5XA 4RTQA 4ZI7F 1TEVA 4D7SA 2XNDD 3B3JA 3WRYA 3N2KA 1SCNE 3H99A 1SHLA 2I34A 4K9KA 5T4EA 3I9V6 3C7KA 4MVJE 2WK1A 3ABUA 2AMVA 2O8CA 4JQSA 3BBLA 2JJ2G 1XZDA 1SVOA 2H08A 1ORVA 1JYSA 2FA9A 1YQXA 3IP1A 1WMDA 4LMBA 1O95D 1BN6A 1C50A 1PG5A 4D79A 3SBEA 1V2GA 3ZP7A 5EIFA 1KEUA 4LN1A 3KKMA 2WJIA 1S77D 1ZOOA 4QYMA 1WB5A 3EUWA 2CNWD 5EPEA 2VQ3A 2F55A 1BMTA 3LNMB 3I6ZA 2P6OA 3DBLA 1VE1A 4KAJA 2AHRA 1GAJA 1U0NA 3KHNA 1ZICA 2BGNA 4HVCA 4HEA6 4EF6A 1L4EA 1ILWA 4OMUA 3G4SV 4U7FA 4GT1A 5IFLA 1BWSA 4NHEA 4UFZA 2IV7A 3WADA 2I29A 2HLHA 3R3WA 2Q4RA 4BXOA 2X0LA 1P33A 4BNKA 4GI2A 4KXLA 1NF8A 3H0CA 4L7QA 1HDIA 4TYYA 1PL0A 3LYUA 1HTTA 4QE9A 1AQIA 4QU0A 3JZDA 3RBZA 5CW2A 5AKLA 2Z3WA 5BVGA 4XUDA 1CK2A 2J5XA 3V3KA 2X1MA 2HS4A 3RIGA 4RV9A 1EINA 1OIWA 1XIVA 5CCXA 4YRSA 1BHSA 2BZ0A 4KIFA 4KQXA 2GBGA 5F73A 3EEOA 1XDBA 4EO4A 3PQEA 4DA6A 1DKQA 3CFYA 2PH5A 2A7QA 3H1IH 1KQGA 3CRZA 3INNA 3LL4A 1Y6QA 3VMFA 2VZ0A 3SQOA 4RU1A 4NATA 5DIFA 3FX7A 3PTAA 2PSFA 1F4VA 2N75A 2XWBF 1IOLA 1SRYA 1ZCJA 1AMUA 2QM7A 4TOIA 3WGLA 3Q0IA 1XE3A 3K09C 5BUCA 1ZCFA 2J08A 3C5CA 4M6WB 3VYTC 3VZSA 3IP8A 2HIMA 4TWRA 3NALA 1AI6A 3FG9A 1OE0A 2FH5B 2FRDC 2JFZA 1UBCA 2JI9A 1GPJA 4REOA 3RYCA 2ZI5A 2QVBA 2LW1A 5K05A 3FHCB 5BSEA 5CYOA 4ZOLA 4OY3A 4O6VA 4AKIA 4BKMA 4JI1B 4BRWA 1E7SA 2HX1A 5BSRA 4B3JA 4F2HA 1XLVA 5F4ZA 2W2KB 3FN4A 4F7DA 4HATA 3IAS1 4HBGA 3CPSA 4LBWA 3CYOA 4TTSA 2H0AA 5HS4A 1POXA 4GUDA 2LIVA 4UMFA 3QXJA 4EKYA 1P7PA 1I0LA 3VDNB 5EMNA 1XD8A 2CUNA 4K8OA 2CV0A 2OFOA 1O96A 4MS3A 3RANA 2I3ZA 3EX7C 1E1QA 3OQIA 1PR5A 1VL8A 4AD8A 1O0SA 1JQEA 2JAPA 1OWMA 4YGXB 4BZWA 3G6WA 2PWAA 3EE6A 1OILA 5HBRA 1DC4A 1V8BA 2R5WA 2C97A 4ZU1X 2ZI3A 2CDCA 3L0YA 4NPHA 4HYYA 1X1CA 3W6UA 2KG4A 3K57A 5CJPA 2X8BA 3EFOA 4MPPA 5B1BC 5DNUA 2VCYA 3H5OA 1ORHA 5IJ0A 3ELWA 2RBGA 1WXDA 4HH3C 2PANA 5HIAA 3DMFA 4BVLA 2X0FA 4JA2A 2ZDQA 3GAZA 3A9UA 4E11A 4BJ3A 2C4MA 2IP1A 4Y2SA 3WFIA 1LBIA 1ZUIA 4FWTA 2FGJA 1ZLYA 5F7XA 5DTRA 1XF9A 4ZVRA 4RF4A 4NBNA 4JLOA 1JQ0A 4N9QA 1JXOA 3DXYA 2ZUSA 1I2CA 1BD4A 3HCEA 3OF2A 4JHLA 3N87A 3OP1A 4FKZA 4M87A 4P8RA 3TCXB 3LI2A 1EBUA 4MDYA 3T1CA 4JKOA 1AKWA 2C7RA 1C4XA 1KKLA 1UZLA 4LJ4A 1RP7A 4X95A 2QWRB 1Z5VA 1PP4A 4W1QA 4U5QA 2NV0A 4P4SA 1W52X 4NZ9A 3MOGA 2VF2A 3IR6A 3H11A 1G8PA 2VYNA 5DXFA 1HNWB 2JFWA 1OXUA 4I9HA 3T4PA 1W34A 1SD1A 2VPPA 4KE8A 3PDCA 3C7TA 1DFGA 1MNAA 1PNTA 2C5LA 3EK2A 1T8PA 1NJ8A 4A1FA 1ZD1A 1KAOA 2YV5A 3A6ZA 1I0IA 5HUJA 3MK31 4DSNA 1JV2B 3GB9A 3TVYA 4ITVA 1Q11A 1PZNA 4S24A 3GR6A 2DPYA 1Q0RA 1H42A 1RPOA 1RQGA 5J2TF 1JOYA 4BBPA 5EHQA 5E1DA 4I5GA 1JG4A 2EJVA 2D0IA 3LOQA 4NKRA 2DKFA 1V55C 1RRMA 1QG4A 3C1OA 2NZVG 1EVYA 3QK7A 1YASA 3DR5A 2R8ZA 2UXDO 1KQSF 1EP1B 3G0OA 3WQHA 1H4SA 5LYYA 3WBFA 3VQXA 4CN9A 1J21A 2Z04A 3COYA 3VSDA 4NCNA 4R84A 4FLTA 4TZTA 4L8JA 1E6EA 2VXYA 3KXDA 2P4VA 1KY3A 1PEYA 3R3JA 5EWRA 3OHPA 2XBUA 1DC7A 3C7AA 4X88A 2SNIE 1T2NA 3P94A 3PYXA 1JWAB 4QRIA 3RSGA 2CHUA 3C8ZA 5AJUA 4ZPJA 4CTKA 3RS4A 1YJBA 1JG2A 2QE6A 4OYLA 3RIMA 4P36A 4HF7A 4BR6A 4M38A 5JYEA 4BTVA 1TADA 2WJZB 4CM9A 3O26A 3B09A 3OJWA 1DF5A 1DQYA 4LF8B 2HPVA 3OMIB 1MIOA 3KQSA 3O95A 1B0AA 4IGFA 1E96A 4ID3A 3W8RA 5EG5A 1V16B 1F51A 1T9CA 3V8BA 4XUGB 1F7UA 3OIGA 1ZGZA 2VS1A 3CKKA 1BX3A 3MGKA 2GPAA 2JHAA 3H7AA 3IAUA 1TUBB 1U65A 5DSXA 1NC3A 3WLLA 1L0BA 3R7DA 2E37A 5BN3B 4DW0A 4LYEA 2QIPA 2ZB8A 4YP6A 4FONA 2XUFA 3HZHA 1BIFA 2D1YA 3U2QA 3IP9A 4EDFA 4A6XA 3RV4A 3L0IB 3DEJA 4MP3A 1PU2A 4E3ZA 5T3UA 4CTNA 3DWIA 1TKCA 1GUBA 3WLJA 3RH0A 2C94A 2F00A 1U9JA 2O8FA 1U04A 3C3EA 3T4XA 3H9BA 1WXEA 5C18A 5ALLA 2XWJI 3EQ8A 3NBZC 1RSOA 5HY1A 2DE0X 4ZYLA 3CCQF 3ZHZA 2HXYA 2REBA 1H8EA 4EW3A 1Q0LA 3AK1A 3L5OA 4UTZA 4WACA 4F9TA 1EDBA 2EYUA 3F6EX 3WJ1A 4HNHA 4TTAA 4FT4A 4A9AA 1TM1E 3NVAA 4NI5A 1YFKA 3OTQA 1IJFA 4A2CA 5FJIA 1ST2A 3ZOPA 1GT91 3CSSA 3C16C 3ZY4A 3TR5A 2C3YA 5ECYA 1MPTA 1PEKE 3V4VB 4BN4A 3RRXA 2JIQA 2FEPA 4FOLA 4UJ3A 4W8HA 5B4VA 3KWFA 2UUCO 1BN7A 1I32A 2UZIR 4QBGB 3QWAA 2JH9A 3N7UA 3ORHA 3PQFA 4XRRA 5J2UB 4XUCA 3S28A 1CNEA 3KZVA 1Y3BE 1VQMF 3OICA 1M5RA 2W6OA 2RGWA 3PC2A 1A4XA 3X2QC 1XDGA 4Y6RA 3ZYCA 2OBYA 4F45A 2WNSA 2WIGA 3A4LA 3NCTA 5TPZD 3EHDA 3GBVA 1H1TA 2X9LA 1MB2A 5EQTA 1JVBA 3GFGA 3ZW8A 3UXEA 1W48A 3OVMA 1IULA 4I99A 5K6AA 5A3RA 4FC6A 1E3WB 2MSKA 4AG6A 1Z13A 1IHPA 1TTPB 3GK3A 2ZR0A 4JH0A 4LSMA 5JCOC 4MI1A 5TC4A 3B60A 1A7AA 5DKFA 2PKRA 1XTJA 2YL2A 3PHBE 1R10A 4BNGA 2GPJA 1E8DA 3ADPA 1QHHB 2GAAA 3TSWA 2KW5A 3WTBA 2HGZA 3QW4B 4X92A 5DHPA 5TRTA 3GEDA 4UUMA 1FX0B 2VT6A 1F17A 1O6FA 4EFBA 2CSUA 2IOHA 1NQWA 5I8WA 4RDXA 5LIPA 4MQFB 5C52B 3TFWA 4E09A 4HH4A 3I2KA 2FEWB 1ONSA 5CNIA 1YJWF 4V0SA 3HJBA 2H52A 5BNFA 2QMEA 5KQPA 4DLBA 4ESOA 3GJRA 3NYQA 1IONA 1JN1A 1QTQA 3T9FA 1N5IA 1C3OB 1M6VA 4L0CA 3JCMM 5KNCA 3DKRA 1KEKA 3ABTA 3II6X 5E9QA 2O2JA 4CKCB 2F8TA 5JV5A 5EYPA 4FZRA 4DR7O 1GO3F 2VZEA 3ET4A 3GYGA 2P69A 4OYYA 2AOWA 1YOBA 1YU9A 1J4AA 1PVOA 4FZJA 5TIIA 1E2GA 5FI5A 4M9UA 3BE8A 4KAFA 2ZWOA 4RUEA 2QE7G 3K1YA 2JARA 5KJ6A 3CR7A 1PWEA 2H0RA 3P2YA 2EL9A 2VHVA 1GPNA 2RGDA 3MXOA 1KQSU 3B2NA 2XB6A 4X1IB 1XRJA 5TARA 4RIHA 3OEYA 5ALXA 3MB5A 4NV0A 2VJCA 1BCSB 3VKFA 1NTMH 3CR8A 2AF4C 1TLTA 2Q69A 4L3WA 2Z2ZA 1Q44A 2EKPA 1E98A 4V2UA 1QK4A 4GPEA 4QWWA 5DGDA 3IMPA 2V0NA 3WGHA 3N6XA 4MRAA 3WQRA 3ZNPA 2EJCA 3C6YA 2RHOA 5JJBA 1VJ0A 2C3PA 3LKVA 1P9LA 3CC4F 3V42A 1CEYA 4S35A 3GDWA 1GRNA 1WY7A 2PTHA 4TWIA 1O95C 1N6KA 4N47A 2LRHA 3GLUA 1J7KA 3AP3A 2EIKC 1T8TA 3BFPA 4MJ3A 4FMDF 4LWZA 4H0NA 3VUFA 1ZP6A 1VJTA 1WLYA 2NZXA 5EKTA 5A04A 1JNXX 3VTZA 2RHCA 3VU1A 1X2EA 3AVTA 1NR5A 4GSKA 4I1IA 3D6UA 2F17A 2XGOA 3QX3A 5DGCA 2TMYA 4UASA 4DL9A 2Y1CA 4C88A 2I3BA 4R2IA 5ED4A 2ZJAA 4MV7A 3DNPA 1JPUA 2YVKA 1KMCA 3F5FA 3LTEA 2GPBA 2IEAA 4BVBA 1YGPA 2D5IA 3F9CA 5EJ8A 3FYTA 1ELOA 4IIJF 4DN6A 2RHGB 5ICMA 2E5LO 3N75A 1ODEA 1C30A 4NJMA 1JWBB 2EX1A 3HB3B 1ESNA 4ITUA 3VTFA 4WFAV 1UK7A 3AR9A 3GJXC 1VP7A 3C6ZA 3LSQA 2PSEA 4IUCS 4JI4B 4HRVA 5GMOA 1G2IA 4IHJA 2R6ZA 3CCRV 1Z6PA 4QRHA 1U2DC 1DIGA 5EJFA 1S1MA 4I1RA 4C6TA 3NAZA 2HO4A 2P79A 5BSMA 3D02A 3ZD9A 4PM4A 2WZBA 4C01A 3OPYB 3WLHA 5H82A 3ENKA 3T7SA 2BSKB 4DE5A 2BJWA 4C7VA 2PV7A 4H7IA 4OXRA 5KQSA 4L78A 3H1EA 4ISCA 2FQXA 4JC8A 1KDZA 2PD6A 3KZOA 3G2IA 2CH7B 2H4JA 4XGQA 4U02A 1E79D 4OX9O 4O4JB 1F51E 5M7EA 2WAXA 3ILHA 3G6KA 4BMDA 2PM8A 5CJJA 1NVPB 1FFDA 4OD0A 1BMDA 3CU5A 5FOSA 5C1BA 4ZK6A 4P35A 1N32B 5BY2A 3FUXA 3JD3A 3MN1A 5D5QA 1XTRA 2WRZA 3ZJUA 2FMIA 2PKXA 2R6HA 3RRFA 3BD7A 3B51X 1BH6A 3ZWKA 1JJBA 5FYDA 3VPFA 2P3OA 2XITA 4IZIA 2YN4A 1ZMRA 5LQUA 2C5SA 1GILA 5E4JA 3LG2A 3B1ZA 1OXXK 1KS2A 1QHTA 1QQ7A 3QF4A 5I7VA 3M4ZA 4DV5B 2A3QA 3EN0A 3OZTA 4DCVA 1UKCA 4M8SA 2BUBA 4I55F 3QHPA 1LNQA 3D00A 5J1TB 1U2QA 4G0YA 5BUSA 2O8DA 4MROA 1HI9A 3LUBA 1MA1A 5ALTA 3KD3A 4E08A 1E3LA 3BGWA 4X8OA 3DM9B 2O7NA 2ILMA 1FXKA 2V7PA 1A76A 3NIWA 1FSZA 1AC5A 4PZLA 2XRYA 4B33A 3Q3CA 1T5HX 3OIDA 5JXWA 4CU5A 2WLMA 4R41A 1OT5A 2Z58A 1W5BA 3USCS 3KZNA 4PLHA 1R7RA 5AI0A 2AB0A 3PQ7A 1GTSA 2R96A 3FOWA 4QHSA 4LRYA 3REQB 5DX0A 5C8YB 2CWJA 4XVUA 4ILEA 2P5YA 3L7DA 4FHFA 5GZ6A 3IOCA 3GH1A 1TMGE 4J9UE 2CMFA 1GPYA 2FN8A 3C45A 2PLRA 4YJGB 2BC9A 1PDWA 2O06A 1T0HB 4L5CA 3LIPA 2HBZA 1NMEA 3BMQB 3B7GA 3LLCA 3UJAA 1I6KA 4NYIQ 1X25A 3BMCB 4IAOA 4MVMA 4EB0A 2Q27A 2H6LA 4NCJA 2H4HA 5DN6G 2E21A 2QJTA 4UVEA 2NTYC 4Q39A 2C58A 3NEPX 2O3QA 1YIJV 2O23A 1XLTA 4AL4A 2AZ4A 3E3AA 1ISRA 3ML1A 4YRCA 1ZX1A 1IWOA 3K1JA 5KTSA 1TE2A 4FE7A 1WW8A 4PZEA 2R1VB 4X3PA 3V55A 3ELUA 3SICE 3SEZA 1KRXA 4UBMA 2ZG6A 1ORQC 4E5KA 3L7IA 3ZMSA 1H2LA 2LP7A 3OZUA 2FKAA 1WXHA 1P7GA 4GR4A 1KO8A 3WB1A 2F43G 2ILVA 1IZ7A 3GFVA 3GFFA 4J7UA 3REGA 1N2IA 1LLFA 1W1UA 2DBVO 4OAPA 1HDZA 4EB8A 1ZXLA 1U1GA 3FJ1A 2AIRA 3PPYA 5CA0F 3X2FA 4RC9A 1VCNA 4HX5A 1I36A 4MW4A 2ZT9B 3WL8A 4G8BA 3FFWA 2EIMC 4EJ2A 1RWVA 4FOSA 3ZU4A 1HZZA 2WIAA 3DDZX 4XTCS 5KVQA 2V6FA 4AYTA 4NTYA 4J4TA 4HHEA 4W5TA 2VEDA 1GGFA 1J5EO 4A5OA 1O6BA 1HYQA 1VQPF 4UD2A 2YIJA 1YBHA 4EUSA 1MJGA 3B3AA 2BF7A 3GT4A 4BV8A 3F78A 4GYKA 2GN2A 2FMLA 4QYIA 1BJKA 1L3BA 4DPLA 3ZMUA 2H92A 5H2FZ 2IC5A 2O3TA 2M6YA 2I6GA 3SR4A 4Z2AA 4HWRA 3V2HA 2WHYA 5HGXA 4JYYA 1G8GA 1MO6A 3TL2A 5EHXA 4JB3A 1FQOA 2H59A 3SBOA 3WYCA 3TIXB 5A5EA 5LUAA 5F1KA 4INPA 3TXXA 4FEGA 4FZ1A 3ABSB 2XMDA 1YL7A 3R5HA 4A8TA 2WBLC 6LDHA 1A9YA 4MUFA 4DW8A 4JI8B 2CMDA 3TIVA 2C5FA 2J3KA 4DSOA 1JZQA 3OFND 4XD7D 1HDGO 4KYVA 4KQGA 1R8YA 1L5WA 1CUJA 1Y4MA 4EJ6A 5AW6A 5FBQB 2RHTA 1E3EA 4II2A 3UK2A 4NWIA 3R3ZA 2F3QA 5LGUA 5JU6A 2ZSUA 5F64A 2FN9A 1QCCA 4ZWNA 1PUIA 3EARA 1GDDA 1QVWA 2ZGVA 1CERA 2W2XA 1RTTA 2IYXA 3IJEB 1XZBA 1D8AA 4FFNA 4JJ4A 3GIWA 4UQPA 2EEPA 1X13A 4R3NA 4IQ8A 3TOZA 3TRIA 4PQEA 3GFTA 2WIDA 3MEQA 2HU7A 1BJTA 2CVPA 5TVKA 3QTYA 1W2GA 3D3JA 1QVZA 4IOJA 4MAFA 3O92A 1EQ2A 5GTHZ 4ZOAA 2NO0A 5CP8A 1F9AA 3W9SA 3C85A 1TEHA 2Z4TA 4V0MA 5FOXA 2X8LA 1VYHA 2J59A 1PJ3A 2GASA