4TV8B

Tubulin-maytansine complex
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
428
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new tubulin-binding site and pharmacophore for microtubule-destabilizing anticancer drugs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 169
structure length 427
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4tv8B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4tv8B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4tv8B01
1TUBA 3JASB 3RYCB 2R6R1 3HKEA 1FFXB 5KMGA 2VAWA 4I4TA 3M89A 4FFBA 4O4LB 2RHHA 4O4JB 1TUBB 4TV9A 3HKDB 4O2BA 4O4HB 2RHLA 5LP6A 3RYIA 3WGJA 3HKCB 2BTOA 5LA6A 5IJ9A 3E22A 5JH7A 1W5FA 3E22B 3N2GA 4X1YA 5BMVA 4EI7A 4HNAB 4I50B 4U3JA 4X1IB 3RYIB 4ZI7B 3N2GB 4X1YB 5ITZB 4IIJB 1JFFA 5JH7B 5IJ9B 2VXYA 3RYFA 1SA0A 5EZYB 3UT5B 2Q1XA 4B45A 5MN4A 4FFBB 4O4LA 5EYPB 5LP6B 5CA1B 3CB2A 3JAKA 1W59A 5C8YA 1W5BA 3HKDA 4O4IB 3VOAA 3HKBA 4O2AA 1W581 3RYCA 2BTQB 4O4IA 4WBNA 2Q1YA 3HKEB 5CA1A 3N2KA 5KMGB 3VOBA 1W5AA 2BTQA 3R4VA 5J2UA 2XKBA 3JASA 5JCOA 4XCQA 5J2TB 5EYPA 5EZYA 5KX5A 5BMVB 4ZHQA 3V3TA 3C8LA 3JALA 3JARA 4DXDA 2RHOA 4KWEA 4E6EA 4I50A 1W5EA 5LXTB 4IHJA 4TV8A 5M7EA 3VO9A 4O2BB 4ZHQB 3WGLA 4X1KB 5J2UB 4EI8A 5CA0B 4U39A 4EI9A 4EB6B 1FFXA 4LNUB 4TUYB 5EIBC 3JAWA 4O2AB 1TVKB 4TUYA 5GONA 5IYZA 1RQ7A 3JATB 5FNVA 5LYJA 1TVKA 5JVDB 2RHJA 3HKBB 3RYFB 4LNUA 5JCOC 4IHJB 4TV8B 2VAMA 5CA0A 5MN6A 5CB4A 4X1IA 4X1KA 1SA0B 5LP6C 4ZI7A 1RLUA 2XKAA 4ZOLB 4IIJA 1FSZA 5LXTA 1Z5VA 3HKCA 2GVIA 5CB4B 4YJ2B 1Z5WA 4ZOLA 4I55A 5JQGA 4O4JA 3RB8A 5JVDA 3ZBQA 3RYHA 5J2TA 4WBNB 5GONB 3ZBPA 5MN5A 4DRXA 3JAWB 2VAPA 5LOVA 5EIBD 3ZIDA 3JATA 5FNVB 3JAKB 5LYJB 3RYHB 5LOVB 4DRXB 4YJ3B 5IJ0A 5C8YB 1JFFB 4EB6A 3WGNA 4F6RB 3UT5A 3M8KA 4I55B 5JQGB 3VO8A 3WGMA 4X20B 4YJ2A 3WGKA 4B46A 5ITZA 5KX5B 4HNAA 4U3JB 4F6RA 3JALB 3JARB 4O4HA 1OFUA 4M8IA 4X20A 4TV9B 4YJ3A 5LA6B 5IJ0B 1RQ2A 3VPAA 3N2KB 4I4TB 2R751 5IYZB
chains in the Genus database with same CATH superfamily
2IK8A 4KXRA 3DKKA 1QYVA 5HBRA 3X1KA 1NVXQ 1V96A 4QT0A 4P36A 1C30B 1R8XA 2LQTA 3AOEA 1GRJA 2ZUVA 3CLUC 5MHTA 3ERCA 3A11A 4O4JB 4E1BA 2F1OA 3E9EA 4Z2AA 2HHJA 3V7EA 4BFLA 1KY2A 1M4UA 1CR0A 1K88A 4H6XA 4P32A 4NZOA 1RIFA 3JVIA 1SN7A 3THOA 3HKCB 4FTWA 3UPUA 1WXXA 4B3SB 2XZDA 1PL0A 1QKIA 4HDOB 1JAXA 5CX1B 5IC5A 4CIWA 2XMPA 5CBHA 3JQ9C 3FAKA 4LK3A 4LX8A 5C8YF 3T3IA 2HLPA 1U5BB 2UXXA 2ZYGA 1FMCA 1TU4A 3P9NA 4JSRA 5DNWA 4P84A 2WIAA 2PUGA 3CCFA 3CYFA 2WVHA 3HRHA 4JOBA 3L4BA 4KGZA 3O90A 1JLHA 3R1IA 1CUDA 5EC2C 4PSVA 1TZ2A 2BJVA 1E7SA 2G0AA 3CLUD 3HUDA 3OFND 3WLNA 2WLHA 1L1RA 1L4UA 4J76A 5LGTA 2NYAA 2R66A 3I58A 1KL7A 1AQLA 4YIPA 4RADA 3FB1A 5HIJA 3OQNA 3OZVA 3A9TA 3G1TA 1C3XA 2H5EA 5TX7A 2VRWA 3G71V 4DQUA 2WWYA 3ZQ6A 1OWPA 1Z0DA 3AEXA 2QSAA 4JA0A 1WLYA 4AJ2A 3L04A 2DWDC 2AHYA 1XVTA 2P1ZA 3L7CA 3QVGB 3B12A 3ICXA 1GN9A 5E4YA 3RC2A 4D46A 2YWRA 1RKUA 4DXDA 2ZS8A 3BHMA 1Z74A 2BGUA 2ILTA 1QU3A 1XZDA 1G7SA 1JXQA 3QU2A 4PIPA 2QTVB 2CDCA 3AUAA 3JTMA 5CYFA 4AUEA 3U09A 1BIFA 2FW6A 2VTVA 4KQXA 4MRVA 1ZMTA 2ETNA 4ER6A 3AJAA 4BFWA 3RU3A 3KHKA 4CI0B 4P4GA 2L82A 4MP8A 4LJAA 3RSCA 4BW9A 1E3WB 3BVOA 3D01A 3AYZB 3PHJA 1XRPA 4CWAA 4D9GA 3AVPA 4G65A 3UGKA 1PK7A 4BGIA 1CC1S 5EUCA 4NXMB 2WIDA 1E0SA 3R9WA 1SHLA 1QO9A 4J7XA 1I6LA 3QEJA 2YUTA 1FCJA 3BB4A 3ZWAA 5DHRA 2NV2B 3C3AA 5CBFA 3K3WA 1RLUA 1U3LA 1Z7WA 2DU8A 4HMQA 3RRBA 3FY4A 4GE0A 4HYOA 4OK5A 5C5IA 1A7JA 4N40A 5L4SA 2XDYA 4JGBA 2YQ4A 3GEMA 1K7XB 4FX5A 4K0KB 1ZX1A 3E8MA 1IN5A 2CBXA 1T5TA 3MYRA 2QZZA 5KVSA 4UJ5A 1EHIA 3RTDA 3P9IA 3OUZA 3LDCA 1GL9B 1JQDA 1P1BA 2DF8A 4GI2A 5L3FA 1U02A 2AI3A 3Q9NA 4U9IS 2NU8A 1GQRA 1IXSB 2XECA 1WPXA 3IIJA 4MH0R 1IC6A 1J1ZA 1I5EA 4GGOA 2ID7A 5DHPA 4B40A 4ZQGA 1SCQA 2Q9AA 4E22A 2Q6LA 2YXEA 4OX9Y 1DWPA 4HAOA 3BILA 2V3WA 5IT9M 1WZCA 2Z4TA 3C43A 2FZCA 3IJ4A 3M8KA 4GYJA 3H9JA 3KZMA 4YMIA 3KJFA 1Z28A 5BSUA 2FZWA 2X6RA 2VWQA 1STOA 2CEAA 4PG5A 5EIWA 4FGLA 3H1IH 1F3OA 1JIJA 3GJ0A 3RUDA 2HJVA 5KQLA 3IJ5A 3ROPA 2J3DA 4ERXA 1SCJA 4LF8B 3GZJA 1VL8A 2XJ9A 1M2EA 2C82A 3COYA 4BZZA 3ZMVA 2ATIA 3DHYA 3OLCX 1U1EA 1Z2GA 4HAIA 4TTTS 3R6LA 1O95A 1RQPA 3DC2A 2GUZB 1DKPA 1GZ5A 1LI4A 1X7DA 2VSXA 4MPDA 2YIJA 3H8WA 3EIFA 1UL1X 2CSUA 1M8FA 1BWQA 1TOAA 2HCBA 3W7VA 4ZHSA 3PQEA 2VLIA 3A1TA 5F7ZA 3ROQA 4RMJA 5KUKA 3ONFA 1IM2A 3ROKA 1YBHA 2HA4A 2NXCA 3DLTA 5CFQA 2CFSA 2JEYA 5A3QA 3WGJA 1X1EA 2X9NA 1E3IA 3N7TA 3VR6D 5AW4A 3RIYA 5B1AC 1L1QA 3BDIA 1ISRA 1ORIA 3K35A 1ZUD1 1NULA 4EI7A 2IEBA 2QRHA 4H31A 4JZYA 2EKLA 2WPDD 4BY9D 5B12A 4CEJB 3D0QA 3RUPA 4JROA 1PZXA 1SQGA 4JP8A 1NE2A 3H2YA 4Y2VA 4BYGA 5L3SA 2BI8A 1H9AA 3RBVA 3LWPC 4UU8A 4PD4F 4KDEA 4IYJA 3GNLA 1HZZC 3G0IA 4RVOA 5B6JA 5CB8A 2WAOA 1K2VN 2G77B 3PXAA 4ONEA 3HY6A 1YD7A 2NZUG 2Q62A 4XPIA 2P2NA 3FCOA 4RAOA 3BY6A 1SBIA 1PJ8A 2WT9A 5JJIA 1QH9A 1ACLA 4XGIA 1N32O 3GP3A 1MH9A 3A70A 3DFZA 4A03A 2P6MA 1TM4E 4MVCA 2O8VA 2WAMA 1TGOA 2COUA 2P6JA 1WTCA 3I2KA 3OZRA 4QEDA 5EGSA 1CZRA 2X0NA 3C14C 3U39A 3TEJA 1L5FA 4UAVA 3AU9A 3HUTA 4M0EA 5KYUB 2JK5C 1K08A 4TRNA 3RVDA 2VJNA 1FP2A 1XJ0A 4ZO7A 5TMEA 3BSWA 1H6AA 5IRCD 2ZDGA 1O57A 3GEBA 5LXTB 3OBYA 2ZUSA 4B7EA 1DAOA 1MEEA 1PT9A 2P79A 3E03A 4P4SB 1YZFA 1PJZA 4QFDA 4RHFA 1AI7A 4WFHA 2WP8J 2Y1LA 4C7XA 4PWZA 5FL3A 4ZJYA 1JA8A 5FV4A 5B2ZA 2X3UA 1PP9H 4K35A 2XCRB 4MT8A 5AOAA 2JVIA 2RDCA 1JIQA 4KOAA 4DILA 1NMQA 4J0IA 2ID8A 4K9OA 1KDTA 3ZZTA 3UZUA 4D9KA 2CC2A 1Z73A 1HEUA 2C5BA 2C5AA 2R1TB 3C6QA 5KZMB 3PHBE 2OUKA 4PRLA 3LXMA 5JCOC 1H1LB 1NF3A 4MK4A 3MLEA 2PL9A 5IKPA 1A72A 3CGGA 1RQRA 2PX2A 2VWKA 1RFGE 5IT5A 2AYZA 2HSEA 3FVQA 4ZANA 2OYCA 5FUXA 4TKMA 4FFDA 3VBCA 3K0EA 4AJEA 4DGSA 1SQXH 3ZLBA 4CQLA 2AB0A 4P0TA 4J10A 2ZAGA 3IVXA 4CRWB 2H8CA 2CLKB 3MVEA 2D2XA 4G4VA 1E0DA 4V0KA 5F12A 2R6DA 3A14A 4FMTA 4X45A 3NHLA 4LMBA 4EG5A 3IELA 1GLGA 1N0IA 4TWIA 1W55A 3N4ZA 2GZLA 1E8MA 1QLJA 1U7DA 2FW9A 2ZXFA 2CFOA 3B82A 2Z08A 4CT5A 3GQBB 3G2OA 4J3FA 2PZGA 2VO1A 1VMDA 4GZ6A 3T7DA 3VGPA 5BMOA 3BEHA 3KT8A 3KJZA 1DKNA 4FOTA 5IDJA 4GVPA 4I99A 4Q4JA 2PFSA 4ESHA 3UV7A 1JEYB 3DDNA 2C5HA 5E6UB 3TXAA 1ILEA 1JJAA 1KS9A 2QTVA 2WA3A 1AN0A 2PU7A 1QGZA 4JC4A 4WW0A 4P0PB 4YMGA 1E5XA 1ZEJA 2IYXA 4WD3A 1K5QA 3HN6A 2QUIA 3I2YX 1XTVA 4HWKA 1EXMA 3R24A 4NYJQ 5BYJA 4C0SA 1ISSA 3CZ9A 3E18A 3QIAA 2VJAA 1P7VA 5K1PA 2FK7A 2XDAA 4C8IA 3C1TA 4UHCA 4BEVA 2JGNA 1G0OA 1E8NA 1OD6A 5C2JB 1AM4D 3LRTA 4M1TA 1KDYA 1NXQA 1FUYB 2RKBA 2YJ5A 3A9CA 1A50B 2HAEA 2WFAA 4CCWA 2VR1A 4U7DA 4M9SA 5U1PA 5AM3A 2BFAA 1K9MW 3F6SA 4JJZA 3CXHF 2JLYA 4JS0A 4O4IF 5FUBA 3P4YA 3UJ9A 4RS4A 4RCYA 4BRUA 2QTSA 1AHIA 1W6UA 2O0MA 3CV3A 4U3FH 2G09A 3DCNA 4I50B 2A0WA 5BSRA 3EOZA 4QD3A 5C3MA 5HKOA 3BHIA 2ZG6A 4NFLA 5BSFA 1QORA 5JASA 4YIHA 3E7XA 2J3JA 1V54B 4R6ZA 1XYYA 3G2NA 4J90A 4EQZA 1ZLXA 1BXGB 4CE6A 2BDUA 5HG0A 4JEUA 4JLKA 4LF4B 1DMRA 1E4OA 1Y9ZA 3OIFA 4F8JA 1HNZO 3HZHA 4BEWA 4WESA 5JSKA 1VB3A 1CJKC 1TA9A 1XTIA 3HDHA 2ZRIA 3M6FA 2DYKA 4RIHA 3TSOA 1J6UA 4B2LA 1W0KA 5DI9A 1N2XA 3KWJA 3U3XA 1YRYE 2J4FA 3AF2A 1VKZA 3VBEA 4N8SA 1OWOA 4AP6A 1LTKA 3VU0A 3BIJA 2XCIA 3PE4A 4MR7A 1ZJZA 5FOVA 1XYGA 3V4OA 2N48A 2DM6A 2GBIA 5KCMA 1SULA 2ZJYA 4OHRA 5C18A 3KVOA 2QN3A 3KYCA 5K8LA 2WD7B 2I9PA 3KHNA 5EPUA 1TTHA 3EAFA 3JWPA 2IHTA 2RCYA 4Z1MG 4B09A 5CCEA 4UJ3A 2BH2A 3FETA 1XMOO 4REMA 3V5NA 2ZU0C 1JHUA 3S5JA 4JY7A 1Q83A 1TMKA 5KWJA 3RC9A 1L5OA 1SWVA 2ZIGA 3L8ZA 2XGJA 1CJSA 1E61A 3ODGA 2ZIAA 2XT6A 1SC1A 1KP2A 4WLUA 2XZPA 4Z9AA 4Q5IA 2XX3A 1JFVA 3NNDA 4NV1A 1IY1A 4I7ZB 1TIPA 3IIIA 5AKGA 1DXYA 2O5CA 1ZGZA 1M2FA 2UYJA 3KQOA 4QYXA 2FFJA 1B0AA 1C4XA 3B6MA 4M99A 3MHTA 4MR9B 3QX7A 5DNDA 4CS4A 1PV1A 3DLPX 3DBLA 2FUG1 3C87A 5COBA 4DXAA 1Q16A 3TZCA 1L0NH 1EE9A 4ZAWA 1O0BA 4Q02A 1DCKA 3LQ2A 3TIIA 3ILYA 4PZ0A 4TL6A 1VA5A 4Y7CA 4IHKA 4POAA 3BA8A 1XQXA 1P73A 2P6PA 3R3SA 1IN4A 3YASA 1DUVG 4G97A 2FF5A 3WWZA 4UVAA 2C61A 1RP1A 3JWEA 1ZY2A 1QK4A 4F1WA 2Z56A 2ZEJA 3O8DA 3C9UA 2VXBA 3Q12A 5EAZA 4OJQA 5TR9A 3OZXA 1L5QA 3ILVA 1LDGA 2R5FA 5A04A 4H18A 4G0OA 1QQCA 1KVRA 1TYCA 4B9EA 1SF9A 2P6OA 1JQJC 4MVJE 5F7JA 4OK3A 4JLPA 1HDYA 2Z0AA 3CMMA 3IAAA 3JR3A 3PPWA 2QTLA 4WLNA 3UCXA 1IBSA 1X77A 2XA9A 3EA0A 1TZKA 2F64A 2RH8A 1OKKA 5CVVA 2Q6KA 4EPWA 3H1AA 5BUZA 1W44A 3ND7A 3MBOA 3QELB 2GEJA 4RQTA 3TW6A 3SC6A 1Y9DA 2JFXA 4IIXA 2N1BA 5KWSA 5KMGA 1HETA 1AQ6A 1OZFA 3K9GA 3PICA 2IA5A 1U0OC 4OU5A 1RWOA 3N8DA 2K1EA 3F4KA 3FF1A 3OKCA 1L5GB 4DLVA 3OX4A 1F8FA 2ADMA 1N0UA 4CKCA 4ERNA 2XOXA 2PMCA 2F8LA 5BSHA 1VF5B 1UZLA 4ZEWA 2QXTA 1U3GA 5JSZA 5KNBA 4Y3UA 5AW8A 1CIJA 4KQ9A 2B7LA 1UZNA 4Q66C 1OASA 3VTIC 2VJQA 2GZRA 3HGTA 4OJNA 4XPZA 4D6XA 3IJPA 3U4DA 4QHYA 2QGZA 1QR2A 5IH3A 3KIZA 2EJWA 4W5QA 1U3VA 1YR8A 4GOND 1SQSA 2HA0A 4JLJA 5E2BA 4B5CA 5IN5A 1W59A 4MQEB 4YH1A 4Q3KA 5CCXA 4LOKA 4J4HA 3VI6A 4DV2O 1EJBA 2ATXA 2PF4E 4AYXA 4N3CA 4CF5A 3THXB 5CB4F 2OORA 1YIAA 2H1LA 3ROFA 4EKGA 4GEKA 3THWA 5CEEA 2Z43A 4LH6A 1R0ZA 2RB9A 2ECQA 4JH0A 3VPAA 1CUWA 1X38A 4EX7A 4CETA 4ZI3A 5FFNA 2ILVA 2WJIA 4LWPA 3NCTA 1P1FA 3RUAA 1XELA 3DOIA 4PO9A 2A35A 3C6KA 2HFJA 3A1UA 4MDHA 1Q92A 3EQ2A 3GCDA 3TMAA 3C8HA 3MG9A 4PHTA 4FBLA 5I48A 2ZUUA 4DLUA 1URPA 4RQUA 4UMEA 3WMWA 1JBEA 1VP3A 5IS2A 4NQ3A 5EGNA 5K3CA 4OI0A 1U0GA 3GRVA 3QE0A 4Q37A 1SKYB 2VHZA 4CIYA 4RHCA 3VX3A 3LNMB 5B3LA 3BMOA 4UQPA 5I7RA 1UIRA 3PXUA 3QP9A 1H2HA 4F4LA 3URMA 1IVNA 2AMJA 4ZBMA 1RHRA 2W71A 3JYLA 4PHGA 5C37A 3CCUF 2EBHX 1SA0B 4MKFA 3V7YA 4EHFA 5A2GA 1LC3A 1IEXA 2B1IA 1SC5B 4GI7A 5ITSA 5GIPE 3U0VA 5E6SA 4WOCA 4NG4A 1XZJA 4L3WA 4M60A 3VU9A 1RJEA 4GXQA 4MVUA 4HLCA 1M0EA 3EVEA 2XCLA 1Y6XA 1N6OA 1Y4SA 4RJKA 2KQXA 5JJNB 3CXRA 3RHZA 3AEUA 4LHSA 4GMXA 3ZNNA 3FDXA 4OXIA 4XVHA 5EBMC 2Z9DA 3D8RA 3I7TA 3K1JA 3ZIAD 4PONA 4M21A 3R4CA 4QGBA 1SXPA 2YIVX 4X64B 3CZ4A 5AWFC 3SEZA 4AN0A 2ZIXB 2JANA 4LZLA 4QRIA 2O7NA 1W4LA 1E79A 3LNCA 4FQ7A 4N82A 1T9GR 4AWAA 5JXIA 5DCYA 3JQGB 3OM3B 5ADVA 3HFSA 4XIIA 1G1AA 5A9SA 3BQ9A 3B8EA 1E32A 3OTWA 5IDXA 1OBVA 2XGMA 5EWLA 4CMEA 3NIFB 2I99A 1ZN2A 5EWLB 1T5IA 2X6CA 1ZH4A 2WJPA 3BWDD 3DC7A 3GG2A 3GROA 3LLCA 3PKIA 4GAEA 2WWWA 5FWXB 1FSSA 8MHTA 4DNXA 3BMQA 1N2ZA 3LCMA 5FR2A 4DREA 1KDOA 4PC6A 4ZDWA 4DHWA 4R31A 5G40A 1NASA 5GIOE 2YWHA 4ND3A 2RBEA 1KRHA 4JVSB 3EQ9A 5B66Z 2HK8A 4LYDA 4M22A 1B93A 2MYNA 4ZU3A 1X3LA 3M70A 4LOJA 1I2ZA 4MRNA 4BNLA 1QF7A 1KETA 1ZK3A 4RANA 1GGKA 1PSWA 4G0ZA 4OM7A 1KBQA 1SR8A 4W7SA 2G9NA 3VQTA 4J6EA 1BGXT 1MA0A 1RQNA 3C45A 5LA6A 5LMUB 1IDOA 4UB6Z 2DHCA 3BULA 4N3NA 2Q7OE 4M6WA 3COPA 3KB8A 1C1XB 1WSWA 3PUJA 1SBQA 5BMVA 3EIEA 3SKVA 2O8BA 1GO2A 3PI6A 1UOPA 1N2GA 4NTWA 2QRJA 4F3RA 5J43A 3IKEA 3L8GA 1K4MA 3NHUA 2IJJA 1YRWA 2OXIA 3C3XA 4GKVA 1EVIA 2DSNA 1PQPA 3LC1O 3ZWBA 1NXWA 1JHVA 1VQ5F 3BHPA 1T8PA 3PA6A 4GM1A 4KE6A 1XTBA 4Q4AA 4C22A 1ZM9A 3HBAA 2HR3A 3LLUA 4QUIA 2KPOA 1QCZA 4MW9A 4YA6A 2FR0A 4QSHA 4B47A 1B73A 4EBFA 5U4XA 4IHJF 4Q7JB 3EEYA 1T15A 2GZHA 1EA5A 4ICGA 4Q9AA 5FBVB 2TMDA 3EHEA 1GO1A 4R0NA 3SR4A 2AR9A 1WLSA 2ZLBA 5A4KA 4IILA 5DP1A 1I3LA 2PHZA 4YP7A 4JWTA 1HV8A 1V47A 2RGXA 4G5YA 3H1JH 1ISJA 2UXBO 2J33A 3BG5A 1CHNA 3F1LA 3N2EA 2O2IA 1UWVA 1GITA 3EXHC 3HZOA 3KCNA 5KJ6A 2WAXA 3GT3A 4OFXA 1GR1A 3DMTC 1KQNA 1T24A 3K72B 1FNSA 1YZLA 4QTUB 5I8WA 1UAGA 1V37A 5FADA 4NS4A 4E5MA 3H9UA 4N8DA 1UEXC 1PFWA 4OFWA 3OJWA 3P45A 1NLUA 1E79D 3KTAA 3UM9A 4RFSB 1V1MA 2QWOB 2JK0A 2P2YA 3UT0A 1POWA 2OZBA 2IGBA 3FZEA 4GNKA 3EGXA 4UBKA 4QJBA 4YJHA 3V32A 2QD4A 4IV8A 5JXHA 1Z4MA 3S7ZA 3HNRA 2NUPA 1Z68A 5BVGA 1FD9A 3EFOA 3ZY2A 1ULBA 1US8B 3D3IA 4FZ5A 4KWIA 1WVGA 2PX6A 1F12A 2HL6A 3J80N 1PGJA 3KBBA 4QL3A 1KHHA 5HIAA 1P2FA 2WUEA 3K9CA 5T64A 3PDWA 1I13A 1RJ9A 4Y2XA 4ER7A 1HEYA 1VPVA 2GD1O 1VE9A 2WPDG 3AUTA 3QG5A 3D4PA 3OA2A 1HR0O 2JAWA 2HK7A 1N75A 4XM2A 2F8TA 3H1GA 3LLVA 1JG7A 4G0WA 2X4GA 4CDRA 2IUFA 1B76A 3L93A 4JI1O 2AN9A 1YTFB 3P5BA 3PX7A 1VG8A 2OENG 1RJWA 1Q44A 2QR5A 4EJSC 4Q1FA 4DR2B 2WJ4A 2DKFA 2G9UA 4FDLA 4DRXA 2QZJA 4REQB 5AMXA 5AKIA 3PDHA 4F85A 3V4LA 2XEDA 4E7PA 4W9MC 3TZKA 1RW4A 3NHRA 2X9QA 4AW9A 1UDBA 4G5XA 3CLRC 1JHOA 3LCCA 4AVYA 3FX7A 1OBOA 1TL7C 2Y4TA 3SZOA 2BYTA 1G19A 1UC5B 4GEGA 2OQVA 1D7OA 1NMSA 2O2DA 4OYYA 3VMFA 4AF6A 5I47A 2E37A 2QD5A 3LT0A 4FXOA 4ON9A 2ZWVA 2Y93A 2JGDB 3STVA 2XZLA 5HK8A 3QVLA 2ZCVA 3E3NA 3H5OA 2JGIA 1LKZA 3HYSA 3OFSA 1FNKA 4F8EA 1GU7A 2HU2A 4DCUA 2ECOA 3PEFA 3RK1A 4YAKA 3EEOA 1IRXA 1SCBA 1YQTA 2O1WA 1FDRA 4ENQA 1I0HA 3CLSC 3W8DA 3HDQA 1LBHA 2HSZA 1YJ8A 3N05A 4HNQA 4XPIB 4PNPA 4BMCA 1ECBA 3NWOA 4Z7OB 1DBPA 1KO1A 2VNKA 3DF9A 2OXFA 2QDKA 3NBYC 4NV0A 4RLHA 4ZQFA 1SPXA 5ENZA 1T9GS 4URUR 1RYDA 3NGLA 1E18A 4US0R 4DFDA 2IH5A 1EFPA 1U28A 1U04A 2AKYA 1V8OA 4NICA 4FMCB 3ASVA 5ALNA 5A0TA 4G27B 3K8OE 1GCOA 2X8BA 4GUAA 2K6GA 3V1LA 1JN1A 2ORYA 2AFHA 3K1ZA 1AGXA 2NNWB 3CW8X 4RKFA 1W29A 3EY9A 1KPGA 3H6KA 4KR2A 1Y1PA 2HXYA 1VBFA 4KRFA 2PWBA 4FDVA 4MYHA 4R01A 2IF2A 3LPAA 2VTBB 3HM2A 2NT4A 1W48A 1Y1RA 4IGAA 4C7BA 2I0FA 5IX8A 3D6HA 3H13A 4OL0A 1EFAA 3IOCA 5HFMA 3GD7A 2F8SA 1I6KA 1P2SA 4W63A 4XSGA 5GPBA 4BP1A 1E3SA 2CK3G 9LDBA 4EGSA 2BOBC 5EBWC 2ZRNA 1D9ZA 1NM5C 1Y6ZA 3ORRA 5A03A 1WAZA 5TISZ 3DOCA 2LKCA 4TZZA 1E92A 2Z3YA 4QYMA 3ZZNA 4AO7A 1POXA 2ZVDA 3RS4A 3UNXA 2XSZD 1TKBA 2WE8A 1EN6A 4GVXA 4DC1A 4EVIA 3I5YA 1B8VA 4XLTA 1QP8A 3WHIA 2G4CA 2Q4DA 3ACDA 2R1ZA 5DTQA 2NTJA 4HXEB 4B8YA 2V9CA 2OAP1 4PAGA 5I9SA 2C2HA 4JOCA 5EWMA 4ZVTA 2I3ZA 1YDXA 2WSSG 2OFFA 3WYDA 3H2ZA 1Y9JA 3MINB 3CJTA 4MS3A 3TUJC 5FUQA 2C5FA 4QJFB 3VPGA 1U8AA 2Q6AA 4AMUA 4CMIB 4PFJA 2VHJA 3ESYA 3Q8XB 5KTMA 3JRWA 1E59A 1EHCA 4J0QA 2BFNA 3S1SA 3J81M 3IUPA 2KG7B 1SVWA 1XBTA 2YYSA 2VGMA 1TUEA 3NTRA 4EG4A 4X8MA 1M2HA 2NTEA 4AB1A 3A2MA 3E48A 2BEUA 2PKRA 1I7LA 2VAXA 4ETWA 3OO0A 2W22A 1LX7A 1XTRA 2GHYA 3I5XA 2UUBB 5LDDC 2BIFA 4XX0B 4CF7A 1ZGJA 1VQMF 2O14A 4X65B 3FVTA 5AJYA 5HRCA 2JJ2D 4Y0VA 4OXNA 4IEFB 5DIFA 3DLCA 1GDHA 1SQFA 2Y0DA 3C70A 4V02A 3AF3A 3JQ6A 3OQIA 4GKKB 4NYMQ 2IV7A 4AJ4A 4URYR 4NX2A 3PIIA 1O5IA 4XM0A 3RYHB 1PJ2A 5JEEA 2REBA 4GL4A 1Q22A 3E6AA 3QVMA 4KUGA 3Q9SA 4OMFG 2DSTA 1XKTA 5L3SB 4BU0A 4WF9V 2C8LA 3AF0A 3GOHA 1Y4ZA 3RV3A 5G3ZA 4EYEA 2QR3A 4PZ9A 2ZT6A 4I9HA 5HKAA 1Z38A 3D7SA 4Q9NA 3TTVA 1SZPA 1BEUB 1Q1NA 1I2DA 1W87A 5H6QA 3L1JA 4MV1A 5DGTA 3AK4A 3KUCA 5L8VA 2Z4RA 3FR7A 4HX5A 3LI2A 5E9JA 2IBTA 4PAQA 4DRZA 2V6MA 4HQ0A 3ZX5A 2H31A 2ZVZA 4B2IA 1YBMA 3DXRB 2QP9X 2GRAA 3DDZX 3WYCA 1VOTA 1QIGA 1VYHA 3ZCSA 5GAPK 3I39X 1QV6A 4OHYA 4MROA 2NT3A 1Q91A 3GVCA 4XD2A 1X7ZA 4LF9B 4JPRA 4B3JA 1UBCA 2GK4A 1THZA 1H0SA 5FPTA 2BGWA 1ZBQA 1ZP6A 2JFQA 3HVIA 2OCBA 1X1AA 4XM1A 4UXNA 2G8NA 4GU5A 3VNBA 4EELA 4F4JA 5HZKA 2AZTA 2ZTLA 1DS6A 3FYTA 2DH6A 2H2AA 3SLKA 2IOYA 3WLMA 1DC8A 4LJSA 2WBLC 5AVZA 2I1QA 2OZKA 3OW2F 1BW9B 1T10A 2F1HA 2P30A 3G0CA 3MIIA 3OC6A 4XW2A 1C1XA 3UMVA 5KTOA 3HHEA 5KYYB 1AZSC 3G02A 3HBNA 2ZODA 2Q0AA 1VJ0A 2KE5A 2PWZA 1DFIA 2XYVA 1E9EA 5EKXA 4P08A 2CJYA 2P5UA 3A9SA 4U5XA 5JS1A 2VQEB 1DADA 1XZCA 2WLIB 2ODPA 2HRBA 4D98A 5GJBA 1HLPA 4QDJA 3HJAA 3NOXA 1NBWB 1U1CA 1QTNA 2WMYA 4UDYX 2IJKA 4WBNA 1JR4A 4W1RA 2QTNA 2PD3A 2I1VB 3G8DA 3JY6A 3QX9A 2IU6A 4UE3S 1HLFA 3CSXA 1NNI1 1GYQA 3D2LA 5E3JA 2AEMA 1FA9A 1L3BA 1JG6A 3T1YB 5DOZA 1KDPA 3CPJB 3DMPA 4R9UC 5SY9A 5HUJA 1EBFA 4DLYA 3MOIA 3NATA 1JDNA 3MJSA 3MWDB 5JSQA 1QCCA 3AM4A 4GZMA 4N9WA 4RF2A 1NXXA 2RDMA 1VI6A 2FEOA 4IOMA 3U4QA 4TZTA 1JAYA 5B1SA 4GP6A 4P3XA 4X1KB 5H59A 2YOHA 1TTQB 4CKBA 5ELXA 2KKWA 3V8MA 3U44A 1YHYA 1COWD 1SD5A 3MSXA 5JD3A 3HA3A 1OXVA 2ET6A 3L7DA 3T0FA 1LFAA 2OG1A 2P6NA 1DKOA 5EE5B 5FUYA 1RLGA 2Y48A 1VQ6V 3S3XA 1H22A 3HU1A 4CIBA 5DEDA 2PKXA 4D82A 1PYOA 2HJDA 2Q2WA 3AC0A 3PVSA 4F8YA 2H07A 5JISA 3KJQA 3RKUA 4XJSA 1H2ZA 3W9UA 4DLLA 2YFKA 3MAQA 2XT0A 4EG3A 1X7GA 1PD0A 4X44A 3DO5A 4BX8A 1EQUA 5JWRA 4IUYA 1P0FA 5K01A 2W2KA 2AMTA 3SX2A 1AMUA 1SKUA 3N27A 3P8ZA 2XWSA 4C29A 1M7GA 2PWAA 2WF5A 4NBNA 5KHOC 1KJNA 1H5UA 2F3UA 3BXGA 5GJCA 3EMVA 1T1RA 4LJ6A 4PYKA 3T5TA 2RMKA 4EPYA 2Z1FA 1ONPA 1GUFA 3CCRV 4UCRA 4PLPA 3CWCA 3TRDA 1X6VA 4HXFB 5IY5B 1E4EB 1M2JA 3E27A 5CPBA 3V4PB 5C51B 1CLUA 4WACA 3PZBA 2EC5A 2GH1A 1JU4A 2REOA 5LOVB 1A1SA 4KQHA 1Y67A 1T25A 1EK0A 2BFPA 2LIPA 2Q4BA 3EXG2 2B8TA 2WP0A 4ANFA 1MT0A 1DQSA 2PS1A 3AL0C 1VHAA 4HNUA 3CNEA 3GELA 5B4UA 2AA3A 4JYCA 3STZC 1QVFF 2I6QA 2Q1UA 1BL8A 3T06B 4F5YA 1T4CB 1Z0SA 2Q1TA 3GBSA 4P31A 3S27A 4AMZA 4QPZA 1L7MA 3GP8A 1V5WA 9MHTA 3RKRA 3O21A 3ZCUA 5IANA 1R16A 2AFIA 4CQNA 1XP5A 3H9CA 4F38A 1QYWA 1TC2A 3WP1B 5I4KA 4A7PA 1HL3A 1OC2A 1Q7GA 3R3VA 1GN2A 5FWAA 3V4ZA 1HDIA 2WTEA 3GRRA 3L05A 3N2YA 4B7KA 1C30A 1MFZA 2WV9A 4IJ6A 1FVXA 4N9QA 1FRVA 3ZE2B 3S3TA 2XQFA 4MP3A 4RZXA 4DNPA 1MB0A 3JYNA 2ZBDA 1ESCA 1WHSA 4K6FA 3S40A 1CFZA 5L7YA 2D1QA 1WP7A 2PBFA 3OBIA 5F2VO 2HDNB 2QUHA 1QX3A 2X0DA 3M4ZA 3LW8A 1NP6A 1RKBA 2ECKA 2G9RA 4I0XB 1SOWA 4HQKA 5BNZA 2F4VB 5I3CA 2F1RA 2KYRA 4QA9A 3ZLTA 2C7RA 5LKRA 4A1FA 4RF3A 3QE3A 4LGMA 1L8XA 3UFXB 5A5DA 1YZQA 4LP8A 1ZXXA 2GM9A 1EFHA 1KO5A 5LMNB 1JHAA 2WA1A 3T7KA 2XOKG 1DDIA 3OKPA 4B4DA 2CFTA 1PR3A 1XFDA 3E5NA 4JLNA 3PC7A 1SVLA 4YAFA 5LLSA 3O1LA 4HQFA 4ZJZA 2ZXEA 5FWNA 1CUGA 2JI9A 5B36A 3FLEA 4XXHA 3OTOO 1A98A 1T29A 1FU4A 3FKSD 5BW4A 2HLDD 3H4MA 2RH5A 2ZQ5A 2C7PA 3N3AC 2Q6TA 4HAXA 3IVAA 3O3CA 1AF4A 3ZHCA 2AFHE 3IT2A 2HQRA 5DO9A 5EWJB 3STLC 5KYVA 3TMKA 1JJ7A 3PK0A 4RK1A 4PRYA 4E08A 4YUXA 1QLHA 1UCFA 3ASNB 3ZWPA 1ETUA 1LJLA 3OEHG 1OWLA 1JR9A 2YXZA 2H2DA 1V16B 1P9OA 3H16A 2B8EA 2KTUA 2C2WA 2CVPA 3CYPB 2GBFA 4FFMA 3LHSA 1LC0A 2L35A 4UCSA 1NMZA 2WV7A 5FPRA 2E3JA 4LDRA 3UKDA 3A8TA 1S4QA 1OR8A 5J58A 5HFLA 4NHEA 1YF3A 2DUNA 1KI2A 5JQWA 5SY4A 1Z62A 5IBQA 2WK1A 3ESBA 5J2UB 3FUVA 4PVCA 4OX9O 3CVJA 1DBQA 1VBMA 1WBDA 3W8NA 2WEKA 4B4KA 1QH1B 4QXQA 3U7HB 1Z4IA 1AT1A 5T7BA 2OP0A 4YY3B 1FFAA 4BO7A 2CFRA 1CS0B 1MO3A 1H2YA 1CN7A 2GZAA 1YKGA 1DPFA 5FV7A 2NO6A 3U4HA 5KU7A 1OBCA 2RB5A 5EUQB 5JVDB 3SYOA 1JB9A 2PTHA 3WL6A 2LBWA 4WRRA 3K5NA 4YT8A 4DCNA 1EU1A 1Z0JA 4IMPA 4FBGA 3BREA 1WSDA 3KKNA 1QVZA 3KAQA 5DF1A 1H38A 1PWZA 3NUZA 4LJLA 5J9PC 1COWG 2IZZA 2N75A 1IEQA 4QDZA 1ML3A 5EHIA 2FPPA 4DYVA 4E5YA 5BP7A 1U3FA 1UH5A 1U9ZA 2IPAB 1HNWO 4MHSA 5DE3A 4C0LA 1XWWA 1J1IA 4IV0A 3FTFA 1TYDE 5AJUA 1JQLB 1XD8A 3BXXA 2INGX 4HEHA 4I5GA 4JCCA 4Y1RA 3UMJA 2YIMA 1H1DA 2NNLD 1ATZA 2VPYA 5AW3A 5I4CA 4YS6A 3FX2A 5EJMA 1S3IA 5BN1A 4FWTA 3LYBA 1OWMA 1TB4A 5D00A 1RC0A 1L8LA 1YNSA 4O4HF 2QJTA 4IUBS 1C41A 1M0TA 4GP7A 5JNVA 2I4TA 2JGAA 3VU3A 2PSFA 1UBHS 4LAFA 4S35A 2CN1A 1XZ8A 3TXYA 2H92A 3AG4B 3KFLA 4MVJF 5IDYA 3SBEA 5KHHA 5KAIZ 2HYDA 3JQBC 2Y1GA 4RF5A 1KY4A 1YA4A 4ZDKA 4Z1VA 1N1DA 3QXJA 2MSCB 4HKTA 4FI3C 4IZOA 4A82A 4OIMA 2VRCA 4NMXB 4Z9YA 3R0IA 3VV3A 3FYUB 4R0MA 3U16A 3ICQB 1DF4A 1XBIA 1JXOA 3VV2A 2JBWA 4QUHA 5AOVA 3C5EA 3W5UA 4DSOA 5FOQA 5K03A 2FR8A 1XDWA 3HYTA 4NNOA 4XIGS 4X60A 4YMSA 3ZHYA 4DWJA 1J7JA 2B4QA 5FO1A 4M9UA 3RYCB 4EYKA 2FFAA 2UYNA 1MOPA 1L8DA 1F06A 1FK8A 4QOFA 5TGTA 4E2LA 1SC3A 3S2EA 2Q5HA 2O8CA 3QPUA 1IM8A 1MVOA 4WKPA 1Z7YA 3MS7A 1MO5A 4JN6B 2WLIA 2MQEA 4B3HA 1EB8A 2HHLA 4DAEA 4G85A 1PI3A 4K9RA 4RK6A 1U96A 3VR6H 4CPDA 3JAMN 2HQSC 4F04A 3KQNA 1YS4A 2C58A 2Y05A 1KA9H 3VNRA 2E85A 4NVPA 1J33A 1IZ8A 3H9EO 3IIMA 1DMSA 2IPLA 4MKRA 3UHJA 2DEUA 3ZP7A 1R5NA 4UHHA 2VXYA 5KTRA 3ZLJA 3G6EV 1U2DC 2G25A 5JALA 3B20A 3CRMA 3BRCA 5LKAA 3UGQA 2VQFO 5ALLA 1SZDA 3KG2A 2O8DB 3O38A 2NXNA 3IUEA 2OKGA 1W1IA 4MS2A 2X0LA 3TLBA 1EGMB 1SK9A 2NAPA 3R4VA 3SZUA 2RGWA 2JDIG 4JAVA 1JUDA 4ZHYB 3C6ZA 1MQSA 2AJTA 2VDKB 4UU7A 4JIMA 3SG0A 1L5NA 1W2BU 4H7JA 4DNOA 2IX3A 3L84A 3KR2A 4UCWA 3E8BA 5ALVA 3TX2A 1C7EA 1RD4A 2VCYA 3FCSB 2BZGA 2O1SA 2QD2A 4LYYA 1T6XA 4OIFA 5CP8A 1PO7A 5D6OA 3VR2A 4C3ZA 5T6BA 4Y2RA 5JAMA 2DULA 1A8SA 2FUCA 2XQKA 3AV3A 3L7IA 4LY0A 2CUGA 2IYOA 1UBRS 3AHGA 3F96A 2C2ZA 4C4WC 2W2MA 1JALA 2Z0MA 3HDJA 5KQPA 4WCDA 3ZQ4A 5KHLB 4L87A 1IUNA 5C1PA 1VPTA 1QAMA 2DERA 1BS1A 5DEOA 3CCVV 3ZCQA 4KITB 4LJKA 1BE0A 1VLJA 4F56A 1G55A 2UDPA 1Z88A 1PXWA 3FWNA 3JAMM 1X7XA 2H7VA 3I5UA 3KZCA 2BM0A 3QVUA 5DU2A 4UMDA 4HCJA 2J9XB 4F72A 4LSGA 2XWBF 4B7XA 3GEHA 3IBGA 5EIAA 3G49A 2VUSA 1Z07A 1E3QA 2HLHA 4KLNA 3I6BA 1IPEA 5ESXA 2O23A 5IF3A 1R6NA 1QIEA 1XWFA 1YHNA 2FRXA 1FXWA 4J16A 1W88A 1VMGA 3JQ7B 3U9SA 1I4OA 1W9MA 4GMFA 4G2KA 1FMTA 1WX1A 1Z4NA 1IQUA 1FU8A 3PF9A 2I2BA 3GUHA 4ALJA 5FDFA 1BVRA 2OLEA 1GZ3A 4KP4A 4DG8A 2EX4A 4GC5A 2BGKA 5J1SB 2IE0A 3JWGA 2R7LA 3LWVC 2IP2A 1F51A 1P62B 4GDMA 1CUYA 1AK1A 4X63A 5CVEA 4A91A 2Z8XA 2VZ8A 3SDSA 2V9ZA 3K0AB 3UWMA 4TQ9A 4MS3B 1GO3F 2XTZA 2A4MA 4GX1A 1AMOA 1JSZA 4MKZA 3WNDA 4DJAA 3ML1A 4U2KA 3OCCA 1AKMA 1J8YF 1G42A 1QBGA 2OZLB 1AB6A 3C85A 4YRAA 2YWGA 1T9BA 5AVMA 1RLIA 2F4VO 4P4SA 2O52A 5FBZA 4ZVPA 3SEAA 5AW6A 5C46F 1IVYA 2XHZA 1OREA 4A0RA 4X00A 2ON6A 3CF0A 1NLMA 2JCBA 4YALA 2GKSA 4JI1B 2ZJFA 5ALQA 4HRXA 3ABMC 1DEXA 3RRJA 2VQ6A 4Q9IA 3R74A 4EO9A 3B51X 1PJ4A 5IPFA 1WHTA 4FMCF 2Q3DA 3HR0A 4DV4O 1FNNA 2I22A 1FQWA 4LTNA 5COQA 3PC3A 1LLCA 1I24A 4UCVA 2FEKA 1HDEA 1T5LA 2DCMA 4B6EA 4FB5A 1COZA 1BAPA 1MA3A 2IDZA 3O26A 3PTLA 2FP3A 3HU3A 4IOLA 4KXXA 4TWAA 4CQMD 4UBNA 4UCUA 1T2AA 2IPNA 3VSDA 3C7KA 3NHKA 1X7HA 2JBAB 4Q7QA 3ANXA 4RNCA 5DLYA 5D5HA 3BSSA 3T1TA 1UQUA 4OXXA 3ZIAA 5FNZA 4PQFA 1Z6ZA 3OQ6A 3ZY6A 2TMKA 3QEMB 3LKVA 2XZOA 3TW8B 3KXLA 1GO0A 4I1IA 4RF4A 2RK6A 3D1LA 1OXMA 4FFBB 2Y6VA 3HR8A 3RV4A 2W8BC 2AE2A 1I4DD 2PNJA 4CBCA 1CQJB 5B8FA 5DV9A 1CRZA 5DLPA 4JI4B 3WLJA 5IEJA 3MA0A 3KVVA 2EERA 3R5JA 1EZVH 4LXHA 3CG0A 1UBGA 4GUNA 2BM8A 3B6KA 4M0MA 1XVVA 2FMXA 2FX5A 4BO0A 3ZV4A 1SCAA 1MO6A 4AKSA 2WTMA 2XA2A 3H9QA 1RZUA 3I83A 3JR7A 5KUTA 1A88A 3RROA 1JI0A 2AEJA 4LDNA 4JYPA 5BMVB 1P0QA 1YFJA 4F97A 1ZSPA 2PVCA 2NO1A 1E5TA 4RWEA 3B5EA 4G0YA 1ECPA 3PFCA 4OG2A 1H8EG 1FRFS 8ADHA 2X40A 2P9JA 4UTXA 1KOFA 3AR2A 1PNQA 1IQPA 4OQEA 1CB0A 1N6NA 4MGHA 4ZVMA 3H1TA 4IVPA 3SHTA 5D3QA 1RTTA 4YUYA 5IFLA 3KSMA 3TCKA 4LZNA 2PE5A 4DJDC 2Z6QA 2FN9A 4IZHA 4B8ZA 2J5QA 1IQRA 5JXJA 3NV9A 1RQ7A 3B2EA 2CGNA 2C4NA 1QUEA 5IHXA 1F8UA 3IR5A 4BVTA 4CM4B 3EVAA 3CYQA 2RNBA 4HXYA 3QF4B 3GJQA 2PKQO 1P0CA 5B1DA 4UAUA 3MWEA 5EWMB 1Q3EA 1HNNA 3NW9A 3KJJA 1BGYH 4IIJA 1GQ2A 1UJWB 2CSXA 1NTKH 3UN1A 4FIPC 2PDAA 3GRAA 3HJFA 1Q1EA 1SGWA 1ESMA 1Y4MA 1H8EA 3U3OA 4QPJA 3UJ8A 5K7SA 4KLAA 5KYGA 1U40A 1PS9A 3WICA 4DSTA 5B37A 1G7TA 2XGOA 3FFXA 1U3PA 2WM3A 1R18A 4INOA 2JLAA 3RN4A 4KMSA 3ZVNA 4X6XA 2I87A 2CE4A 1M76A 2Z2KA 3ACCA 3CRAA 3VJKA 1SVNA 1X7YA 3I53A 4PLTA 3BX1A 4PWYA 5JMPA 4DIMA 3QSYA 3L7MA 4FM2A 3ECSA 2FSSA 3IERA 3S2GA 2VZ9A 4FEYA 4TM7A 3BWVA 3HP4A 2IPMA 2GJSA 1UUFA 2CCKA 2OQRA 3BFXA 3K73O 3G1WA 5IJ0A 5AHKA 1FFTB 5HIMA 1U97A 1CU1A 2PYDA 2WHYA 4UVGA 4UTPA 5IZCC 3L6DA 3WGGA 1Y4AE 2ZXWC 5ALHA 4BNDB 1KNJA 1P45A 1U6IA 4P2ZA 3ZW9A 3P3PA 1VDZA 5AHOA 5DNAA 5AVKA 2ECPA 4UVBA 1NJ1A 1X1BA 1Z4PX 3ANMA 4CLXA 4EGAA 5L3QA 3UMFA 4WXMA 4UTRA 3C4QA 2Y71A 1A9YA 1VDMA 1OE0A 1FNBA 1VCNA 4FEAA 5HIIA 2XDQA 5M3BA 1X4TA 2V4DA 3KVRA 1C14A 3VPDA 5E3HA 4RC9A 2QN2A 5EN4A 5EQJB 5KHGA 1GZHB 2EILC 2FW7A 3D7MA 3GFGA 3CF2A 3VYTC 2IQQA 3SIWA 1T0KB 3UMGA 2A92A 4BWFB 5IKEA 3EPHA 1QYRA 2PGXA 3D5TA 1E6MA 3CSUA 4LQDA 1I6WA 1CUJA 1O0SA 1UPTA 1VL0A 3BVPA 2IL1A 3FNGA 3QHPA 1PQUA 3FMOB 3ETNA 4UUPA 1QG0A 3W5AA 4X61A 4ZYUA 3PQ8A 3SPIA 2IJGX 2YS8A 1CIVA 8OHMA 3THRA 2J7PA 2ZJZA 4W5OA 4DXHA 3IOMA 1LDBA 1XQ8A 1C9MA 2EZ4A 3SGIA 1RZ3A 3L92A 4B6FA 4OUDA 1OH8A 2DT4A 2CK3A 4CNBA 4X8AA 2JGDA 2PGIA 1XFAA 3EG9A 4KKXB 1P5ZB 3HB9A 3QBJA 1O77A 3X2FA 4N23A 4EPTA 3S8EA 4DE5A 1D2CA 3OJFA 2DT5A 1UMKA 2CTPA 1OLXB 1K86A 2WM8A 1GEEA 4NHOA 3K0AA 3ZZUA 4BLRA 3WGVA 5J4VA 3CX5F 1LD3A 5KOYA 2FCRA 3H5WA 4JXJA 1DOHA 3NGXA 1BKSB 4M0KA 5EPEA 4F2WA 4CL2A 1UPAA 2Y1EA 4HWSA 2NU6B 5DXAA 5F52A 1UODA 2GLXA 2XRMA 4YJ3F 3TW4A 3IXQA 2PK3A 3FDIA 3WRYA 3S1AA 5C5CA 1KS2A 3RJ9A 2BMFA 4RPIA 5HF9A 4G4SO 2RGRA 1OC4A 2VF2A 1RXUA 4WESB 4DV7B 1L7DA 1H8ED 4PNEA 3WMRA 2BKUA 1MRNA 3CTPA 3WRYC 1R9NA 1JBKA 1VQ9V 1QR8A 1Z83A 3PLAC 1RI1A 1H48A 2DQSA 1N9ZA 2HXSA 2OVFA 3PHHA 4KK3A 1E69A 2D3OW 1IATA 1GMGA 3S0HA 2BSKB 1VBNA 2A7QA 2GAIA 1DWQA 3C15C 4RQFA 3HRKA 3L1KA 3P9XA 2B9EA 3I9OA 4OQQA 5DM60 2H1FA 1JIXA 5AK3A 4KYVA 3LC7O 2IW1A 3PFWO 4YEDA 4BZXA 2UZ4A 2VRNA 4CQMA 2NUTB 1SMKA 1WD5A 1E3LA 2BV3A 3GJZA 3CE9A 4GOXA 1ENPA 2V7GA 3TTSA 1RBQA 3F7YC 1Z6PA 4TXHA 4ARAA 1D2GA 1NXTA 2BMDA 2QF7A 4KGXA 3UQYS 3OPYB 3CVWA 2ZSFA 3PFFA 1WF3A 3ADDA 4BX3A 1XDZA 4KPYA 3P2EA 2GS9A 1YUBA 2WIBA 4R69A 3OI7A 4EHIA 4JTDB 5K05A 1M54A 1GTZA 1NRIA 1XU4A 4IDDA 4C2BA 2UVQA 2XW6A 1N4CA 4L3OA 2A30A 1AKRA 5EJ5A 1E2GA 3A1DA 1QS0B 2WSSD 3U80A 4LCKA 2L17A 3PFKA 5E1MA 3RRYA 4DMFA 4GLFA 1N92A 4R3NA 4DQKA 8LDHA 2HPHA 4YLEA 1A9RA 5LQKA 4A0SA 2P4KA 3GLGA 3ZU4A 4MWSA 1P7BA 1IEWA 2PMBA 2EINC 1ZH6A 2P5TB 4II2A 3DKRA 1IH8A 3HU2A 3PXDA 2Z04A 4O0LA 1V41E 4BKPA 5HOQA 1RXWA 1P7YA 1ABEA 2QNBA 1MPXA 1J23A 1XD2B 1NW3A 4G4JA 2WE7A 3IA7A 2J7PD 5F73A 5IJAA 1HOXA 3H9BA 2OTJF 2HLDG 1HI9A 4QJ3A 1GAQA 1R0RE 1XXLA 2RI0A 2ZI7A 3AEKA 3O8OB 2P22C 1X86B 3PC4A 2P7IA 5B1HA 1W35A 5K51A 3VAZA 2X8WA 2FOLA 2R79A 3CRCA 4HFRA 2XKKA 3ZWOA 3NRBA 3O2NA 1Y4DE 1K9VF 2I91A 3O8QA 3O1JC 1R73A 1SQ0A 2P35A 2WYUA 2XTMA 4R05A 4XYEA 2HNAA 4YBRA 4HH0A 1I7FA 2CYAA 4CKEB 4YR7A 3BWEA 2PJRA 2W8BA 3DYBA 4ML3A 4YMVA 5JECA 4FYYA 5AT1A 3RANA 4FE3A 3SYRA 1B3BA 2AC2A 4N7JA 1PGNA 3KSBC 1K63A 2MSNA 2ZJBA 3PGXA 1SHJA 3BN3A 1P5RA 3RSZA 4I4TB 1R88A 3ABOB 3DBHA 3HXLA 4IYRA 1VEWA 1TMYA 1O1YA 3FFWA 2IV2X 1JA9A 1XCBA 1ADCA 2X5OA 4KBFA 2IITA 3PC8A 2Z09A 2IHVA 3A2NA 2DLDA 2F90A 2GZ1A 4PICA 3VHRA 2GVDC 3K2EA 4QOHA 3W6PA 4CG3A 4GYKA 4PQRA 5DI3A 2C9YA 4TV9A 1ML4A 1P9RA 2OXEA 3R6DA 1JPNA 4RAQA 4B6GA 1S2LA 1WXFA 3FW1A 2W6IG 4IBOA 5CBKA 5D5QA 3LYAA 3OO1A 3TS1A 2D7JA 4FFWA 5K3EA 5CT6A 3VVMA 4C03A 5EOVA 5B4VA 1SESA 1HLGA 5K0BA 2JFWA 1F60A 4LY9A 4JK3A 2VDWA 3N2GA 4YIKA 2GO7A 3C7CB 2GAOA 3HJHA 1MB4A 2Z2YA 5EKTA 3N2GB 3M84A 3PD0A 4HUJA 4WE3A 2R1UA 1IDSA 1XEXA 3A4IA 1DCFA 1I1NA 1W6RA 2RGNA 2YZ7A 3D8UA 2F1JA 2HMYB 4LOLA 2ZULA 2ZROA 1WNFA 3VYUC 1LWOA 2X0IA 2ZB8A 2J46A 3Q4GA 5JNSA 4K46A 3W06A 3W05A 2Q1YA 3W8FA 2LGWA 4G01B 2Y9MB 3REGA 1BDIA 5K9ZA 4N7RA 4HGOA 4IXDA 2F43A 2WVGA 3ER8A 3GFBA 3FHOA 1NRXA 3CEMA 1U94A 4HJRA 4DR6O 1IN6A 1J21A 5EZYA 2CXOA 3CW2A 3U7RA 3W5VA 4IFBA 4AP5A 4YYEA 5K4HA 1VIBA 2EIKC 3GVIA 3TW8A 3OIUA 3EORA 4N76A 2WJ6A 5E6SB 4HJXA 1R6XA 4DR7B 3LY5A 5THKA 5LHGA 1PTKA 2ZWAA 3UICA 1BSMA 3USZA 4BX2A 1YJWF 1WXWA 3JCZA 1RM1B 1ZIOA 5CDFA 3VQYA 4BAGA 1N5KA 4U39A 3D6FA 2A5JA 4A36A 2O5RA 3NOQA 4CLOB 1KSHA 3OJLA 1TNDA 1KFJB 2BF7A 5LBIA 1MAVA 1K7CA 2GETA 3ORHA 4KPUA 5AW5A 2M6RA 4L08A 1YHQV 1UKEA 1NQVA 2JNWA 2UXCO 3LUAA 5T41A 4P4NA 4TTAA 1SXGA 5DZSA 4LTMA 4HG2A 3WLOA 3T9AA 2PTMA 2Y8EA 1WP8A 3D5EA 4ZQCB 1RRVA 1TM1E 1YK0A 3ANNA 4PN3A 3BWMA 4XGKA 1MJ5A 1Y33E 1NLYA 4U2FA 4ENTA 1ZK2A 1MNQA 4JYBA 1N34B 1USWA 3NB0A 4DM4A 2VHVA 1FXKA 2EIXA 3U9TA 1ZK0A 3N0XA 3FDZA 4DA7A 4BQFA 2CGEA 5KJ1A 2GDZA 2PSDA 3FYEB 3UWDA 1I1HA 1DZ3A 1VIVA 2XF2A 1Z26A 3OEED 6PFKA 5FYDA 3A6KA 3E8GA 1PR6A 5K0GA 3OZ7A 3PKJA 3Q15C 3EIOA 2CXSA 3NJ4A 4LRQA 4D9BA 4LXGA 3TRFA 4C4ZA 3UY4A 1FP4A 3HI6A 3N2ZB 2BE3A 3QUBA 4GD3Q 3AG2C 1T0BA 3NHZA 4KXFB 5E2AA 1SD2A 3JZMA 4KQEA 1HDCA 3FKSA 3IUSA 4JA2A 4D4HA 4KG7A 3D9QX 2FZKA 2XQIA 3ZLUA 1AN9A 5K4GA 1WDMA 1Z2EA 4PGFA 1HNWB 3QBDA 4V2IA 2BGIA 3KV1A 4YRTA 4D2IA 3CC2F 1IZZA 2E82A 2QLLA 1JMVA 4Y9UA 5KU1A 3KJNA 4IDGA 2D2CB 2R44A 4HLUA 4DA6A 4UE2A 3HR7A 2EDAA 4J75A 1MJGA 2XASA 3CA8A 5AVYA 1ZD4A 2WHXA 1XD9A 5T67A 4G67A 2J0EA 2YWBA 2J9FA 4IR7A 4RJIA 3K09A 4IH1A 1W5TA 1Z15A 4PZPA 5FI0B 3UAGA 2G8LA 3WGHA 2CW4A 1OAPA 4B79A 4C05A 5CW1A 2EFHB 5F51A 5MFPA 4XDJA 4M87A 2Q2QA 2JCSA 1M1KW 1N5JA 1W88B 1MAWA 2QW0X 3JQ7A 3H97A 4XEUA 1GPBA 4DV5B 4LWOA 4DV7O 3VR5D 4BT4A 2QD1A 3VZDA 3SGLA 5KS2A 2J45A 1NU6A 4RH1A 4FMDF 2C98A 3GFRA 4MRMA 3E22A 4DDUA 2A9FA 3HA7A 2BP7B 4OHVA 4DL9A 1VJTA 1D5CA 3ND9A 4H7PA 4K9KA 1SKVA 4N54A 1J0XO 1CETA 4RD3A 1M1YA 4RO0A 1T8TA 1JHYA 3AKYA 4AJPA 3H0CA 4WK2B 4E33A 2BISA 3QVGA 5DBFA 4DC0A 3NRJA 1AI5A 4PNZA 4W7HA 4OXQA 3C3SA 4PHZA 4XDGA 2PT6A 1NQTA 1MABB 3HKBA 2KSQA 1BJRE 2A0FA 3C0KA 3O7WA 3UA3A 3B36A 4B3DA 1QQ6A 5AFSA 1KZ4A 1U6JA 2E1RA 2VNJA 4FWIB 2C7GA 3BM5A 1XRMA 2LBXA 4ZQBA 4HI0E 1OCCB 1FXKC 3ZJZA 5J2TB 1CR1A 4P53A 3U7QB 3B6ZA 1GNRA 3H0KA 4J2HA 1ODFA 2BHLA 4D7SA 2Q7HA 1FQJA 2JAPA 2UVDA 2O9JA 2YL2A 3O94A 1W1UA 3F0EA 1W25A 2FWJA 2BCCH 2W5UA 1CS4C 4K9MA 4QUEA 2IHBA 1A71A 4HR7A 1J2UA 2JFUA 1D2DA 1W2GA 1LBTA 3CZ5A 1S7CA 3FUUA 4FOLA 4IYHA 1ZNYA 3QUAA 4IXWA 2ODTX 3REOA 4CT0A 5LQAA 2B0CA 4BS9A 3K5MA 1VBKA 2BCGY 3EUEA 2Z1EA 1NBMA 5BY1A 1T13A 5KSWB 2F95B 2C9MA 3IB6A 3PGMA 1NDQA 2VNHA 4FLUA 3WWOA 2YIBD 4Q4JB 1QNLA 2HJ9A 4B08A 1SXJB 4RVFA 4WKBA 5KNLA 4HPXB 3H5AA 3OZSA 3CKKA 5C9ZA 5ICGA 2AOXA 2WJWA 3LWNA 2IUUA 4B48A 1MC1A 1RWWA 5CTJA 4C0JA 3QKRA 4N7BA 3TJZA 4BQQA 5J40A 3RFTA 4OBWA 3X1XA 1N5IA 1C3VA 2AW3A 3VNQA 3WMGA 5L6MB 2LCFA 2QW1A 4BB9A 3EZ6A 4MIEA 4C6TA 4DYHA 2C31A 4GPAA 3KLNA 3CWZA 1LGYA 1XSEA 4HH1A 3I9JA 2FZVA 3KSZO 4OA5A 3B60A 1Z5WA 1QVWA 4N21A 1A7AA 1P1HA 1W2WB 3HUUA 4L6IA 4YFVA 3RSHA 4LI3X 1TYEB 2XUFA 4IRMA 4LF8O 5IAJA 3A6EA 5KNCD 2CLFB 3D4NA 3NOOA 4Y6SA 1NT2B 1BE6A 4WBNB 1OZHA 4LCBA 4X85A 4HATA 4CVNA 3L7JA 2H1IA 2MMCA 4Q9LA 2P7TC 5KYXA 1UBTS 1BXZA 1Z5ZA 5K6TA 2V7PA 2DJVA 2A5YB 1HY3A 2GR9A 4C0HA 3WXMA 4FLYA 1UBNA 4R8CA 2VT6A 3DDOA 3PFNA 2HMUA 5E6RB 2PUTA 3B70A 4L7VA 3B6JA 3I9KA 3CVVA 3FG9A 4I9GA 4OQMA 3A05A 2O0JA 1NFQA 3NVAA 1U0JA 3PX3A 2ZZNA 2J0QA 4TQDA 7AT1A 3PWKA 1Q1GA 2XMZA 4MGKR 4BZQA 5JC8A 3VYTB 3CG6A 4AICA 3HPLC 1EFRA 1GNPA 4Y6LA 1E2BA 2JVJA 3WJQA 3WL8A 4R84A 4UCQA 5IJWA 3HQ4O 4F3YA 3NK7A 4FLFA 2AHZA 2FQQA 4PCVA 5C34B 1Z2AA 3U5ZB 2A4KA 2FG6C 2EW2A 1W36D 5WRFA 5KNBH 3K79A 1WPQA 1YJ9V 2BDTA 4P7JA 3B3FA 5BYKA 1V5GA 4DCMA 1FYJA 1IBLO 1NUSA 3OZAA 4YGXB 2VS0A 3RASA 1J99A 1TO2E 1PGQA 4N01A 3DDCA 1ZVJA 2PGLA 3AB3A 1EA7A 3IT3A 4FNGA 1U7OA 2PJUA 4FEGA 5CVUA 2PSHA 4WNAB 2PZ8A 4RKYA 1SOAA 4J1NA 2HNBA 2REQB 5D7BA 5ARDA 2OC4A 3W5BA 4A3SA 3JYCA 3NWPA 5EZYB 1W0KD 3KKKA 2Z1TA 4U7JA 2AOWA 2H4YA 2AZMA 1BZKA 2RB4A 1IJFA 4ROTA 4CN8A 4ZDJA 2XXBA 4EKDA 3WMFA 1L5MA 4JQYA 1ZJWA 2DG2A 4IKEA 4UHFA 4KQKA 2J32A 2GDSA 2JIQA 2Q8NA 2AQKA 3ISVA 5AJXA 1NI3A 2FZLA 4MRAA 4ZEOA 5F7OA 2O59A 4QEZA 3KZKA 4YJKA 4YWHA 5IVPA 4NTXA 2X4DA 4EGJA 3M6XA 2YXHA 3RVZA 2WF7A 3L7YA 2HWXA 2HJFC 3RK4A 4EUKA 5B7NA 3F78A 1UKVY 2XTNA 3TMYA 4CCYA 4V0MA 2FN7A 3MOGA 3SSMA 3VZSA 2VWJA 1FRZA 4DSUA 2DYSB 2ZITA 4X94A 5L7TA 2QTPA 2IEZA 2N46A 4FSHA 3LW7A 4AI6A 3BS4A 3WIOA 4A8JC 1WNTA 3E2EA 3E70C 3N6VA 2F3TA 1ULTA 5KVCA 4IOJA 3NXSA 3VDRA 3EVZA 3PGVA 1PLKA 3MAJA 5KINB 5EO3A 2RG1A 5H9VA 4F4HA 1ZHOA 1XG5A 3C5WP 3K1YA 4DQDA 1TVEA 2JHPA 3RVRA 3AG7A 1VCIA 4E88A 4TYNA 4U9HS 4NCBA 4ETIA 2J1LA 5EZ6B 3MINA 2FVYA 4EHNA 2F1KA 1O4VA 2I8CA 3KOXA 3PT5A 1JSRA 1GADO 4BCBA 3T80A 2ICAA 4PYLA 2GN4A 2LCIA 4TLAA 1MW9X 2CH7B 2NOAA 1ZI8A 2RH9B 3M5WA 3PXGA 5EXXA 2ETXA 1BE3H 3E4CA 4WCVA 4WOJA 5CB4A 2Q9CA 3GOQA 3I9V6 1FTGA 3OU7A 2X0KA 2IBMA 3FM9A 1OI2A 1QMGA 1G16A 3OT7A 4JI3O 1W8DA 1JMKC 2AG8A 5AK5A 2HRRA 2WWXA 2WIFA 1IZ9A 4QGFA 4X90A 5SICE 1SXIA 3GLQA 1U3WA 3W3AH 1NLZA 1CUUA 2O2CA 3HLYA 4B81A 5JJKA 2DYRC 1F2VA 1YQXA 1UPUA 3A26A 3C6XA 4IDPA 5BYBA 3CW9A 1G9SA 2IHJA 2LV8A 2YY5A 3N8IA 4UFNA 3VR3A 4B6SA 3E1KA 2Q0XA 4BMZA 4DDVA 5LQUA 2R6CA 4UXIA 2DT8A 5F3RA 5B3KA 1YS7A 2QW8A 4PC3A 1K5GA 1T36B 3KTAB 4TROA 3ZKWA 1N7GA 3PC6A 3VVBA 3AM1A 2EFGA 1WJGA 2YFQA 5AVXA 1L4LA 2ZSDA 4CM5A 3WL7A 3KYBA 4FR5A 3WGNA 2WJGA 4LRUA 2X4IA 4WBNF 2EIJC 3HJWC 3KB1A 1NNEA 4KI7A 4M9XA 4LPKA 1OKKD 2UYKA 2X42A 4E6PA 5TQ0A 1I7NA 4LN1A 4TWRA 2EV9A 2BR4A 2AIFA 4OAPA 3CCQV 1P19A 1XTUA 2QR4A 3HNOA 3WKAA 4AN1A 4J29A 1HG1A 4NK4A 5GWXA 3S2FA 3KSAC 2GRJA 4RGYA 4AIRA 4BE4A 1II9A 4O2LA 2W6QA 4GOKA 1TMOA 5G1NA 5HBGA 3V00A 2EL7A 3CJHA 1JJVA 1OI7A 2C3YA 1XDUA 3GZNB 1OPXA 5EEHA 5AVRA 5JIBA 5L6LB 2E7ZA 1JSLA 1RE0A 1SKBA 3GLGB 2R62A 2Q3BA 3K92A 2QRVA 4NJEB 1O0CA 2QWNB 1RBYA 1Y3FE 2HUPA 4EUNA 2H7YA 2F8MA 1FTQA 5EEGA 3W0LB 3DBRA 1KC1A 2RFLA 4PCLA 2OCAA 4D8YA 3OFNA 2FFHA 2W2KB 4OQ4A 2FB5A 4MCHA 1S72V 4BO1A 4HLQB 2YS7A 2WSBA 4J03A 3VMFB 2WABA 3T0IA 3TSCA 3M3PA 5AIAA 4B71A 2JNBA 4MRMB 4G8DA 4INAA 2VPWA 4WXEA 5CNKA 5HE9A 3ULKA 1D5NA 4JAVC 1PLJA 3MTBA 1Q7EA 4JLBA 2HWUA 1FC0A 2XADA 3Q6NA 4HUQB 1SRQA 4QU0A 1ZTEA 4HY3A 4XYBA 2O05A 4FMDB 3KPWA 4ZCQA 1I2AA 4TYPA 5ERGB 5I01A 2PCLA 2X2PA 1QLNA 3UHFA 2OQIA 1SH7A 5A0FA 2XUOA 4BLUA 1YO6A 2D6FA 1E7MA 2X1LA 3MIZA 5J47A 2G83A 1BMFD 2DVMA 4GPEA 1AKNA 4DMKA 1KYYA 1XROA 2W93A 3H8SA 2Q5ZA 1GJRA 5AK0A 5TXGA 3ZXXA 3UB2A 2MMGA 2XA1A 4Z3KA 1C9NA 2EEZA 4DIBA 1LLDA 3EVBA 2ISCA 4JAUA 2P5YA 3FTPA 3T61A 3WGYA 3WXBA 2GN6A 2RIPA 2FXVA 2FMHA 4PSAA 1YC5A 3JD4A 4D7AA 3T1HO 1MNGA 4IHJA 2WTXA 4O2BB 1Y1QA 4FS8A 4BVLA 2XNCA 4COOA 4DUGA 5EJ8A 3K5HA 4MKHA 4F5DA 1RC1A 1B74A 3ET4A 5HKLA 4RQEA 4JUAA 2HR1A 3ZV6A 2VJPA 5DNVA 2Q3LA 3MLAA 3RJZA 1KP3A 2R5NA 4O2AB 4IQFA 2K2WA 3M9XA 4BNWA 4XWOA 2O0LA 2PG3A 4TS9A 5J4KA 1DEOA 1GKKA 2W2PA 1PKEA 4L5AA 3DMYA 2FW1A 1TXGA 3BE5A 2BF4A 2ZYTX 4EVQA 1BO6A 4PGMA 5GONF 1LLUA 4XQGA 1RXCA 2CBGA 3UMMA 121PA 2ECFA 1FAFA 3I2FA 3QM1A 4J4TA 1GKYA 4JV5B 2GF2A 3P2OA 4FKZA 4JX9A 4XRRA 4J7CA 3M4JA 1YSCA 1SB8A 3G2KA 1HNXB 5JHGB 4GMHA 5FNVF 3S28A 2MSDB 3ZIUA 1S3JA 2GK7A 4CF6A 2EVWX 1TJYA 4BMDA 1ZMBA 4FHFA 1NF2A 4X95A 5TSDA 3BGDA 1W0JG 1A5TA 3T4XA 3PUHA 4Z1MA 1AO3A 4KNVA 2G04A 3N70A 4ZOLF 1Q0HA 3UM7A 3PUZA 2I6GA 2ZDHA 1Q14A 3A6FA 2Y1DA 4XR4A 5KYWA 3BT7A 1JIKA 3QEAZ 3WHPA 3NRCA 2A9OA 1OHHD 1P2BA 2GTIA 1T5DX 4OQNA 1F2UA 1F1JA 1JYSA 1LBEA 2I33A 3BH6A 4EY6A 3ED5A 5D3MB 5SZKB 3SWWA 5BOSA 2RGDA 2X1MA 3D5QA 3PPYA 3KS9A 4JMPA 3S81A 2DXIA 1TLFA 2GWRA 3TQQA 2BZ1A 3VC7A 3WWDA 5FJJA 1G1MA 1J22A 1DXOA 3P9CA 2DN9A 5KKCA 4BP8A 1PDWA 1V48A 3LZ6A 5E2IA 1GUDA 5FI3A 3O4VA 3VAAA 4BGEA 3AJRA 3EODA 4YR9A 4NDZA 3F6YA 5TQ2A 5IP5A 4YXWG 2Y1CA 3BD6A 3IS3A 3FAVB 2QZ9A 3MQ2A 1SDSA 2C5SA 1ENZA 4PZZA 1JYEA 3RGBA 2J41A 5IYZB 1G8JA 3G71F 1EG2A 3DHWC 5FOXA 1CE8B 3TRHA 1H4SA 4C30A 4CMGA 3R09A 1T6YA 1XKQA 2J3HA 1G3QA 2MYPA 3FPEA 4HNRA 4FFNA 3OPYI 1G4HA 3EXEA 3Q0TA 3UFBA 4DARA 2JG3A 5KYNA 3ROXA 1E2PA 2GCPA 4YROA 2OFWA 5GOZA 3DLHA 1KERA 3CMAV 4URZR 5ALDA 2CUZA 3CCEV 4LWZA 5CIYA 1GAWA 1HORA 2WDZA 3LBAA 2YWEA 2FSFA 4UBIA 1OY1A 4WFIA 2CMDA 3D8NA 1M67A 4YI3A 3IMCA 3CUWA 1GEGA 3ZPXA 2ZAUA 1YB4A 1R66A 1YI0A 3PQ6A 5IJ9B 1R0LA 3RVSA 2R8EA 4FVMA 5DI3B 1B16A 1RABA 1NXOA 3I1JA 1US8A 4KPEC 3QNEA 5TEVA 4KOEC 1W5BA 1T5BA 3A2LA 1OCCC 5DM2A 2VP2A 1MAHA 2X5XA 4AQ7A 1JLLA 1GXSB 4OEHA 3LD9A 1FTYA 4B35A 3I5AA 4RTLA 1YQWA 3NEAA 1UANA 5M29A 4FXPA 4YP9A 2CV1A 4O5AA 3R7WB 1RFYA 1TQ6A 2H1VA 2W48A 5ERYA 5BSWA 3TGPA 4DMHA 2HA7A 4FILA 4HPJB 5TQJA 1PK9A 2UZ1A 3TN7A 1NVEA 3HJRA 3S29A 5EY5B 4YV1A 1E98A 4UUMA 3B1KA 4JI3B 1I3OA 1C5KA 5F2NA 4FU0A 6CHYA 2Q5CA 1TUGA 1DAHA 1UMDA 2BUAA 3ZN0A 2KX7A 2NU7B 2OLKA 1T4CA 2YFHA 1HE5A 3TLJA 1PWHA 1CRWG 3CONA 1YDWA 2CL6X 3D6VA 3TAUA 2RHTA 3QF7A 4C7JA 2R1VB 1NSTA 2IEGA 3KKPA 2CTWA 2Y2VA 4UHJA 3WE7A 4BVQA 4C43A 2QVZX 4TMYA 4BAZA 3NIDB 5C5EA 2J6HA 1KEUA 4O2BF 1BT8A 2XNHA 4ERHA 2XWQA 3D6UA 3KAPA 3HKBB 5KJEA 1HTBA 5DSTA 4I7EA 2B7BA 2VAMA 1NGSA 5CA0A 1PL4A 3QK7A 4X3LA 4YK7A 3MFQA 5GJWC 3SNHA 5DBGA 2O1EA 1RZRD 1WPBA 2GN2A 3IV6A 4FNOA 3LQKA 1W94A 10MHA 1Z5NA 4DR7O 2YMLA 3WJ7A 4BTVA 1AUPA 2Q46A 4YJ2B 2R6ZA 3JSLA 4BU1A 3H83A 1ODKA 3ETDA 5IT0A 1VQVA 2ZSIA 3AMVA 3U3JA 3C90A 3RYHA 1MB9A 4UM5A 3R9XA 1U2EA 1JLLB 1GXSA 2C9ZA 3MXTA 4DM7A 4I1UA 1J06A 1LU9A 3HUFA 1X7YB 5AKYA 5FTKA 5JUWA 2P6RA 4FFKA 2XMDA 4A2CA 1IHXA 5JY1A 1QDLB 3E3LA 3DZ8A 4X62O 2BTUA 2YVQA 4K6KA 3CNLA 2EF1A 5THQA 4L9WA 4IL6Z 3ZGZA 3L7QA 4ND6A 3I56F 3KYJB 3PUIA 4ZCPA 4FLXA 2RC5A 1JXMA 1RYBA 1KEWA 1UDRA 3CX4A 3NP7A 1UKAA 2I76A 3FTCA 3TE6A 3IH5A 1BFUA 2CXPA 2JA2A 421PA 1CQPA 1SUSA 2J3IA 2YXNA 5KEIA 2ILMA 5LQDA 3EY4A 4LHWA 3R0QA 1PCXA 5BSTA 5EIXA 1F9EA 3WXMB 1E1RA 1DIGA 3L4EA 3UHPA 4B85A 3EFOB 2V59A 1ZH2A 4RUKA 2J4DA 5LHIA 1PTJA 4M55A 2FPKA 5JQGF 3O91A 3R23A 5ECWA 2PI5A 2QAGB 3FCYA 2QYHA 4MV5A 1JPVA 4ZT4A 5AXBA 4NMHA 4Z8YA 3T7RA 3V80A 3QA3E 3WJ1A 3ADOA 3QEBZ 1ZWZA 3R8CA 2DOSA 1YV9A 1N9KA 1V1MB 2ROQA 3BFPA 3GDFA 4BQOA 2VA8A 3FSEA 4UVIA 4GYCB 5A2QM 4LC9A 4TLLB 5DP2A 5BW8A 3QVKA 1G5QA 1W93A 2FMTA 2RD2A 3R3UA 1BXKA 3DW1X 1RRMA 4TZKA 4B83A 4ZZIA 1FMFA 2IY7A 4GKJB 5ITZB 3GQVA 5AVJA 3E5HA 2SKCA 1BQ4A 1BS2A 1ORDA 3LBFA 3OPNA 2C83A 4YGYA 2BAGA 1W30A 2EGHA 1B00A 2WC1A 1F2UB 3FNQA 3O4IA 4P3YA 5AKEA 3U13A 2EJ7A 4F6EA 3OM1A 3G67A 3EXHB 3ZG6A 1YBVA 2YOFA 4I1VA 5J59A 5B30A 2IP4A 1GGEA 3LY7A 4PINA 4ZKEA 1RZRA 1T6ZA 5CCDA 3GYQA 4HEA6 3E15A 3Q3JB 1OIVA 4WAUA 4OHPA 1VG9B 4BGUA 5GAJA 4AQYB 1I10A 3ZNOA 3J7AU 3TDNA 2H8PC 4K2AA 1K8ZB 4RAIA 1LZKA 2B92A 1YL6A 3ZMZA 4OM8A 4XSVA 1YE5A 4IDHA 1CERA 1FF9A 4ALLA 3KNZA 5FI5A 1L5HB 3DFFA 4NIMA 4BY9E 2WUDA 1NQ5A 4EMSA 3CZCA 1U2GC 4X7MA 3V42A 3UK6A 2XAUA 3ZDXB 2SECE 5LMCA 3UUEA 1RCFA 3EGIA 1T3ZA 1GH6A 2HCTA 2OHFA 1CNEA 5E4TA 1KU9A 4L50A 5FIUA 2WB2A 4D26A 3CZPA 1QXSA 2ENUA 2JFPA 4KFRA 4M0FA 4H7KA 4MYTA 4QATA 5DWVA 3RUCA 3MAAC 2N04A 3SJAA 5BSGA 2VT3A 3TQTA 4QYSA 2OAEA 1I1OA 3C2QA 1HXHA 3TQCA 1NRWA 1C7IA 2GCOA 4TV8B 4CFYA 3X1MA 4MARA 3WX0A 1GGVA 5HF6A 4XJXA 1TO1E 4E3WA 4JXXA 2OTMA 1SNYA 2PUAA 4GR5A 4GL2A 4QXAA 5HIKA 3K2XA 3ZU5A 4OQDA 1L5YA 3DZJA 3HS3A 2PS0A 3DTTA 1Q6HA 2MTBA 3DAOA 3RIHA 2QMHA 4RVGA 5E8RA 3IMPA 5ICSA 5KNDH 4C21A 4RD1A 3FOZA 3Q8KA 3VPCA 3ZTTA 1LUAA 1O6GA 3NHSA 4R9RA 4RDIA 4C7VA 4Z51A 5EHNA 1XN4A 1NE7A 2IZ6A 1OVGA 1KIFA 5JAIA 4MGYR 1KVTA 1U4SA 1C3OA 3ABMB 3OHSX 1C1DA 1RLMA 1RLTA 4I6JA 4ITRC 2QSYA 2RGAA 4NS1A 1RU3A 1XTQA 2HZBA 3KB6A 1ZAUA 2IXAA 1VHDA 3QGMA 2GD2A 2D5CA 4MOWA 2O3RA 3VO8A 3OSUA 4JJIA 5JRZA 1DDOA 1LK5A 3IXLA 4MEJA 3AQIA 1XNGA 4DR5O 4JASB 2BMJA 1L7VC 5EINA 2HEIA 5FUVA 4M8IA 1VE6A 5KHAA 4OGWA 3VA7A 4O8CA 4MI9A 2QM4A 2PVPA 4D4MA 2PWPA 4ILKA 1HTTA 1VQNF 1QRDA 1R0CA 2ZIXA 3L4BC 2C9CA 3QWHA 4P5PA 4YUVA 3KQUA 2R11A 2WKRA 1ZC4A 3CLRD 5JMOA 3SZRA 1KEEA 3HLTA 1H0HA 1ORTA 1U1IA 2Q2NA 4L5CA 4RH3A 3TE7A 2QLBA 4E5SA 5J4LA 5L3DA 5MFZA 2NN3C 1JNYA 3ZTYA 4CS3A 1UXHA 3W2HA 5H9WA 5JXWA 1KJJA 2PYZA 5I3ZA 3RUHA 1UPFA 2I34A 1NUTA 2CXNA 2IP1A 2P41A 2XNSA 4YRDA 1OBFO 2PT5A 3C16C 3IALA 3THYB 4ARVA 2A7XA 3ZO8A 2BHTA 2EX3A 3BK2A 2C7VA 2YV5A 4FPXA 1OJ7A 1GYPA 4RSHA 1T34A 3QUWA 3R40A 2RONA 3NM4A 4P98A 4DCJA 4K5QA 2ZFUA 4AMGA 1Z25A 3QY0A 5IKMA 2DECA 3PNMA 3R0XA 4Z0NA 3FB5C 1EK2A 1V7PC 1O5OA 5HP8A 5GP1A 2XZTA 3FTDA 2GN9A 5JH7F 3CBQA 1ADJA 4RA6B 1XHXA 1IZYA 2ZUCA 4QFMA 2C5LA 4NBSA 4R16A 5B53A 4EITA 3KCYA 2I4IA 2QE7G 1YIJF 4KXYA 1T1JA 3W9SA 3WQQA 1G8GA 1W46A 3MTIA 3T0GA 2V65A 1HE1C 1K3TA 4BE7B 4INPA 1MG5A 5ILGA 4PDLA 1XYVA 5A5GA 3UAXA 2RGEA 2GVZC 1KQPA 2X22A 1P17A 2PY5A 5IAEA 3VR5A 1GCIA 1N6PA 1NVPD 1X7PA 3TLEA 2DYYA 1MD9A 1GAXA 2E6KA 4CF3A 3WSTA 3AG3B 1UFYA 4RSRA 1FFSA 3KR0A 2DPHA 3UJDA 3MS4A 2QAGA 5H80A 1MKYA 3A1EA 4DOMA 3MWLA 5ER9A 3WLHA 2XE7A 2CV2A 1U7TA 1DDGA 1RPJA 2MR6A 4EATA 2B4AA 1ORWA 4OGGA 4M1YA 3WADA 1M1YE 4CMHA 4C2TA 1YB5A 3PDIB 5BR7A 3TX6A 2AN4A 4KQJA 1IU9A 1L5RA 2OHIA 5HILA 3SIRA 4BLWA 4B76A 4EF5A 3ICEA 3IHLA 3AF6A 1DF5A 1YKSA 2FZGA 2MOKA 1CUEA 2Y69B 3TSZA 3SEFA 1PF5A 1NSFA 1UM8A 2IYTA 1LTHR 2WA2A 3IKJA 4LE1A 3F74A 1FFBA 3GEDA 3ZWDA 1FSZA 2AV6A 2EZPA 3AJDA 3VSEA 4TVBA 3VZRA 4C6HA 4EVSA 2O06A 1K4KA 4QDUA 2GD6A 2IS4A 2E76B 3JSNA 3BZBA 1K8RA 3B9QA 5IYDO 2KBEA 1OCRB 3DV0B 3U1VA 4PC2A 2P2SA 5ERXA 1UBMS 2G9IA 1R8QA 5CCBA 3HK2A 1ZIXA 4JOSA 4JC5A 2QIOA 1E1LA 2HVYD 5A0VA 3T1CA 1MX1A 1THMA 2IVZA 2VDLB 3M1LA 5TQVA 3RNOA 1C29B 2IIQA 1AX9A 2Y1XA 4GC9A 4INZA 1PR1A 2ZYUX 5KTNA 1KU6A 4TYYA 2UV8A 2ORVA 1PR4A 3HCPA 4F6CA 3RSQA 4IIUA 3MCWA 4WNAA 3NI2A 3T95A 5JAPA 3W04A 5KX5B 3KVNA 5H0IA 3ZI4A 4CKWB 3CT4A 4MTXA 4L0CA 1JPXA 1VSTA 1FDUA 2O3JA 4JQSA 2L42A 4U1RA 2P9YA 4MRSA 3K14A 2PL3A 2YFYA 5B1EA 1E6CA 1CCWA 2R9AA 3CM0A 4LX0A 1ZGHA 3KX2A 1EUZA 1XZQA 4TSFD 3K0FB 3TI9A 3HTNA 3KV3O 3QWAA 1AURA 5C7YA 3X2QB 2ZYSA 4DCTA 2JJ8A 3ZD8A 1UMCB 2EQAA 2I2CA 1HDRA 2EW1A 1UBSB 2P2GA 4O3FA 3FNEA 4KFTA 3EXHA 1UKZA 1R3UA 1GYRA 3QLTA 3R77A 4GQBA 5BWOA 1F2DA 1RVV1 1H2WA 1YC2A 2QQFA 4UBMA 4YCAA 3N5CA 4D81A 4C2UA 1K8AH 1RRFA 3A36A 1GTRA 4XVCA 1RI2A 4RXMA 1Y3BE 1Q0SA 1NVKA 2GCGA 4YUAA 2C2AA 4ZC8A 4RJJA 4B3FX 4HYQA 2Q7XA 4D3FA 3RVMA 2O6HA 2G76A 3A6HA 3K0GA 4IIJB 1Z4OA 1PR2A 3G23A 4YQZA 5F21A 4Z0TA 3THYA 3O5AA 4A8HA 1UM9A 1V35A 1U2QA 6REQA 4AY6A 5EESA 4R2JA 4E21A 4J07A 3EZYA 5JYCA 1KI6A 2XUDA 2M32A 3R0ZA 4JDUA 1UKCA 3QU9A 2XWPA 2CSLA 1IY2A 3R0VA 4HDRA 1XAIA 1CEQA 4TWBA 3DVRX 5BQOA 5T4EA 3H3JA 4NLLA 3PYXA 2P4SA 1PUXA 3MK31 2ZI4A 4TTPA 1E7RA 3KLOA 5KAFZ 4RLFA 1F2TB 2C2BA 1TRKA 2D3TA 1E1RG 3PUWA 1SRYA 1JHPA 2BSKA 4D7TA 1LH0A 1FNCA 2YV4A 4J8PA 5DHAA 1UBFA 4K9DA 3A2FA 1F6WA 2CLCX 3FSRA 4JP3A 4ZTUB 1Z7EA 3T5BA 4NONA 1EINA 4I3FA 1E2FA 1YE8A 1REQA 4TRJA 5BR1A 3SVLA 3D3NA 3LJKA 4CCYB 3LVRE 1W4RA 3RE1A 1DVRA 1KGDA 2L2QA 5F64A 5GVRA 5HX7A 3KXIA 2PU5A 4I2NA 3O8LA 2P3SA 3C8MA 3S2YA 3KU1A 4JL8A 2IWHA 4MV9A 4WN3A 1U4NA 4ZHQF 2NADA