4TV8B

Tubulin-maytansine complex
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
428
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title A new tubulin-binding site and pharmacophore for microtubule-destabilizing anticancer drugs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 169
structure length 427
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4tv8B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4tv8B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4tv8B01
3WGMA 5IYZB 2VAPA 4IHJB 5ITZB 5MN4A 3JASA 5LOVA 3UT5A 1SA0A 1TVKB 3E22A 3JAKB 1Z5WA 2Q1XA 5JH7A 3VOAA 4X1YB 4DRXA 4ZI7A 5J2UA 4DXDA 4O4HA 4X1IB 3N2KA 4O2AB 2XKBA 3HKEA 1W59A 2R6R1 4I55B 5CB4B 5FNVA 1OFUA 2RHJA 3WGKA 5EZYA 4I50A 4O4JA 1FFXA 5LP6A 4YJ2A 3HKBB 4ZOLB 5LXTB 2RHOA 5CA0A 5J2TA 5IYZA 4IHJA 2BTOA 1Z5VA 5ITZA 3M8KA 3JAWB 4TV8B 5JQGA 2VAWA 3RYHB 4ZHQB 1TVKA 3RB8A 3JAKA 4EI8A 4B45A 5J2TB 4X1YA 5IJ0B 2XKAA 3WGNA 4EB6B 2VAMA 2R751 4EI9A 4YJ3B 4I55A 5CB4A 5EIBC 5EYPB 1RLUA 5LA6B 1W581 3HKBA 5LXTA 3JATB 1W5AA 3ZIDA 5JVDA 5JCOC 2RHLA 1TUBB 4TUYA 4TV8A 3JAWA 4B46A 3RYHA 3HKCB 4ZHQA 1W5BA 3JARB 5CA1A 2BTQA 4EI7A 3VPAA 4U3JB 4M8IA 5IJ0A 3V3TA 4WBNB 3VO8A 4EB6A 4YJ3A 1JFFB 3C8LA 5M7EA 5EIBD 5EYPA 5CA1B 3VOBA 5LA6A 4FFBB 4X1IA 5C8YB 4O2AA 3JATA 3RYFB 4O4LB 3ZBQA 1TUBA 4IIJB 3HKDB 3HKCA 5GONB 3CB2A 3JARA 4ZOLA 5J2UB 3VO9A 4X1KB 4TV9B 3HKEB 4HNAB 4U3JA 5IJ9B 4O2BB 4WBNA 5LYJB 3JALB 5BMVB 4F6RB 3N2GB 4LNUB 5EZYB 2RHHA 1JFFA 4O4IB 3ZBPA 5KX5B 5JCOA 4FFBA 5C8YA 4U39A 5JQGB 3RYIB 3RYFA 5MN5A 5KMGB 4I4TB 4O4LA 4X20B 3RYCB 4IIJA 1W5EA 3HKDA 5GONA 5LP6C 1RQ2A 3JASB 5LOVB 3UT5B 1SA0B 4X1KA 4TV9A 3E22B 4HNAA 5MN6A 5IJ9A 4O2BA 5LYJA 3JALA 5BMVA 5JH7B 1W5FA 4F6RA 3N2GA 4LNUA 4DRXB 2VXYA 4ZI7B 3WGJA 4E6EA 4O4HB 3N2KB 4O4IA 5KX5A 3R4VA 5JVDB 3WGLA 1FSZA 5FNVB 2Q1YA 3M89A 1RQ7A 4TUYB 4XCQA 3RYIA 4I50B 5KMGA 4KWEA 4O4JB 1FFXB 4I4TA 4X20A 4YJ2B 5LP6B 3RYCA 2GVIA 2BTQB 5CA0B
chains in the Genus database with same CATH superfamily
3GWKC 2R7LA 3IRVA 1XNQO 5AK3A 1QKKA 4QAQA 2ZRAA 2Q2NA 4TQUS 1F48A 3LPNA 2Y69C 1E4YA 1KP9A 3HKBB 1ZJ6A 3MEQA 3Q4HB 3SR2C 4EFDA 4NU8X 4ZV9A 4WZBB 3CLSD 1B3QA 2ROQA 5JARA 3SPCA 4JA2A 3LOUA 4KXWA 3EXIB 4P7FA 1QGUB 1WMFA 3E8BA 3KVRA 5KYTA 1A9OA 1P1JA 3RTGA 4EF5A 2G80A 1CZKA 1QP4A 5SY4A 3DB2A 4OM7A 5AKEA 2D00A 4NKRA 1USWA 3TXAA 4D9NA 3ZCCA 1OWLA 1LUAA 3FAVB 3L07A 5DM60 4F4DA 2BI8A 5KX5B 3G79A 2HLDA 4W6QA 4Q12A 4OHOA 1DAGA 4IIJA 3UUEA 3AM1A 2X6TA 4QM7A 1G64A 4GS5A 1NN0A 1PVVA 5IN5A 4QVIA 3R7BA 1ZCZA 3RUCA 4Y18A 4S2UA 4MS4A 3HU5A 1TFRA 1ORQC 4NMLA 4CQMB 3PYLA 2ESRA 2QZ4A 3FFQA 3KR9A 3JZMA 2NO5A 4NMXB 3W79A 1CCWA 3O8DA 4BZWA 4DJEC 1BEEA 2O7RA 2K7ZA 4IEEA 3F47A 1NQ5A 4FXPA 3F5WC 1P4JA 4IINA 4KP7A 2IEZA 1CUSA 1R4AA 3WLQA 2XTAA 3DKVA 1RKQA 2WIKA 4E30A 3HO8A 1QCZA 1A8PA 1OIWA 3CINA 3ZLJA 1T1EA 5A62A 3D36C 3CLHA 4DVGA 4I6EA 4O08A 2ZBGA 4FLVA 1D5CA 2UYQA 3LO8A 4DBLE 5LMNO 4EO9A 3UA4A 3OEYA 3W7WA 2BSXA 1MORA 4Y9SA 1PYOA 2WJYA 2ID4A 3VKGA 4UW9A 1AUPA 4PX5A 1YS7A 4RLQA 5BQFA 5EI5A 2RHOA 1SC9A 2W6PA 4WCFC 1HNNA 2YV2A 4AICA 1XZBA 4DYLA 4HYTA 1NXQA 4MITA 4D3DA 3KXLA 4LW8A 4W9RA 3EXG1 3QPBA 4R8VA 3BMOB 1EK2A 2WAAA 3ETQA 1BWPA 3IVAA 2PMDA 4JC5A 1QC5A 1A82A 3UO2A 4RFSA 1YWGO 1MZFA 5GONB 2DYRB 2ZBPA 2EJTA 3JD3A 1OX6A 1ZA2A 3M2TA 1DXYA 3K70B 3OTIA 4D9FA 2GYUA 5ALLA 3HKDA 1JWAB 1LJLA 1YZQA 1HMYA 621PA 3JXEA 2GJKA 4F9FA 2Y8EA 4XR4A 3N2KB 4JXXA 2PYZA 2Y1GA 3B2NA 3OIFA 4HDSB 4TKZA 2VUUA 2IU3A 1QIMA 1MSWD 1HXHA 1KMHA 1ZCAA 2MSNA 4UEKA 4DMUB 3P9NA 1SC4A 4QU9A 2UZ0A 1JR3E 5TGTA 2QNRA 3V8RA 2WUVA 4AZ3B 5CH5A 2W83A 3WC4A 1HYEA 4DSNA 3KCQA 5ABPA 1Y3IA 5FEMA 3DUFA 5CVCA 2HVYD 2DHEA 2OY0A 2B8WA 2NQ2C 1CJBA 1DXOA 2AHRA 4URFA 4Q34A 1JW9B 3IEIA 3REQB 1XU9A 1Q74A 1F14A 1DKMA 1NRIA 1SUFA 3HUEA 3BZUA 4CMKA 2CH7A 5JNRA 1E3DA 4RK6A 3SS9X 4F86A 1MG0A 4U2CA 1AMNA 4YRPA 1ICEA 3T1TA 2VF2A 3V2UA 2XJ4A 1OCRB 1II8A 4FPXA 5EMHA 4RTSA 2GHTA 2W2MA 5ISMA 1VCMA 2EX3A 1SQSA 1Q0PA 4KWHA 4B3GA 2F1OA 3G2OA 1JEQA 1NVTA 1P4GA 4G0ZA 3B53X 1XYVA 4LZAA 2AYZA 4KR9A 1T2VA 2JH3A 4GLJA 5B1BB 4I5IA 1VYVA 2NU7A 2OGZA 3N6XA 1ZW1A 4FE7A 1R8XA 2XDWA 3X2SA 1YJ9V 2P78A 3CP1A 4JXKA 2BJVA 4Q1FA 1O6GA 2GCOA 3U2QA 4EFLA 1Z2CA 3B9BA 4Z0HO 2ATVA 1IHYA 2AW5A 2X0NA 7REQA 5K1ZA 5KU7A 3I56F 3D6UA 2PFKA 2J9YB 2HGSA 1X9GA 1EZ4A 3E84A 5LQRA 1QRRA 4R8RA 5ALVA 1A3CA 2ZNJA 2W7TA 3TX6A 1KZHA 1VQ7V 4U5XA 3IA2A 3GLGB 4KUGA 2EJ7A 4E3ZA 4KDEA 4CQJA 1Y6JA 4A8JC 1LC3A 4PO9A 3ABKB 3ZMTA 2FWNA 4KO8A 5EQTA 4W9NC 3IKMB 2GJSA 1Z5ZA 4YCJA 3VU9B 5CLLA 1EFRA 3OCWA 5ALRA 1X7ZA 3HR0A 1SBQA 1O58A 3OBYA 3WMRA 1V8FA 5ALSA 3IURA 3N8HA 3F8TA 1M0SA 1UBMS 1Q1BA 4KO3S 3ZHOA 4P08A 1B4DA 4X9QA 5FTKA 5CT8A 4M7RA 2GMWA 1XMQB 4I4NA 2VTBA 3IT3A 1ZM2A 2N04A 5AI8A 4F3NA 4YRAA 1U98A 1PGNA 1AI6A 3ETCA 4D26A 2NMVA 1SDSA 2ZDIA 5JR3A 3JD2A 4HMOA 5DT2A 3PS9A 3DWGA 4YX9A 5A6VA 5A71A 3RU7A 4MDEA 1XA3A 1EP9A 1PJAA 2TMYA 3DLTA 3OT1B 3G7SA 2IY9A 4ESOA 3W2FA 3L6UA 3OI7A 3ZOZA 1G7TA 2A5DA 4R9VA 2ZSDA 1QQ7A 2WM8A 3GPIA 4O1MA 2EJVA 2MK3A 3TD3A 4MUMA 4BKMA 2J3MA 3DXZA 1M66A 1JDSA 4E5UA 1CUUA 3TF5A 5I4BA 3ABTA 3L49A 3MSCA 2OAP1 1ISSA 1VC2A 1GNLA 4RWZA 4B71A 2QWNB 1RM3A 3HUTA 3DTVA 2D0IA 1Y8CA 3UAOA 2I6RA 2GM4A 4CH5A 3TSOA 3HN2A 4XIIA 4MRMA 1S3FA 5IZ4A 4LMRA 3L82B 1YL6A 4IDFA 3PEYA 2NZWA 1OLSA 1NL3A 1YT5A 1ZRSA 3IP6A 5EZYA 1TRKA 3KAJA 4ZA2A 1YBMA 1HL7A 5L9AA 1MA1A 3MBMA 4PDVA 2PM8A 3CLKA 1T0BA 1PO7A 2BJWA 5IAGA 5HY0A 1IBMB 2P65A 3M3HA 4R8SA 1KDYA 3L7DA 5K5EA 3WB0A 3OONA 2X9LA 4Y1GA 3SM9A 1VF6C 1WS6A 2IOQA 2ZI9A 4JAUA 3CEHA 3AR3A 4FM2A 2QTHA 4IGGA 1E3JA 3PFNA 1DEKA 2W6JD 1ZW6A 4EEKA 4GXQA 1IN8A 5TT1A 3PUXA 1RAGA 2EKLA 3TINA 4CDMA 2HQBA 1OVMA 2A7XA 3H87A 1Y3CE 3EXHB 3S0YA 2HF7A 4JOBA 1FMCA 4FFOA 3G0DA 3KZ1E 5C5EA 4QUAA 4IYIA 3I8SA 1ZH8A 2XMCA 3ECCA 1Z28A 3E1GA 5BT9A 3IMCA 3KKQA 2MU1A 4C29A 4NV3A 3FI9A 3L4JA 3HZHA 3EGXA 3PRJA 3J7AC 1UDCA 3A36A 2ZAIA 1NXXA 4BQNA 1I7LA 4DCCA 2GF0A 2O5VA 3T7TA 1AX9A 2CBZA 4D96A 3SD7A 5WRFA 4MPPA 2COUA 1G3MA 2GBLA 2EC5A 3BILA 2WVJA 5GJCA 3AONB 2FW9A 5F98A 4YCMA 1QVAA 1R64A 4F84A 3NDRA 5KX5F 2LBXA 1TI7A 3ISTA 1MEEA 3P30A 2HSDA 2YZ2A 1H42A 1RMYA 4P5EA 4ER0A 4EJ6A 1BCCH 2WUWE 2JCSA 2AB0A 1ZA1A 4FZ3A 1K7XB 1Z0JA 3I64A 5JC1A 2QSZA 5C8XA 2CXOA 2NQ8A 4XIGS 3TVDA 1MO5A 4G24A 3N0TA 4Y2JA 1DOZA 2IPAB 5CW1A 1PHRA 3PIIA 3OKAA 1YZUA 1WRBA 4FEEA 6ADHA 1K27A 3MT8A 2PT9A 3E18A 1TAUA 4EEZA 3NM4A 5BSMA 4EGQA 3THXA 5C4MA 4GDMA 5CMUA 2GBPA 1XRRA 4P22A 3V00A 3TDKA 2FKAA 1BHBA 4EB0A 1N1EA 3OZWA 1FPQA 4ZEOA 3GLIB 1BXRA 2Q3DA 4A23A 5CX4A 4N5LA 4OTZA 4I9FA 3RUFA 1N0JA 4MT8A 1Z39A 1ZMTA 3FTDA 4QPJC 1ML4A 5K3SA 2OT5A 3EVGA 4L1KA 2WWRA 4UXHA 1Q86H 5I8ZA 4Q00A 5GANK 3V1KA 1W1WA 4ENWA 3NT5A 1FQOA 4FLXA 4LDPA 1ISFA 5DBEX 2RNBA 4P2GA 3ZLBA 1WSBA 2QXUA 3P0ZA 4UTVA 1V4VA 4RF4A 1QQTA 3QF7A 2IVFA 4Y3UA 2HB6A 3K5LA 3R5SA 2QWOB 1WXQA 4BYGA 2P2SA 3GWGA 3A6DA 3TR6A 1GL6A 3IAYA 5HMLA 4D8TA 3I61A 2OIEA 4LXHA 5F35A 1L1EA 2HRRA 3CCFA 2IKQA 3HCAA 4B46A 3OOJA 3GGOA 3UHAA 3AVUA 2IPXA 2V6MA 1QVZA 5GONF 4NAUA 1IVNA 1IQ0A 4QYXA 3C7KA 4GZRB 3ROFA 5LA6A 2ZSKA 1RCFA 4K88A 2DQZA 2CLEB 1WVIA 4FM9A 1PZHA 2VQDA 3MGBA 4H13B 3BBPA 1CR0A 1XDWA 4YP9A 3E1SA 3M4JA 4F6LA 1O08A 3I0ZA 3T4ZA 3KB1A 4OL0A 1I0LA 2VSOA 1U28C 1W4LA 4G1BA 4IWYA 3W2TA 4AL4A 1XALA 1BE6A 2ECFA 3CG4A 4HFMA 2VOJA 5F9FA 2ZTMA 4BZXA 1KEWA 2X22A 2HR3A 3QLVC 3AKDA 4ISBA 4CCYA 5EB0A 1SQVH 1GDDA 4MHSA 1SFRA 3ESAA 1OIVA 3T38A 1IJKA 3INGA 2O3SA 5KC9A 1T36B 3E8MA 1UFOA 1XNJA 4NFHA 4CKBA 5DM0A 3PTAA 4UJ3A 2XADA 2WQ7A 1KD1W 3FD5A 1GPNA 4QODA 4GQAA 4Z9AA 1QHHB 4URXR 3RIXA 1IONA 4D0SA 1QIDA 2YWCA 4GPBA 2BEJA 2PUTA 3I9KA 4INAA 3FUTA 5JXGA 1XMIA 1HRDA 2OGSA 5LYYA 4I9WA 1D6NA 2VR1A 5HJEA 3BA9A 4M1KA 5JWHA 2X2EA 4AO7A 1KDOA 3KUKA 2IIPA 1QDUA 3KJKA 2LKCA 1FD9A 3RVDA 4F6RB 3JVEA 3RKRA 4KSCA 1PNRA 1ZU4A 3QPUA 2WA3A 4N1AA 1ZD3A 2XH8A 4E4YA 2OWDA 2OM2A 4JYAO 2BR3A 2TS1A 4MRNA 4A5SA 2QVGA 3QPVA 1X39A 2VK8A 1PQYA 1G66A 4YH1A 4PZYA 4IS2A 4M38A 1R50A 3OECA 4YVFA 3MLAA 3DTNA 1J9ZA 4X7RA 1LLCA 4D8UA 2ATEA 1WHTB 1BOOA 1C5KA 2JHAA 8ADHA 4CH4A 1YIOA 4X9XA 4LFCB 2QW0X 4I9UA 4LGVA 5LVAA 2YX1A 3R3XA 3M0EA 2HMAA 3G2HA 4DYVA 3VPCA 3SDZA 4L6CA 4H7IA 1ZDMA 3GRUA 2HLDD 3V4PB 4X94A 4EPRA 3C1TA 4KR0A 1R4NB 2FFQA 1S2DA 3AHCA 4MV1A 4IV5A 2FWBA 3MBIA 1G2OA 2GH1A 2IIBA 5GIOC 1A9PA 2HBRA 3KKZA 1DSSG 1L7DA 4CHGA 3F8SA 4HR7A 4LFBO 4G8DA 3H9BA 4HBNA 3LWBA 4F4FA 3OM3B 5AW4A 1DKPA 4PBTA 1JIVA 3L8HA 1VHJA 1COWG 1E3SA 1I8TA 1W1UA 1JTFA 3IDZA 4WH0A 3PHCA 4M37A 4EHBA 5HKBA 4Q01A 3R44A 2WWTA 4DV3O 3UM7A 2OTJF 5GOZA 4RAIA 3WYAA 4H0LB 1WCIA 3TW8B 4LRSB 2NACA 5EUQB 2RBKA 3KDSE 4Q3AA 1PCXA 1CTQA 4IVNA 5EQJB 2RHLA 1UJ4A 2H6LA 2BE7A 2C04A 4TM7A 3DCYA 1DIHA 2X5KO 5C7IO 2OMKA 2AUNA 4PLVA 3UJDA 2FZEA 5L3FA 4MAAA 2W6NA 3HWX1 3TQCA 5LNK1 5GY7A 3N2GB 5AVXA 3EVBA 2O4CA 1CUYA 4C4WC 2FU5C 4RVNA 3MWGA 3D4NA 7GPBA 1E8NA 1H3FA 5DTJA 4DDHA 3ZD9A 5F52A 1O5TA 3FCYA 5BSUA 4GKJO 4R16A 3LOPA 4BNHA 5JXHA 2CNKA 3D3WA 4NVRA 3K1AA 1M76A 2VXCA 1BD4A 2PJZA 1V8BA 2GN2A 5EPOA 1J1ZA 5IWAO 1CUIA 3GL9A 3OKPA 5BRJA 1XTKA 4YR7A 4EJSA 4MW1A 4XOUA 4JCCA 3QVGB 1XMOB 5BR8O 2PA3A 4JLAA 4JLPA 3NBMA 1JF8A 4QDTA 2B21A 5D3QA 1C3JA 3F7NA 1WZIA 3GUCA 2BV3A 4XUDA 5ECWA 2F4VO 1K5QA 3O1JC 4UM9D 1WXGA 4ZFNA 2VQ3A 4IMIB 3A0HZ 1NLMA 4KUMA 1AJNA 5E0KB 2CEKA 3E35A 4B6QA 1B8UA 2XOEA 5ADHA 3WJ1A 4BP8A 2ZYRA 3PAFA 5CVUA 3OWXA 3D8SA 1N36O 4Q3NA 4D81A 2FA9A 3QBJA 1Z0IA 2ZJ7A 4G97A 1SZPA 2KSQA 3O38A 4I5EA 1N0VC 5TSDA 2NYAA 4N3BA 3RN4A 2QEQA 3C0KA 3BXFA 4N47A 4QQKA 2I71A 1Q1GA 5CVTA 1PR1A 4NJEB 3GLHA 4Q6WA 5CBGA 3AG7A 1SR8A 1OILA 1AILA 3BVOA 4L72A 1QX4A 1VL5A 1OFTA 1TEXA 5ALOA 3ITNA 3FAZA 2AK3A 4E7PA 2AR9A 1Z62A 4XQEA 3ZVMA 3B6IA 2QWQB 1XQWA 1S1CA 2LQTA 3ZCXA 5HKAA 1QQCA 3PFHA 1KQSF 1RLIA 2PUJA 3IERA 1MA3A 4FBLA 1MT0A 3K2EA 2DVMA 4H7EA 4EVIA 1PBNA 5LMCA 1VP3A 3GLHE 2ORYA 3DEIA 5AM3A 2X14A 2OCPA 1VQNV 1GNSA 1EN5A 2PS0A 3MN1A 4WNIA 4K3VA 4XRRA 1FYVA 5K4AA 1MT3A 4G8BA 4KL1A 2XAQA 2P4KA 1E98A 5EFOA 1NVGA 4OQLA 4DIFA 5LGTA 1NXPA 3EGWA 5KJ6A 3QU4A 3SSMA 3UGKA 3A9VA 3FPBA 3DKIA 5TGZA 4DSTA 3ACBA 5CBPB 1MEOA 3ABUA 1PX0A 1CZOA 3L0DA 2ZRLA 2Y48A 3TCUA 4B3TO 1T3GA 3MUOA 1UQUA 3E0XA 1BDIA 2CFSA 1SBTA 1HETA 3CG0A 2LBTA 1M2OA 5B3JA 4QHYA 5JNLA 3KU1A 2GEVA 3NS7A 1FOEB 1UEIA 2PGLA 5KNCA 2ECQA 4A0FA 4RVFA 3GR6A 2ZSUA 3TOSA 4FIDA 2UV8A 3LQ4A 3X1WA 1DX4A 4MPTA 1KZGB 2C0QA 1BMQA 4PSKA 1EFRD 2AN4A 2E4VA 3HBMA 3BL6A 2X0JA 4UOEA 4WFEA 1E7KA 1TVKB 3WSVA 5J2UA 1XTUA 2X9GA 4LDJA 1EK5A 1X25A 3U4AA 4YNBA 1DDGA 1MEJA 2FMUA 2ZI7A 3RV3A 1TC2A 3QEKA 5B3SB 2VPQA 3BFRA 2R47A 2H3HA 1AB3A 5AG2A 1TQ8A 2JCGA 1KXZA 3OTQA 4HRAA 3ESCA 2Y92A 1DUSA 3X1ZA 1P2SA 4G28B 1R4MA 1Z29A 4OBEA 3A58B 1O4VA 5JJEB 3CLTD 4RZUA 3LDDA 2W4QA 4UFPA 5GM1A 3VPGA 1EWTA 1KO8A 4PR3A 1VARA 2APJA 2H2WA 4UEOA 4OLBA 2OM6A 2VXOA 1HX7A 1ZVJA 1MRSA 4NS1A 2ZIMA 4JEHA 3DTVD 3VNQA 1GT91 4LF9O 4BNMA 2JGRA 3E61A 2FSPA 4RTMA 1IG0A 1EWQA 4LYGA 2J4FA 3BABA 4ITVA 1RZUA 3IXQA 1M74A 1SK8A 1HNXB 3MOIA 3AKEA 2CSXA 3RAPR 4JLUA 1RRPA 2VDOB 2HXYA 3CR3C 4B7EA 4DR4B 4JVOA 2HS0A 1COZA 4U0JA 1VDMA 1OH8A 3AILA 1YULA 5HZMA 4F4IA 4PAQA 4X61A 5IXSA 1YGYA 1HE4A 3G5MA 2NSLA 3A6PC 3HDGA 3QBVA 4N4AA 4WCDA 4BWYA 5FTJA 2BDUA 4JELA 1H94A 5BSVA 2CDYA 4ZOCA 1YDGA 3ZN0A 2VRNA 5CXXA 4TT3A 1G16A 3LYAA 3S3WA 4IH4A 5IN4A 2O2EA 3KQPA 1WB4A 1H5QA 4YQZA 2DY0A 3OLXA 2G04A 1DHRA 3B1ZA 3ZNPA 1JR9A 5GJBA 3PRKE 4RVHA 1ZVMA 3TECE 2JAOA 1FFBA 3ECAA 1I30A 4X00A 1ULTA 4TL6A 3VQVA 1NVVQ 1I2BA 1LDBA 4I1RA 4X6XA 2R1TB 3EK2A 1XXHE 4Y2TA 4L95C 5EEHA 1O89A 4F3YA 3VJKA 2BGNA 1UKVY 2GX6A 2UZ1A 2OCXA 2HVJC 3SR0A 1RLMA 3SFVA 2CMHA 3L01A 1F7YA 4ZHQB 3BMCB 1O8CA 2WBLC 2VHZA 1TLTA 2WOOA 1L8QA 2FMXA 3RV4A 1R5BA 4BU1A 4JZ2A 1ZRNA 2NT4A 2P5UA 1S2LA 3WYNA 1YE8A 4MZXA 1PTJA 4FPPA 4M1MA 3AM3A 2DUJA 2JCXA 2GN8A 2WUDA 3AF3A 3MWDA 3PHBE 1UP6A 2ICAA 4YHBA 4ML3A 2KW5A 2HIMA 2CVLA 1W1IA 2Q9UA 2GDZA 4BTEA 3CW8X 4JYPA 3Q3HA 1ZJZA 1V8ZA 4EHHA 2D2EA 1KC8H 3UOWA 3ESXA 4GE3A 1BRTA 2IX9A 1W4RA 3GJ5A 3EVCA 3CSUA 3WJPA 4QDZA 5ANRB 1N92A 3P4EA 2FSFA 1V45E 4U7TB 2E89A 3G0IA 3VR5H 4FKZA 3MD9A 1JFVA 4X8HA 5BY1A 2JAXA 4E6PA 1HOXA 1NU8A 2YR0A 4GCZA 2DMRA 1IX9A 1RACA 4WFKA 2OHVA 3HY3A 2JEYA 2BFEB 3ND5A 1HBJA 2HBYA 4A27A 5KCZA 3PL1A 3LCJA 4YAGA 2IZ6A 4N0QA 1TTPB 4I9NA 2RGRA 1VQLF 4YRKA 1EUZA 2C0CA 5FJIA 3ZY5A 1ZMBA 4QNHB 3K1ZA 4LNAA 4Q1VA 1RZ3A 4IP0A 4PQRA 2DFVA 3O94A 3K73O 4BRSA 2ZJOA 3NASA 5KVSA 1E9CA 3QHQA 3E3OA 1CS0B 5EJMA 3CRAA 1UPUA 3UJ6A 2Z95A 4RDCA 1EYZA 1ZR4A 4GF5A 1RYZA 2OGUA 1XNGA 4XUCA 3FOAA 1B1CA 1CIVA 4G88A 2VCYA 1ZN2A 3H1JH 3H7AA 3MJEA 3DZKA 2JVJA 3OQMA 2QRGA 5IANA 4D0RA 2NO4A 1EG2A 1ZR2A 5AR1A 4O5AA 1S3IA 4YJ3B 3STVA 4K35A 2PV7A 1DCKA 2NN3C 4XD2A 3UJ8A 3R23A 2OYQA 4JJGA 2ZYDA 4AJPA 5HM8A 1GNQA 4O2AA 4U4AA 2H52A 3D6JA 4XDJA 4PNPA 4CODB 3TLJA 4A8PA 4OJQA 5JO0A 3H7IA 1YI2F 3RIEA 4INOA 3OTOB 4UUPA 3PDUA 1E32A 1EZZA 4FZVA 1FSFA 1J9GA 1QANA 4HPXB 1Z0ZA 3BMQB 4OX9Y 2OZVA 3N2EA 2OBMA 1RJFA 1E6LA 4ZEMA 1X1RA 2XOKG 5JSQA 2P8SA 2Q7GA 2VF4X 3AFGA 3TGWA 4PLFA 3SYAA 4YJHA 4NENB 1E89A 5FUMA 1WZEA 3UB3A 3E3MA 1MJ5A 2BKXA 3CX8A 3BFKA 3RTEA 2G6TA 1KP2A 4BVAA 1W0KG 1QD9A 3KAQA 3QUCA 1F60A 3GYBA 3HU2A 3G2JA 2A9RA 2C4NA 1KO1A 1SF9A 3K9WA 3LC2O 4KO2S 4M98A 1PU2A 4G37A 1QOPB 1YACA 3T9BA 2EGHA 2QPOA 4CIBA 3H1EA 2YHIA 3BWBA 2QYOA 3EZNA 5DHRA 5HY2A 3GVIA 2ZUSA 3TJRA 2B25A 3O2NA 4WJZA 1GTZA 4KVFA 3U4CA 4KACA 1LK0A 3QUSA 1QCEA 2AOVA 1J24A 5PNTA 1B41A 5FBLB 3N8NA 4B5LA 4HWRA 4MIOA 4K0KB 2XZOA 4BJ6A 4UCWA 1DUIA 3BJEA 2WFLB 4JUFA 1I24A 1GXSA 3EHEA 3ZI4A 3GHHA 3E5RA 1W36D 3QA9A 2C8LA 4DZRA 3L1IA 5F23A 4F12A 4HAMA 4DQLA 3JSAA 2YWDA 3OF2A 1CY4A 3GZ4A 4F9TA 2C7PA 3GT7A 4EP1A 1USIA 4U5QA 3VDXA 3PQ4A 1PNQA 5ETJA 5I9MA 1FDTA 4FX2A 1CC1S 4C81A 3E23A 5EKXA 3X43A 4PZLA 4N5NA 1S2IA 4LJ8A 4KODA 1CF9A 4I8IA 4EYQA 1MO4A 2C9BA 4TWZA 3NP9A 2HQOA 4RD3A 1MNAA 1L7OA 3L02A 3M1IA 3MERA 1VMEA 4K2AA 2BGTA 1NJ1A 3P9QA 5CDSA 1M5TA 3VZRA 1W2GA 1F1BA 1JQDA 1SKUA 3KYDB 4ZT5A 4US0R 1V1JA 1KJ9A 3RA5A 3B36A 4GPTA 4P80A 3TRHA 4DYHA 3A4LA 1PJTA 5LQNA 1Q81W 3VR1A 5K2OA 1OV6A 3NC4A 3IV9A 1A98A 4LZPA 3R2JA 5DLEA 3FYUA 3BZWA 4KMMA 1UDAA 3U0BA 2HJ9A 3EIFA 2YWFA 4ROSA 1O4WA 2LDXA 1H93A 1MC8A 2ZT7A 3W2HA 1P7GA 2WSSA 1YZNA 1XL6A 3SVTA 1DJQA 3MHPA 3A3PA 3MQ2A 1Z6QA 2E4ZA 2FN8A 1ROPA 5EJGA 4YMVA 2PJRA 1V5FA 4KQCA 1H66A 2H4ZA 4NQZA 3ETGA 5AICA 4D8VA 3FZEA 4XSGA 1DBIA 5KPDA 1PEYA 1LBHA 1KAMA 3OA2A 5H16A 3KTAB 4L3VA 1S2MA 1VJ1A 1FXVA 2TMGA 3HYRA 4GOLD 4PV1B 3K6SB 1OH6A 4QEZA 3M5DA 1C7FA 5ELMA 1DCMA 1U2QA 2YFHA 2I6TA 4CIWA 4P6VF 5AKYA 2EX0A 1YVWA 1P7PA 2IOYA 4AF8A 1O0BA 3EWSA 5DF1A 5GGYA 4BFUA 4J0JA 4L5YA 3LUPA 4N01A 1NUAA 3L0YA 4UVAA 1CT9A 4M6WB 2RKOA 3SJZA 4D4MA 3MUFA 5CP8A 1O57A 2WFAA 1X0VA 1XEAA 1NR1A 4H1HA 2MQEA 3HMKA 3FMOB 4EHAA 4R9UC 2INGX 2NQTA 3S7ZA 4AX8A 4LZLA 1QG2A 1USGA 2CW4A 2ZYUX 1SO8A 2P3QA 1NI8A 2X5JO 3G0HA 3FDFA 4X66B 3NBXX 3TQFA 3PC6A 4LZNA 5I9IA 1EE1A 3RS4A 3AEQB 2EX4A 1NLUA 3AI3A 2GCPA 4HNAB 4HLQB 1BRMA 1RC0A 3ZX6A 4I9HA 1N2HA 2HI0A 4KXQA 2GZHA 4LFAO 3AIMA 1EFPA 3FCXA 2ODWA 3JCMM 3NOOA 2YHBA 1XNRO 1FFHA 1RXYA 1I5RA 2YV1A 3BS4A 1H65A 4C8IA 5C9ZA 1NXTA 3IDSA 2IP2A 4H1UA 3P71T 3TYXA 3AZPA 3GELA 1I5EA 4CC6A 1CUFA 4J42A 4ZU3A 4DANA 3LIIA 3CLSC 5K8VA 2IZ1A 5DM4A 4ZHQF 2VJPA 5EJ2A 3NBYC 3AO0B 2ZIXA 4UAVA 3WXBA 2QSYA 4I0WB 1S8NA 3M83A 2YMQA 1BXZA 4JDPA 1OXXK 4BKRA 3IP5A 2GAFA 2OP1A 3F5QA 1ZX1A 4DNFA 1GPAA 4CMEA 2G1PA 4XWAA 4D6YA 2YNMC 3O74A 4NCBA 4RHAA 3QHPA 5G3YA 3ZWMA 3WQRA 3JY6A 4ZQFA 4B2LA 3BREA 1JLRA 1SKMA 1O94D 3L7KA 4HDMA 3RG2A 5M5BA 2RH4A 3AW8A 1JHDA 4BIUA 2HA3A 5D3KA 4O4LB 2Q5OA 3I55F 2MSWA 3HKCA 1NX6A 1U94A 4MA5A 3T95A 2EILC 1EHCA 1YJWF 1GZ4A 5DBIA 2OV3A 3PX7A 3RU3A 2RAFA 1BVUA 4QATA 3JYPA 4FZJA 1Q7EA 1JALA 2CTQA 4GLOA 1T3TA 2CDCA 2WEKA 4JB3A 2PMWB 3JQ8B 5A2QN 3C3BA 4ZI7B 1THMA 2BM0A 1E20A 3HB5X 2VNJA 1CYDA 1H38A 1QK3A 3GVXA 1P2BA 3HBFA 3CCLF 4WWHA 5TLSA 1IUPA 2XTZA 3GDOA 2ZU6A 2RCVA 1A9TA 1SNYA 1PYGA 4JUAA 4ZOLB 1SM4A 1Q92A 2XI4A 3AUXA 3MHSC 3CZCA 2PY5A 3IOYA 2RJNA 5KZMB 1AHHA 2QT9A 3DC5A 1V1RB 4D43A 4PHZA 3OZTA 3WZLA 4V1CA 3BL8A 3NHWA 2AZTA 5KNCD 1NPYA 3RLIA 2OHXA 1FP4A 2AWNA 4B32A 4P5DA 1LW7A 5TQ2A 3T41A 2OCBA 1GFSA 2XQFA 5C8VA 2C2OA 3HBJA 1LTKA 4FYMA 1WDKA 1R6TA 2REOA 1YBVA 1YMUA 2RIPA 3UYLA 5IC4A 1QP8A 2OAEA 4E4RA 3B5JA 2UYNA 4OK6A 2JFOA 4BAUA 5CYOA 4MQEA 4R5HA 5IZCC 2HP8A 3RWRD 4EO7A 2RAUA 3Q3GE 2PL5A 3NYWA 1WQ4A 4GVLA 5CUQA 2YDXA 3ZCRA 2CGNA 1D2NA 4DV6O 5I7HA 1GILA 1SJ9A 1U3WA 2C98A 3CF4G 2C3MA 1KIAA 4IYHA 5FLXM 1WUJS 4UTXA 2P4EA 1OFUA 3AB7A 4YJ3F 1CG6A 4OI2A 5BWNA 5D6OA 4BUJA 4CM6A 2AL7A 2ZJ0A 3QEBZ 4CMJA 1IJFA 3PCRB 2FQYA 4ZGWA 2VWHA 5EQDA 3UB4A 4XLTA 3CZAA 3T4PA 4FD3A 3GVMA 3JQCA 2PSFA 4GLLA 3U11A 2UYOA 2Q4PA 4RDXA 5G4LA 5EJFA 5EWMB 3SLGA 3A0UA 3SPXA 1E4VA 3MWJA 2CLMB 5G1OA 3VHXA 1SB8A 2XMRA 2WR8A 4F2WA 2F3UA 2FQXA 1OWMA 2D13A 4WNYA 2PSEA 1AOXA 3WIEA 1OI7A 4E70A 4C05A 2FUKA 5TF0A 2X0KA 3LPDA 3E7DA 4N3CA 1FDVA 4UHKA 3TLKA 4W7HA 3AY7A 2O57A 1YU9A 1Z7BA 4KFUA 4E0BA 1MAVA 1FCJA 4MWCA 2FQQA 2MOKA 2Y0DA 1GITA 2G63A 5CVVA 4ZVRA 3SMQA 2CXHA 1E7SA 4DGSA 2GDSA 3ZJ4A 4E07A 3QNWA 4R8MA 1AF7A 4KITB 5BYKA 5LZ4A 1SC1A 4I55A 4NDNE 1JIQA 5KYUB 2X8WA 2XXAB 3C7CB 4DPMA 2QX6A 1G1AA 5BNZA 4TT3D 1M83A 1I5XA 3LIPA 3BTOA 2JFUA 4PPQA 1J5PA 1G0NA 5DNAA 3VKVA 5JTUA 2IYZA 5IAEA 2KX7A 1YBHA 4TWRA 5DGTA 4ZO6A 4O2RA 4NKGB 1FU4A 4JBGA 3D6HA 1KUQA 3UQYS 3K12A 4WOCA 4TOIA 4KDRA 1GYRA 1U9ZA 1B6GA 3ZGOA 3BY6A 3D6VA 1PG0A 5H4HA 2JJ2G 2J0SA 4BFCA 4FUTA 1ESDA 4UUJC 5HCUA 1JTEA 1JEOA 5FLEX 4KN6A 5EIFA 4LSGA 5G3ZA 2VXBA 2V5VA 4KP4A 2GPTA 4S1WA 2O3JA 2NN4A 4PA6A 1YUMA 1HPLA 1M2VB 1BKSB 3DFFA 4AIRA 1JR3A 3BCRA 1GZ5A 4KFTA 3KHKA 3CCQF 4L5AA 1SQBH 2QX8A 5IAAA 3LRXA 1F0YA 4G5HA 5A2QA 3GG2A 3EA4A 3T1OA 1PR4A 1XCMA 3Q6MA 3GMIA 1S5LZ 1JIUA 2AOXA 1W93A 3PPXA 1LX7A 3PLNA 4AD8A 1IIRA 1E5QA 3SYPA 4WF9V 2I6UA 4EF4A 3RWOA 1E2LA 1M7BA 3WKEA 5KNLA 3TR0A 3SHWA 1MKYA 5A4JA 5C46F 3U3OA 2X9NA 3CRMA 2JATA 4TLEA 3ERNA 4MR8B 3LYUA 2F1KA 1JECA 3C15C 1QCYA 3UPUA 1DV2A 2RC5A 4QTZA 3EQ6A 4V0RA 3B3JA 1EEHA 4X1YA 1QVRA 1YOVB 4UHJA 3HVHA 3BCSA 1LBSA 5FI5A 3GDWA 2CLKB 1MV5A 3HRHA 1IH8A 3HCNA 3PGA1 4IQ0A 2C1ZA 4WEOA 1UQRA 5K0TA 4RLSA 1F3OA 1KI1A 5A1TA 1UC5B 3CGGA 3KLMX 3ZYCA 2FCAA 1ADJA 3H8VA 5G2OA 3ITKA 1GQFA 2CL0X 1EX1A 3V8QA 1NI4A 4QQNA 1QS0B 1GAJA 3THWB 3U44B 2DOSA 1FFGA 4M49A 5A7GA 2XQIA 2Y1DA 1G1MA 1NQOA 3P0FA 2PCLA 1XT6A 2C58A 3BSYA 3VVCA 1E9SA 4P7BA 1ZUHA 4OXXA 4U7WA 1U97A 4MUGA 2H48A 2QUBA 1DZ3A 4MJ3A 2JFNA 5EIAA 2QN6A 4EI2A 5DXFA 3QEOA 2X5XA 4WXYB 3RSCA 3K4HA 1PR6A 2JC3A 2DF8A 4EJ2A 1LRKA 3K6JA 5ENDA 3IPCA 1R5OA 1I0IA 3COVA 1FDOA 2IYTA 3L7NA 1ZS9A 1ZN9A 3B6ZA 4XUEA 2XXJA 1R0BA 3K9QO 2CEAA 2D62A 1W19A 4LCEA 1G4AE 1F2DA 4I5SA 2B7LA 4G0VA 3TJTA 1S5JA 4QWWA 1MB9A 3OC0A 2GNOA 2NR5A 3TD2A 5F2KA 2DQKA 3K0GA 2AZDA 2AV6A 1KY5A 2WTXA 1OTXA 2GLTA 2IE8A 1WXWA 1SUCA 3KETA 5DN6A 4V2IA 1U96A 3KPYA 4QASA 3ON5A 4EAAA 1VQKF 1GAXA 4D9CA 2BPOA 2O6LA 5BV0A 2FWPA 1YGPA 5AJZA 1CETA 3I9FA 1HY3A 4W1RA 3CPSA 1ND6A 5LNK6 2CK3G 4Y1FA 3RSSA 5FTLA 3GU3A 1ZIXA 4UVCA 4MRPA 3V6MA 3AVTA 4K5QA 2Y1WA 3DDHA 3HP7A 3VDRA 3H0KA 4GRDA 1R6UA 3LS2A 1PQ4A 4L0MA 5FTNA 3CUTA 3A3OA 3CH7A 4EQZA 1P3JA 3BWYA 4S1VA 4PPYA 1LQUA 2OV2A 1NUPA 2WTEA 1A95A 4O4LF 3B2QA 3NJ4A 4JXZA 2VH1A 2PLWA 2B1GA 2JFHA 4BMOB 1AP5A 4UVEA 2XD4A 2NG1A 2NPOA 4V2UA 3T9DA 4P83A 2AZ0A 1KI6A 2VZEA 1XTPA 4ZI7F 2V3CC 1JUDA 2O2DA 4G5FA 4RJLA 3TX2A 4BJ1A 4CKCB 1P91A 3K9SA 1CFZA 4AS3A 5FOTA 4ZOLF 3U48A 4KRXA 4HAXA 1B14A 1VBMA 1OB5A 3CD6F 1Q11A 2RAVA 3ZHRA 2F43A 4LY0A 1GFWA 1TZCA 2QWRB 5HM6A 2VZ8A 4NYIR 1WHSB 2B92A 2ZI6A 3K0FB 3T7KA 3OX3A 5L45A 2Q6VA 3BJZA 3G2QA 3NTRA 1Z3CA 1IBKO 1OZGA 3SU8A 4GSKA 1N34B 2K87A 2VJMB 1NBEA 4BJ3A 5DE3A 3OFNG 1J6UA 3R0IA 3F6RA 2WZCA 3M34A 1JQJC 1TE2A 2D8MA 1DBQA 4EB6A 4YDSA 2H17A 2YWXA 3BXGA 1RJGA 2NZ8A 2WKPA 2MSDB 1RXEA 1K63A 3IQXA 1MNGA 3O9VA 2EZ4A 1XTQA 2GKOA 1RSOB 2XNKA 5GV8A 5KJEA 3K59A 2W37A 1PDWA 5KAMA 2QIOA 2W2KA 2KQUA 1VK3A 4FGZA 3FFAA 3S5UA 2DBYA 1QXSA 2HA0A 3F98A 4UHBA 2VQFO 5LP1A 1YJ8A 1G19A 4RA6A 3Q2OA 1T4CB 5T7BA 3VVMA 2XLCA 1UJ2A 4AW9A 1PQUA 3DXRA 3RFRA 3TAHA 2V7PA 1IZ3A 4BEJA 3WBKA 3IAXA 4PLHA 1FA9A 3IDAA 2WWIA 4ESHA 2IXFA 4IOJA 1GSHA 1JSCA 2P2NA 2RGUA 5L7YA 1KQGA 6REQB 4KK4A 5GTIZ 3VJLA 2FPMA 4V0OA 4HV4A 4POAA 4Q1EA 1JHZA 3NHKA 5HF6A 2NOAA 3G5LA 3OZVA 2P0YA 1GLGA 3H3FA 3HVUA 4AXXA 4HRYA 4C2AA 2QN2A 2JASA 2XYPA 1EFLA 1NVPB 1G59A 4YYEA 3NEAA 5AI0A 2B1IA 1IM5A 4BRWA 3IR5A 2A06H 2OTCA 1P1HA 3KV3O 1KAGA 5MN5A 3ANSA 4LHEA 4HH4A 1ZU5A 4BVTA 4FLMA 4Y6OA 5BYJA 4EABA 2BMVA 2YW2A 3FXAA 5J1SB 2KTUA 1TZMA 3RS9A 4IJQA 2D7DA 1P72A 5ALJA 5K01A 1PXWA 1FQJA 1FDIA 1AURA 4I50B 5IYZB 3UV6A 3IMFA 3QVJA 4MWTA 3C3EA 5JC8A 1CXZB 2Q3HA 4BNGA 1O9HA 4PNZA 4DA4A 4DWOA 3E6AA 1UDXA 2O2SA 5HF5A 3E8GA 3EARA 3GA5A 4DDMA 2O2XA 4MWOA 4RHUA 3V4OA 1MX9A 1C9MA 2VDPB 2DOKA 5T3YA 3O3NB 1TM7E 2A3QA 1F9EA 2OORC 2RGWA 2WJHA 5HBGA 2WJWA 4LWQA 3BC1A 2V4DA 4LVNA 4QDJA 2HK6A 1T8YA 4Y8VA 3ZWXA 2MMCA 4R5MA 1NZDA 1YJ5A 5HJ2A 3CCCA 1FUEA 3H16A 5TV2A 5HILA 4QEKA 1YCFA 3VH3A 3FG9A 3OW2U 2GNPA 1QCCA 4G36A 2J6CA 3FA2A 1NJGA 3NWBA 2BLNA 3RSFA 3CJTA 3HDTA 3PFGA 4RBNA 2OUKA 4YIKA 4AZTA 5JVDB 1Y3AA 3AVPA 3DJFA 1GRNA 3CSXA 3A1NA 1LKZA 4MW9A 4WLVA 4GKVA 3MJHA 5TQ0A 1Z0DA 2UUAO 2BE9A 3DE2X 2VAWA 3EVTA 2KB1A 2BFCA 3OTFA 2PVCA 2O1EA 1GQOA 1TYAE 1SOVA 4QRIA 4UOQA 2VHQA 2C5GA 4AJ1A 3GP3A 1JYEA 1IJEA 4YUWA 1W8DA 2JIZG 2DW4A 4Q21A 2P1DA 4FEAA 4MX8A 2JL1A 2O8FA 4MJLA 2GJ8A 1GUZA 4G0MA 1QLNA 4DM4A 1J06A 3ABLC 4QJ5A 4J80A 3QY9A 3T5BA 2CZCA 4OQXA 1G8PA 1NIPA 4BB5A 4QPZA 2WZDA 1RPJA 4WXPA 2FN9A 1NPTO 2ON6A 3PUVA 4MIKA 2ZPTX 2EKPA 1DAFA 1DOHA 4WBXC 2XGOA 1RM0A 5BN3B 3HY4A 3QXGA 3OVMA 5CM8B 1MNQA 1HQCA 3VR4H 5I7SA 4CPDA 2F2TA 2RKWA 1WMBA 4JH0A 4ARBA 4L85A 4IVQA 3AFNA 3BF8A 1XRLA 4DDKA 2F1HA 4GP9A 5L3QB 3KK0A 4RD1A 3M33A 4KLCA 1RM4A 1KQPA 3COPA 3KKOA 3GDGA 3DXFA 4B75A 2I2DA 4G5XA 1PGOA 2G4CA 2I6XA 1I3KA 4BQOA 4N18A 5F1PA 2OKCA 3AHDA 1YQWA 4JB2A 2I4OA 1VYHA 1OFUX 1EUQA 5KA6A 2BRUC 1KJNA 2WLHA 3HKEB 5CCEA 2WKWA 5LIPA 2ZCUA 1NATA 2D2VA 1WA8A 3EGEA 1QU2A 4OPHA 4KN9S 1P5RA 5BY2A 2GK7A 4X24A 1QU3A 1LTHR 1GPH1 2NO6A 1AKRA 3W6UA 1QFMA 1UFVA 1BE8A 4QC2A 1JQ5A 1L4HA 1E9AA 5BW5A 1WXXA 4OJYA 3OEEG 3KVOA 4OGLA 4ZYUA 4DR1B 3I1YA 1AUQA 5DHTA 1LLFA 3ICOA 5KREA 3HJRA 3PV0A 3JAKB 3ORHA 2F6RA 4QBKA 7ADHA 1RP3B 2PXXA 2PGXA 4D82A 8LDHA 3V42A 4HLDA 1Z5VA 4HZUB 2F7SA 2H5IA 1CUVA 3KUCA 1Q7TA 2PBFA 4ZIBA 2XBUA 3NONA 2CZQA 2A4MA 4XB1A 4L5BA 3L3BA 4NJOA 3MT9A 1ZUWA 4EPTA 4JBWA 4JBLA 1VPLA 1TKCA 2FYUH 2FZ4A 3DZGA 4RVUA 4NQRA 1ZUNA 1NOIA 2QSUA 1FY2A 2W42A 3FSGA 1MB2A 1S6YA 2VZ0A 1QH1B 2QTTA 3CUEF 1VJ5A 1NQUA 5C34B 3Q8XB 4KGDA 2P6JA 1RJ9B 1K4DC 4W6ZA 3VGPA 2VHWA 4GMFA 4UAUA 4I8XA 2BM9A 4CL0A 2AJCA 1QMGA 1VPDA 2V4UA 4BO9A 2QLBA 2N48A 2ZD9A 3MNFA 4M55A 3BH7A 1HLDA 2EHDA 1II9A 5AHOA 4W99A 1UBTS 2VAPA 1OF1A 3H2IA 3UZUA 1KJYA 5DMXA 2YJ6A 3TW6A 1YKSA 3VV3A 4NVPA 1L5OA 3K03A 5FBRB 3WL6A 1S0VA 3G9XA 3H4MA 2AHOA 2A9OA 5FULA 3Q9SA 3KSAC 2YYSA 2P2CA 4NZYA 4Q93A 3BXHA 2P2LA 4JI7O 5LU9A 3KEMA 3QFHA 5LLDA 1JA8A 1LDYA 1MA0A 3GJRA 1TF2A 1L4GA 1U5BA 1MOFA 4PONA 2OILA 3OT7A 4BQFA 1CNEA 4OKIA 1CSEE 1DVRA 2VRBA 4PYKA 5KWVA 3HI4A 4A16A 1OTHA 5AJTA 5THXA 4BUCA 421PA 1J1IA 3QNUA 3CC4V 2AI3A 4P35A 1PV4A 2PKQO 3M89A 2A88A 4I4TA 4DO2A 4PYQA 4ZQCB 2BGUA 2P77A 3D00A 4I8DA 3UCXA 5DEIA 1WB9A 3JQFA 1E5DA 3GFVA 1CZHA 4Y1EA 4QX6A 1JR3D 4XLLA 3HSKA 4E2ZA 1POXA 1YNOA 1QR2A 4B35A 4HVTA 2JG3A 5DULA 5A9SA 2FG6C 1G2PA 5LWQA 1SRYA 2E5LO 2Q41A 3WNBA 1DIAA 1L3BA 4PSVA 1X70A 4CKEA 2YZNA 4MLPA 4E4EA 1WF6A 1UBHS 3MW8A 1MC5A 1URFA 2QLFA 4HKTA 1G1XB 1W49A 4ZQEA 2VATA 1ISMA 2QRHA 3ER6A 4OM8A 1OXSC 1QZZA 2WU1A 1DEOA 1AKNA 5F5NA 2Q4DA 3RRMA 5KMGB 1KA9H 4HGNA 5HGJA 3EB9A 4J9UE 1Q1EA 2HPAA 2BBSA 2JW5A 2Q5ZA 5IXYA 3R77A 3QIAA 3WDLA 3CLRD 4ZAZA 3QW4B 3QVNA 4DG9A 2EIMB 3FM9A 2FYTA 1Q95A 3VR3A 4JV5O 3AR2A 5IVHA 1U1GA 1OTYA 1DI0A 4TKVA 2P6RA 2QYTA 5D3ZA 1KO7A 3NHBA 3IBGA 3LFUA 2N74A 1HUQA 3PGLA 1YUNA 4GMDA 2KBEA 4H08A 4I3GA 3CLTC 4RSMA 1YR1A 5FA8A 3CG6A 1R8JA 4HH3C 3JD0A 4QUKA 4BCCA 2JBAA 3CMCO 5K0BA 3FMPB 1I2DA 3OCUA 3PR3A 5K3DA 4DUYB 1B06A 3HCCA 3P9XA 3KKYA 1H2AS 4AF6A 1HYBA 4DLTA 1Y4UA 4B6PA 3PN1A 4I50F 3SOPA 4FDUA 5IYZF 2JB9A 2EARA 3RAGA 1FP2A 4UATA 4O0MA 1US8B 1RHQA 3BA6A 3WDKA 1YASA 3AP2A 4UC0A 4BMXA 1QRSA 3KZMA 1YQ9A 3BJRA 3CF2A 4B6OA 2VHYA 2AMYA 1GZ7A 1M7GA 3LRTA 3IUNA 2VRCA 4GPIB 3WOHA 1P0MA 1WP9A 3RLFA 3Q3VA 4GYCB 4B3MB 5DYNA 2C61A 1BHJA 1R9GA 1UWLA 4CIXA 3TXSA 3PNQA 5IY5C 4JVNA 1NVMB 4QARA 4J2OA 3R5XA 3T61A 1NW3A 3BICA 1MF7A 2O8BB 5JD5A 4RPKA 3AGPA 5DN6D 3RIYA 3C8UA 2XB9A 2RBEA 3QJYA 2Q7XA 2Q9BA 4D0GA 4B09A 4RIEA 2LE0A 1T0JB 3JAMM 1M6EX 3ZWDA 4XCXA 5DXAA 5JVDF 3PWTA 1TMYA 1XHOA 4AY2A 1NMSA 1SIWA 4BZPA 3ZH2A 5EHXA 1PWYE 1K7SN 1LVGA 3JQBA 2YJNA 4OLHA 4IQ4A 3UVEA 4H18A 2Z57A 4YR9A 4J11A 4BEWA 2XUFA 1D2AA 3S1LA 1UZAA 4S1TA 2H6EA 5K4GA 4YRBA 4Q4JB 4E14A 4BYMA 2VNIA 1SBIA 2VWKA 3DE5X 2Z1NA 3GIWA 5DCLA 1EZJA 1J42A 2HWXA 2OEPA 4R98A 5CAEA 5LXTA 2PH3A 5DRYA 1RWVA 3EFOB 3KZXA 4DR3O 3B5EA 2Q2VA 2D1QA 2C54A 3EPPA 5CLJA 2X7XA 1A7JA 4UEJA 4IT5A 2W8BA 1C81A 1OA0A 2ZP1A 4YV7A 2I2WA 4C3UA 4UBJA 2WSBA 2ZKLA 1MAAA 4FDAA 4WX2B 4WA8A 3UPDA 1MX5A 3DHNA 5B5SA 4BFSA 1U2GA 1ZBDA 2CTRA 2QA4F 5JZMA 4LF6B 2ATCA 2GYVA 4KR6A 1K98A 5TT0A 3GLQA 2D2XA 4ZAYA 2FRVA 1FVFA 3LWQC 1T13A 2VSFA 4C82A 1THTA 3WFZA 1SQ0A 3O75A 3GRPA 2QMUA 2O50A 3HYSA 1XXHA 3P2MA 3NTUA 1Z6PA 4BS9A 1FW8A 5EP1A 1N5DA 4NPCA 5BN1A 4YRLA 2R25B 2XDQA 3N74A 3W06A 2BMWA 3OQ6A 2AKYA 3V6LA 4O33A 1DBSA 5E1AC 3S8YA 2BISA 3PD7A 3OQHA 2P4VA 5M3BA 4RPGA 2KM1A 2FP3A 2UUBO 1PKXA 2RHCA 2R5WA 5LGNA 2D5LA 3OGCC 2V7GA 2EHJA 4E5VA 3RUEA 4NAHA 4EO4A 3K8OE 4JFAA 3HXKA 3K5MA 1JLHA 3G6KA 3CCEF 4D4LA 3AR8A 1JAZA 4MB6A 3ONNA 3IA7A 1GHTA 3G71V 3X1DA 3V7EA 5B55A 5H83A 1RABA 1BS9A 4AP6A 5LMZA 3MAJA 3GNTA 1AR5A 1M5UA 4MVOA 2I33A 1SCBA 1CQIA 2OC4A 4RIGA 2WSIA 3C48A 4DYDA 3UOAB 5KKNB 1HTBA 1KZYC 3WIBA 2OG1A 2LW7A 3VZSA 4I5GA 4ER7A 2H1RA 4OXYA 4O5OA 3GT0A 1CVIA 4NF2A 1KDZA 1FFTB 1R8SA 3R0QA 2CCKA 2ETVA 4PSUA 2OQVA 2JKZA 9ABPA 3DZ8A 2ZINA 3RVYA 3H2YA 3JYNA 2FB9A 3TI7A 2JFBA 4CM8A 4RJTA 3OCJA 1KVSA 1L7AA 4B3JA 3JCZA 3KV1A 1MD9A 2H57A 2Z3VA 3VR6A 3N4ZA 1TF7A 3ABZA 1CN7A 4KQXA 1PEAA 3I30X 1IK6A 3OIWA 4ALIA 1QRTA 4OMUA 4LRWA 1DKLA 3UCSC 2SHKA 3OZXA 3QO5A 4RJ2A 2GXSA 5EIOA 4RELA 3CE2A 1SRQA 2Q1TA 4TS4A 2ADMA 1WUTA 2Q5EA 5LLTA 4WT7A 2YS7A 4K46A 1MENA 3T35A 4BP1A 3GRFA 1H9AA 3BHMA 2KWIA 1M33A 1DAPA 1Z8HA 1QLWA 2V59A 3VISA 2QENA 1YMQA 1D03A 3N86A 3AWIA 2DGDA 2FF5A 4W5WA 1KD1H 5F2NA 2W2OA 2O2YA 1W36C 3CMAV 4DQDA 1QONA 3V7UA 4J2HA 3WDMA 4TWIA 2D5CA 3AJEA 1T5HX 2Z4RA 1U9YA 5CA1A 2KG4A 1JB1A 1B0AA 2NSJA 1R6KA 2J33A 3K09C 4RXTA 3HACA 3LG2A 4Z9YA 1UM9A 1Y76A 1GN8A 5AO9A 2ECPA 3OY2A 1ZKDA 3KYCB 4YT2A 4L15A 1F5SA 4IBOA 5JJCA 4TSRA 3FWYA 4B7AA 5GIPE 1H22A 1U9CA 3UENA 3KR1A 4PLTA 1ZD8A 3NBFA 4II2A 3A1CA 1INLA 2B8NA 4Q1AA 4HLCA 2UUPA 4YRFA 4AO8A 5TMDA 4KBYA 5AVZA 3MS7A 1C1DB 2B2XA 4I1UA 4KR2A 4MR7B 3WG7B 2XAAA 4HQFA 2PUSA 3LXUX 4C78A 4DV2B 1CRQA 1NXWA 3BJIC 3SZRA 2GPSA 1SOMA 2B9VA 4W82A 4LOLA 4I7ZB 4UNNA 1JH9A 5C5CA 3GGCA 1PR5A 5GZ1A 4NMHA 1AR4A 3BORA 5IYCO 2GZRA 5KI6A 2XKJE 1L5NA 1CVRA 1NOJA 5A5GA 1RMTA 2JJ1G 1A27A 4RDIA 2OHIA 3OX2A 4UDNA 4Q3KA 1OU0A 1PJBA 4ZVKA 1PL4A 2Q3FA 4A1FA 3DZDA 4E5DA 3DVAB 1FFSA 3FZQA 2OQ2A 2I2XB 1U8XX 2EV9A 4MVJP 3AC0A 4G2KA 5CFZA 3U3RA 3CCRV 5IMSA 5TGDA 3CWCA 3N28A 3RKUA 1QKIA 1REQB 2OFPA 1U90A 1Z22A 1I94B 3PTLA 4KG7A 1OD6A 5GVSA 1EUDB 4C2UA 2KS6A 1W5BA 1R73A 4V0SA 3RUIA 2JH9A 3K3PA 1APBA 2QXTA 2UVDA 5EIBD 3R3ZA 1U8UA 5HHTA 2X3FA 3TI9A 4WSOA 4JGSA 4FN5A 1C4XA 1Q50A 4QJIA 4CIVA 4Z49A 3VKUA 3G6BA 4TYPA 1O9BA 1NZFA 3GG9A 2BF4A 3NHUA 2YWJA 3WGGA 1JTVA 2LUOA 2AWOA 4GR9A 4Z4IA 4CLOA 4EJSC 3GTZA 2VQEB 1VMDA 4I3HA 4N5HX 1HFWA 4CL3A 1U8AA 4KW7A 5M04A 4QRDA 1L7EA 3D3IA 1NC1A 3DV0A 3F7MA 4Z5XA 1VQ8F 1SVNA 3NT4A 5C32A 5LP6A 1G38A 4B8YA 1ONOA 2RGAA 3WLOA 1VQ9F 2Z2IA 4HNVA 4E51A 3WLKX 1XDZA 5ALMA 4RTNA 4EHKA 3AESB 4WLNA 1ZM7A 2OPHA 3FSGD 3H1LH 3CCBA 4QNNA 5JYCA 5THQA 1OGJA 4KXNA 3ONDA 3PEFA 1DAKA 1RD4A 4QYIB 2H07A 5KYXB 1QU7A 3EXFA 3CVYA 4QSMA 1QLHA 3L1KA 4YGXB 2XTMA 2R00A 1KOLA 3JARA 3O4RA 1O87A 3WLPA 1EM8A 1I51A 2WWXA 1KJ8A 4DB4A 1U9JA 3T3OA 4KNVA 3KVVA 1A7AA 1J90A 4BWAA 1FU8A 1LBIA 2PGOA 4A6XA 3BTSA 3VC3A 4OG2A 1NJ8A 3ML0A 1CP2A 3CLUD 1TXGA 2GQ0A 5FNVB 4LH7A 2ZWMA 4J0HA 2XMBA 3SSNA 4GT1A 1OV9A 2F8LA 3OUUA 4Q3LA 2CFOA 4LECA 1H85A 2WNHA 4P86A 1TPYA 3L6CA 3LDCA 4B7ZA 3TLBA 2CHTA 3SYRA 1BX0A 4G4VA 4J0KA 3AF2A 3CSSA 1O94C 1S8AA 3R9KA 3VKWA 5K0SA 2H2FA 2I2CA 1VLMA 1WUKS 3L7BA 1SUSA 1GPMA 3IL2A 3HHPA 4MS1A 1BAPA 2QNBA 1N2IA 2RH9B 3R7WB 4ADSG 1PBTA 5AMXA 1QUFA 4ZOBA 1NV8A 2MDTA 2ZIZA 1FYDA 4OHYA 2E6UX 3G8AA 3E05A 4ZYVA 3W04A 4NUTA 1NYTA 2IP4A 5JLJA 3DP7A 1Y8RA 5AYVA 4O8CA 3WNCA 3SYKA 4MVMA 1PL6A 2YUAA 1JY8A 1RPTA 4O3FA 4D98A 1XI2A 1XCPA 4RK4A 3FGPA 2J32A 4QUBA 4EG1A 2XUKA 2B3TA 4MJ7A 3VVBA 1B74A 4RW0A 1N36B 1QGED 4FW8A 3FVVA 1DRVA 3G85A 4RJKA 4AMZA 3IEPA 2QLNA 5L51A 2AG0A 4O29A 2CD9A 1KYXA 3EC2A 3IBYA 4C7OB 3ASOB 1Z4JA 4ZK2A 1IN4A 4PGHA 4EPVA 2VJKA 4PSDA 2Q5JA 2XVXA 1LDMA 1V11B 2JAPA 3X1MA 4JZGA 4G63A 3ZW7A 2HUPA 4QWMA 5JATA 3BWDD 2RQ6A 4MW8A 1TKBA 3FBGA 4DNOA 1R6NA 3LZCA 5KVCA 3BWMA 3GUZA 3PQCA 2PV0A 5M7EA 3QE3A 4GMKA 3A2NA 3OMAB 4ILKA 4JI8B 3EJWA 3G02A 2PRSA 5EWJA 2OB2A 1JZTA 1FXKA 3UMFA 4KFRA 3ZU2A 3M49A 1J25A 4YJFA 1Y9JA 4J49A 1WBBA 4Z0PA 3JPWA 5J1TB 4AKIA 1P7WA 4QYTA 1ZD9A 1VKHA 3UXHA 2WYOA 2K2WA 5CNIA 4GOND 4EW3A 3PIRA 3VR3D 1S01A 2AW9A 4U9HS 3B1KA 4H35A 2F1IA 2VC2B 3ZCTA 4KGZA 2R8YA 4ZYTA 4CV2A 4N5MA 1Z88A 1V3VA 2BFDB 1F4LA 1ESCA 2ZJ5A 2XUAA 4JOCA 3GQBB 3P5SA 4ZC8A 2QN7A 3BT7A 4YAJA 5K0EA 4WFHA 1NUSA 4W7IA 1JKJA 3QMWA 2W6IA 5AOVA 1CF2O 2NV0A 1EBBA 2YEVA 3CYPB 2Q1WA 3N9IA 1C9NA 3Q5GA 4I1IA 4QKQA 4MUXA 2WG2A 3U7RA 2J07A 1P39A 5KHIA 2CJPA 5G0WA 2H2HA 2ZWIA 2WPDA 2HQRA 3PE3A 1KMMA 1RI4A 4DIDA 2CHVA 2C78A 3AK2A 1T3LA 2ZYHA 1U81A 4OFBA 3G2KA 1LF5A 1P7YA 3BCUA 3H65A 2VRCD 1SCJA 1UMDA 4D4KA 4DJ5X 4MNTA 4G5QA 1CS4C 2J9XB 5IM4A 4LYJA 2I55A 4YMTA 4JI0B 3CM0A 3CRZA 1LI4A 3P52A 5B58T 1JDBC 1J7KA 1WN7A 1GTSA 3PC3A 4KQ6A 4DC9A 5DNWA 4A03A 2QD1A 4K0RA 2G1JA 1T1RA 3T5DA 2B82A 4HAYA 1FP7A 1MN6A 3NYQA 3X1XA 5TPWA 1E3WB 1F8GA 2PZEA 5K05A 4G9EA 4D57A 4GGMX 3N2YA 4ZCRA 3UIEA 2AN9A 1YZTA 3R8XA 1EM1A 5K0GA 1O0CA 1V41E 2EQ5A 1TFUA 3WSWA 4FZ1A 5CHYA 1D2EA 3L1HA 4U7NA 4BGUA 4NB5A 5I7EA 5HXUA 1G18A 3B78A 1XJWA 1DQRA 2EXXA 2XT0A 4Q4LA 5DLYA 3PR1A 2QGZA 5AHWA 4U8HA 3B1FA 3CZMA 4GOOD 1SURA 1RQRA 1RJEA 1KKDA 4NYMQ 4E33A 3PC4A 2ZBDA 4OI1A 1YZVA 1EQ2A 2G07A 1OLUB 2PQ0A 3LJKA 3TIFA 5D3MB 3O8LA 2ADOA 3ET5A 4EJ0A 4OGWA 1PLJA 3HJBA 1V35A 3OZCA 3PWZA 2HHHB 3UWDA 3VTIC 3EC1A 1Y3HA 3U17A 4R9SA 3EC7A 1Y6QA 1JT2A 3UJAA 5FUQA 1HP8A 4KX5A 4DREA 2ZI3A 2NUAB 5C93A 2O2CA 2I62A 3JD1A 2RFLA 1XZLA 3JQ7B 4BVJA 4AJLA 1KI4A 2WU4A 3MWYW 1L3IA 1EESA 1V6SA 4JLVA 4FNAA 2QBYA 2WSMA 3HB0A 5ADUS 4PCUA 1O96B 4A5UB 3FNHA 2EBUA 1VPWA 1CUXA 3BSWA 4KIUA 4JI5B 1G3UA 2YC0A 1CR4A 3FSEA 2HA6A 3CWBH 5BO5A 2ADFA 5EHZA 3AUKA 3KJJA 2V1DA 3U3JA 3H5AA 3AHJA 1YB7A 4TRRA 4N7BA 2ZUDA 4JODA 1KVRA 4BATA 3GN1A 5F78A 3N2LA 1J00A 4MAFA 2UZIR 5F1YA 4PAWA 1NTZH 3K8QA 1R27A 3GC6A 4EQ6B 3EQ2A 2R6CA 1VE5A 1MABA 4E03A 3RT1A 4PX3A 4BNDB 3DSQA 2O8EA 1UWKA 4LHSA 3VU8A 3NJRA 3B40A 4NJMA 4BDTA 2CVPA 4CL8A 4NXNO 3A32A 1KMIZ 5AVKA 2GPBA 2PH1A 2AC4A 2GEBA 4TVOA 3A1FA 4W5TA 2VFAA 5IDVA 1HQDA 2Y4TA 3LOQA 3IPAA 1W0JG 5H3LA 5GGXA 3PXEA 3QJGA 3DOJA 1IV1A 1KY4A 5THKA 4BRZA 3H4IA 5LIRA 2NUTB 4E1BA 2ZAUA 4YLYA 3L72H 2VGNA 2VNSA 5B2FA 1XRMA 1JG1A 3Q5EA 5AW0A 4F46A 2AZMA 1YTLA 4FOTA 2QP9X 2JIMA 4IRMA 1GN6A 4IIGA 4EFEA 1AKTA 3WMEA 3PENA 1VL1A 1QF7A 1JPVA 1WF3A 1SG9A 4C7MA 2CFTA 2H85A 4MWGA 1CLUA 4ZMSA 5CMLA 1UMBA 4AUKA 4B40A 2KQXA 5IVKA 3LA8A 5JI2E 2UXCB 2BSQA 3FD9A 1M1XB 3VR6D 4BVSA 1WLEA 4PCLA 4BVGA 3QPAA 1ZXBA 3IAUA 4DPKA 5FNVF 3E9NA 4PW0A 4RMJA 1FF9A 1C9YA 2X1LA 2J30A 5IJWA 3ZRWB 3SDBA 4XQGA 3ND7A 4CKWA 3ELDA 4EMUA 4R81A 3GFTA 3R7AA 3QFRA 3MB5A 3GLVA 1ZC3A 3OZRA 3LKDA 1I7SB 4Y2SA 3ZI7A 5CA0A 3ZU6A 4E5PA 1YE5A 2X0IA 1J7HA 3DT9A 5E9QA 5CHEA 3JQAA 3PNPA 5CB0A 2PMPA 2FZVA 3OIUA 4MR9A 3KP1A 5JFGA 4FSDA 5JBQA 1Z4NA 3DEHA 3E15A 3ICEA 3AF0A 1I4WA 4DMFA 3ZD7A 1Z74A 1H9BA 5JCPA 3QIVA 5G4KA 2B36A 4WFBV 2ZYVX 2FP4A 2Q6LA 1I2MA 2OCHA 3PQ6A 1MO3A 4AULA 3K9CA 1GP2A 1L5HA 1YI8A 4RSGA 1JFTA 3OUFA 1H2XA 5H0IA 5LCXA 3ZE1B 4AU1A 4I08A 3UCEA 1SIUA 3L1UA 4RKFA 1WAMA 4KE8A 2PPLA 2J48A 2CUTA 1A8QA 2C9MA 3QO8A 1DC3A 3QEJA 3LNCA 4MICA 3CHYA 3SHQA 3IJRA 4KO4S 3HU3A 1D1TA 3IC7A 2GCIA 3LC0A 2HJVA 1BCRB 4RETA 1EFVB 1KJIA 2ZK7A 1Z2NX 1QF9A 4ND6A 1GLVA 1JAYA 2ZR2A 1E2FA 3LD9A 4MMYB 4HAWA 2EZ9A 4UUMA 1SKAA 2PMBA 2QROA 4U7FA 3SR3A 4C0XA 2WA2A 2ZSBA 4RVCA 2DFNA 1A8HA 2JGDB 3DLBA 3CN7A 4O59O 3OU2A 1K6EA 3EE6A 2HRYA 2AH5A 1X6VA 4HTFA 2FN7A 3O4HA 2QU8A 3AX6A 4JX9A 3B5IA 3S2GA 1I3LA 1P7ZA 3G0GA 5CPFA 5BVGA 3F5DA 4GGOA 5MN6A 2OHFA 2PMKA 4FDVA 1RQ7A 3ABOB 4KWEA 1ONNA 3L0ZA 1QH8A 2L18A 3JASA 3GRVA 3HA5A 2PZLA 1S02A 4BKUA 4CR6A 1GTMA 1GPYA 4BQRA 1YXMA 1W59A 3N7UA 3I5XA 4UTZA 4K9KA 2H4WA 3HLTA 3Q3EA 5K6TA 4AKEA 4NDAA 2I1QA 2C1XA 4MVJG 1PZXA 3MWEB 3P1JA 4P32A 2HJFC 3CZPA 2NVBA 2JLCA 1AE1A 3ITDA 3ZVKA 3TZQA 1Q81H 3I39X 4L7QA 3OQ1A 4DG8A 4WN3A 1DEXA 4BGVA 2FX5A 1KFKB 2WF8A 4M54A 3CE6A 4QT0A 2QG6A 2V4ZA 3DP9A 4RMHA 5FPRA 1KYIA 2BHLA 2ZB4A 1NRXA 3FVTA 1JSRA 3UK0A 1UFIA 3OD1A 3SEFA 4FDLA 2IYQA 2VBCA 4ITRC 3NIDB 4MVJF 2PUBA 4L74A 1U7XA 2RONA 2R8RA 4O4JB 2NAPA 2OL4A 3EWIA 1EFKA 5G0UA 4TLDA 4JJ8A 4XJSA 4I5DA 1RCUA 2FR8C 3GMDA 3T7AA 2QJWA 4FOPA 2ZROA 3DE0X 3L9DA 3U9SA 2FKXA 2WT4A 3AV0B 4HFJA 2G72A 2YZMA 2VUHB 4DWVA 3KB6A 4ZEWA 1NXOA 3B12A 1SXJA 4UFZA 3TVTA 4OHPA 4G56A 4BWGA 1XBLA 3B7GA 2TYSB 2JI4A 1YDXA 4F9EA 3VV2A 1DLBA 1NULA 2ZREA 3IBCA 3KR0A 1AXEA 5BOVA 1MPTA 1Y9EA 2FWJA 1ADYA 3O6VA 4CCWA 5I3CA 1H2GA 2BMFA 4NWOB 3AQIA 3F2IA 4JITA 2B6HA 2Q50A 5DCVA 1QVGU 1ZIPA 2X41A 2SKEA 2DHCA 4B33A 3FMVA 4JMLA 5AM5A 4G1EB 1WW2A 5D84A 3AB8A 2V6GA 2HRZA 2XNJA 1M8PA 3RVQA 2NO0A 2WSSD 3IKVA 3SPGA 1SXJE 1DPGA 1JDJA 1JA1A 5AP9A 3S70A 3KLPX 3BA8A 1S5HC 1KAEA 4P4SA 1FLDA 1CB0A 1JMKC 2Q4EA 4E32A 4GEGA 1GM7A 3ELBA 1CE8B 2W8ZA 3HBNA 2GBFA 3RW9A 1C8VB 1RJWA 2I9KA 4C4PA 1M90W 4ZDIA 2YC2C 3STLC 2IS4A 5JRDS 3MA0A 1AUOA 4KYTA 1O6CA 4PSCA 4MUBA 3QE4A 4CV1A 4FKBA 2I2AA 2J67A 2H92A 4JLDA 2OQIA 3P2EA 1AZWA 3VPXA 2ZFUA 3TLCA 4U3JA 3FIJA 5LYJB 3VBCA 4BB0A 2QW8A 4V0LA 2BM1A 4ZXPA 3DM5A 3SQWA 4Q4AB 5EXXA 1OFHA 3PQ5A 4DCNA 5KSYA 3TZKA 3NI2A 4KI0A 2G4VA 4H7DA 5KOHA 1ECCA 4FGLA 3KYJB 4LFAB 1TPZA 2LZ0A 4DM3A 1E6UA 4XIJA 4I1VA 2OP0A 4YONB 3U7GA 2QTZA 3GUUA 5DX1A 3FR8A 1GSIA 4J7JA 4W4TA 3WZMA 1IHXA 1P1RA 4O4HA 1ZH4A 3K7EA 4OHZA 1GA1A 1EFTA 3OICA 2CNLA 3W5AA 4EI8A 3P9ZA 3CRW1 3E2MA 5L3GA 3JZDA 2WIJA 4G1MB 1FS5A 4WZBE 4Y9RA 4EDHA 3WK6A 4YUYA 2DFLA 3OFSA 3NHYA 5AXAA 2WIGA 5T41A 1H2RS 3FROA 4G0OA 5GZ6A 4LN1A 4JB8A 1TU0A 1IXYA 2BOBC 3E2PA 4DIBA 3ENVA 3SVZA 3FCSB 5EHQA 3ZDFA 4PQFA 1LD3A 1IQUA 2FZLA 3AK3A 1PZNA 1QHNA 2F9MA 4FOLA 3UFBA 4ZJUA 3RU9A 4R69A 4AP5A 2Z4SA 3I4LA 2WB2A 2CVOA 1EZ1A 3LW8A 4LYFA 3QKTA 2V9CA 2R1UA 2WLIA 3E53A 1RRCA 1FRZA 2CFIA 2R1VA 5MGBA 1W5FA 1Y5NA 3I6MA 1TT7A 1NVDA 5IT5A 5DX8A 2Q4OA 4A92A 5FUWA 2EIKC 4J7ZA 2BR4A 3B7PA 4C87A 3ZMVA 4B4WA 2MTBA 2ZAGA 4QGAA 2QOEA 2FZKA 1P1BA 4YUZA 2R5FA 2BEUB 4ND4A 3V4RA 4OGQB 3BMNA 4F5EA 1RRVA 3A04A 3CMEV 2W6ID 3VKFA 3KUUA 2R84A 5NLLA 1P61B 3U1TA 1K9MW 1PHPA 4ZKDA 1QIKA 1Y74A 3DEZA 3T3IA 1JDZA 1RWXA 4QPCA 2IU4A 5E7QA 4ZXFA 3ER9A 2VCEA 3C6YA 1G8FA 3CCJV 1QLJA 2OUIA 4DBLC 4ERNA 2WPDD 2FW0A 4OXRA 2SCUA 5C1DA 5TPZA 3A9UA 5SY9A 5CNKA 3ZOKA 2ID7A 4PIPA 2B7BA 2DECA 2AIRA 4QELA 1KDTA 2IDZA 1XMJA 3C4QA 1RQ2A 1JHVA 1LH0A 4QYWA 4XVUA 1M1ZA 1GFZA 1AVMA 5ALYA 2ZE5A 4OB8A 1XNQB 4KREA 4HEJA 2Q9CA 1CRWG 3GJ4A 1RLOA 5BUZA 1SESA 1YR6A 1XSEA 1UXHA 1ZMRA 3MB8A 2V5AA 4JU8A 5JFTA 2HP0B 1FVOA 3B85A 4A3SA 3GBVA 3CS5A 2VDWA 4EG5A 5FWDA 2X8AA 1RBZA 3W7XA 3R9XB 1VQ4V 2X8JA 1VGRA 3M1LA 4MVUA 3IILA 3K31A 1K5GA 1N7GA 1PSWA 3HUDA 1GCOA 1XPUA 3HXQA 1FPOA 3B1WA 1B26A 2AIFA 4CI0B 4BE4A 4KUHA 5JECA 3CCMV 2AOUB 1SG6A 3B8HA 2HPZA 4TVBA 4N0EA 3ENNA 2OCCB 1EVYA 4M9UA 3C43A 1CQPA 3GRAA 1X92A 3MJFA 1PNKA 2HX1A 2XEDA 2KGWA 1UOOA 4LBYA 4HGPA 3B52X 2PUEA 2ZYWX 5DOVA 1L5KA 3H9VA 4BPRA 4FNOA 1NJFA 4BLRA 5TJ9A 4J0FA 4ZU6X 3ESJA 3E9QA 4JI4O 2LCAA 3PWSA 2XTNA 3GEBA 2O07A 1C3LA 1UPXA 4RPHA 4NK5A 5L3SB 2GFHA 3EG9B 4C07A 5HQ3B 1FXSA 3QX8A 3P32A 1I7PA 4RXMA 4I0XB 1NBMG 2VDLB 5EEGA 1P80A 4OI4A 2CYAA 4H44B 1NRJB 3S2UA 2BMDA 2N0SA 4CEJA 5SYMA 3CLRC 2J3EA 3K79A 5EC1C 2HCRA 5LMNB 4PC6A 1Q3EA 3MINA 4J91A 3RW0A 1UMCB 2AN3A 5F7XA 5BORA 2NSYA 4HADA 1C9JA 3UBMA 5KNDH 1JPNA 1Z5WA 2J59A 4X60A 1Z13A 3GPCA 5E79Z 1OA1A 1Q0LA 5I5GA 1Z6TA 1T4MA 1Y6RA 4HMPA 3ABQB 5DEOA 3EH2A 4PXSA 5TEWA 4QXOA 4OBWA 1OWNA 1GGMA 3M82A 2ZQZA 2XKAA 1CIPA 5IABA 4OKNA 4ON9A 1C3OA 3H2HA 1NKDA 4FTWA 1LQ2A 1ITZA 3U80A 3M7IA 3FKSG 1CJKC 3I4FA 4MUIA 4TLBA 2X4GA 3W9YA 2J7PA 1ISRA 2DT5A 3L8MA 4YQEA 3GUYA 3CH4B 1P4SA 3CXUA 4CM4B 2H8CA 1OYYA 1QH0A 5IF9A 5DBFA 1EQAA 3ESDA 4CHTA 3G59A 3KEOA 2V6BA 5JNVA 3GLGE 2RHRA 3S0HA 3SXPA 4YMHA 4S1PA 4O4JF 4R3NA 3MT0A 2ZIFA 3M99B 3OFVA 3P26A 3RHZA 3TG2A 2QAGA 1E0AA 3RFCA 4OP1A 5JT1A 1XBIA 3VDNB 1WB7A 3JQRA 2XAFA 2GBIA 4EA8A 4CMIA 2FOXA 1TD9A 1FFDA 4MTCA 2P9CA 2NXNA 5EHGA 1XZNA 1H6DA 3OIVA 1TM4E 4CLEA 4G07A 4OL9A 1EVJA 4XDHA 3IKFA 4UNIA 5C7OO 3QOWA 5FUYA 3A9SA 1Z7GA 3O4VA 3K4QA 3DTTA 1GR1A 4HQNA 2UVQA 4WVLA 3LDFA 3ICPA 1U8ZA 3F67A 1GADO 3IIEA 3KXIA 5B6JA 3UWSA 1GUYA 5J40A 1KNKA 2LD4A 2ZDIC 5C8YA 2LIPA 4IDGA 2LP7A 3CJRA 1CERA 3R5JA 4LRUA 1JIKA 1ZI6A 3I92A 5CH8A 1XLTA 1A5SB 2R6FA 4BV2A 1E79G 4MVJH 1CQZA 1JEYA 2ZJ2A 4XDYA 1TB4A 1WU7A 2JANA 5EWRA 3JD4A 1WE2A 3RU2A 4NABA 2DBVO 5EJ9A 3ZN2A 2BZ1A 1GZ6A 3DVQX 4IIDA 3NAGA 3OQJA 4XDKA 4KVAA 2W48A 1GZDA 3HRIA 4O8ZA 3HBLA 5ULLA 1K86A 3LNMB 4V3CA 1E59A 2FZGA 2JGEA 4PINA 1NSTA 4UCUA 5IUJC 3IBSA 4JTDB 1V71A 2N42A 3PNKA 3Q6NA 4F91B 3C1OA 2CJXA 1JVSA 4BBJA 3HXLA 4BMZA 1T6YA 3J80M 2HDNB 4NH4A 1ZIDA 3SVLA 4PWYA 5HOEA 4NI5A 3IKTA 5AVJA 4IFBA 5LYJF 1A88A 3WLNA 2Q0HA 1KAOA 4UM5A 2GCNA 3DONA 2LFSA 2FVYA 2MINA 3GOQA 3VYUC 4QDOA 3QTCA 4DY6A 1YJBA 2OZLA 2XODA 4KNWA 4M8SA 4WOBA 1MB3A 2BFMA 2YRXA 4TMKA 1GUFA 4B7XA 2VXYA 4RQUA 5INTA 3MUEA 4O4IA 1KK1A 2VWJA 4ZCPA 5LDHA 3SHOA 3DFZA 1MPXA 1QGZA 5T57A 2AKEA 3RKSA 1AZSC 5L6LB 1NVFA 1PP4A 1W3EX 2P4UA 3SIPA 4Q1CA 1TAHA 2BKLA 3VPBA 5AJVB 1G8KA 3PXXA 1TEHA 4CI9A 2YXBA 4MGHA 3K8YA 1NQ3A 2P40A 3C3XA 5JZSA 4YQFA 4JGGA 3AKYA 3IPXA 2DU8A 1ANKA 1R3UA 1DARA 4TSFG 3BFPA 2E18A 4RQFA 2UYPA 1I13A 2P0EA 3MJSA 5JRZA 5BV7A 3VAYA 2M98A 3MJRA 4J3JA 1GNRA 4GG1A 3TS1A 2ONJA 4WOKA 3LA6A 1FUIA 3O8OB 4K03A 4BEVA 3V4DA 4BIMA 2GHQA 1Y8QA 2XHEA 2E3CA 1JN0A 4DV0O 4CTJA 1JDTA 3HC7A 2GBLC 4UUOA 2N1BA 4YWHA 4DMGA 3CSDA 1UKZA 3VSEA 3V34A 4EKGA 3NV7A 1XEWY 2D59A 2XSZA 2WWGA 2X7RB 1GL3A 3VZPA 2QE7A 3LI2A 1TTTA 2H1IA 1SQXH 4CIDA 2ATIA 1P0CA 3ZDQA 5CB4B 2G3YA 4Q3EA 3ZTTA 3OQIB 4X41A 4YAOA 5IT9M 2AXQA 3R74A 2J6HA 2QR3A 2PXAA 4J29A 4B3RO 1P75A 3OQOA 3LT1A 3P7MA 2OCGA 4MQ5A 2FPSA 4N6GA 3Q15C 3NDJA 1PNVA 1YONA 4WTOA 4AJNA 2HO4A 1M93A 4EG7A 3EODA 1E77A 4IKEA 4JFRA 3ADBA 3BEHA 3NMUC 1Q19A 4GD3Q 4Z0NA 3SDLA 4X6UA 3JVVA 2IS6A 4HQOA 1SPXA 3GLIE 1X86B 1V1MB 5SV2A 3RSQA 4DDUA 5CDFA 1M34B 1OVGA 2X6QA 2J08A 3VU1A 5KU1A 1QU9A 3ZQ6A 1A9XA 3MS4A 4TGLA 1YDEA 3B4SA 4OEHA 4EL0A 3H2SA 3CVJA 5JH7B 4S35A 3C41J 1UDRA 4AIIA 1WULS 2IX3A 10MHA 4C22A 4CCAA 3VOAA 3AL0C 4PHCA 1V9PA 5JSKA 4RIFA 2ISCA 1SUAA 3IV6A 2DQSA 4D9JA 3AI7A 5AK6A 1E7WA 5CDFE 4JL5A 2YSUB 1OSNA 4JJKA 5EK0A 3STHA 4QPDA 5A3JA 3FWPA 3D43A 2FX2A 4HS9A 1LI7A 2D0PB 5AKXA 5EINA 1CD5A 4IX1A 1T36A 2CTWA 1D2MA 3GCDA 2OHOA 1BNCA 1RAAA 3EIOA 1GO3F 2FPKA 4PFKA 4ENTA 3I56V 3P4YA 3DCJA 1GRRA 1QHTA 3FETA 4Z86A 4IIXA 5HF9A 1RE1A 4YY3O 2QVLA 1KVUA 3PPIA 1Z2OX 3C2QA 4TVSA 4NCIA 1EINA 5JXIA 4UTPA 3E22A 1IAVA 1OIXA 4K9SA 2M32A 1JH8A 4MUNA 3R6LA 4IIUA 3I2FA 1WEKA 3W2EA 5HK8A 2QF7A 2PKQP 1BH6A 1TLFA 4NU5A 3PD1A 3U16A 3DE4X 5FOXA 2B4TO 3QSYA 1K8AW 3M5CA 4BVQA 4MEJA 5LQDA 2GT1A 3WZ2A 3AP3A 4FK8A 1N6NA 2X0LA 4CQNA 3WLEA 1SOUA 3QKSB 1OU4A 3I72A 3ZY4A 4CNQA 3IALA 1QSGA 1ZCFA 3SX0A 3B8MA 2G9UA 3AJAA 4F4HA 1CEYA 4DLXA 3CLVA 2ECOA 3OLQA 3W6OA 2HHAA 3OC6A 1U9IA 1SS3A 3P4UA 3Q8HA 2B98A 3D7MA 2X3UA 2JI9A 4LG1A 4QA9A 1WTCA 4HLNA 1CLEA 3I23A 4K9NA 3EEFA 3BTUA 2Y66A 4YASA 2GA8A 1K9MH 1S0UA 2AX4A 3GCZA 4FM1A 1MJHA 4AUEA 4Z9XA 5SZKB 5FI3A 4EMTA 4FYKA 3RWMB 2POQX 2JGUA 3D7SA 1YI0A 2Z6QA 1JKMA 3B9PA 3KKPA 1QAHA 2DH6A 5EIBC 1NHWA 1PFQA 4Y6GB 3HL0A 3GGDA 2IFTA 1HLGA 1IUNA 2ZATA 1WTAA 4MDFA 1P0IA 1OAKA 1F20A 1QTIA 3QFCA 1ZK2A 3S1AB 1OJ7A 3RSLA 4Q66C 5G40A