3JAKB

Cryo-em structure of gtpgammas-microtubule co-polymerized with eb3 (merged dataset with and without kinesin bound)
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
429
structure length
429
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 151
structure length 429
sequence length 429
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jakB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jakB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jakB01
4EI8A 3N2KB 3VO8A 1Z5VA 4IIJA 5C8YA 4U3JB 5IJ9B 5ITZB 4F6RB 3N2KA 5KMGB 2BTOA 2XKAA 4U3JA 5KMGA 5ITZA 3RYIB 5JCOA 3JATB 3RYIA 4O4LB 5GONB 3HKEB 3RYFB 3JATA 3ZBQA 5CA0B 4O4LA 5GONA 3RYFA 4ZI7A 4U39A 5EYPB 5CA0A 4XCQA 4E6EA 2VAPA 3C8LA 3JAKB 5EYPA 5LA6B 1W5BA 4O2AB 1W5AA 3HKCB 4I55B 4TV9B 5LA6A 2Q1YA 5EZYA 5LP6B 3HKCA 4I55A 4TV9A 5J2TB 2XKBA 1FFXB 1JFFB 3V3TA 2RHLA 1FFXA 4ZOLB 1W59A 1JFFA 4ZOLA 2R6R1 3M8KA 4YJ2B 1OFUA 5M7EA 1TVKB 4LNUB 5IJ9A 5MN6A 4I4TB 4F6RA 4YJ2A 3VPAA 1TVKA 4LNUA 5JH7B 4I4TA 4YJ3B 4DXDA 5JH7A 3ZBPA 4ZHQB 4YJ3A 4HNAB 3WGKA 5CA1B 3HKEA 4ZHQA 4HNAA 5IJ0B 5CA1A 3JASB 5IJ0A 2VAWA 5JCOC 4KWEA 1SA0B 3JASA 3JAKA 1W5FA 4IHJB 4O2AA 5CB4B 5LYJA 5LOVB 4IHJA 3RYCB 2RHHA 5LP6A 2RHOA 1FSZA 3CB2A 4O4HB 5CB4A 3JAWB 5J2TA 2BTQB 3RYCA 4O4HA 3VO9A 3RYHB 1RQ2A 3JAWA 1W581 4DRXB 3RB8A 3RYHA 2VXYA 1TUBB 4DRXA 4X20B 4TV8B 4X1KB 4EB6B 1TUBA 3R4VA 4X20A 4TV8A 4X1KA 4EB6A 3JARB 4EI9A 3WGNA 5FNVB 5LXTB 3JARA 5EIBD 3M89A 1Z5WA 4X1IB 5FNVA 5BMVB 4I50B 1RQ7A 4X1YB 3ZIDA 4X1IA 5BMVA 4I50A 4X1YA 3WGLA 5C8YB 1RLUA 4FFBB 5KX5B 4TUYB 3WGJA 3N2GB 2R751 4FFBA 5KX5A 4TUYA 1SA0A 3N2GA 5EIBC 3HKBB 3VOBA 5JVDB 5LOVA 3HKBA 4O4JB 5J2UB 3WGMA 5JVDA 2BTQA 4O4JA 5J2UA 4B45A 3UT5B 3VOAA 4M8IA 2GVIA 3HKDB 4O4IB 3JALB 3UT5A 4ZI7B 2RHJA 5MN4A 2Q1XA 4O2BB 5LP6C 3HKDA 4O4IA 3JALA 4O2BA 5MN5A 4WBNB 3E22B 2VAMA 5IYZB 4WBNA 5EZYB 5JQGB 3E22A 5IYZA 5LXTA 5JQGA 1W5EA 4B46A 5LYJB 4EI7A 4IIJB
chains in the Genus database with same CATH superfamily
4RAOA 1XILA 3I5MA 4TWZA 1NQWA 3CCRF 3AUTA 4FHFA 4I3FA 1HT1E 2JKVA 4JITA 1JHDA 1H4QA 5ADWA 3QYJA 3WYDA 4M8SA 5A71A 4ZOQI 3NTUA 5EWJA 1QTQA 5K8JB 5LBUA 4WFEA 3CP1A 2GPWA 3ICEA 5GINE 5FP0A 5JH7A 4E2LA 3CWZA 4E5KA 3WE7A 4FBLA 3EVNA 1PGJA 1C4XA 4TYPA 4CM3A 1NDUA 5KOIA 1Q91A 4R50A 4NX2A 1WOYA 3BGWA 5KKCA 2VF8A 4KN6A 4FVMA 2H08A 2R7MA 3FDIA 1IN1A 3UH1A 2Q4RA 1CT9A 1KEUA 5DTIA 4BU0A 4KNWA 2ATKC 3CR8A 2AE1A 1D6SA 4IY1A 1UXOA 4R40B 4DR3B 2ZBGA 3ZX5A 4CM9D 1FSGA 3NBZC 4JSTA 1JHMA 1O94D 4Z9XA 3MUEA 1CKEA 3HPRA 1PFUA 1XV5A 3KCYA 1ES9A 5JROA 2ZYAA 2WJPA 3A37A 3TSCA 4DMCA 3KOUA 4BLWA 1YDMA 3ORRA 2H1OA 4AHCA 2NZXA 3PGKA 1GA4A 5K8VA 1UC8A 4MPTA 3WHPA 1P29A 1TRHA 3TK1A 3CNNA 1K6IA 3NBFA 1K8ZB 3N9IA 4L1KA 3DKPA 2YX1A 1EWQA 3H5WA 3LJKA 5DSXA 1ISGA 5IHXA 2ECOA 2KLHA 3HDJA 1E58A 2B82A 2CL7X 4WDQA 2O8NA 3G5AA 1NBAA 4MVMA 1A88A 4B75A 4GLFA 1R0LA 4IX1A 3RU7A 2HMWA 1IDOA 3WDLA 4OUDB 1V4VA 1ZFNA 4GHWA 3FCOA 3BWMA 1Z2DA 1NW4A 1WCXA 4C20A 2FFBA 1RCFA 2GHQA 1O6BA 3WBJA 5BWMA 5CTJA 1X8LA 3QEJA 3WYEA 3CRQA 3KWFA 3FFWA 1OROA 1OYWA 1KNQA 2J9FA 4CCYA 2FNAA 3SZOA 2F1OA 3ZDDA 1Z39A 3UJAA 5K3AA 5TEVA 4FOSA 3BZUA 4HZIA 4JI0O 3CNOA 4X91A 2IYRA 3OX2A 1ICEA 2UDPA 5E79Z 4CG1A 3KNZA 4JYMA 2WWTA 3KT8A 4W99A 1IU9A 4DWJA 1C8KA 2WFZA 4PLPA 1EXWA 1NPTO 3TLJA 3IQWA 2IZ6A 2QVZX 4AYTA 2KHZA 3NU1A 3WAGA 3D6MA 1Z2NX 3O83A 3CYFA 4DMRA 2QG4A 1J9ZA 1BCCH 3HVRA 4INOA 3UT5B 4Q4AA 4QU5A 3EPPA 3LPLA 3INNA 2AQKA 3LVFO 3VSAA 5E9QA 3GXBA 1E0DA 2HLDD 2Z6VA 3LU1A 2JFPA 4TWRA 1ZGCA 4ERHA 2F55A 4BVEA 3PTZA 2V6FA 1MU0A 1XTPA 4LY6A 1VQ1A 3T5AA 1W4LA 5CYGA 4IVPA 3F0DA 5T7BA 3NBYC 4K8RB 4BLPA 4NPCA 1EM8A 2NZVG 3CXCF 5KBYA 2QX7A 4MVXA 3HTXA 4RW0A 4EFEA 1U7WA 1KI8A 1G7CA 2ZBUA 4XYEA 2Y0EA 4B6SA 1FNKA 3I37X 2B1QA 3JX9A 1GPNA 2N42A 3QELA 5LPNA 1JH8A 1XKLA 1KVRA 4I4LA 3ZRVA 4WCFB 3JAWA 3ZOKA 4C2AA 1JLRA 5FJ4C 2CBGA 3PQ3A 2MYPA 3L0BA 3ZR4B 1D7AA 2HFEC 4FMCB 1YR8A 3IAM6 3HNRA 1W0JD 2IM9A 3PE3A 1CZHA 5JH7F 1I94B 3IC5A 2UVDA 1JIIA 2PTMA 1T8SA 1M76A 3ZXIA 3BCCH 2DBQA 2V7TA 4V3BA 2LBPA 1T0IA 2MCFA 2A06H 3N2KA 2GUGA 3CLTD 2FWBA 4QKQA 4KI0A 3GWGA 2AMVA 1L7VC 1P39A 4H77A 3IAFA 5DEOA 2YHUA 1WHSB 1VG1A 3TG2A 1RZVA 3PNQA 2C59A 4O29A 2E4UA 3VZBA 4NQRA 3U7RA 2BHRA 1HDXA 2QD3A 5JWOA 4Z4EA 1Z35A 4PGMA 3NAGA 1N0IA 4KGZA 3JZFA 2Z2IA 3I9NA 1UDWA 4FPXA 3U9SA 4QOGA 4QUIA 4C3UA 2UXCB 1K8AH 1QGDA 5C8XA 4FCWA 4U8HA 3AHIA 2NZUG 4O08A 1L5OA 2H1RA 2WHPB 1Q7EA 4LKRA 2F66C 3RC1A 3KR1A 4GOXA 3QEAZ 3KZIZ 4FNOA 1U0SY 1GL6A 3DBHB 1H2FA 3Q72A 4W82A 3NEJA 3EGOA 3BHJA 2JGRA 4LRYA 3C3MA 3BKXA 1ZJYA 1PR2A 2E0IA 3ASOC 4FFOA 3OJFA 5H02A 2ZIUB 4F12A 2DCMA 4OXNA 1ENOA 3JWJA 1DBFA 4I4TB 3L92A 1OFTA 1VFPA 1PNLA 1U7DA 4KV9A 4G0MA 2WAMA 4GMFA 2YVQA 1ML3A 3WK9A 3E61A 1G63A 1U9YA 1HFJA 4M22A 5ITVA 5HQJA 4U6SA 4TMYA 3OZBA 2CZCA 1GTMA 4YONB 4LX8A 2VCEA 3H2SA 4BP1A 4QWMA 1QAOA 1EDOA 3SE7A 1RTTA 5EP3A 3GL9A 4CQJA 4HDNA 4OGLA 2E21A 1P2UA 4NK4A 3A4TA 5AI9A 4NQZA 4P4NA 3GUHA 1OCCC 3DVAB 2J30A 1LZLA 4I0WB 3NIDB 3UQ8A 3HFGA 4E13A 3ELBA 1GRQA 4LF8B 3OMIB 2KG4A 3SKYA 1XLUA 3ND9A 1DELA 3A9VA 2C98A 4BO0A 1DAOA 5B2FA 4P3KA 2AYXA 2R79A 4OFZA 1Y1LA 1IURA 1G5IA 5AD1A 4BT6A 5F5LA 2IODA 1QRRA 4AUMA 2VOJA 4YRPA 1KO4A 2X13A 1XMIA 1T36B 1V0JA 4R1UA 2C07A 2BDTA 3HKEA 1THTA 5H16A 3V2HA 4BMCA 1M33A 1YNOA 2IZ5A 2ZQYA 4ABYA 2NU8A 4LWZA 2QV0A 5JAMA 2ZYHA 1LW6E 2NZYA 1N8RH 4TKUB 4AU1A 3ZEIA 3ML1A 2VYCA 3Q6NA 3AUFA 1U0JA 4MJ7A 3N07A 3D31A 2MYUA 3GDHA 3MWEA 4KSCA 1MH9A 1D2HA 4LH6A 4G85A 3HBFA 3ZLJA 3FIJA 4OYRA 2RAUA 4H1VA 2Q5OA 3IJ4A 2O5RA 1FP4B 3ASOB 4GOLD 2QT9A 621PA 3G2HA 4JLNA 5A1JA 1G7TA 4ZCRA 2O0HA 3P4EA 4IDFA 2UYGA 4EKDA 3HGQA 4HAOA 3CUVA 2NTEA 2OBYA 2O1XA 5KWIA 3T54A 3BRWD 1ZMTA 4FSXA 2YYAA 1GAWA 1D07A 4BQNA 2H2GA 1R6AA 2HP8A 2C2HA 2ZJBA 4RKWA 2QNIA 2HF2A 3F46A 2IT1A 4S1PA 4W5OA 1AKMA 2OGSA 4PSCA 1A8IA 3D59A 4MCIA 3SPXA 5BUQA 1EWKA 3AG6A 4LF9B 2B94A 1H48A 4MB0A 1ZGAA 5JO0A 2J8ZA 2R00C 5G0TA 3A6EA 3PNSA 3V7YA 3LXMA 1O0SA 1Q6HA 1VSUA 4F3CA 5G4UC 2IYWA 3OQIB 4HRYA 1K9MH 1EQ2A 5A4JA 4AZ3A 3WP1B 3DDZX 4G3XA 3UXMA 3GT3A 3EZGA 1QNMA 2X1MA 3KR0A 3T95A 3TSWA 2FN9A 2UZIR 5L40A 1TFUA 4YDRA 4UFNA 3WRWA 2M98A 4C8IA 1TLTA 2H6LA 1M2VA 1OIWA 1T2CA 2JFYA 2ZJ4A 1GO3F 4D9NA 5I7RA 4IVNA 1FU7A 4JU9A 4ARVA 3L1KA 2K4MA 1VCNA 1XDCA 1WG8A 3IJ5A 3GJRA 4UHKA 2XD9A 4JNCA 1EP9A 4MMZB 5I5GA 1Y6FA 2DBYA 1Q1GA 1T4GA 3JQGB 3KJQA 1BXRA 1M34B 1QZTA 1T0PA 5ALTA 2IK8A 4OYHA 3AVPA 1ORTA 1QGUB 1RQRA 2V4UA 2X2EA 1W5SA 2ZYDA 4HGQA 2I2DA 3T9EA 1O96A 3QY9A 2C7PA 4XSHA 3WTCA 4DCOA 4YT5A 1EWVA 1HORA 4MVJE 4YCLA 1QAHA 4PBRA 3RSSA 1Z2EA 5DKFA 2CB9A 4O2BA 4YIOA 1AQUA 1EP2B 3TH5A 5B1IA 4BV8A 4CXMA 4GOJA 2HQOA 4YAUA 3USCS 2ZWVA 3P19A 1TT5B 3DYIA 2WPDD 2RAVA 2AEFA 3DNMA 3I61A 2CH7B 5HDQA 4BMDA 2A1IA 1O2DA 4HQKA 1MB4A 3A9WA 4LK2A 1OBCA 2LFRA 3BTOA 5AW1A 3HWUA 2HD4A 4GMKA 2O52A 3W8EA 4OUKX 3OQBA 1YU6A 4AXXA 3N39C 3OURA 5AM3A 4HADA 4C5AA 1YFJA 4EM6A 3BN3A 3ZUGA 3B9QA 4CL8A 3CX4A 2GHRA 3L70H 2MIIA 2EIJC 2GXSA 3ZDZB 4KX5A 4KR0A 1SBYA 5ECYA 3ND5A 5JAHA 4FIDA 4EL0A 3NR7A 4D9FA 3MCZA 4MV0A 1ECPA 4EMUA 4XIGS 2LDBA 2WW8A 1PJ8A 1RBZA 4Q12A 3MAGA 3U7IA 4L8JA 1LPSA 3TEJA 4ALNA 1QKJA 2H6EA 1Q6ZA 5IK2D 4CH5A 3ZGNA 1XLTC 3R0ZA 3REQB 1NJIH 1P5ZB 2EW1A 4BJ3A 3ZNNA 4OGKA 3ZWMA 4FYXA 4AD8A 1NFFA 4H18A 5CK5A 3ZHZA 2W5UA 3UW1A 4FBGA 1H2YA 2EGGA 4YPVA 2XPCA 3SHOA 1KS2A 4MI1A 3UC9A 2YSUB 3KQNA 1XAJA 2B35A 4BNJA 1L4FA 3NKVA 2WSIA 2OGUA 3DDUA 3CCUF 3V48A 2P2ZA 2EOAA 3VUFA 3K9HA 1NZJA 4JQZA 1XDBA 5FIUA 1ZVVA 2C88A 1ZU4A 4S1TA 4TGLA 1V9PA 1YVEI 2IEDA 3INTA 5EIBC 4H4EA 3TDNA 4DV3O 4CM8B 4NYJQ 4CEIA 2FHPA 2PUCA 4G8DA 4NYIR 1CQIA 4KKVA 4ZREA 3QIAA 5NULA 2DFDA 4BVBA 2V5VA 4R68A 4V1CB 5CJ2A 1L3IA 2RI6A 2WKPA 2ZITA 1IJEA 2OCHA 4UAUA 4BGIA 1KEKA 1E79A 1LJUA 5DTQA 1X7XB 2YC4C 5EAIA 4Q4LA 1GXSB 3OE1A 4KPUB 2YC0A 1HSZA 1OXMA 3H13A 5L8VA 2ZAMA 1UIRA 4FFWA 1YJ5A 4FVTA 3R66A 5L3QA 2BE7A 1RXCA 3VQYA 4JELA 4CKEB 2QUBA 5HEKA 3VO1A 4RSGA 1SXIA 1G3UA 1HDGO 3T35A 2QN6A 2XIJA 2JBHA 5IKOA 1HNNA 2WHRA 3QPDA 4CMBA 1EGMB 3KTFA 4BFWA 1OOEA 5E0OA 3QEMB 3JCUZ 3FCXA 3E3MA 1AKQA 1OPXA 4XDYA 4HV4A 3FYHA 1PNRA 1P7WA 3O8QB 2N04A 3FB8C 1U2PA 2HLNA 1G2IA 3PFKA 5DYYA 2IYLD 1YO6A 5FL7G 4DW8A 1EK6A 2A0XA 5JSQA 3OEWA 4Y18A 1JQJC 1FCJA 4OY3A 4HRXA 5B66Z 5IPFA 2XWQA 5KU7A 3GJ6A 3UHFA 1DCTA 1H2ZA 4CH6A 3JQAB 4MP8A 4YRCA 1DKLA 4POAA 4IUBS 3FF4A 3FHJA 3E5MA 3FY4A 3KOZA 1XKTA 2XNKA 3W90A 4C0JA 3AY7A 2IDJA 1CD5A 2VOEA 2DZDA 4ZICA 1PGOA 2ZB2A 5J1SB 3KUDA 3ZTYA 4GD3Q 1YUBA 1VQ4F 4V02A 4O2BF 4UU7A 3W9SA 5JAIA 4JJ6A 2W6OA 2ZS7A 3JASA 1Z73A 1WZ2A 2WG0A 1ACJA 2P5UA 3V4OA 3AOGA 3MBIA 3FH0A 1T5EA 3EBLA 3JTEA 1UDCA 1GKFA 2NADA 3IR5A 2G88A 5H9CA 1QD9A 1QVVA 3ZCSA 1OJHA 2BTQA 1P0PA 1G20E 1FP6A 5IG2A 4IINA 5JYCA 4RHUA 4AFNA 3T1NA 1ACMA 4N0MA 2PX6A 1XF1A 1ROPA 3DE1X 3GCXA 2JDIG 3PL1A 2GPAA 4EK9A 2VRBA 3ZGVA 4DLXA 3PD0A 1U0BB 3PEYA 1EU1A 4Q1VA 4RH1A 1VSBA 4XBFA 2ZTHA 3NWPA 1CVRA 3OTQA 1GN9A 1U9IC 3L0ZA 4QPNA 4KNVA 3UAYA 1WSWA 2E89A 5B1SA 3VYVA 4AY4A 2YQ5A 3DPIA 3SSAA 3VDQA 3ETDA 2AUNA 1D1QA 4YT4A 3WAKA 5AKJA 3GLHB 5JPIA 1A9TA 3BVPA 1RLMA 3QWIA 5T3UA 4YY3O 1NIJA 4D02A 1Z74A 4L22A 1B6GA 2WUVA 3R24A 5DGTA 1VIAA 1U9ZA 3V8BA 3KFXA 1ONSA 3G2OA 2LP7A 4MT8A 2HXSA 2Q5IA 2YHIA 1JLLB 3IHTA 4R5MA 2REBA 3EIUA 1BMFG 3VPSA 4HWGA 4YRGA 5LNK1 5C7LO 2ZIGA 2ZDIA 1OGYA 1E2DA 1RFGE 3PA6A 4CWAA 4FIPC 1UT8A 2QGNA 4OQLA 5JC1A 3IKLA 1R8QA 3AERB 4GZ3A 4LXTA 5ITSA 4LC1A 5KYXA 1UBCA 2OCXA 4HBGA 1PJZA 4C7OB 3OVMA 5LL6P 4CLOB 5EAZA 4QUHA 1WPBA 3Q8WA 3LSSA 2NNWB 5EJMA 4OHYA 2F3TA 3ABRB 3MHTA 2L17A 1LK5A 3KSAC 3CO5A 1HKUA 3JAMN 1SQ6A 3DEYX 1YIJF 5H9WA 1JDJA 3AETA 3L9WA 2ABWA 3EUWA 1HP8A 3H1LH 2GBCA 3WMGA 2C2YA 3N76A 2E5LB 4UBIA 4UQPA 3HB4X 4HZ3A 4Q9IA 2HF7A 1M34E 3DKIA 4JLSA 5SY9A 5BSGA 4LP8A 5HJ2A 3ZDCA 2OTLV 3NEAA 3ELUA 2V7WA 4D8XA 1UJ5A 3PWSA 5CFOA 2CBXA 4FYMA 1N2CE 4HNQA 1K7XB 3M84A 3OF3A 4CL3A 2LCIA 4LYEA 3PN1A 4M89A 3CXUA 3V5NA 1R6BX 4BWFB 2NG1A 5DW3A 2BEVB 5JMOA 3N8NA 4AQ7A 1U02A 1JRLA 4DRXB 5ELLA 1H6AA 3IEXA 4ZOEA 1M1NB 2ZZNA 2IBZH 3ICQB 3VR5A 4U7FA 1RJWA 5AJHA 1RRCA 1GYQA 1SQSA 1TU4A 5LQSA 4M21A 1Q7TA 3Q3EA 2FZCA 1THZA 2CZWA 2C2OA 1O8BA 3IODA 1ZCJA 3CF0A 2IYAA 4HQ6A 1TI7A 1QO0D 4X61A 2JGKA 1E4OA 1B42A 2JRIA 4TWAA 4YRJA 2VJBA 3IEUA 4EKIA 3HDQA 2K1EA 1RADA 4JXKA 1WKVA 3AY6A 1GN4A 1SHKA 5HE8A 2ZB8A 1ESNA 2ODNA 4KYUA 2YWXA 3D6FA 4OHFA 1ULSA 1W96A 2WOOA 4K3UA 1CP3A 1YZLA 4R7TA 4JGBA 2OYQA 3IEQA 2MYTA 3TG8A 1A2QA 4ETMA 2CSUA 1BRTA 3TI7A 4PONA 3DL2A 4IIUA 2R8OA 3PJGA 1U6KA 3UAVA 2AOXA 4HX9A 4UZSA 1AHNA 4CM9A 4K8ZA 1M1YB 2FL4A 4YV0A 1O94A 1XDSA 5TB5A 4PJ0Z 2BZ1A 5KX5B 1HLDA 4BCCA 3EFFK 2Y6UA 2I91A 3U7EB 4PGHA 2GFHA 2BFCB 1H4TA 1OTYA 5IT9M 4H0CA 3O1IC 2WB4A 4H27A 1UZUA 4E88A 5HTKA 2Z1FA 4N41A 2YQ4A 3MYRA 3H2JA 3CH5A 2XUMA 2C5LA 2QVGA 1D2AA 3HB0A 3AH8A 4LOKA 3IUBA 5EP2A 4JK3A 1HPLA 4A9AA 2F4NA 1M2EA 4MKRA 2EEZA 5A4DA 2PGIA 3RUCA 2HK7A 3ZE0B 5DECA 4X7MA 3NGXA 3DL0A 4OAPA 3FZNA 1G18A 3M70A 2RK4A 4ETIA 3KE8A 5TE9A 1EFVB 1ECCA 3L7LA 3E18A 4DLKA 5EWMA 2X8LA 2YXNA 3CRCA 2HSDA 2NP6A 2QTOA 1VE6A 3BY6A 1AA6A 2PSHA 4WKNA 2I29A 2XDWA 1LK7A 1GPJA 3LBHA 3QOFA 2CW5A 3AYXB 4NATA 4IUYA 2I5PO 2QZ4A 4EYSA 1RLUA 4RIEA 4ENSA 2B20A 2WJ3A 4Q3DA 2J3EA 5IVKA 3DC5A 4REMA 5CHEA 3CC2F 1X70A 5EIHA 5J1TB 5F5NA 2RC6A 2XCQA 2V74B 3W5DA 4KLZA 5HY2A 3CH4B 3TQFA 3IV9A 4E32A 1YFZA 2BP7A 1GAJA 3ZBQA 2HNKA 5IC4A 2VYND 2VHCA 1RKBA 4HWSA 2CHVA 1C3EA 5U1PA 2OCCB 4K9QA 1U2GA 1KK2A 5AW4A 4BT5A 2HEPA 2RH5A 3BMOA 1JL3A 2XD4A 1LBQA 3H2ZA 1ZM4A 1GAQA 2FZWA 2V6BA 3BMQA 1P7PA 3E5HA 5HILA 4EGQA 2M1XA 3H5TA 3MA0A 3ODGA 2HLDA 1RYDA 3V8QA 3ZZNA 3ZEAA 4MQFB 3RUPA 2VP3A 1WPQA 1XBIA 3FPCA 3LCCA 2YZ2A 4CG0A 1YCGA 2L82A 3S02A 5EUQB 1XEXB 1SQVH 4CBVA 4OM7A 1P2GA 5DYTA 4YAWA 3A2KA 3QMPA 3KFVA 1OHHG 4UVBA 3QHAA 1RT9A 3RG2A 4I6JA 2WA3A 2R9AA 1PVDA 2EJVA 1PFQA 3IV7A 4UHHA 1U5BA 4AY2A 1Z37A 1FYWA 4FLWA 2FAXA 3EZ9A 4PO9A 3WXMB 4QEDA 1VL0A 2HP0B 2O8FB 4Y2UA 3GJ5A 3QX7A 1I2AA 3D3EA 3N28A 1H2XA 2PRIA 4NECA 4RTRA 1ADGA 2V6JA 1W0JA 1QDEA 1X1DA 3OOWA 4CT0A 1XRPA 1PJAA 1C7ZA 3UO3A 4UU1A 1U6JA 4MTLA 1K9VF 1FRZA 2X19A 2VF2A 3DXFA 2A9JA 3H6KA 3B60A 1ND5A 2QDOA 3GG9A 3EQ6A 5I7UA 3BFRA 4LBEC 3WADA 4KUEA 4HDRB 5I9IA 3D01A 4WVFA 3RWBA 2R7AA 1L9XA 3CQ9A 3Q41A 4PR3A 3OFJA 4PA9A 5MGNA 1BS9A 3TI9A 3ZCUA 5J40A 4NZMA 4PX2A 3IVRA 5IP5A 5JUWA 1GL7A 1VIBA 1WUYA 1ZN9A 3S1LA 1PW7A 2X5XA 2DECA 3DMRA 1IPHA 2D7JA 4RORA 4RJLA 2JVDA 3WAJA 5L7TA 3PUIA 4H7PA 2HA2A 3OETA 4MQMA 3VDXA 2WLLA 4EJSB 2Z5UA 2NT4A 3JZIA 2BSAA 1T24A 4UXNA 3S2UA 5C4IA 2XJ4A 4CKWA 2G72A 4F5DA 3IUYA 1PDVA 2CCGA 3HTNA 2QWPB 3CVYA 3AEQB 5IYBO 4MV4A 1GM9A 2V03A 5JDCA 1YC5A 5HQ3A 1ZL0A 1E1LA 1EFDN 3LVQE 1BH6A 3I8XA 3CTMA 1KZ9A 2YDXA 3BT7A 5ICFA 4ZZ2A 4E4YA 1VQLF 3QE2A 4U8GA 3LKVA 2I2XB 2ZJ1A 2Q5CA 4K9LA 3JVIA 1Z5PA 1RZRD 1R12A 5K4HA 1ZK2A 1PIWA 4Z51A 4TYWA 3TBKA 1GFWA 4S1VA 3IPLA 2OV1A 4GICA 3SC4A 4LDAA 5FD8A 3OCUA 4WOBA 1URFA 2QGFA 3OTIA 4QGHA 1RIFA 1PTJA 2QN7A 4UV9A 4ONEA 3AO0B 4GBMA 4OI2A 4L9SA 2H52A 1CEYA 3BXHA 4L74A 1QIFA 4Z0HO 4C0WA 4D4HA 3KXKA 5GM2A 3MRTA 2QU7A 3PP8A 4MK4A 2LW1A 3N4YA 3VH2A 2RDMA 3F7MA 1VSQA 5JS2A 1CZNA 4IO0A 3H7AA 2DFPA 1CZLA 2ZBQA 4FFKA 3L77A 3VTKA 4DCPA 3R3YA 1WP7A 2A9QA 3RSOA 4YUYA 4NARA 2PUEA 4K46A 2V7QD 4A6PA 1Y6GA 1V11B 4JZKA 4BNZA 3NONA 1RS0A 2ZYRA 2FC3A 2H4FA 2GRUA 5EERA 4P58A 3KS9A 4UVHA 4MVRA 2IH5A 1F2UA 3PHLA 3PHJA 1VP3A 4E2FA 4H37A 3E7PA 1IVNA 1JALA 1R15A 1ZNQO 1S02A 2FUG1 3K58A 1BGYH 4L51A 3UJPA 5IJ0A 2VC2B 5F33A 1PNOA 1X7YA 1MQAA 4ER6A 3MHPA 1LV8A 3RS5A 4NHOA 1HR0B 3ZHVA 3P0RA 2QLMA 2A5FA 1GGVA 2WAOA 3R8FA 1N6RA 3HKBB 2J3HA 5G0WA 5JD4A 1ZD9A 2OV3A 3LRTA 1VP9A 3PZBA 4CIBA 1MR3F 2JCYA 2QZZA 3JV7A 4AL4A 5JASA 1BZKA 3BPSA 3BRWA 4EJMA 1DIBA 5LGTA 1Y5IA 3TTXA 5AW2A 2PMKA 4JVNA 4KQMA 5LHHA 3I01M 4HMPA 1F7UA 2QRKA 4BAUA 3AG5A 1XCMA 1VMDA 2YC2C 1P1IA 4W9MC 3LNTA 4DY6A 4W5HA 2Q6AA 5CDFE 4BRZA 5H1YA 1UBSB 4QAJA 2VT2A 4CM7A 4OHZA 3FFBA 1JG1A 5C81A 2R6HA 5FLEX 3MK31 3GA0A 1L0NH 5I7WA 4B35A 4OP3A 1YSCA 1RWWA 4UFPA 4JT8A 1IYZA 2WG2A 1QFMA 2LJ2A 1TO2E 4HD8A 2F3SA 2JEXA 2HCFA 1WA8B 3OOSA 3ABMB 2JI7A 2BY4A 3U9LA 4Y6SA 4K6MA 2AIFA 2OHWA 1Y9AA 2XAJA 5LBTA 2P75A 3VVBA 1V55B 4R2XA 1A2KC 3BX1A 2E48A 3O92A 2P2GA 4Q3OA 1FXHA 3V2UA 3MRXA 3L1VA 1KFKB 3ABUA 1G8FA 1GNSA 5AK3A 5FPSA 2FW0A 3HKCA 1QVGF 2AA3A 2O2ZA 3A36A 3ROTA 4ZAZA 4OHMA 3HJRA 2FPGA 1XCBA 1N6LA 5IFLA 4TKZA 2Q6IA 1YJNV 4IDBA 2PHZA 2G7MC 3MYYA 2BT4A 4TV9F 2YIJA 3NG1A 4AMZA 2NU9A 5EVJA 4BNNA 1LJ8A 4NB5A 3U4IA 2A5GA 4M1SA 1A27A 2H17A 4X20B 3UJ9A 3BXFA 5HG0A 4LVOA 1DGSA 4P1ZA 1BJRE 2WAAA 1JT9A 3NUGA 4RF2A 2ZJYA 2Z95A 5LQNA 3DLIA 4JBNA 4MS4A 4UDNA 1Y6RA 2CLHB 4EF5A 4J1QA 4C7XA 3SEFA 3IIJA 3QX3A 5D3QA 3CF2A 1PUXA 4WT7A 2WPDA 3T5PA 5KQGA 3PE4A 3Q3GE 1BNCA 2VZ8A 2RKWA 4FOPA 5H0IA 4CMKA 3W5CA 1YF3A 4TVOA 3ZTTA 1Z33A 4YR7A 5LWQA 2JK0A 1O9GA 1DWOA 3FMGA 4KAAA 1QUEA 4G0VA 2FP3A 2LR0A 2Q4OA 1W25A 4HYYA 3AK4A 1N6PA 3OZVA 4MKXA 4X45A 5F2NA 3BSYA 3ROXA 1N9GA 3LD9A 4AZWA 4EKWA 2ZIAA 3PFNA 5ESXA 1IBCA 4NENB 2CE2X 2QXUA 4AUNA 1OF1A 3UMVA 2YRFA 1QG4A 1NJ2A 3I34X 3E1KA 2EERA 2N9UA 1E3LA 1Z2PX 5IK2A 2P7TC 3PPWA 4J2OA 1E3QA 2X3UA 2QENA 1F4MA 2ZR8A 5C35A 2BCEA 2OTJF 2XNSA 1PP9H 4ICGA 3AKCA 4P4LA 2HDOA 1TF5A 2LGJA 1XK7A 3AG2C 3WYCA 2WV7A 3K2EA 1DLIA 5JXJA 1Y7LA 1LJLA 2PZGA 4QG7A 2CD9A 2X4DA 3DP9A 5KMGB 1Z36A 1P1RA 3I9JA 1M56B 3C3SA 3LF2A 1QYVA 4GQBA 1MRSA 4MVCA 3F6YA 4JASB 4KAXA 4YRZA 2QRGA 2A88A 1SVUA 4I8DA 4BVQA 2QI9C 5DN9A 2CFTA 1I4TD 2GERA 1VG0B 1V16B 4LCUC 4W6ZA 2I7TA 1R66A 2CXRA 1PZNA 1NULA 5SZKB 4NXMB 1JBKA 2XZPA 1MAHA 4NWIA 1SXPA 2GA8A 4UKDA 4Q3CA 4Q7JB 1X1RA 2GAIA 4YCSA 5EVCA 2XOKD 3IR9A 5D2CA 3C1UA 2ZJ8A 5LSAA 1Y1TA 3IJPA 5GY7A 1A5BB 5EEGA 3QK7A 5B1YA 5AHXA 1XPOA 2ZWOA 3ZZ1A 4WBNB 2JFNA 3EIFA 3OT1B 1W41A 2HS3A 4U5XA 4KACA 2E85A 3AL3A 1T4DA 3QGMA 4ZAXA 2J67A 4LDPA 1EZJA 1UEIA 2A5YB 3F8SA 5IW8A 3FTEA 1AO3A 2WKRA 2X1HA 2WJGA 2ODAA 3CN9A 5J59A 2X8AA 3QLEA 3JU3A 2ZVPX 1G21E 4EA9A 4BNIA 3DD5A 1TDJA 4W7IA 4YNBA 3AHFA 2FG6C 4C8GA 3GFSA 1CR6A 4QX6A 1YMQA 1G291 3MTEA 3GK3A 5ERYA 3DE5X 3DGFC 3DHEA 1X4TA 5AIBA 2VUTA 1KU0A 1NA5A 2C82A 3CCLV 3ND8A 2GPNA 2WD8A 3P5BA 3UYKA 2B9EA 2X7XA 1GVNB 4GPD1 1AU9A 1YASA 1R1MA 4TTJA 1VZ3A 5AH0A 1TMGE 4ZJUA 1K6XA 1Y34E 3PC8C 4DMHA 3JD0A 3RIMA 3L7MA 2O0LA 3DEZA 2OK8A 2HCBA 6GPBA 4XJVA 1PJTA 5LIPA 1WETA 1NKTA 2R9IA 2GCPA 3BA8A 4MLCA 3HB7A 3PX2A 2A3NA 3LX4A 1RI1A 3AKDA 1DLBA 1DKNA 3IO3A 4NCXA 3RVSA 3K0FA 3T61A 3SS9X 5C5EA 4XFJA 5LZ5A 1A2OA 3KOMA 4DZZA 3SVLA 5F1KA 3BILA 1BGXT 2O5CA 4KFRA 2BEWB 5CFQA 3AI2A 1FFXA 4PXSA 1YB5A 5LDGA 2MW2B 1ZSNA 3J80M 2HS4A 4XPIA 3O8BA 3HBAA 1C3OA 4A0RA 3AVWA 3WWOA 3DBLB 5GIOC 3MVEA 2YWCA 1KJQA 3K0CC 5LP6A 4X6UA 1GA6A 2IDMA 2WMDA 4MWEA 1XZIA 1E18A 5EPUA 2HJFC 4PG7A 1Y8RA 1EIZA 4IYIA 6AT1A 1ZJJA 5LHIA 2F00A 1WDMA 1FS0G 2ZJ7A 1G3IA 3O47A 3HP1A 4BLSA 4QDTA 3GCDA 5J4LA 4ADSG 4MDEA 3ZW8A 1HNZB 3BABA 3FPJA 2ZRMA 1Y9EA 3RRJA 1ZDMA 3I3SR 1DADA 2AFHB 4KQCA 3WFIA 5AVXA 4UUNA 4JBHA 2IHUA 4GE3A 2WWFA 1RRMA 4UM8B 4EA8A 1MZFA 2VP6A 2O07A 1NJ1A 4HB2A 4PQRA 2IH1C 4Q20A 1F51A 3KKKA 4HSGA 4Z1VA 5JCXA 1OXKB 3KSDO 1NTOA 4BT7A 1F5SA 3SYMA 4RMIA 3BE8A 3ANNA 3PI6A 2GTSA 1JNYA 4BW0B 1X7ZB 5KZMB 4XR9A 3K16A 1HT0A 4L8FA 3DDHA 3KQQA 4EB6B 1WN7A 4L4UA 2JAWA 4E7PA 2WUDA 1KEPA 1MB2A 4OOFA 3SS8A 2UXNA 1CXZB 1CJMA 4N9QA 1WZUA 2ZUFA 3ZJ4A 1Z63A 1PD0A 5EUMA 2GETA 4AQYB 1LPPA 4B6PA 1NMZA 2W6PA 1OLSA 1J00A 4DZRA 1A2BA 1RD4A 1R1DA 2P6PA 4RTSA 4DA0A 3K0DA 3S8YA 2CSLA 1HZZA 4HGYA 5A3SA 4BV2A 3ITNA 2QROA 3IFSA 5JJEB 3GOQA 4Q3KA 1RYFA 5CW2A 3OZFA 3G68A 3H99A 4WTOA 2ACVA 4M99A 3SGLA 4Q6GA 1HQYE 5JLAA 1MJGA 4JLDA 4RH3A 1XTVA 5L3GA 2SKEA 3FI0A 1ZA1A 4C4TA 1GAXA 2VATA 4IZOA 2G70A 4ZOBA 1C9KA 2AMJA 4N40A 1V8ZA 4KWTA 3UXEA 1N6IA 2IITA 4X9QA 1BSVA 4BNXA 3BFKA 2VAVA 4V0MA 4X66B 1FDIA 4IJMA 4GLXA 1OGIA 2Z43A 5EBWC 2UYCA 3D36C 4L5YA 4Y2GA 1ND6A 1FSFA 2F9FA 2AK3A 1A7KA 1O5TA 4XQ0A 1VLZA 4E12A 1MG5A 1B06A 6REQA 3LFHA 4EUEA 2PV0A 4BN4A 1A04A 4LHWA 3MQWA 1NXQA 1DFGA 5FBZA 3OPXA 2JZNA 3NHMA 4RFLA 1J20A 2QP9X 3IQFA 3LDTA 1FXSA 1R27A 4M8KA 4B8YA 3IE0A 2BOVA 4KN8A 3VU9B 1MIHA 4N8DA 3X1DA 4BGUA 2V0GA 1QMPA 3C3EA 4AJ4A 1GPYA 4EFLA 1H42A 3OQ1A 2WZBA 2PT6A 2GCOB 4AO8A 3JZAA 3E1GA 2R44A 3LYUA 3UKDA 2X86A 1J5XA 2D0DA 2JAXA 3MD0A 2LBTA 4OTZA 5D6OA 2DXIA 1ZWZA 1UKYA 4CI9A 2CWJA 3R75A 4FFBB 1CEXA 1QO0A 5C1DA 3BXGA 4RYLA 1DZ3A 1NQAO 2OUIA 4KRXA 3IOEA 1TAHA 1TW3A 3H3XA 4WI1A 5T41A 4Q3EA 1URPA 2R47A 1A8UA 1W88A 2QEXV 2O7VA 3C5VA 1PO7A 4E2WA 3ID6C 2O3TA 2WSSD 1YBHA 5DF1A 2OUKA 3AWDA 3FPSA 5INTA 5EYPB 3BFVA 1JJIA 5DZSA 4JA0A 5DXJA 4DNPA 1Q7CA 1CW2B 2GPBA 3BF8A 4HVLA 2OYRA 5A2QA 3G71F 5EZ5A 1WP8A 3LDEA 1A77A 3EA4A 3KQOA 5KYGA 1JKJA 2QM3A 3MHSC 1SBQA 1ZKMA 4HWTA 9MHTA 5GOTA 2FUCA 2O57A 3VH1A 5FF9A 3WA7A 4AY6A 3ZK9A 3S0WA 4KITB 3X1XA 5K0LA 5EHXA 1SAYA 3YASA 2IYYA 4GVLA 2IYZA 3QNMA 1WF6A 2RHWA 2IX3A 2W37A 1K27A 5HZKA 1LKZA 3NAQA 3JVEA 1NGSA 1ZN7A 2JJMA 2APJA 3PUKA 5H2FZ 1YRLA 3B5EA 3UUGA 1QIJA 2YXEA 5AJZA 5J4YA 3LOUA 3ADKA 1XSEA 1HTWA 1Q3TA 2HMUA 1PLKA 2IY8A 2JGJA 3EXFA 1PEDA 1G20B 4ALLA 4URFA 1QYWA 3SJUA 4IOKA 3GMSA 1R00A 3I9LA 1NM5C 2AGAA 5I7EA 2EAUA 3AOEA 4IHAA 2GWHA 3BGOS 5B3LA 3OIGA 5H83A 1XCOA 4LJ8A 4LF5B 5H5JA 3RJZA 1NVPD 4H9GA 3C98A 1PZMA 4Z54A 1PLLA 5DHAA 2M32A 1GLVA 1T0KB 2E4VA 2VDPB 1TC2A 4BXOA 3KU4A 2CSXA 5CVTA 1PV1A 3KV1A 3R6WA 4KVAA 3NHZA 1DO8A 1BWSA 4WH0A 2CUNA 5EESA 2EHJA 4QO8A 1A1VA 3OJ0A 2A5LA 3N8HA 2VYNA 4DQVA 3T3DA 3S44A 2VDQB 3D0OA 1OPRA 5K51A 5T4BA 1ORDA 4LRQA 4DR2O 3EIHA 2CUZA 4J4HA 4A7PA 1T8PA 1ZD3A 2YV4A 3FYUC 5J4KA 1HNWB 1NU6A 1O57A 3M6VA 1OCCB 4JXJA 5ENDA 2YXZA 1FUYB 2X9NA 4M1MA 4OLJA 3MERA 3ZWOA 3SLKA 4V0OA 2QM8A 1P9OA 2VNKA 3BXXA 2XY4A 4O1HA 4FLUA 5FUQA 3MAQA 4DRZA 1E4YA 3C3PA 4JQOA 1C1DB 4RMNA 1I1QB 4WLFA 3UY4A 1BQZA 1X7WA 2BAGA 1UPXA 2IXGA 4L08A 1UFQA 3ZS9A 3X2QC 1FDTA 1RHKA 3BCRA 3JYNA 1E9EA 4YDQA 3RKUA 3S1SA 1DPFA 1N5LA 2OD7A 4O4IA 4B3MB 4IH9A 4EFMA 3D8CA 3LQQA 3MUOA 4Q3LA 2P79A 5E1DA 3UQYS 4ESOA 4YP0A 3LBIA 3KQKA 3W5VA 2A0FA 4E30A 2Q5ZA 2QA4V 2XYVA 3C8ZA 4B09A 5CA0B 3W5AA 1BHBA 4NCNA 3OQPA 2AWOA 4D4JA 1MTOA 5IT4A 3E3OA 4IAOA 3T4PA 4GECA 5A05A 1DX4A 1XTIA 1SVSA 4N18A 2ALJA 4G67A 2R86A 3ZTWA 1HQCA 1I5XA 3NORA 3GLGA 2GPYA 2WVJA 2G7ZA 1N2CB 4P4UA 1NR5A 3CD6V 2X7JA 4JYCA 2AFHE 2GBGA 4C14A 4ROSA 2J33A 2FMIA 1NS1A 4JL6A 5BORA 2H8PC 1SUDA 3CG4A 4EPRA 1E2NA 3EGIA 4G41A 1DQYA 1PT9A 5ER9A 3RR2A 4MI9A 1N5KA 5J2UB 3K72B 1XMVA 1SBCA 5KQRA 2E1RA 5A04A 5J58A 1O9BA 5D7BA 5ALJA 1K8YB 1XMSA 3T1YB 2O14A 4Y2RA 5C1OA 1BL8A 3K79A 4EI7A 1KYYA 3R3SA 5DK4A 3AJRA 3LDGA 4S2EA 2X58A 3WLEA 2BSQA 3IQHX 4G1UC 2PUBA 3GOHA 3ONWA 4S0XA 1VXOA 1RVV1 1NBOA 4NZOA 2BIFA 2Q2WA 4QYXA 4B3SO 2NVUA 4A73A 3ENQA 8ATCA 5BVGB 3CVXA 4FKMA 4R6ZA 1N1MA 3RREA 4JH0A 5DHUA 3MILA 3OFNG 2A58A 1A1SA 1E1KA 3GYBA 3UCEA 1RWMA 1PNTA 5GIOE 4Y2SA 5JALA 1MXFA 1DAHA 1V7ZA 4I7ZB 3DMYA 5KSZA 1WUTA 4B73A 5DE3A 4C89A 5B1AC 4KE8A 4B80A 3MWDA 3OZXA 3F4BA 1KE1A 3H9CA 2QD5A 3LMKA 4X89A 2K6GA 1RZRA 1UCFA 5BYKA 1VRCA 1WOMA 1Y1RA 1ZXLA 4KLNA 4NAUA 4CLRA 1K4MA 3A3NA 4P9NA 1Y4DE 1VYHA 2JZCA 2ID9A 1R0YA 3GQVA 5AK0A 2HU7A 3MEQA 5JI2E 3HLKA 1R74A 1PL7A 2ZPAA 5ALIA 4BKMA 3E9CA 4MW1A 2RC5A 3OW2F 1PJCA 1Q21A 5P21A 5L4LA 3U2QA 3K35A 3PRYA 4ZOLA 1OVMA 1DKRA 4NESA 3IMCA 1RPNA 4KQXA 4HNGA 4QLAA 1QHNA 4A16A 1VRWA 2ZAUA 2XCOA 4MYHA 4XM0A 1R8JA 1FMLA 1ULHA 4CMCA 4XYGA 3D1LA 4HWPA 3C6ZA 1EPUA 4LRSB 3IOCA 2LNDA 4YAKA 3BWCA 5C7OO 4C4OA 2V7QA 4R9UC 2OBMA 3KJHA 3U26A 5GP1A 4BT3A 4EJ6A 3QLUA 2PK3A 3D7NA 4JLPA 2QN8A 3RHSA 3A2LA 1WVGA 2Z1NA 1VL1A 3O4IA 4URZR 2JEZA 4KDCA 1W6RA 2EIJB 4K3VA 4OHVA 4LE0A 2P77A 4BNWA 1PWEA 1VQOF 4RTOA 3QZUA 1G3MA 1GG5A 1LTHR 2PKCA 4RKQA 1KF0A 1NC3A 4PD4F 5K0CA 3GIWA 3DDCA 2NVBA 1ILWA 3UTCA 4AN0A 4AYWA 4CM4A 3ZIUA 5K3FA 4NAHA 4Y9DA 4BIUA 1U2RA 1Z8HA 4ZOAA 5KYNA 2OCIA 1AVMA 3RVMA 1L5HA 4PAQA 2FRDC 5B1AB 3DXRB 4JJFA 4QJ3A 1MBZA 3GFVA 1NMEA 1SUWA 5B1EA 1O4VA 5IJWA 3ZLVA 1WV1A 3RI3A 3NYIA 3Q0TA 3HCDA 1ZH4A 2JIMA 4X0EA 4CU2A 2FZ5A 2BCJQ 3EIQA 4DCNA 4WADA 3W4KA 2QAGA 4YK7A 3SBXA 1ZGBA 3FDJA 5CRIA 4ABTA 1YR6A 3E5RA 4DCSA 1K0FA 2ZRKA 1DKMA 4FGUA 2UYJA 4DLTA 4YT8A 5CD1A 4MZDA 1KOGA 4MVSA 1QU7A 5KNDD 1RI4A 1GAEO 1D4ZA 5I9LA 3OHPA 4BZPA 4ZEMA 1EFPB 3S29A 1O0CA 3FAVA 2NSHA 3K5HA 4RHEA 5BR4A 1OILA 4CMGA 2HBZA 2JVKA 3AVOA 3LPNA 4WFJA 2JARA 2AFRA 4G01B 1NSFA 2IPLA 5JSYA 1P1BA 5DV9A 2MSCB 1ZXXA 1DIRA 3K0AB 2IEIA 4XB1A 4GDMA 4D9MA 3K70D 1X7OA 2R8PA 4EYOA 4K6FA 1LC3A 3IBFA 1VHQA 4NBNA 1KD1H 5JNTA 5JHGB 4ZO4A 4RF5A 4CPDA 5ESDA 2Q8VA 3V7UA 2FZKA 4KXNA 2Q2QA 3C16C 1E2QA 3F5WC 4TMZA 3LL7A 1X7DA 4F5ZA 3NOXA 4HNUA 2V8OA 5AK6A 3QW2A 4BNGA 3F7TA 3J7AU 1JLHA 4KFMA 5JCJD 4XWOA 2QTCA 2RJ3A 1JDZA 1B23P 3ZU3A 3JQ9C 2JZOA 4DQ0A 1KZYC 2MINA 3FYIB 2YIAA 1K8RA 1EX1A 1ZGHA 2ODWA 4Q9AA 4JB0A 1W94A 4LFBO 4GWKA 1E20A 4UFOA 3H1HH 3RG8A 4QYTA 3CY6A 3NTLA 1E1QG 3W9BA 5G3YA 2QBYA 4LDQA 1E62A 1SXHA 3K7EA 4HTFA 2UZ4A 3M4SA 2WLNA 4JODA 3KSMA 2PMEA 3S2IA 4ZQCB 4CMEC 3SAJA 2WIGA 3DFUA 1L8QA 4K9OA 4PXAA 2H7CA 3WYGA 2O6HA 5L3EA 4Q4HA 1IBLO 4QD3A 3SICE 1NJGA 4O4LB 2FW1A 4LBYA 2FR8C 2VTKA 3ENZA 3B7WA 5ICEA 1GPH1 3CCRV 2B99A 1R6VA 3A28A 4NOLA 3AF2A 2BW0A 2LUOA 1FDOA 1BX0A 5K03A 3EQ9A 5GV7A 3SXUB 1B6SA 3S7ZA 4EX6A 4G0PA 4MW3A 3G1TA 3ISJA 2PT5A 1SU6A 2ROQA 4P22A 4MLDA 3WVNA 2L42A 4PSVA 4Q05A 3P10A 4LOLA 1K7DA 4G07A 2YRXA 4Y2PA 4B3JA 3DE2X 4FJCC 1UEJA 4C6TA 3R44A 3UMRA 3O8DA 3RJMA 1NWCA 1ODEA 3WSTA 4MUFA 4YQYA 1G7RA 4WXEA 1BGWA 4Q9HA 1QIGA 5AW5A 1BVYF 2IXBA 2KTVA 4DV2B 2I2FA 3KLNA 4U6QA 2YW9A 1YDXA 1US8A 3P5SA 3FB1A 2PWYA 1S2LA 4N3GA 1JEDA 3QVXA 2WV9A 3R8XA 3OGIB 4U7TB 1TU3A 2GASA 1AILA 1YZKA 3L4KA 1LGYA 4IEIA 2XOKA 3RFXA 3FTDA 5JMWA 5FJIA 1BC5A 4JCOA 4JAAA 5CBPB 5BR1A 2FGYA 3T4UA 4XVQA 3OSUA 4RVNA 3OPYA 1M8GA 4G5HA 4TZ6A 2ASVA 3C6BA 1DKOA 4K1XA 2AIZP 3E53A 4JOCA 2BM1A 3KDSE 1V39A 2SCUA 4QYWA 4GPIB 3A1UA 2AEEA 1NR1A 2XDYA 2QSJA 2Q0OC 3RS3A 2HDHA 2XYQA 2G9RA 1V1RB 4ZAGA 4YI5A 2J4DA 4OQFA 4Q34A 2VHWA 4XASA 2Q28A 1YJWV 2JBWA 4B46A 2N0SA 3HCAA 4JROA 2QTBA 1G55A 2FMFA 5BRAA 1DLJA 4I1OA 3GT4A 2X42A 4OQNA 5DBGA 2I66A 1AXEA 4YRRA 1PJQA 3U39A 2ZM5A 4UREA 2A4MA 2G25A 2P3SA 5JZVA 2UVPA 2O3UA 4QDZA 1CUCA 4UNQA 5F4BA 5HX7A 3FB6C 3SEZA 1QAQA 4IHJB 2ZROA 4M8IA 1JQEA 3RYCB 5JRJA 2PZ8A 5LJLA 1W2HA 2DCUA 1HOXA 1W1WA 5IAJA 5EQDA 2QT0A 4JMLA 2Z9DA 2FSVA 4PE5B 1Q3HA 4D8YA 4XGRA 3O26A 1QE5A 2F95B 4WINA 4N47A 3U7QA 3OQ6A 4N3NA 1MDBA 4ZIRB 2HUNA 1Y67A 1GQYA 1ZNXA 3Q7IA 1L2TA 3K8OE 4FLEA 5BWBA 4DXAA 3FOAA 5LQAA 4RY9A 2W0FC 4LDRA 4OHRA 4RJKA 4D0LB 1MH1A 2ZK7A 2ETXA 1XRMA 4Y2TA 2NZ8A 1KS9A 1X3LA 3TIFA 1YWGO 5KNBH 4D56A 3OLYA 1HLGA 2F2TA 2PKXA 1MAVA 2EDCA 2V4MA 2VUSA 3V33A 5JBQA 1G38A 1EE1A 2GZHA 4Q6BA 3DFZA 1HQKA 5BR8O 1PS9A 2VDNB 1UEXC 3O3CA 1P7GA 5DP2A 4WFIA 1LSSA 2EARA 3E8SA 2B61A 3LGSA 1XNJA 2J3KA 4FJ1A 2DQYA 4BL5A 4GI2A 3ZCQA 2HW8A 2JIQA 3PXBA 3CR7A 2GRAA 2JKZA 3HMQA 3DAHA 4YDHB 3HBJA 4X7PA 5E2AA 4QTUB 4WX2B 3WYFA 2C20A 4QUJA 1J8QA 4P30A 5JWRA 2EWVA 2Y1GA 3O3NB 1WXQA 3L1IA 1JQKA 4WKCA 3C7TA 5IF9A 1RPOA 2J48A 2V7UA 1HDJA 2OHXA 1ZESA 4KMMA 1SQFA 1Q8RA 4OGQB 4OB6A 1CUYA 2AHOA 2IZOA 1XPUA 1JIVA 2XTMA 3AVVA 2AVDA 1NP6A 5FBVB 3V7QA 5FPTA 4GR5A 2EZOA 3VYWA 2BRUC 3Q8KA 1PG2A 3SYQA 3HJBA 1WCIA 1A7UA 4ME6A 2NNUA 2OMEA 3VU1A 5H3LA 2FFRA 2WYHA 2DMXA 4LF7B 1PG5A 2GESA 1H2HA 1JDNA 3HPLC 2FSSA 2VJMB 1NU1H 1RYYA 3VOAA 3QWHA 3QUBA 4E4TA 3L1HA 3GWKC 4YYZA 1SVLA 4RL4A 4MO9A 1IUPA 1DFIA 2LP4Y 4PTLA 5KHHA 1UXJA 1D5AA 1HE1C 1N57A 3EXAA 3L06A 3LDDA 1YZ3A 4IIYA 1O95D 1Q2XA 4NBLA 4CQMD 3THXA 2G4VA 4ZRMA 4JJGA 3NT2A 1S3FA 3QYPA 4QXOA 1YBFA 2DQKA 3AV0B 2J08A 2O8EA 4HN9A 4EUSA 3LLCA 1WD7A 2VK2A 3CW8X 2AJTA 4DDVA 3X1KA 4XDHA 3A6HA 3PICA 4X60A 1NUQA 4ZD6A 3L7KA 5EE5B 4RJ2A 5KHLB 2HI0A 5DCLA 3PFHA 3EEOA 4HNHA 1XPJA 4BZXA 3T34A 1KZ1A 1S89A 4XSVA 5AIAA 1E69A 3CCVV 3C6YA 4J4TA 5IMSA 2EC5A 4RF3A 5B12A 3OE7D 1M6VA 2XA2A 1Q86W 2ZUTA 1S4QA 4EVQA 3OMLA 4DMGA 3NJ8A 2ZD9A 3WICA 4PN7A 2VHYA 2P6RA 1U7HA 3ILYA 2CXTA 3NP9A 2GZAA 3L05A 3EXIB 3OCWA 3Q1LA 4KUHA 3E3AA 1HYQA 3GVPA 4CKCA 1CWUA 3ZU5A 1EVQA 1QNLA 1K66A 1LK0A 4D57A 4PC3A 1KY4A 4JENA 4FN5A 3H17A 3QYFA 2IE8A 1G21B 3EOZA 4IIHA 4QUAA 3K2QA 2YWRA 1G8GA 2C99A 4NCHA 4P2BA 1TCUA 2X77A 4B71A 2QZ9A 1DMSA 5AI5A 4Y6QA 4BW5A 1VQ7V 3QLVA 1P61B 3EN0A 1ZUNB 1OAPA 2D8AA 3GFBA 3QWAA 1RDFA 5DP1A 5AJYA 4DQLA 4YV7A 1J0EA 2WSSA 3OM3B 2XMDA 2PZBA 3B3FA 4X24A 1AH2A 1M0WA 1QG2A 1P73A 4TQAA 1FMFA 2C1ZA 3INYA 5DWVA 4IXTA 2LE0A 1XR3A 2OL4A 3ESXA 4R81A 2P5TB 2QE7D 2V5AA 2BGIA 4LHXA 3ZLUA 2P4SA 4FZ1A 1J97A 1LBTA 2FX2A 2GYYA 1JFRA 1QOQB 3HDTA 1PEAA 3LA8A 5EB1B 4AY3A 2IUFA 3HJTA 4J43A 3AVXA 3M4XA 3H05A 3UXHA 3ZU4A 3L73H 5JMTA 1QJ4A 4LWSB 2H1SA 5FLXM 2V7EA 1F4NA 4HG2A 4JI4B 4O4HA 1E9AA 3FAKA 1HFKA 3O8OB 3TMKA 5GJVC 4B2YA 3A3OA 1B04A 4J42A 4Z7NB 5CFLA 3T38A 2JGMA 3QOWA 1NVMB 3H9GA 4TLMB 3RD5A 4LFCO 5TC4A 5E7IA 1G0OA 5BQXA 3FLEA 3H9UA 3P26A 4FHEA 3V2IA 3B1XA 1UQUA 4GOMD 2BH2A 2I8LA 4QTZA 3U17A 2HWYA 3GNTA 4ISBA 1JEJA 4MR9A 2AC7A 1RSOB 3PLRA 3QMVA 6LDHA 3FJ1A 1TK2A 1P2BA 1J0CA 1VL2A 1HEYA 2MSWA 4MRAA 2ZCUA 3WSVA 5HIAA 2OSVA 4EVSA 4RZSA 2DW4A 1EUDA 3M6FA 1TM4E 2PFSA 3TTVA 4JT2A 1QFYA 2A1TS 3HLTA 4NTYA 1YR2A 4CUJA 4FGZA 4QPJA 5DSTA 4WLVA 5GMOA 4EATA 2IS4A 3N0WA 3CRAA 4BJ6A 5KCMA 2HR1A 4NDAA 4PZYA 1QC5B 2O0JA 2H54A 3JSNA 5DNYB 3VPDA 1PJSA 1ACLA 2G9QA 5KAPA 3MBKA 3IP9A 4F2WA 2IYEA 3WFVA 1PFWA 4MPRA 4Q1FA 1NJ5A 2FB9A 3WLPA 4CN9A 4KVFA 3BK1A 2Q69A 3PENA 3TW6A 3KE1A 2JFFA 5TGTA 5EHIA 4AZ0B 3RT7A 3NYRA 3ZUPA 1TAEA 1XCLA 1F3LA 4UPDA 3W05A 1CTQA 3WLOA 2VJKA 2QTAA 4Q1EA 2OBNA 3HFRA 3KVVA 1QOZA 3QBJA 1MSDA 3BMNA 1GNPA 4WLOA 1U2QA 4AQDA 4O8CA 5A9RA 3RVDA 3GFOA 5FULA 1NASA 1P1HA 4BFCA 1N6NA 3HA2A 5CA1A 2PLFA 4Z9AA 2EWMA 1LI7A 3KJNA 4L87A 4Q1CA 2FHSA 2ZODA 1SRQA 2ZIEA 4R1TA 3TAUA 2XMZA 1V71A 1E9SA 3HDGA 1DCFA 4LVNA 5TF4A 2F67A 2EJBA 2O2JA 1D1TA 4B3RO 3KE9A 4WEQA 2DR0A 5A6SB 1A9QA 2JLSA 2QSUA 1AN9A 1VB5A 2DPGA 4WQMA 4Z4HA 4R6WA 4BTEA 4BRWA 3DE3X 3QU9A 3HFSA 2OEPA 1E2EA 2RGWA 3QW4B 4ZVVA 1IH8A 2IXFA 1PEKE 3K96A 1CLEA 3JAMA 4K87A 1XT6A 3GNLA 4QEKA 4DCTA 2Z04A 3Q8XB 3CR3C 2IUEA 5E7JA 5KQSA 1TTQB 1IC6A 4U0KA 4K2AA 1H23A 4D2IA 4DW0A 1CJBA 1JKFA 2YRWA 5IXYA 1U2SA 1Z83A 2AOVA 6CHYA 1UDBA 2W2LD 2XUFA 1PWHA 1ZP6A 1D2GA 3ESDA 3GP3A 1V5EA 4G5YA 4C2BA 4J16C 1B2LA 4KXXA 1AUXA 2XDQA 4WY5A 2OQIA 3ANMA 2HQBA 1JHAA 1PAUA 1IXRC 1EVZA 3QPVA 5DASA 2AJCA 4R1MA 2WWRA 4M88A 2IW1A 3TR6A 5BRJA 1EMDA 1F8XA 6NULA 5JEDA 4JLVA 5KC9A 3H65A 2F9LA 3W7VA 1PUIA 2EHDA 4JBGA 4HJXA 1J1ZA 4N5NA 1N32O 4WY2A 3MELA 4O4HF 4DSNA 3GN1A 3DS8A 1C9MA 5IZ4A 2PL1A 4RQUA 5FI0B 5K0BA 1JJ2U 4L75A 1XJ5A 2JBAA 2ZT7A 2CE7A 2I4TA 5KREA 3L4BA 1KI6B 3BMCB 2BR4A 2NUAA 3A25A 2PD6A 3LPDA 3N27A 4JBXA 3L75H 1BN7A 1PF5A 1ETUA 4RWZA 1GKUB 2ZRJA 5K0TA 4MTXA 2FPIB 1C7RA 1MRNA 1YL6A 1T4BA 2IPMA 1T1GA 4IDHA 3ZHXA 2JFOA 2C4WA 4F7DA 5BMVA 1JILA 1C0EA 1CQPA 4AF8A 3W5HA 4GP9A 3TCUA 4MW0A 4H6VA 4BHTA 4UQLA 5AKKA 2YS8A 3VBEA 4WERA 2GQ0A 3F47A 2GN1A 3CPJB 2UXDO 4H13B 2EFCB 4FZVA 2XHEA 3IESA 1OBVA 2WLHA 1W9MA 2VYVD 4C04A 1R8SA 5JNSA 1UWCA 1J06A 4LZZA 3DDOA 8LDHA 2K1SA 1B7GO 1N3BA 5I8PA 2P35A 2A1TR 4NS4A 3QEBZ 3IE2A 3UENA 3PQEA 1WEHA 4XOIA 3WLIA 4P7BA 4H7KA 4PA3A 4G09A 1VQ4V 3CT4A 4M7OA 3ZN2A 4JYYA 1E8NA 4D0RA 4HTAA 2ZR9A 3MXOA 3CEHA 4U6NA 5TT0A 1CVLA 4PZDA 2NACA 2JB9A 4MV7A 2Q1UA 2JEYA 1T26A 1D2RA 4X84A 3ORQA 1QX4A 4JLWA 5TISZ 5FLYA 2I4LA 4RO0A 4X62O 3JQQA 3NTVA 4PYIA 1Z4KA 2VZ0A 1YTUA 3ILHA 3T5DA 3KAQA 2ZOVA 5CA1F 1F8UA 4L4XA 3NGLA 3OAAG 4QAQA 2P2DA 4D4KA 4J7KA 1GM5A 1G66A 1BVHA 1V48A 5HGJA 4N0QA 5CBFA 4NDZA 1X1BA 4UAVA 3QE9Y 3TZCA 2NU6A 2XUJA 2VNAA 2WM9B 1IL0A 4EHIA 4MTOA 3T7TA 4PYOA 2HV8A 2IOFK 1C0LA 3KQYA 1DU4A 4K9MA 5G0VA 1NBHA 4KE6A 3AG2B 1C2YA 3GRRA 3QX8A 1KPIA 1U8ZA 3BJZA 2NZWA 3KXIA 3O2JA 3E58A 3LQ2A 4PAWA 4D8VA 2OPHA 4C01A 5LQUA 2HP3A 3QHDA 2GBOA 4YR9A 1PK9A 2Q3MA 1EFKA 3F3YA 1EDDA 1JEQA 1Q14A 4BQQA 1T6NA 4TL7A 2YBEA 4RK5A 3KJJA 3G17A 4KQHA 4B9EA 2J41A 3TLGA 3ORHA 1CR4A 5ALWA 5C31A 3EEFA 4OQDA 5KNDA 3IOMA 3MT8A 3PFCA 1PVVA 4GG1A 1FQWA 2PG3A 4YBZA 4QSHA 3ZWDA 5KHJA 2DT5A 3Q8LA 4TZZA 3TCKA 1BKSB 1FSSA 3BE6A 4YC7A 1SQGA 3M6UA 1Y6JA 2XDAA 3G2PA 1RLGA 1PR5A 4TZTA 5J23A 4BVLA 5KYVA 5HKKD 2QNBA 2HUPA 3CZPA 2QLFA 1LI4A 1Y3CE 3U6KA 5BN5B 4FKBA 2XQKA 4PSKA 4AKHA 4UPEA 5FXMA 1E98A 1PS8A 2H4JA 1NNI1 1ZNZA 4KXRA 4OHOA 1YKFA 3ICVA 5ESRA 3O8CA 4MA0A 1XA3A 2EGUA 3A6PC 1B6RA 3ZMZA 1C7QA 1MRZA 4Q1BA 1KVUA 3NH9A 4TQDA 5JSZA 2OYSA 5LOVB 3NT5A 1A8SA 1GQRA 1SRRA 3FWYA 3JPWA 5B1HA 4YH1A 4O02B 2VXYA 3ZWKA 1WQ1R 5LIRA 1SZXA 5FTKA 1FVOA 1KK1A 1M3SA 1Y74B 3KJZA 3OC0A 1EKXA 2H65A 3D4PA 2F43G 4Y0AA 5FTJA 1YIJV 4LUCA 5JVDA 2DT8A 4CKBB 1X39A 2P9QA 5KWVA 2OXCA 2EF1A 3P27A 4B4WA 5JQGB 4K0KO 5JCJA 4OH7A 3URMA 2ZRPA 1TUEB 2FEMA 4FDAA 4TTRA 1K73W 4D4IA 2PDAA 4NF2A 2B4AA 4P54A 1XVIA 4XX0A 3IA7A 4LXGA 1N34B 2ONYA 1T8UA 2XBUA 1W5BA 2HA3A 1I0IA 3DMTC 2QN1A 1YACA 5K8CA 1PFVA 4R8KA 2C4NA 1NHGA 1WKBA 3NHYA 4FLTA 3COSA 3PX3A 1RLTA 2WHXA 1P4SA 5DH9A 1BSMA 2Q0HA 2CTRA 3CRVA 1SMKA 1ORRA 3RB8A 4ZARA 2HK9A 3FOBA 2DFLA 1UUFA 5KUKA 2DQZA 1QIEA 4MICA 3LUPA 2PFGA 2UYKA 3N2GA 4ZVMA 4OLHA 5ETJA 3Q4HB 2O2HA 2VP0A 3RUHA 3SP1A 4CV0A 1J1IA 4B6EA 5C4MA 2QLJA 5E3IA 4IFIA 2GK6A 3H4IA 1A71A 3DUFB 2O4CA 1DZIA 1OV4A 2QTTA 1H0HA 2G77B 3ZWPA 3JQCA 1RQPA 4RY2A 1T3LA 5BSEA 5C5CA 2RB4A 4JT4A 1XNRO 3D3IA 2JANA 1ULAA 2VQ6A 1ABEA 3PIRA 3DMPA 4JAUA 4S0ZA 3DFFA 1TK3A 3CM0A 1O97C 4EAQA 2XGSA 2XXAA 5A5VA 2C94A 2ODTX 4PVCA 3DAYA 2XQGA 4BZZA 2ZIXB 1NJ8A 2YIMA 3CMCO 2OCDA 3TDMA 2PUWA 1H2MA 3QPAA 4II3A 1WULS 4OM8A 4WBSA 4JB3A 4HXGA 1XZMA 2GVDC 3DAFA 1UKCA 1C30B 3CCBA 3M6AA 3MWGA 3HXMA 1GNQA 1Z18A 4O4JB 1JMKC 2NTYC 3CCJF 1U8AA 2YIBD 4PO8A 1DXQA 3DV0B 3UK0A 2QJRA 3SZRA 4M46A 2YVKA 4EA6A 1JDUA 3U3JA 1K88A 3VC3A 5FV4A 5G1OA 3DQQA 4GL2A 3KUKA 1E8DA 1TL7C 4YDSA 3WY9A 3IAEA 3HY6A 5CH3A 1ZO8A 2ACWA 3BE4A 2GO1A 5FR1A 1RQGA 4BX9A 4PCUA 1AGXA 1KDTA 2GZ1A 5ALKA 2XQIA 1GZ5A 4MW4A 2C3MA 4KRYA 1IQRA 2V0NA 1ZLXA 2J32A 1FJHA 1BYIA 1EK1A 1SPBS 4B5LA 1YJAA 2PA3A 4DKJA 1DCKA 4Z4GA 3BGSA 2NGRA 4C76A 5CCDA 2PMPA 3IE1A 4FC7A 4G86A 4A5SA 1EFUA 3IEMA 3MWYW 2ZI6A 1MAWA 1E6EA 5LP6F 4MRMB 5DJ5A 1ZUD1 3KT0A 4L8LA 1AA9A 3GAFA 4LZAA 1G1AA 2PWPA 1JVNA 3JALB 1B0AA 3G5MA 3I6ZA 4YMIA 2CNWD 1N6HA 1T9BA 3C4JA 5KA6A 4QDKA 1OZHA 2WEKA 3N7AA 2C2GA 3O9MA 3I3FA 4HXEB 3PI7A 4XDLA 3COPA 4HZUA 4BFVA 3ZJYA 1XEQA 1MOPA 1UWLA 4IJ5A 4WASA 3AEKA 3ZXYA 4LS3A 2WALA 1EDBA 4J6EA 5KYTA 2HYDA 1EUQA 1R9GA 4OI4A 5HA5A 2QNRA 3K0TA 3GZNA 1QS0B 3L8YA 4HNAB 4PLYA 3HE3A 4TSFG 1NTZH 2B37A 3AU8A 3FCCA 4JI0B 1S8AA 3VHQA 3W2FA 4OPHA 3V6MA 5EHZA 3U3RA 4W5QA 1MJNA 4N5LA 3F5SA 4TV8A 4OB8A 2WM2A 1L4EA 4NJOA 4UCSA 1Y8ZA 2R751 1FPOA 1II8B 1ZVMA 2QSYA 3QXCA 1CS0A 2GPSA 1QYIA 3H1FA 2D5BA 5FO0A 4HZGA 1WABA 2OLJA 5E3HA 4IL6Z 4ZRDA 1Q2UA 3KHUA 4MKHA 3AR3A 2C1EA 1SVOA 2JH3A 5DGDA 3UJ8A 3DHYA 3BH6A 4LSZA 3S4YA 4OEHA 1SG0A 4WK6A 3ZRSA 5IM5A 1XTJA 2ZKLA 1DDIA 2O50A 3CF4A 4YUWA 1JKXA 1JU3A 4UULA 1VKNA 4MRRA 4URXR 4MWDA 4C29A 4CR8A 2QQGA 3AHJA 3FCSB 1AN0A 1D8TA 1QV6A 1H8HD 1Z5OA 1UZAA 2UAGA 4R5HA 2FGJA 2MJLA 4GCZA 4M9QA 2BEUB 3ER6A 1L5QA 1OY1A 2A9PA 1UPCA 1E6WA 3K1JA 3JQFC 5DHQA 1A4RA 3HXLA 2GJ8A 3HZHA 1FDUA 3ZS8C 1BFUA 1DBIA 1R4NB 2LV8A 5EMJA 2B1JA 5E1OA 3CNLA 3KTAB 2O6LA 1U90A 2CJWB 4JFAA 2WICA 4B40A 1S72F 3RVNA 2OZVA 2ZSJA 3PR3A 4LJYA 1VE3A 2CTPA 2CLCX 4DLNA 1PS0A 4CH4A 2ERYA 1Q1AA 2JJ1G 5AHRA 5TVKA 3G6BA 3R20A 1IZZA 2V7VA 4HUQA 4DV1B 5DN6G 1JMVA 2EJRA 5DGHA 2PRYA 1YK1A 3MSCA 3L41A 4BQOA 2VDVE 3COVA 4B08A 4YP5A 4G1VA 1VPDA 2PS0A 2PU5A 2HHCA 2ONCA 4G4YA 3GRAA 2VGMA 2H5JA 4CM5A 4F4DA 121PA 4QHYA 3V4SA 3W1VA 1FUIA 1W0KG 1C4KA 4ZK6A 3WNBA 1ZS9A 3U4CA 3KOYA 4J7CA 3R77A 2VXBA 4LMBA 4TVBA 5A03A 3TTYA 4EENA 2IQQA 3TIGA 4K0RA 5TPWB 4B3IA 1MG0A 3EUAA 5DFAA 2QSZA 4F4UA 3R0VA 4PV1B 4L5CA 1XREA 4YLYA 5I4KA 3UBMA 4R1SA 3PGVA 4HQ0A 3AGKA 3RUIA 1NYLA 1O95A 2F62A 3D2LA 1CK2A 5DM60 1MIOA 1L0BA 4CQMA 1TQ4A 3R9WA 4IKOA 1ZBQA 2WT9A 5FNZA 4DLLA 4P5EA 4BY9E 3LQYA 1PTKA 3RYIB 1XTBA 4REQA 3U44B 5HDBB 1EDEA 5CVJA 1SG6A 2X40A 2HJVA 4GI5A 1NVBA 5B6JA 5AT1A 5LA6A 1ZIPA 1TMOA 1M2GA 3AW8A 3CWBH 3SXPA 4URUR 1TC1A 4Y7DA 3SXJA 1HE2A 1T13A 1CC1S 4Z4IA 3I56F 4YJHB 1GZDA 4ACAA 4ZT2A 1J70A 2N3ZA 3TB6A 1WUHS 1Y76B 3HB5X 1GYRA 1UBHS 3FYUB 2QVYX 2WFLA 4Q03A 2ZVQX 1GPLA 4M1ZA 2NTVA 2M1ZA 3W9UA 4YJKA 5AUNB 1TUBA 4C9BA 4CF3A 3OE7A 3GQBA 2NV2B 3LLVA 4TQ9A 2BFWA 2CWDA 2DJIA 1JG4A 5AWFC 4L8GA 2VP9A 2F17A 2RIRA 3F7VC 3WLAA 1OJ7A 5DRTA 3KBBA 1H1LA 3HKDA 4KWHA 2GH1A 3FZYA 4UE2A 1JEYB 3APOA 3PTLA 4RKEA 3RSGA 5DHTA 1UL1X 4Y67A 1E1DA 3X2QB 4TV8F 4INAA 3G8AA 2D8MA 3RAEC 3VOUA 4XLTA 4RPCA 2OAP1 2HRBA 3GGOA 1CN7A 2C31A 1JFFB 2JAOA 2YV2A 4F4LA 1I80A 1JB1A 2X4GA 2DPMA 3F5QA 2H9AA 4F60A 4M4SA 1TQ6A 1MTZA 4PFKA 2PGXA 3OE4A 3I30X 1U2ZA 2R8BA 1RFLA 1VQVA 3A3KA 4NPHA 1HRKA 3SCZA 4LZNA 4AKIA 4Y2YA 5IAGA 3C97A 1GMGA 4JB2A 3FYTA 3MGGA 5ULLA 2X9QA 2X5JO 5G53C 1T25A 2J9RA 4BW9A 4MMYB 2OQRA 2MR6A 5DI3B 4NE7A 1E3IA 4H7FA 1N25A 5KTKA 2QE7A 4P0QB 3A06A 2VKQA 1OBFO 4Q7KA 4LW8A 1Q1BA 9ABPA 1A8QA 4MS1A 1GCOA 2WU0A 3HWSA 5FTNA 1XVLA 1P9WA 2PBLA 2B2XA 1QHGA 4LEIA 1J2TA 1P2TA 3K53A 4Q66C 1FRVA 3ZVLA 2Z83A 4DLWA 3FRJA 5LMUO 1N36B 2VJAA 2QMOA 1EZZA 2WWGA 4G0NA 3UJNA 2BKXA 1CDOA 2R11A 2ZATA 1AY0A 3V4ZA 1J23A 2RGAA 2OO5A 1T1EA 1J8MF 3G0DA 1RBMA 3MRVA 1BO6A 3Q88A 4ZYVA 2YJZA 4REOA 5GTIZ 1DOHA 4R9VA 1DPGA 3K3PA 3BXZA 2WFMA 1D4AA 4BE9A 1QORA 1Q0QA 1P7BA 1NVVQ 1DE0A 3KB1A 1I4WA 2R6FA 1W4ZA 3JYLA 1KSGA 1DJOA 2RGBA 1QH8B 4OKIA 5BT9A 1A4UA 2XCIA 1LVGA 3ITEA 3OBWA 1QHSA 3J7AC 2H7XA 2JNBA 4NJMB 2BV3A 3MCAB 3E8BA 3ESCA 1Y1QA 3EH2A 2I7DA 1M8PA 1IIBA 2C9OA 3AF5A 3BDVA 4O4IF 2C9CA 1IVSA 1G8KA 1ZIXA 5I7AA 4KGVA 2J0EA 2F93B 2AZDA 2EZ9A 2ZF8A 3F4LA 2QX4A 4I9QA 4EZIA 1NBMG 4JP5A 1MAAA 4LK3A 1UMDA 2WT4A 2CK3D 4LOHA 5HIKA 5FJJA 1G59A 5A9SB 4UCTA 3G82C 3U13A 3BBPA 4NHEA 5LFAA 1Y6XA 4C05A 4AK9A 3D6HA 2OAGA 2JLQA 5JAOA 5E7QA 4GZRB 4NAVA 4ZV9A 3O84A 3ZMSA 3IP3A 1P0IA 3P4XA 5CJPA 1VA4A 4HDAA 3AU9A 3BTUA 3D5QA 4N4AA 1K4KA 1ESDA 3DTVB 1OWLA 5EIFA 2FSGA 4M9ZA 2HT6A 4NZZA 1BHO1 3IT0A 1ZW1A 4QOIA 1SC9A 3HBMA 5LZ4A 3IQGX 1A72A 3AMVA 5HUQA 3L71H 3PXUA 3QJYA 1CY8A 1IHDA 1Y5RA 4MI6A 2P5YA 1P18A 2RGEA 5JTUA 2DQ3A 4ZCSA 3HJHA 2OILA 5B1NA 5KAIZ 4J80A 1T3HA 4MPJA 2GDSA 3K30A 4KI7A 3DP7A 1QGZA 1XD2B 5DTEA 2BR3A 3I8SA 1QOPB 4P35A 1P77A 1XL6A 1HYEA 3GVMA 1L5ZA 3S28A 3U3MA 5AVSA 4KN5A 5CK4A 5AM2A 2B9ZA 2D74A 1MO3A 2XW6A 2UYNB 1ZPDA 3OO1A 3E86A 1R64A 2VK8A 3ZD6A 4LMAA 2R6CA 1JIUA 5KTTA 4W1QA 4DK1A 3C3XA 1JXAA 3P20A 5IN5A 3MUFA 2ODMA 3VH3A 1OIXA 1SCIA 3HJWC 4V24A 5AOBA 2GHYA 4RJIA 2YKGA 1QMGA 2W2LA 2HRUA 3UV7A 5AXBA 4PANA 2OZLB 1IBKO 4GNKA 4MROA 2ZUEA 1U3WA 3UO8B 1ZCFA 2QPOA 4HUTA 4F6RA 1SQPH 5CNMA 3JQBA 1Y89A 4LNUA 4QM6A 3P0ZA 3U4HA 2NUPA 3PSAA 2NW6A 1X52A 1Q0UA 4OK5A 4G4IA 3DE4X 4JI5O 4ZOLF 4KYTA 4ZFNA 2QQEA 3ZHQA 5B5EZ 2PV7A 4X7BA 2XE7A 4LHYA 4EY3A 5EOVA 2HQSC 1W7AA 4GVXA 4RD2A 1FUUA 1EUZA 3KWLA 1G6OA 1KAQA 4LJLA 5BSWA 1OIVA 1FK8A 5TGZA 2I65A 2WY2D 3Q3CA 1EVEA 1NQXA 4JHXA 1JR3D 1G3QA 1X86B 1LUAA 1YZFA 1KGDA 2ZT8A 2X8JB 4RWUA 4OXKA 4G0QA 2ZNIA 5FEUA 1JT2A 2GYUA 1HH4A 3QV1A 3FZEA 1X38A 4HVTA 3ABSB 4DTCA 3PDWA 1E1CA 4N48A 1ZUWA 3TLEA 2QW8A 2RGNA 3W3AH 1PQPA 2I4RA 3NCTA 3B77A 2CVFA 5LD2C 3FD5A 2X23A 1JIJA 3UAZA 3GGDA 1JI3A 5JCOC 3L1UA 4P3OA 1L4HA 2PE5A 1P19A 1MV5A 5EMLA 2PX3A 2PGDA 5EJ9A 1ZA2A 2V6IA 2QWOB 4RH0A 4KSBA 3E23A 2JI8A 1NVWQ 3ANLA 3TS1A 1PBNA 4IKEA 4ZTBA 2VYVA 3PNVA 1A9XB 3OTOO 3E8HA 3V7WA 2RHJA 4GM1A 3UW3A 3BWXA 2FFHA 3E22B 1L8XA 1NXPA 1ZH8A 3KYDB 1G8SA 3TKAA 4ARZB 3PUXA 3BCHA 1MJHA 1MEOA 3J81N 3FKSG 1OB2A 3PFFA 1BX1A 5L51A 4AY5A 2GJSA 4P4TA 4ZVLA 4KQ6A 1VYVA 4LBVA 1ZR4A 1L1QA 2BJVA 3ZD8A 2XUAA 1EP3B 3P0EA 3X3HA 2EILC 4RV9A 3EGWA 3TPFA 2QL9A 1V3QE 4ZHQA 1FRNA 4EHHA 4JZYA 2O2YA 2G63A 1GITA 4EDHA 4B83A 1Z0KA 3DHVA 3L72H 3EVAA 1RQLA 4I9FA 1QU2A 1JHXA 1MC1A 2IDKA 1IRIA 5C3UA 4XM1A 4A36A 2HRRA 3IHLA 4O2LA 2HWKA 1KK3A 3ET5A 3CJHB 5A4MS 4FFSA 3IUNA 2V7PA 3WIUA 4MGHA 4HAIA 3VI4B 4L50A 1J07A 2JJQA 5DLYA 1OX4A 1R6UA 1MABA 1W4RA 5DHPA 2QKYA 3I76A 1CP2A 3DCYA 5H81A 4PGAA 1M0SA 5I6DA 4C8EA 3U11A 2BONA 2FFQA 3B9RA 1JPNA 5DYWA 1KDVA 1XMOB 2B3DA 3R74A 4AW9A 1JTFA 1YZBA 3CMEF 3IMGA 3NBKA 3K1AB 3NHBA 4YCJA 2LD4A 3VU0A 5FAXA 1WMDA 1W52X 3V4FA 1PW5A 3K32A 1XN1A 4JKYA 4XOUA 4DR4B 4G27B 1K4CC 2VHJA 1UJ6A 4B4VA 3EASA 1VOTA 1GPDG 2YMPA 2WYOA 4CDRA 5HCUA 1E7WA 4YY3B 1BEZA 3CXCU 1YH3A 1F0YA 4MDFA 5AKLA 2VSOA 3MD9A 3QEOA 2M6LA 2ZYVX 1FDVA 5B64A 1PK8A 3IUSA 2Q3LA 5HKKA 3FHTA 3I32A 4OF4A 3KVRA 4ZHYB 4MCAA 4WXMA 3AY0A 3LSYA 2Y4UA 1GPBA 2WUFA 2P7HA 1MG1A 2J0UB 4R8CA 3TNLA 4YJFA 2XNDD 1MVOA 2BTOA 4YI3A 4J7XA 4LXQA 3A1CA 3MB8A 4M87A 4Z5XA 3DEAA 4PYKA 1ESMA 4A0SA 2WSBA 2WFAA 1JG6A 3R3UA 5AMXA 4O2AB 2PUTA 3FMIA 3HDYA 2IEAA 4EDFA 2PSJA 3ZPXA 1XRLA 1PGNA 4LKOA 3IDAA 2Z8XA 1U2DA 4WK2B 5JRZA 4YJ3B 4XI9A 3EZNA 1H69A 5AKGA 2GAJA 1BD3A 4L9AA 1KUQA 3OG9A 3ST7A 1UP4A 3SMVA 1J0XO 1VJTA 3H1JH 1Q7YH 2PUAA 3H11A 2WLMA 1KYIA 2FTKA 1J7HA 3V42A 3TD4A 5TEWA 4DLAA 3CUWA 1AUQA 1Z0SA 2CEKA 2FEPA 3RYTC 5A9GA 1J24A 4YIPA 2J4FA 1GV1A 4HEA1 2HYIC 3CNEA 3KALA 4XEHA 3R2JA 4RTPA 1Z3IX 3CRMA 1Z4IA 3TPCA 4V03A 1FRFS 1IRXA 3H5RA 4CFYA 3I9V1 1L0LH 3HH8A 4DGQA 4MV3A 2EZPA 3FNHA 2Z58A 3CE9A 3VZQA 1LD3A 2ENWA 3BHMA 2ISQA 4WDRA 3FYSA 3LS2A 2B2NA 4CS3A 3F96A 1SCDA 4DA6A 5H82A 3ABQB 5FWXA 4RV5A 1I8TA 2W93A 4FNGA 3N5CA 4F1KA 5U4QA 4XZ3A 4H7DA 4GL4A 3ZQKA 2Q4EA 4J8PA 3SJAC 3ANYB 3GJ8A 3KT3A 1SOWA 2WJZB 3DCIA 3EXG2 3TO5A 4ZCMA 2OK7A 2IWHA 4HN2A 1C1HA 4G9BA 3A14A 3B8MA 4KQIA 1WAZA 2IOQA 4OL0A 3LNMB 3DEKA 1XTTA 1SVKA 4JZGA 3FVVA 4KVGA 1CUEA 2IH2A 1TKCA 2Z57A 2IA5A 5JHHB 2A9RA 4CG3A 4UHEA 4LWPA 5C4GB 2IAFA 4BUZA 1BWQA 5BSTA 3S40A 2HU8A 1CUHA 2OECA 3NRBA 4QTTB 3PCTA 5BQFA 3AHGA 2W0MA 3GPDG 4YP9A 3OZ7A 3LFTA 2OHHA 2ERXA 2JGEA 4ZT7A 2OPBA 4DYHA 1XTQA 2PXHA 5BV0A 4E6EA 5A02A 2WLJA 2ZYIA 3GLIE 2ACKA 1I5YA 3R23A 2QTVB 1RWXA 5IZCC 2CLOB 2YWJA 1KEEA 4E2ZA 4C0SA 4HB0A 5ADHA 4UPVA 3KXDA 2HQ1A 4L0MA 2IYSA 3DGEA 1PR6A 1E1MA 1S3SA 5T6BA 4IF4A 2YHBA 4MLPA 9ATCA 2YIBA 2GLUA 4UUMA 2RJOA 3PB3A 5G1NA 1YMUA 4D92A 5K9ZA 3M1IA 3IDQA 1J8FA 2FMLA 3AR4A 5CYOA 2MSDB 1Y4ZA 4QUDA 3UB2A 4J0QA 4Z3KA 1NW6A 4CT5A 5FOWA 3AXSA 3WRYA 1DBVO 1WU7A 2J6HA 2P4HX 4W9NA 2EQ5A 3EG9B 1ZMRA 4DEYA 5FWNA 2LGQA 1MVNA 5TX7A 3OWXA 1QQAA 3ZE2B 1SY7A 2TSYB 2GV9A 1H0SA 4S1WA 4BQIA 3S8MA 1JAYA 5K8TA 1YB1A 3RJTA 2GCIA 1JUDA 1U5CA 5T5QA 1S7GA 3KAPA 1XHZA 1NUAA 2GEDA 3LPMA 5J2TB 1AZLA 1RZ3A 3DMGA 3W5BA 1GFIA 2JIBA 3BG5A 3G59A 5TGDA 1P6UA 2I8AA 5K4GA 4F9GA 3V00A 1RRVA 1X7PA 4DXDA 5KQLA 2ZXFA 3QLTA 5A5EA 3U16A 4J9UE 1VHDA 3LSQA 3EMKA 3N5KA 5K8IA 4JOQA 5HQTA 2GYWA 1UZLA 1XLVA 4BAGA 2JFHA 4CS2A 1Y3FE 3V32A 5JLJA 5CM8B 2OAEA 4V2IA