3JAKB

Cryo-em structure of gtpgammas-microtubule co-polymerized with eb3 (merged dataset with and without kinesin bound)
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
429
structure length
429
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 151
structure length 429
sequence length 429
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jakB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jakB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jakB01
1TUBB 5IJ0B 2RHJA 3RYCA 3M8KA 1W59A 4ZI7B 5BMVA 4U3JB 2XKAA 2BTOA 5J2UB 4EI8A 5JCOA 5KX5A 3RYIB 5M7EA 5JQGB 4O4JA 1TUBA 2BTQA 3R4VA 5JH7B 1SA0A 4O2BA 5CA0A 5LYJB 4IHJA 4IHJB 2Q1YA 3JAWA 5EIBC 5J2UA 4O2AB 4TUYB 5KMGA 3RB8A 1W5FA 5BMVB 4EI7A 4O4LA 4YJ2A 4YJ2B 5LA6B 4ZHQA 4XCQA 2RHHA 4M8IA 3JARB 4ZOLA 4FFBB 3RYIA 4X1KB 3JATB 5ITZB 1OFUA 4U39A 3HKBA 4HNAB 3WGNA 3WGMA 1FFXA 3JALB 2VAWA 5LP6C 2R751 3ZBQA 2VAPA 1RQ7A 5FNVB 5FNVA 3N2KB 5EYPB 5IJ9A 5IJ9B 5CA1A 1W5BA 4I50A 4IIJA 3ZIDA 3UT5B 4X1YB 1Z5VA 4DXDA 4U3JA 5JH7A 4O4IA 4O4HB 4TUYA 4I50B 4YJ3B 4WBNA 5JCOC 5KMGB 5LOVB 3WGJA 3WGLA 5JQGA 4DRXA 3RYHA 5KX5B 2RHOA 4B45A 4I55A 5IYZA 4X20B 3VO9A 4ZOLB 5LP6B 2R6R1 5MN6A 5LA6A 4ZHQB 5CA0B 3ZBPA 4I4TA 4I4TB 3E22A 3JAKB 5LXTA 3JARA 3VOAA 4X1YA 4EI9A 4O4JB 4O4LB 4I55B 1TVKA 1TVKB 4ZI7A 5CA1B 4KWEA 2VXYA 3JAWB 4X1IA 4X1IB 3E22B 3JAKA 3RYFA 3RYFB 2GVIA 5J2TA 3HKBB 4TV9B 3VOBA 5GONB 5LP6A 4TV8A 1FFXB 3JALA 2VAMA 1W5EA 3HKEB 4O4HA 4YJ3A 4WBNB 3VO8A 4LNUB 3N2GB 3JATA 3HKDA 5IJ0A 4O4IB 3CB2A 5LOVA 3UT5A 3JASA 3HKDB 3HKCA 3C8LA 4B46A 2XKBA 5C8YB 5C8YA 3N2KA 4X20A 5EYPA 3VPAA 5J2TB 4X1KA 1JFFA 1JFFB 4EB6A 5GONA 4EB6B 4DRXB 1FSZA 5JVDB 4F6RB 4HNAA 1SA0B 4O2BB 5LYJA 5EZYB 5IYZB 4LNUA 1W5AA 2Q1XA 5EIBD 3WGKA 4O2AA 3V3TA 1RLUA 5CB4B 5CB4A 5LXTB 5ITZA 3HKCB 4F6RA 5JVDA 1W581 3HKEA 3RYCB 5MN5A 2BTQB 3N2GA 4TV8B 3M89A 5MN4A 3RYHB 2RHLA 4IIJB 1RQ2A 4FFBA 3JASB 5EZYA 4E6EA 1Z5WA 4TV9A
chains in the Genus database with same CATH superfamily
1YF2A 1ZD1A 3AY6A 5AKXA 5ESXA 1KDYA 4ZIBA 2YDXA 4MIOA 3IODA 4ND1A 4P3OA 4R98A 4DJJA 1WBBA 4QXMA 3C7DB 1K3FA 3GNTA 2P5OA 4JX8A 4CTOA 1G2IA 2G1AA 1FNDA 3BGVA 2QLLA 1MAAA 4XUEA 3H97A 1BKDR 2XODA 4UUNA 1FCJA 4B3MO 2PFGA 1J00A 1CNFA 2GHYA 3AHDA 4QNNA 1X42A 1C1XB 5HDBB 1XA4A 3HGTA 2R8EA 3I8SA 4NKGB 1Z33A 5K6AA 3T80A 4NG4A 2MHCA 1LPNA 2XNDD 3QJYA 3RFXA 2WAAA 3DC6A 4LF4B 2RIPA 4G8CA 2ERCA 2M1XA 4N7MA 4DIFA 1Q92A 1D5WA 4HD8A 4OXKA 3RU7A 4I5SA 1W4ZA 3HVHA 3L0YA 4LCBA 3K31A 4PG4A 3PLAE 1IX9A 4ZOQI 4C4ZA 3GVMA 1LUWA 1U3VA 3L4BC 4NMHA 4Y2HA 2EFDB 1SO8A 3H84A 3U3JA 2NSHA 1D2CA 3Q85A 4FZRA 1A77A 1M83A 4GPIB 3ZZTA 1QGDA 4EHAA 2XRMA 1M33A 1VPVA 5KUTA 4HOYA 1GXSB 1DKRA 4K40A 4WFEA 2Z3ZA 4AKGA 1P18A 2ID7A 3NVAA 4UNSA 4LHYA 1XL1A 1I2MA 4BGIA 3GPLA 3IT3A 2ONKA 5GADl 2HEIA 4WKNA 4E1VA 3VBBA 5AM0A 3T0FA 5JCOC 4BP8A 4QXQA 2FEWB 3THOA 1N0WA 3ZDDA 2C3UA 3KEOA 4DQ0A 3FBTA 1RHKA 3WRWA 4ZI3A 2ZUSA 4FJ0A 3I32A 4RHEA 4HNGA 4HRVA 1X8XA 3TX2A 4YCBA 3ZN1A 3OBWA 1MBZA 1VL6A 2BR4A 4JI4O 4O0MA 2FG5A 4QUGA 1NE2A 3RS4A 5I51A 3BHNA 1XU9A 2BAGA 1DCKA 2R6DA 1VJTA 4ZI7A 2BM0A 3OW2U 1EZJA 1DAHA 2BKEA 2Q2NA 3F6PA 3HUEA 3I2IA 3LCUA 3CCQF 2FX2A 4Q02A 4A9AA 4EW6A 1OZ0A 1PV4A 3L93A 1V48A 3THXB 4BB5A 2GPNA 3NT5A 3C3CA 3GNSA 1Z0FA 2FK8A 4JLDA 4QYXA 2IIQA 4NCIA 2FC3A 3PNOA 4A0GA 3R0IA 2VP5A 2CCKA 3D6JA 3VH3A 2UYOA 1D0IA 1CE8B 3TD9A 3G9XA 3EOBI 4HXYA 1BD3A 3B53X 4IJMA 4E5NA 4WY2A 3EQ6A 4L5JA 4TXNA 4Y2XA 4O4IB 1J0AA 1L8OA 3H9CA 3DCJA 4BNHA 4NEQA 4MQBA 1NI5A 3D81A 1IEWA 2CK3A 1P45A 1IPFA 1K8AH 1QTIA 1J33A 2W83A 2H18A 1QGAA 1NQXA 5HZMA 2WT8A 4RYLA 1GH6A 4FLXA 3LNTA 2PS9A 1FSZA 2B37A 3MWEB 4ZO8A 1ZNQO 3H1KH 2PUJA 3B9BA 3ZWVA 4ESEA 5DLDA 3ZY5A 2ZJ5A 1SU7A 3FRHA 4A3SA 3AKZA 1EEXB 3AKDA 3BB4A 5EK0A 2H7XA 3GTZA 2FE4A 1ADFA 1RD4A 1IBRA 3F49S 4N8DA 4P08A 2J9GA 5U1PA 2FUG6 2HS0A 2Z1UA 2IUEA 3FDZA 5H3HA 2P4KA 3U9TA 1SZTA 4BEBA 2CF6A 4XLZA 2WZDA 2O5CA 2BUAA 1VQ8V 2ILMA 4AKHA 3OZXA 3ZV5A 3KL2A 1FDIA 1O2DA 3FUWA 2XRZA 3LT4A 4AJKA 3CCVF 2QZPA 1ADJA 2IIPA 3HA5A 4HXEB 4ODIA 1GGJA 3LT1A 3UAGA 4CS4A 2R6FA 4RQEA 1KJQA 1MVNA 1C7QA 1NY5A 1GAXA 1RLJA 3DLCA 3NASA 3J7AU 2BTOA 4IIYA 4W7SA 1NU1H 3VNBA 5TQ0B 1E0JA 1YNSA 4UTVA 2P67A 1M8FA 1OAPA 3RRZA 4H17A 4LFAB 5JARA 2XB4A 3I0NA 3FTNA 2WD9A 3BB3A 2VF2A 4MZDA 5DSZA 3RWOA 3RUCA 4DDWA 4JFAA 3R7DA 3PKIA 1SVWA 1SCJA 2OCPA 2YJ3A 4MCAA 1NYQA 2BHLA 2QL7A 5K1PA 3TE7A 2QTHA 4HH0A 5B1AB 5IJWA 4AN0A 1Z8NA 1UM9A 2OGWA 2GN0A 5LQJA 3QU2A 2JW5A 4HDRA 5DK6A 5GZ3A 3CLSD 1QYXA 2APJA 1AA9A 2RK6A 2HREA 3AW8A 1NW9B 3H2KA 3A04A 1PGJA 2Q9CA 2QL5A 3FNFA 3HCBA 4TL8A 4IEEA 2DWUA 2HDHA 4YS6A 1YDGA 3SLKA 1XTPA 1JV2B 3STTA 2Q8PA 1MOZA 1CY8A 2XGGA 2HO4A 1GQSA 2B69A 3A1DA 1ZVVA 5EE3A 3PFBA 1OCZB 2WB4A 5FPSA 2P2LA 4BGUA 4NX2A 1NJ8A 3QU5A 1AGPA 4WPGA 3CRCA 8ABPA 3STYA 3IEKA 1Q0UA 4DL9A 2AJDA 4B81A 5C37A 1SELA 5LBTA 1SQQH 5IS2A 1O6BA 2X5KO 1QR8A 1LK5A 5A0FA 4N5MA 2YJ4A 2JFZA 5EXTA 2JLRA 2A3NA 1SCKA 1XRLA 1LQ2A 4FW8A 3N0RA 4POAA 4RA9A 4OHZA 1RQRA 5CCEA 3E81A 5DP1A 3TQIA 6Q21A 4RMNA 5ITVA 4KXFB 2O8FB 1Q1BA 1MIOA 3CPJB 1DBVO 4LJ5A 4MNTA 5JXGA 4KRFA 2QN9A 3KPWA 1H8HD 4KGDA 4L75A 2QA4F 4YLGA 5JHHB 4TS3A 1VRCA 3JAKA 1P2UA 3DJYA 4H6WA 3W9YA 1E77A 3KBBA 4Z3OA 3UQYS 3DG9A 4M6WB 3S4YA 2VQFB 1WMEA 4U6SA 4CC5A 1JP7A 1RJWA 1Z6XA 3IQGX 2VT6A 1RJDA 5T4FA 2UXCO 3AM5A 3I09A 4NYMQ 3FPEA 2YNMA 3IGAC 2OK8A 2ENWA 1SVKA 3HFSA 4BKPA 2BEUB 2HQOA 2D1YA 3ROMA 1IIBA 2P7TC 5B7QA 3DO5A 2DQYA 5JQGF 1HOTA 1E1MA 1EU1A 3FH0A 3HJRA 3MCZA 3TSCA 3WAJA 3HI6A 1J56A 1T8WA 2W2PA 1NDQA 3QV1A 3UC9A 1FNSA 3SS7X 2WSBA 1ZJ6A 4Z4IA 3ZN0A 1DFHA 1E2BA 4ILEA 3QLTA 2SNIE 3U62A 3OUSA 1OT3A 3R2JA 4X5OA 4G5QA 2PNJA 5BWOA 2C8JA 4FWTA 3NVKI 5SICE 4RO0A 2OCAA 3M33A 2IJJA 1WHSA 3QP9A 2PD3A 3W8NA 2QW1A 2GRJA 2Z1MA 3F6CA 3CIOA 3IPRA 4G1CA 3TSWA 3U3DA 1G5TA 2ILVA 1KEEB 1WMFA 4ZDKA 3V1KA 5KYWA 3IKVA 1FFWA 3HZHA 3M8AA 3NGXA 1O57A 1VJDA 4RGYA 1X59A 3SQMA 3LFTA 4XM2A 4F04A 2YINC 2C2GA 2I6DA 1DC7A 1MNAA 4PR0A 3O9ZA 2AK2A 4R6WA 1EGHA 1U7OA 2D0PB 2F3TA 2B82A 4WFJA 4ZGBA 2BH9A 2NXWA 5HIAA 1HDJA 1AMOA 4YRQA 3FPSA 1PDVA 3K1AA 1FP2A 2I66A 4GW3A 1NW7A 2V7QA 5IG2A 1OCOB 2ETXA 1E1NA 1KIFA 2FMIA 3PSAA 4Y9SA 2YTZA 4WW0A 5K0BA 5EUCA 1W0KD 5DNCA 1YIOA 4AD8A 1DTWA 5AFSA 1SIOA 2XJ4A 3L4BA 3IPLA 3CMEF 4YIKA 3NWJA 1W4AA 1ZICA 2C57A 3IURA 4PNEA 3H1EA 3CD6F 3FWPA 2WYIA 5DN6A 4MR8B 1JEQB 5ECDA 1VHWA 2W2TA 3TTYA 4D3SA 1O4WA 3AKYA 3W3AH 1RR6A 4DO2A 4OI4A 1J49A 3T4EA 4YJ2A 1BCSA 1HK7A 4BNNA 3II6X 4P33A 2RAFA 5CBKA 4PNZA 1U2SA 3ENVA 1C9YA 1VI2A 3OJXA 3FHCB 3VTZA 2WJYA 4DLBA 4ZI2A 1RKXA 3FN4A 4JU9A 2CZQA 5K0NA 3ONNA 4N5LA 2R2AA 1WE2A 4RZXA 3WMWA 2PMDA 1XP8A 4MGIR 3ZEIA 2F1JA 4ZU1X 3V4ZA 3K9SA 1BSVA 3ICWA 5BQ3A 2E87A 2W6ID 2J5KA 3K6SB 1XLUA 4UAJA 1J5EO 1WB4A 3KFXA 3LHFA 5LN1A 4DR3B 4EHDA 1FJXA 1JVSA 4JBHA 2V59A 4QGBA 3KZMA 1A4IA 1IXKA 2ECKA 4GZRB 4L8LA 4RQBA 3T7AA 3URMA 3ZHCA 4R2XA 2JLYA 1KECA 2VGMA 4F92B 2CT8A 1CUXA 3QO8A 1G9XA 1ZUWA 3DDCA 3FWHA 2YL2A 3K5MA 4COOA 1XOIA 1RAGA 3ENNA 3BMOA 3CS3A 4B4KA 2HXGA 3WFVA 2EFGA 3FNIA 3O4RA 2VJKA 1AZWA 4JIMA 3L1IA 4A8TA 3WB9A 1VE6A 1AQUA 4RLHA 2HQSC 1RLOA 1U3LA 2MSLA 5JDIC 2HLDD 3G71F 3D3WB 2AOVA 3DMHA 1JKXA 1PLJA 3CMAV 2XUAA 4DCGA 4O4LB 2BI4A 3MMSA 3R65A 3QBEA 1J0EA 3UT6A 5U9CA 3U4IA 3TJZA 5LBUA 2ZE8A 5AHKA 4NCAA 1XDBA 2ZSEA 2NSJA 3S2YA 3ZDCA 3WK4A 5GMOA 1B3BA 1A3CA 1DG9A 1R0ZA 1EGAA 2FQYA 1XTQA 4BUZA 3ZS8C 1OHHG 1WU8A 3QZUA 5B1NA 2ODEA 1UIRA 1ETHA 1RHUA 4X8HA 5CHEA 1P6UA 2M6KA 4C43A 4Y2UA 2CTWA 3ZZMA 1EINA 5ELXA 2H1IA 2ZTVA 4QEKA 1UOEA 4TRJA 4IT5A 1DXQA 3AB7A 4R1LA 2C4WA 3NHAA 5DVZA 5EHNA 5AW4A 3UJ6A 4G0UA 2BEVA 2NZWA 2WA3A 4PXAA 2JAWA 1MSWD 2XHBA 1WCXA 2I3BA 3PGLA 4UVGA 5AM5A 4FLWA 3W6UA 3OE5A 1MAUA 2YFKA 3SIWA 2PWYA 5F2OA 1AILA 2ZYUX 4PHHA 5CW1A 5J4HA 1IHDA 3VGJA 3U61B 3D4LA 1SFRA 1MCZA 2XOKA 3VZQA 4M1OA 4CM9D 4DLVA 5B55A 4I4IA 5EUQB 1C80A 1L8LA 5C1DA 4OREX 5CG1A 5E1MA 3BERA 4RS4A 4X9XA 3IMGA 1PZMA 2TMGA 3K9FC 3WGKA 3NHRA 3SEFA 1A82A 1DL5A 2BMDA 2V6BA 3BIJA 1VKOA 4F4DA 1X7GA 3KQLA 3QUQA 1RAAA 4KO1S 1IDN1 3I76A 2IWHA 4CIDA 4DXHA 5IAOA 3B48A 3M2PA 3H5TA 4PX2A 2OV6A 2XUOA 3AERA 2F8SA 2OXEA 1F4VA 3EIUA 3VBCA 4A10A 1VSTA 2D5LA 4BNUA 4IY1A 3B9PA 1KETA 5LGNA 1E2LA 4FD3A 4Z9XA 2A7WA 4GVPA 4ISBA 4DV6O 2XVMA 5GV8A 3NTXA 4BVRA 1KEVA 2GEBA 2HHJA 4FOTA 3S3WA 1MO2A 2Q6TA 3CKLA 3R7WA 2EFEB 3L0OA 4X7PA 4XOIA 4BC0A 3GZ4A 1E63A 1REQB 1XNGA 1H38A 3QYFA 4P81A 2WSSD 4YP5A 4ZCRA 1IATA 3BZBA 1PZFA 4MW1A 1HZJA 1AM4D 2OHOA 3FCCA 3W7XA 1GADO 1G8MA 3WWPA 1EJBA 4MV7A 1Z2OX 2OORC 3ZTYA 5C3MA 1DQSA 1V3UA 3R0QA 1WVGA 2EHJA 1CZHA 1LZLA 3MINA 2EIMB 5H5NA 4P32A 4D4KA 5C35A 4CV1A 4BNXA 1XHZA 1FNJA 1PDWA 2MSNA 4FFVA 5D51S 4IVQA 2ODMA 2B9EA 4ALIA 4JVNA 2CFOA 5ALHA 1WV0A 3IDSA 4YRPA 1FPOA 2WLIB 2JVDA 1USVA 3DE7X 3S28A 1LW6E 3W06A 1X9HA 2NZVG 3H2BA 2FKXA 1EDBA 1MT0A 3EF0A 5A5VA 2QLNA 1CD5A 1XQVA 2ETNA 4A6PA 3ICQB 1E7RA 5CK5A 4ZT4A 1R3UA 3S0JA 4EF6A 1MPTA 3M9WA 3PJSK 4W5QA 3QPUA 1Y4ZA 4A6XA 4B71A 4PV1B 3VQWA 1A69A 2CLEB 1JR4A 1FVHA 1O8CA 3LY8A 1DAKA 2GO7A 1T3HA 4X90A 4B6EA 2AXTZ 1V6SA 4PGFA 4E5KA 2V0CA 3AM3A 1WNTA 1KXZA 1SD2A 2BP7B 1G38A 2C00A 4R6ZA 2ZP1A 3OESA 3P96A 3TLMA 5IEJA 3CC7F 4MV4A 4C8EA 3MLEA 1HUQA 1Y48E 3EWNA 2IQ5A 2CL7X 2VATA 1L4FA 3HXKA 4W5WA 4EO4A 3OZUA 4IIUA 4OFXA 5T4EA 3EQ8A 4BNZA 1B43A 1LDGA 1T4DA 1U4NA 2GVDC 1JKIA 1YU9A 3DSRA 1MJGA 2GGSA 3EMKA 3L07A 3MMZA 3R23A 2HDNB 2QX4A 1QIHA 5A0VA 1MA0A 1QHIA 2JFBA 3V1UA 5CK4A 3EG5A 1E79D 4GVLA 4KW7A 1CTQA 4EO9A 4YR9A 5C9ZA 2N42A 4X1IB 3BULA 2V03A 4G1BA 4PG7A 1OYYA 1SB9A 1NQOA 3PJEA 5IULC 3HCCA 2GF9A 3JW8A 4KIJA 4U02A 4DHEA 3ED5A 4G89A 521PA 3QTLA 4C7MA 1GGVA 3CD6V 3EXEA 1PQYA 2W43A 3NHBA 1UKEA 5EEGA 1ISSA 3C6ZA 3VAYA 3QLJA 3SXPA 3ZWPA 5HUJA 4A27A 3VYUB 2V7WA 5F1YA 1U2QA 3L02A 4N7BA 1WTCA 3HGMA 2E0IA 4RUFA 2QRJA 4U2GA 3M82A 4BTEA 4D74A 1Y6GA 1KPGA 4HUJA 3HHEA 2V9PA 1ULZA 1T6BY 2FVXA 4R9VA 3DFUA 2VZEA 2ODNA 4L8GA 1GAQA 1ACLA 1SKVA 3DDUA 1PNMA 4NNPA 4PIPA 4YI5A 3TBFA 2PUCA 5EIFA 2E7ZA 1T5BA 4EABA 1TUEA 4CV0A 4UFZA 1GV0A 3MF4A 5KQMA 4M8KA 4L73A 3R0ZA 4US1R 3SVLA 1KRHA 3H83A 1AK9A 3EPJA 2QZJA 1GCIA 4HX2A 2A9PA 3QU9A 3VU8A 1AUPA 4RFSA 4KV9A 1ZUIA 3DE6X 3HCPA 3GEHA 3LP6A 4QOGA 2O8NA 1SK9A 2HA7A 4JLSA 2ZSBA 5IK2A 3CXCU 3RFFA 3AUXA 2Q69A 1LWNA 3WKBA 3ZWKA 2J3EA 5F2VO 1M1ZA 3N0WA 1QXSA 5IYBO 4OMDA 4QTZA 3EC7A 5CRIA 4IIHA 3U0ZA 1GO1A 3PC6A 3EFBA 5KU7A 4FE4A 1ZMBA 2ETVA 3E9YA 3C3WA 4E88A 1J7HA 2I6FA 3V8PA 1Q3TA 1S2LA 3ILYA 3M5PA 3U1TA 1E5TA 4GXQA 2QU7A 5J5CA 1B15A 2PZMA 3OQPA 1T1JA 1VKRA 2CB0A 3J80N 1K73H 4BMOB 4N9QA 1QHGA 3ZU6A 3P9SA 4FFLA 5T3YA 2Y71A 3NETA 3VYTB 2GBGA 3HJTA 3MFYA 5ECWA 1YZUA 5L4NA 5LNK1 3E9EA 5L3EA 2ADPA 2JFNA 3W2FA 3AP3A 5JJCA 4PI0A 1NVEA 2VJBA 4BVSA 2Y93A 2IVZA 1TZ2A 1PN3A 2VIIA 5J2UA 2QI2A 1WDTA 1ZPDA 1EIWA 1SQ6A 2GUGA 3K4HA 1YB7A 3WSTA 4C88A 1CQZA 3GFVA 5ECGC 2GBLA 3TSZA 2Q4PA 1X1QA 7AT1A 4FFBB 3CVVA 2XVAA 2X86A 3H75A 4U2EA 1Q81H 4V2UA 4EJSA 4RIGA 4MUKA 2OZKA 1CWUA 3FI0A 1SJ9A 4ND3A 1PGNA 3IRVA 4QWMA 2AA3A 3UAZA 1AN0A 2NPIA 3DR5A 3IVGA 3K20A 3QE0A 4Y1RB 5JMOA 2YSUB 1U2GA 1Z16A 1ZM4A 4OYRA 3BBPA 1K5SA 3I1FA 3NHUA 3TBHA 4HQKA 3D9QX 3EULA 3M6LA 2JIZD 4HXFB 3ZJ4A 3MK31 3NYWA 1JG3A 1UDRA 3BMCA 3I9V1 4MWTA 2B0CA 3BFKA 1E6UA 1LBHA 4YRMA 3EG9A 4MAFA 2QTSA 2HDWA 4C3VA 3WGJA 4J7KA 1UMBB 1WPXA 2AJBA 4EG6A 1NQ5A 1BMQA 5LJLA 3BG5A 2VHCA 1BHQ1 1LS6A 2CNLA 4CM3A 3CNOA 3W4IA 4YMVA 5TVGA 1QX4A 3KT8A 1M90W 2DT5A 3PNVA 3C3AA 5FV4A 1MOSA 2HSWA 3ROEA 1PWHA 2CHQA 5SV2A 3W5DA 3IJ4A 5KQPA 3C3YA 1J06A 5ICCA 5L3VA 3R20A 2VK2A 1P7GA 1KNKA 1YASA 2JLCA 5LQDA 1IHXA 1KP9A 3M3DA 2WWVD 1WV1A 2A9FA 1L4LA 4JZKA 4FBMA 4ZQHA 4Z0NA 1U97A 1A9RA 1CCWA 1YHYA 2IZ1A 1UJMA 3R0XA 3N8GA 3EOAI 2Z0AA 4GBGA 2O3QA 1CUVA 1X7XB 2QL6A 4FMPA 2O57A 1AF7A 1GPNA 2HA6A 1NSTA 3G68A 4HGQA 3LDAA 3RI3A 2RSLA 3LWVC 1JA1A 3P2YA 4KKVA 2DWOA 2JFUA 1FYWA 3FTQA 3CNHA 4ML3A 2J48A 2P6UA 4US0R 5CDSA 1J1UA 2ODBA 2BFEA 4OJTA 3RVRA 4C0WA 4P2ZA 4ENQA 3Q3VA 1MRNA 1WSWA 3KTOA 4IWYA 4KXYA 2BFCA 1BMFA 1IOLA 3I34X 3MOGA 3RIMA 1WEHA 1YGPA 2BVNA 3FD5A 3HA2A 3R41A 4IHQA 3RRBA 4DGQA 4FB4A 4I1IA 4KSBA 1G1XB 5LWQA 1DVRA 2D1FA 3IFXA 4CM8A 1WULS 4C0SA 1PUIA 2JI8A 4X0EA 1XALA 2EU8A 1QANA 5B3SC 1PL4A 2DYYA 2WJGA 3IYLW 4JAAA 2FEAA 3KCXA 2YQZA 3EG9B 5JVDB 2VTVA 3FYDA 3VX4A 4N40A 1FRQA 1LRKA 4W4KA 1DIOB 1AXGA 2IE8A 3E1SA 1X86B 2HMWA 3ON5A 1JQ0A 2HTEA 3V33A 1SS3A 3LW7A 5B3SB 1DAFA 3T7JA 1JB1A 4O8ZA 1HRDA 1V3VA 2DY1A 3DSQA 3VTIC 2ZYTX 1VPLA 4KP7A 1RPZA 1O9HA 3PR2B 1ZLZA 5CMLA 1X92A 3WJ2A 3I04M 1YB1A 2AEMA 3W2TA 1QIGA 2WMNB 1QQBA 2G71A 5K0GA 3AG3C 2OV4A 3OOJA 5JCOA 2J3JA 4RJ2A 2IYWA 3FUVA 4PZ0A 3ENWA 3PPIA 5A62A 4FM2A 1W59A 1DOHA 1D3AA 1CR1A 2CF5A 2VWJA 2JD2A 4HH4A 3COVA 2BC9A 1U9IC 1T25A 1GLGA 4MP3A 4D99A 1H6BA 1C1HA 3CCQV 2SKDA 3CR7A 3QKUA 4EI8A 1PKEA 4L27A 2QRUA 5B64A 3L6EA 1TCAA 3EDQA 4YDHB 3ZCUA 1JLLB 5JJ5A 1XMOB 2J7KA 4KV7A 3FUTA 3NV9A 2XQVA 4UFNA 1L5NA 3JD1A 3O2JA 1R4ZA 3C3TA 3KSDO 4JU8A 4RH0A 1TMYA 5DHTA 5E1DA 1OGYA 3AI3A 1Q1ZA 1KMMA 1TW3A 4KUMA 3F0EA 1KI1A 2FKNA 4BP9A 3FSEA 2HU8A 2KMLA 4F2PA 1DUIA 2YYZA 2QX7A 3GLKA 4DNXA 2O8VA 4JNCA 1A9PA 2WE7A 3BFJA 2PRYA 3IQIX 4NY1A 2C2KA 5K2MA 3BJRA 1YBVA 4IQ4A 1K3EA 1E3QA 5CX1A 2RQ6A 4B5KA 2BFBB 4U9HS 1EFTA 3ZEDA 3R3ZA 3RN4A 2KG4A 1RNLA 1CS0A 3LF1A 4NEGA 4Y0NA 3U31A 4A7PA 1V0JA 1SXQA 2YMQA 1YA4A 4TLCA 3V1YA 4GDFA 1OPXA 2O14A 4N6OA 3L46A 3QRWA 4U2BA 3IHWA 5LQMA 1ZD2P 4XQCA 3GH1A 1QO0A 4DEYA 5ENZA 5CLHA 5KJEA 4GNKA 1XLTA 3BJMA 4B5LA 3D02A 1CQWA 2KWIA 2YJTD 4JNKA 4DMLA 4JYAB 1WXHA 1XJ0A 3L77A 1U1FA 5E7MA 3TZEA 3AEIA 1WD5A 2ORED 3EQ9A 4WIAA 4B75A 1AZLA 3TQFA 1F8FA 4P3YA 3LSUA 4R01A 4B87A 3VUFA 4FYKA 4BFZA 5EC2C 1W48A 3O03A 4A8JB 4FMDB 2EILB 4DXWA 1SCQA 1Y3FE 4WFAV 3I1JA 3H2GA 3UWKA 1H8EA 1UMKA 1KYXA 2WJVA 4L0DA 5AQEA 4PHGA 3T3HA 3L01A 3OE4A 4FXOA 2BFDB 3EARA 3ZDYB 5D5QA 3MB8A 3UQZA 3ZJYA 3IDAA 3T9DA 5EJ2A 3EVKA 1I33A 1NBEA 1V8DA 2YYAA 1RWKA 2QSYA 3PJFA 4MW6A 1WU7A 2ZJZA 1ID1A 4HUQB 4R7TA 5GWXA 3OM1A 2GILA 4MDEA 1ZD5A 5CX1B 4ZKEA 4B6SA 4H1VA 5KSYA 4EKNB 4MUXA 3HFRA 4KIGA 3AZOA 1TZMA 4FLVA 1D9ZA 2QRLA 2NUBA 7ABPA 4J42A 7REQB 3R5SA 2ZR8A 2Q8VA 2PPVA 4H1UA 5HF5A 3LLMA 4YT2A 1Z13A 4PRZA 3UK2A 4LHSA 1LV7A 4FHCA 3KL4A 2HK6A 3ZCTA 1UPCA 4WJLA 2ID8A 3ZGOA 3CP1A 4EK9A 1KK2A 2PR2A 3QITA 5KWJA 2VDUE 2H5EA 1WKVA 1I4OA 3BZWA 3KVVA 4PLPA 5CT9A 1UOOA 4M1TA 2IYOA 2YX1A 1ZJWA 3KKEA 3LIPA 5EIAA 4R8RA 3W8RA 1AH2A 2NLJC 2GN8A 3UWMA 4CIXA 1UUFA 5A7FA 4IJQA 3JCMM 3UUWA 3GC6A 9LDTA 3SBDA 1ZINA 3ASZA 1RFLA 4MYCA 4MQEB 2XB9A 3KLOA 4BT4A 4PG8A 4PA7A 3V4LA 4LOJA 3CW2A 4KZPA 1B0AA 1ZSPA 4IF4A 2XNJA 1PO7A 2XNDA 4LWPA 1U3GA 4UQOA 2EYUA 5LZ5A 5KYTA 2B1RA 2Q7HA 3RVYA 1EA5A 1YDMA 1X1BA 5C8VA 2E5WA 3MDOA 1RJEA 2VYVA 1GPYA 2XT9A 4HYOA 4UTRA 4PG6A 2YC0A 3OF2A 4JN6B 4UDOA 4HFRA 4MWGA 4B3BA 4LMBA 1GPMA 3E9MA 3R4VA 1JG7A 3RIXA 5BURA 4MIKA 2JLXA 2GVZC 4HLUC 4PA4A 1TIBA 1Y42X 3GZJA 1NR7A 2Q1TA 3CT6A 3SN6A 2ALJA 3KAPA 4D7SA 1KFKB 3ES9A 5B7GA 2AYXA 1B14A 2V3VA 5CAEB 3ZD6A 3EFOB 1UAYA 1VL0A 5E4JA 1R00A 1Z8FA 2PGGA 2JCVA 1IG0A 2IYFA 3G0CA 2Q3BA 3DHYA 4HDRB 1KE2A 5JD4A 2NT4A 3C5CA 4XVCA 1T2FA 2DPGA 1Z0SA 3M1YA 4RADA 4RZUA 5H9CA 5ALSA 2J9ZB 2I78A 5AK6A 4CV2A 4DUGA 4YQFA 4MUEA 4PC3A 2P3QA 4Z1MG 2PHZA 4J8PA 1YUMA 5CIWA 1PNQA 1OX4B 2WG1A 2QEQA 2YHIA 3ELYA 1DBFA 2DGDA 3GDOA 3TRHA 2JJ2D 1Z6TA 4V02A 3RODA 1OHHA 5EPOA 5BNIA 2BJWA 3ACBA 5HUHA 1HR0B 1I2CA 1T3SA 2HNKA 3L8EA 2OYSA 3EEBA 3ZWXA 1TZJA 1WUKS 3ABMC 5LMZA 4TL7A 1R6TA 1SBCA 1O9GA 4JZYA 4L4SA 4DPKA 3MRVA 2WALA 3H18A 3G85A 3QKRA 2R1TB 4B43A 1WX1A 4Z0PA 1JJ2F 1BEUB 5I7UA 4U3FH 4IJVA 3NKFA 4BY9E 4ZIRA 2FN4A 1EK6A 2NU8B 2RKOA 3L49A 1H8HG 5AJXA 2I4OA 2Q2QA 4C29A 3DT8A 1NG9A 3AU9A 2VK4A 3GWGA 2EINC 2B4TO 1FF9A 1O94C 2JIOA 1SU6A 1TGYA 3K0DA 1OCCB 1I94B 5P8WA 1H9CA 3RC2A 1ATIA 1BA3A 4NYJQ 3UPUA 1SY7A 3AVQA 4Y1GA 4D9FA 3L9WA 1E92A 1XMXA 2XMDA 2H1SA 5AKHA 3SJQC 4C4WC 1Z4MA 2HJWA 2XDWA 1N2ZA 3CYQA 1LVGA 2CNDA 2H94A 3K04A 1XZEA 3HMKA 4JK3A 1NJIW 1DBRA 1VQ5V 2HNAA 3KAJA 2Y1CA 4ZAZA 1H6AA 4ESVA 4MCJA 2UKDA 4OQNA 4QJ5A 4ZO4A 1XN4A 5NLLA 3TBKA 5TT1A 1ROPA 3OZEA 3CEMA 2WU4A 2XUDA 2CNWD 3IJPA 4ZODA 2IQIA 3PTAA 2AXEA 3DYVA 5K3SA 3EVDA 2IV2X 1PV2A 1W1WA 3LDEA 2AN4A 2G25A 2NO7A 4G81A 1I6LA 3E8HA 4KC0A 4J49A 4Q4CA 2LCQA 3HB4X 1RQXA 3CB2A 1YH3A 2F8TA 1A2KC 4TWIA 3OFNG 3JRXA 2QDOA 1RADA 2Y9PB 3N3BC 2OY0A 1NVMB 3IVXA 4IMPA 4N47A 3TQOA 2WF7A 1QQ5A 1ZWIC 4W9NC 3AW9A 3I0MA 3PCXA 1EVKA 5I7WA 1FP7A 1OFHA 1T1IA 3RBZA 3GJRA 1KOGA 1KTVA 5GIPC 2XQGA 3CLUC 1QRDA 3S99A 3L0ZA 1Z7YA 3AG6A 1R1DA 2Q6AA 4RQTA 5DCYA 2LP4Y 4UARA 4CEHA 5A5DA 4UUJC 1NJ5A 1RTKA 2PSHA 1M57B 2BR3A 4L4YA 4NATA 3L8CA 1FYJA 2Q4BA 1ZEJA 4OX9B 4DRZA 1UH5A 4WESA 3SMQA 1KKLA 2AN9A 5JBQA 2KBFA 3LO8A 3X1ZA 1LLQA 1YS6A 3HB5X 5GINE 3K58A 2JATA 3QBTA 5ECYA 2HEPA 2XQIA 1BMDA 1E9SA 2OFOA 2VHUA 1L4MA 4HQNA 5LQRA 5BRJA 2PSJA 2H8PC 2PL9A 3FNEA 3JZAA 3JPYA 4X66B 3DZIA 4XSHA 3H5OA 3OPYI 2RI6A 2E49A 1IDOA 3VTAA 3ESQA 2IYQA 2DKNA 3BXZA 4URXR 3AR3A 2J4FA 2X4LA 4ZICA 1NYLA 2FPKA 3K73O 1Q82H 1SNYA 1XEWX 3HFGA 4C2TA 2Y48A 3VI6A 5AOBA 4BCDA 1VIAA 3FB6C 3M3HA 2G3YA 4C14A 2PAFA 4PYOA 1PV1A 1Y6FA 3ZGLA 1O3YA 2RHMA 1Q90D 4RHYA 1PT6A 3CNQS 1NVKA 2AV6A 4MVJI 1QPBA 1CLIA 4UVEA 4FIPC 5BMVB 1CLEA 2DVMA 1GM9A 1G2QA 4A0RA 1BL8A 4C4RA 3CO0S 4ZDWA 1BH2A 1E0KA 1CYEA 9ATCA 1XNRB 1BQEA 4TTRA 2FH5B 2OT5A 1T3TA 3UZUA 2O8CB 2NNWB 3H2JA 1AKVA 1QP7A 5B7NA 2D7DA 1FFXA 2FW7A 2WUGA 3OX4A 3NWPA 1EM6A 4TKZA 2C78A 2H5JA 5K8CA 3MAGA 3CC7V 1VLQA 3PRJA 1R4NB 3OZWA 5AOAA 1WJGA 1VI5A 4OO3A 4C89A 2DYRB 1TO6A 1UDXA 5LHGA 3LQ2A 3R5JA 3GPDG 4IIGA 4WLOA 3RU3A 3TCKA 1U8AA 1IN8A 2Z2IA 1Y6QA 5KNCH 4GKKO 1PGOA 3L6DA 2Y77A 1SD1A 1U2DC 3KXIA 1JSCA 3P9NA 4R2WA 3H86A 4RORA 2NTNA 3OT1B 1L4GA 4M1SA 1ZBQA 2P30A 5EVCA 4B9EA 5FL7A 1UODA 3KB1A 3TTTA 1GWNA 4BN4A 4EKDA 3N6VA 4TLBA 3STHA 1UXHA 3E8GA 2PO5A 3CC8A 4L50A 3U17A 2BSKB 4BP1A 3HRKA 2ZUEA 2E1PA 3P94A 3L82B 1UAAA 4OHVA 4HPWA 1ZKDA 1F2TA 4I4TB 3JAKB 4NHOA 4D5GA 2H63A 2PRIA 2CC2A 5HILA 2JFQA 2JFXA 3T1CA 1FYEA 3QHDA 4YECA 4EI2A 1CEEA 3V5NA 3WKDA 1T10A 4NQ3A 3BWEA 2PGOA 3RKSA 3OP1A 3JQAD 3RHTA 3OECA 5JECA 2QNRA 2BLNA 3IBCA 4MUFA 4XIJA 4UVBA 1PL0A 1W0KA 5DGXA 3UJ3X 1E7WA 1V39A 3NQ41 1EFKA 1K8QA 3GP5A 1D6SA 2FKAA 3OUZA 3Q12A 4IO0A 3UHFA 4JYAO 1B26A 3NHWA 1XNRO 3FLAA 2DG2A 4ENPA 1ZM2A 2DPHA 5U4QA 3BSWA 2D54A 3JPWA 4UBJA 3TW4A 3U80A 2AFIE 2ZJ2A 4CG2A 2HHHB 1KYOF 1S8OA 2DHQA 2I4NA 2XUFA 3IQEA 3Q3HA 4B3CA 1KI9A 1YQUA 3I2FA 4ENWA 1PR4A 2X0IA 3JQDA 3HEAA 3LZ6A 4G5SA 1EBBA 4MHOA 1KR2A 4OLFA 1W8IA 4BQSA 3R9XB 2OG1A 2A3QA 1FXVA 1NNLA 2FLWA 2L19A 3LWBA 4ERHA 4EECA 1L5FA 3TTVA 5CNJA 5DM0A 1SA0B 5C80A 4KODA 2XAAA 1E5XA 2D2CB 5TV2A 3FFWA 2IH2A 3OLCX 1H2KA 1UJWB 1I10A 1QB7A 1NWCA 2Z5VA 4BWYA 2DH5A 1QYIA 4BDSA 2N1BA 3G67A 4M88A 4QARA 3IR9A 1USIA 4RZHA 3AJ8A 1JH9A 2WSSG 3RADC 621PA 4DV3O 1XQXA 2B4AA 2WQZA 2OAEA 2ID9A 1Z0UA 1ZGAA 3QELA 4GM0A 1RAFA 3AUAA 1X4TA 1RHJA 1UFKA 3QX9A 4U9UA 3S1AB 2PU7A 3LC0A 4FFBA 3Q9SA 4UHEA 3K79A 3SYQA 1I7FA 1GO2A 2D4HA 2CHTA 1KI7A 5BORA 4EDFA 5DN9A 4O5OA 2FG6C 2XQJA 3VR5D 1HOXA 2D3WA 3CUTA 4M8SA 3VNAA 2XDYA 4C08A 2P5YA 4MV1A 5DYIA 2L6LA 4WECA 1MOPA 1S3IA 3DOFA 2VG8A 2R7LA 3OT5A 1Q1QA 3V4VB 1B0PA 4PC7A 4ZCPA 2RGGA 4Z7OB 5I3CA 1L7QA 5CA0A 1P4GA 3MS2A 4O8CA 2OGUA 5ALJA 4ERXA 1XXHB 1WN7A 3CRAA 4KL1A 1G42A 1LA2A 3PUJA 3VHLB 1M5TA 3QE4A 4WUTA 3WLOA 3CCEF 1AROP 2ZRMA 3A6ZA 2UXXA 4GPD1 4D9HA 4J0DA 3E2EA 2CUZA 5FBHA 2ECOA 2NG1A 3MTDA 2VBFA 2C4UA 4J1TA 2HRYA 4P80A 4DQKA 4HNUA 3NNDA 5F23A 4QE7A 5ALWA 1YBHA 4Q15A 3GJ4A 4MAAA 5JAZA 5KPDA 5KYXA 1B2RA 2SKEA 3UF0A 3BQ9A 1PNRA 4IDNA 1LTQA 4JP2A 4FE7A 1DRUA 1NZJA 2P0EA 3TMYA 4EF5A 4PDLA 4XGKA 2PX0A 4MINA 4JI8O 4GWKA 2CUTA 4QDZA 3ZS8A 2ASEA 2R5FA 2E9SA 3ZCVA 4G9GA 3AVUA 4BLRA 1IK4A 2DQ4A 2PDAA 2ZIUB 3EVZA 3G0OA 4YJDA 4PZEA 3C9SA 3UT5B 5A05A 3NT2A 4D4GA 4Z5XA 3HPRA 2WLLB 2BGNA 4UNQA 4IHAA 4LR3A 2O1WA 1T5DX 1VQMV 2CLSA 2IHKA 3HM2A 4XXHA 4CG0A 4MQ6A 5C5EA 5KTTA 4IL6Z 2CHUA 2IEGA 3E9NA 5TQ2A 3L0CA 2XA1A 3AY7A 2PL5A 4HR7A 4GMKA 3P9PA 3TMAA 2G4CA 2X9QA 3QVVA 5D6NA 3I5AA 5EFZA 3BXFA 4MVQA 1CRQA 1KJJA 1KI8A 1UBFA 2XZTA 3OEED 1QS0A 1TJNA 1TK9A 2AEJA 2N74A 2JHGA 2QPOA 4W8GA 2HK9A 3JWPA 4JP3A 1T0HB 3SK0A 4URVR 4KI7A 2AEFA 2OO7A 3ADOA 3IEVA 3UCXA 2EJWA 1Y74A 3DB1A 3K0AA 4CL3A 5ALOA 1NTZH 1Q86H 5K3OA 2VO1A 1MXHA 3ILHA 2ZKOA 5DYNA 4MKIA 3I2KA 1MDFA 1PG5A 1SRYA 5FWXA 3HS3A 3IUSA 5B1EA 1CHDA 2J0EA 5KTYA 2ZE6A 5HWEA 2B9ZA 1XIVA 2ZATA 4BV2A 4XWTA 4CR8A 1M2GA 1MEEA 1PE0A 3U60B 1ZGHA 1S0VA 1ZX1A 4UTNA 1JR3D 5L6MB 1VLMA 1NRIA 4HPXB 2OWOA 3M4NA 3NO4A 2RNBA 1HE3A 1VSBA 1VE5A 3BD8A 1PT9A 1TI7A 4FNGA 1U4OA 2FW9A 5JNUA 3AM1A 1IN6A 1G6KA 3EZ2A 2BO1A 2IS6A 5ES4B 1M2VB 2XUJA 4E2WA 1VJGA 4BFYA 5IAKA 4GI7A 4RHUA 1D4FA 1FFEA 3UMSA 2EZ9A 2P4HX 2XNCA 1IXMA 3C8HA 3RU2A 2EKZA 5B12A 2V8OA 3BH0A 3H3JA 2VF8A 3DV9A 3G9ZA 4ZI5A 1TAEA 1I7SB 2P9YA 1KF0A 1NW4A 2LBXA 3ZWCA 1QF6A 3UM7A 3AGQA 1DK1A 3KOUA 3BC1A 4PELA 2QI9C 1P33A 1T2NA 4FBGA 4EITA 4EIWA 3OC6A 1VE7A 5G02A 3RAPR 1CJTC 4P7BA 2JIBA 2GVNA 1CRPA 5EZQA 1QP4A 1DX6A 2D2EA 2JH8A 2X7XA 4NFSA 4TKVB 2GXQA 3RLIA 1AR5A 1YKSA 1LNZA 5DXAA 1VP9A 2OAGA 2O4UX 1YB4A 3TVYA 1E8DA 1JE0A 3INTA 1YS4A 3MHPA 1O6ZA 3LF2A 3PL1A 1X3LA 2ZUWA 4M8LA 3RYTC 5I4IA 2R6ZA 4QGFA 4FK5C 2IC5A 3E20B 3CJHB 1UXGA 4GRIA 3QVJA 2R44A 4DNQA 3D36C 2QROA 1OXTA 3NBMA 4OJMX 5COQA 5F2NA 2KE5A 5IP5A 5KNDH 3BMNB 4MIYA 1NQVA 1TM4E 4MPRA 4DV1O 1GDHA 1H1DA 1E2DA 3N3AC 3VQTA 4EKWA 1PJSA 1W41A 2IYTA 1GAEO 1RI3A 1EEHA 3DZ8A 2JCXA 2Y1LA 5EFOA 4AYTA 2OBFA 1YZNA 4Q24A 2AD1A 5C7IO 2QLMA 3GLTA 4HNAB 3MRTA 3WDMA 4MRSA 1FU4A 3PFCA 1SM4A 5HKKA 3TW6A 3PUIA 3O31A 1VQ9V 2HSGA 5DV9A 4YQYA 3T5MA 3T99A 4BO9A 2IH1C 2BT4A 2DFDA 4L08A 1DJQA 1OIWA 4HX9A 5KNDD 3Q6NA 2Z1TA 4LYHA 4UEWA 1F23A 4BWFB 2G76A 2Y4TA 4MLZA 1FFYA 1Z2DA 4FFNA 3DT9A 4D44A 5L53A 2DUJA 1DZ3A 4H1TA 3UH1A 3DAYA 1AHHA 3E9QA 3HUFA 3DL4A 2WQ7A 4N3AA 1BHJA 3IE0A 4LJAA 3DOHA 4P38A 3HBMA 1J8DA 2HADA 1P5JA 3DVAB 1ISGA 3MT8A 3ZCCA 5LKRA 2FP4B 4OQDA 1GCGA 1KMHA 4RIIA 4DQXA 2ZPTX 5CB8A 1DFGA 3LTNC 2MMCA 4RL4A 1GY8A 2H11A 2IT1A 2M6YA 1ZD3A 3ZNOA 2J6HA 3EIFA 2G1UA 2GD0A 2H2HA 2VA9A 4IJWA 2PZFA 4TMYA 2P9JA 3RSFA 3V2UA 4ZI7F 2Z04A 3UYLA 4C7BA 1K5PA 2EFHB 3EYWA 3HJFA 1WOMA 3R3JA 3PLRA 1DLIA 4XD7A 4D02A 1VL5A 2G07A 4KXVA 3DV0B 4EGJA 1EBUA 4FMDF 3RF7A 1MJGM 1Q12A 1NW6A 1J2TA 2YXLA 4K35A 1UBKS 3KJIA 4MWCA 2J09A 4OCZA 3UO8B 4AO7A 5A5GA 1ADGA 2H31A 1KY4A 2G38A 4GX1A 5BUCA 4BVGA 4R2LA 1IV3A 1GARA 2VS1A 2X13A 4MCIA 3DVLA 5IEBA 4FXPA 4DDKA 1IY1A 4PANA 3ITKA 1KVTA 3FPFA 1R0YA 1Y1QA 4JFRA 4Q9JA 5FBRB 4D9GA 4R0NA 3CNNA 2PD4A 5C31A 1UJ4A 3L7OA 1CY4A 4INZA 1Q15A 1BU8A 1YULA 2AQHA 2F48A 1RYBA 4OJKA 1AI6A 2REQA 2IU6A 2WICA 2ZROA 4RFVA 1S02A 1VKJA 4TQAA 3V46A 4CIBA 1G19A 1M6YA 1IWPB 1TT5A 2AOUA 3GD7A 1R6NA 5CNKA 1N9GB 2QXTA 5GP1A 2XCUA 2PX5A 4YAOA 4WN9B 1DAPA 1YCFA 2OHJA 1T24A 4K5QA 3QVWA 4ZRDA 4XYBA 5BW6B 3EGIA 1UFIA 3JQBA 1TUEB 1IZ7A 4RWUA 3BRSA 3DR3A 5ALGA 1WUYA 2BF7A 1Y9AA 2ZAOA 4UUPA 4AZVA 2J3LA 2XUKA 3ABSB 3KFVA 4YLEA 5DTRA 4ZO6A 1VXOA 5BR8O 3AY3A 4QFCA 2LBTA 2YC2C 3HLKA 4MPPA 4E6PA 3ZRSA 5IYCO 3U4GA 5E7IA 4F56A 1XQ6A 4C7KA 2LW1A 2ES4A 2QD3A 2JIRA 3JQ9C 3FPGA 4BMPB 4J10A 1NFFA 1QK4A 3F6EX 3IAHA 4K6GA 4P4UA 5HK9A 3FR8A 4QJIA 4EY7A 2B5WA 2R9AA 3KQMA 1M2NA 2OCIA 2ZDIA 3CMCO 1G41A 1X87A 2JRIA 3H04A 1LKZA 4X3MA 2AFHE 1Q1EA 1AU9A 3GN2A 4WOCA 5JNVA 2EZ4A 1AR1B 5JSZB 2B3DA 3LCJA 2ODPA 3U16A 4YIPA 2K4MA 3A2NA 3OCUA 4KAAA 3D6VA 2V7BA 3TG8A 4MW2A 1IBMO 1R10A 3BD6A 3OKFA 3PQ3A 1A32A 3OJLA 1EUDA 1K66A 3QKTA 3RBXA 5LA6B 1VIDA 2ZB4A 1GFZA 4XQ9A 3VR4H 1WZNA 5B3JA 3L1UA 2C2BA 4FZVA 3RQIA 3EVBA 3HP7A 4QBGB 1AXRA 5HR5A 1ABEA 3E82A 3CF4G 3EJ6A 5JSHA 3QE2A 4HHEA 1DX4A 3R24A 4UU8A 1Z17A 4PO8A 4F4FA 5HJ7A 1K4YA 2NXEA 4X66O 1N57A 4RCZA 4BO2A 1SVIA 4AG5A 1RWBA 2OZPA 2PTHA 1W7AA 2GERA 2YWEA 2IHBA 4P1ZA 1BQ4A 5KYUA 3B7GA 1I08A 3QVUA 3BAFA 5B1DA 1XRRA 2FWAA 2CJPA 8ATCA 1I2AA 2RJ3A 3WLEA 3FD9A 3CW9A 2FR0A 3WNDA 4WFFA 5AHXA 3WNVA 4KN8A 5FO0A 2QZ9A 2Y0EA 2O2HA 4UJ5A 4TKMA 5COBA 1WPRA 2JNBA 5EC8A 1ZN2A 1SXJC 4F71A 1Q0TA 1GUBA 2MIIA 3H6KA 4AJJA 4N0DA 1J8FA 4RFLA 1KA9H 1XUQA 3DBHA 3E1GA 2WE8A 5JSYA 2IJKA 2ZD9A 1MJFA 1M2EA 1LC0A 4EL5A 1PD3A 4J9VA 2XH8A 3RSLA 2B1JA 2D13A 4BWGA 2GAAA 1LJLA 2ZBFA 2G67A 2WG0A 4I1OA 1XL6A 2C7BA 3NFRA 4AIIA 4DA4A 1K98A 4KE9A 2IPXA 4JT2A 3ETQA 4JB3A 5JIBA 5MGBA 1FDOA 4Y2PA 1Z15A 4L22A 4Z1MD 1CB7A 3M1AA 2I1LA 2Z5GA 4KVZA 4Q39A 2X8JB 5H59A 3B6MA 4MV3A 3WLRA 4BMNA 3K14A 3PXGA 2CV0A 3IAYA 1EWRA 4JIGA 3O8RA 4F21A 2HCRA 1I3CA 4BFCA 4L5IA 2Z2JA 2CXSA 2EAUA 3ABZA 3K32A 3TI7A 1XBIA 3D6HA 3EA4A 4P8RA 1E2QA 2OCDA 4HJXA 4PFQA 1GKYA 2C4TA 1FQJA 4B46A 2P9ZA 3GUHA 2XYRA 2HAEA 5FUYA 5EHZA 5K2OA 5K6AC 3WJ1A 1Q0PA 4EFNA 1UF9A 3NWBA 1U3WA 4I81A 1SESA 2WT9A 3QYPA 1VJ0A 2Z43A 4I4LA 4XWOA 4R69A 2V97A 1K5HA 3G7SA 1II8A 2Q3MA 5KKAA 1RJGA 4RS3A 1V1JA 3ZX5A 3JRWA 3VR5A 5FI0B 5BSFA 3JD2A 4DOMA 2V7XA 1PQUA 2YN4A 4J9YB 5JVDA 1LPSA 2I7VA 2XUHA 4RHTA 4IUCS 3DBHB 3GHHA 4CLEA 3AHEA 4DYVA 2VUIB 3FW1A 2YFYA 1OFIA 3PRKE 2YV5A 5JXIA 5CCBA 1XYVA 5LMNO 3PHIA 1IQRA 4BJ3A 5ICFA 5JYCA 1HI9A 4D0LB 2YWRA 4UU0A 3B89A 3OE7D 3K9CA 4ZU6X 1ZMRA 2BM1A 2GZ3A 3IQFA 2EQBA 4DT1A 4OH1A 1NY6A 2AUNA 3U7GA 1CB0A 5J63A 4CH5A 1HDRA 3KVYA 1US8A 1TQ4A 1XDGA 2HS3A 3KWJA 3QLEA 4MS1B 2J5QA 3ICOA 5M7EA 1NF9A 5BW8A 3G0BA 4OUDA 2OBYA 4AS1A 2XUZA 1SBZA 3FDFA 1GOTA 3I01A 3BSFA 1YR3A 1MNGA 2G28A 1R5BA 2NXJA 4MV0A 1L7BA 4LP8A 2QE6A 2GZDA 3X43A 4EFKA 1E5QA 1U0OC 2DHEA 3ZJ5A 5BSUA 1NLMA 4BNIA 5TMPA 4N65A 3TZCA 2FN8A 3VDXA 3PICA 2O2SA 5KYYB 4E1BA 3LUTB 1P49A 2V65A 3CYFA 4NONA 3ZD7A 2FMFA 1JI3A 2X8WA 3HR4A 2B8NA 1RA4A 3KQVA 4ZZ0A 1K68A 1L7OA 1TFUA 2DULA 4QPCA 3RS5A 3T7RA 4H3VA 2DPLA 2VAWA 1UWVA 5GTIZ 2PSDA 2A92A 3EA0A 4XX0A 3RC1A 3PEWA 1VPWA 1V25A 1Z82A 1U8YA 4IYIA 3N28A 4NZZA 1WQ1R 1A5SB 3CYOA 4WFHA 1U3TA 2O3TA 3G2LA 5KINB 1YFKA 4WCDA 4GKJB 3P9IA 5EERA 1H0HA 3LWPC 1T0KB 1X1AA 2XT6A 4TWZA 5GONF 3NOOA 3A2FA 2ECQA 3ISJA 2EFJA 3WFIA 1BWQA 4BQFA 2GF0A 1A8PA 4O4IA 4YJ3B 4HI0E 4NKRA 5AK5A 3A11A 2Q5QA 3D0RA 3ZGYA 1NTRA 1QHHA 1LY1A 4I66A 3WOVA 3Q3GE 4MS1A 4ZTBA 2H52A 1IEXA 2QKYA 4QNRA 5FOUA 3NEPX 3O2QB 4Z54A 2HYIC 3FJYA 13PKA 4NK4A 4ARVA 1O97D 2EKPA 3TAHA 2P9HA 3FCSB 3WHLA 5AXBA 5TEVA 3CLHA 4KR2A 2Z5FA 1VQKV 1QG0A 2XDQA 1N3LA 3DB2A 3IDQA 3CCLV 2ORWA 2OTJV 2BBOA 1OX5A 1QVZA 2IKQA 5GM1A 3COZA 1BIFA 1ZTEA 1PTJA 3FVTA 4MVJD 3V4PB 2H85A 4BQIA 1JF8A 5KWSA 1I3OA 1ZRNA 2H4JA 3NDBB 2B30A 4RY2A 4PPFA 4ZCMA 3CCRF 1G6HA 1GPLA 2BGMA 2WP8J 2YRFA 3BN3A 1SBIA 1Y7HA 3CIFA 3KWLA 4W82A 1BU5A 1R9MA 1C2YA 1SG0A 2D1SA 2OVFA 3IHLA 4R5MA 1VRWA 4WASA 3O9OA 1LCIA 3WIUA 1R0RE 2RFLA 2W0XA 4KVAA 1GQFA 2WK1A 4CKYA 3JQ6A 4MKZA 1U43A 1S5HC 2Q67A 3IT1A 4KFSA 4YB8A 1WQ4A 1HM5A 2HL6A 2FSIA 5JE8A 5TVKA 3R7AA 3U56A 1G59A 6REQB 3WTCA 2Q3EA 4ZCTA 2HGZA 4NR0A 3STLC 2PZJA 1K08A 3CR3C 4JX9A 2IPOA 4JITA 2ZB8A 3AG4B 1NURA 5L3SB 4FMBB 1XYGA 2ZNIA 4E33A 1LRJA 5L7TA 4IG9A 4K2AA 1W5AA 5L7YA 3CPWF 5FQNA 4RULA 1NLUA 1U2ZA 1WW3A 2LRHA 1K7YA 2MT9A 3LBYA 4RGVA 2BCGY 1TYZA 2REBA 2ZT5A 5FPYA 3ZW7A 4YUZA 4KJXA 3FMOB 2C7OA 2EEPA 5JFOA 4YMTA 2P8JA 2Q6LA 4PSAA 4YRBA 3GPCA 4ITUA 4B6GA 3HJNA 4I9QA 2PZGA 3R3SA 2W0MA 3OWHA 3R6DA 3IIJA 3CZRA 2LGQA 3AVYA 4X6YA 3GRRA 4INJA 3GDWA 1JX9A 2DQKA 3N5KA 4HVAA 4J03A 4QOFA 3Q8KA 2FSGA 4BVQA 2IX3A 4GP6A 1RZ3A 1VJ5A 1E9VA 3AR5A 3EXEB 3GLQA 4UPEA 3DDZX 1N36O 2XA2A 4Y2SA 1BSMA 3WVNA 2Q7XA 4XGQA 3QVMA 3HCOA 2F1IA 3RTDA 2WLTA 1QC5A 3OKAA 3GHZA 4XLLA 2PWAA 2AYYA 4LGYA 1LQTA 2H3EA 3EODA 1ZXXA 1YNOA 3LLSA 4OHPA 3C45A 3GCXA 4FLUA 1YB6A 3OEHD 4U4AA 1O8BA 3PLAC 3R75A 4ABYA 2GEFA 2IYPA 3AC0A 3T5GA 1TJ3A 2Q21A 4E2FA 2WUEA 1PR2A 2Q9AA 3TGPA 5DNWA 3L8HA 1NQ3A 4TT3A 4FBLA 3CTMA 4LBWA 4YWHA 2HHCA 3RDPA 1NA5A 2II6A 2QQFA 1S3FA 3JTEA 4W63A 3V9AA 3ZDFA 3MWDA 1XPOA 3EFOA 3PP8A 3MS4A 2PUFA 1N2SA 1DKLA 2H4FA 2HCBA 5FNVB 1RKQA 3N2KB 3NOVA 1MTOA 1Y8RA 2C99A 1YE3A 3U5ZB 2CLMB 4PYNA 4KRXA 3QTBA 1ZYUA 2FPIB 3O7WA 4MQ4A 4P58A 4LQDA 4F9EA 3EIQA 1NUHA 3TDKA 3NGLA 2EZOA 1KK0A 3OIYA 5ARCA 1PBTA 1NMQA 1AHIA 121PA 1U0EA 1V16A 1ZA2A 4P7JA 2ZUTA 5EB1B 5AOCA 5FOVA 2R65A 1G5HA 1HMYA 3A1UA 3KEGA 2RMKB 2JD1A 5K20A 1ESDA 1XVUA 3ITNA 3K4QA 2VKQA 4UD6A 4CU2A 1F8UA 2XTZA 3HEMA 2EJ7A 3E3NA 2G7ZA 4PQGA 4DQVA 3P4EA 3EXAA 4B47A 5ICMA 3QMVA 4CM5A 1FOEB 3W77A 3NIGB 3GMDA 4H37A 4JUBA 1COMA 2Q2OA 5J2TF 5BWNA 3MCAA 1CR4A 2GZAA 4JC0A 5TR9A 2HIGA 3AEUA 4ARIA 1UEJA 4MLDA 5HSGA 3S0YA 1QQ6A 2OMEA 1IY0A 1AS0A 4M0PA 3RHSA 4LDNA 3ZMZA 3MTBA 3DXRA 2VNKA 1RQLA 2F3RA 3P0RA 4AUEA 3KQHA 5CYPA 3DO6A 1DEAA 2F1HA 3HU5A 3EFFK 4QUEA 3G0HA 4IEIA 4TZ6A 7MHTA 1JEAA 1NMEA 2QUZA 2Y8EA 3AIKA 4Q1EA 1ZOSA 2QJRA 3RW9A 3E3OA 1QH9A 2H4WA 4EG5A 3M4JA 2R9RB 5DF1A 2PH3A 2H5IA 3AJEA 4PWTA 4P5PA 3ANXA 3VO1A 1OCOC 2PQ2A 4J7AA 4BV8A 3RTGA 3C1OA 4NPHA 3LNMB 4QE3A 3TECE 3UXYA 2XV1A 1DV1A 3CCSF 3ZZUA 4X20A 1NMXA 1EN5A 3L43A 2OBXA 2ATXA 2ZRIA 4CDNA 1M1YA 4BNLA 3HJWC 5HF8A 2P7HA 4CQLA 4QM6A 3D7NA 4IWXA 1VLLA 4NBTA 5CVTA 1T15A 1PJ8A 1BXRB 5JC1A 2PFSA 3C3DA 1H48A 3D36A 1J5PA 1GGKA 1P81A 2F59A 2GHIA 5GGYA 4XIGS 3TQTA 4D0NA 5FWNA 3GLSA 3JSAA 1W4BA 5AJYA 3HWRA 4Z99A 5H81A 3GLFB 2B8JA 4UM9D 1V43A 5K9ZA 2WTEA 1WXXA 3A9RA 4W1QA 1QGOA 2WJ4A 4RVNA 2FOLA 4QREA 1B3QA 2YICA 4DR7O 1SK8A 3AJRA 3H4MA 3ONVA 4FUTA 4H7HA 2FOXA 4LTMA 4G1UC 1IFXA 3IUQA 3VJRA 1OYWA 2NO6A 1NVPD 5KQRA 3D00A 5B30A 2DFNA 3F0DA 2R8BA 3NBXX 5KHIA 2VDRB 3WIBA 1N2XA 2OBBA 3NAGA 3KUCA 4R2MA 3L8DA 4G2TA 1E3DA 2QJTA 1OC2A 3OFVA 1WZIA 3J81N 4IOKA 4O4JF 4QU8A 1LFDB 2RGDA 3CEPB 2VP2A 3I5XA 2RIRA 4PGGA 2H2GA 2OEPA 3K5OA 3RTCA 5KTSA 1QH1B 2XWSA 3QXJA 2B61A 5JAQA 3TR6A 5TLSA 3WGHA 4EKGA 2QTTA 3THXA 1P4AA 4L51A 3P0ZA 2R6HA 1A88A 3GJ7A 4Q7MB 2HHLA 4LMRA 1U90A 3RU9A 3C3SA 3Q10A 4UBLA 1VQLF 1DKPA 2DSNA 3DKIA 4IINA 4Y9TA 5ESDA 3C3XA 2FHPA 2X1VA 2PL1A 3TIXB 4HVTA 4YCLA 3MJSA 3AI7A 3KAKA 3IP3A 3H6HA 4QSHA 1V8OA 4D8XA 3IKJA 4YP1A 3B38A 1V9SA 2D2XA 1J0XO 3LT0A 5I7EA 5JWOA 4B7UA 4OGGA 4L3OA 1G8YA 5EY5B 1V9PA 1Z0ZA 2DHRA 3Q4HA 4JTCB 1DAGA 1YT5A 4LF4O 4IIJA 3I9MA 3NI2A 5KDLA 1JLLA 5CG2A 4B6RA 3GEGA 5IN5A 1JYEA 2AOXA 3OEEG 4HGYA 1E6CA 4WOBA 1HXHA 1FX0A 4G36A 4BNDB 5J4YA 4JI5B 5AI8A 2Z8ZA 3ZDQA 2X0EA 2P77A 3VDRA 3HY3A 3WHIA 3T41A 3L4KA 3DDSA 4JL5A 3I01M 4FVMA 2BFAA 1QH0A 1QAOA 1GPJA 1IHYA 2UXBO 5MN6A 1A4RA 1KYWA 3K0FA 5LB2A 2J85A 4AROA 4LWSA 1L5VA 1DIAA 2YN2A 4RACA 4D3XA 1NP3A 4XWYA 2XSZD 1UBUS 2NGRA 4B32A 4YRKA 1JNXX 1XJQA 2X9GA 3L0IB 4I55B 3MJDA 1TVKA 2WA1A 3D4BA 1ZXBA 3MWDB 4PZCA 4CMIB 1QWSA 9ABPA 3FYUB 1E6KA 1I01A 2XCIA 3N8NA 4FGKA 3ZMTA 3ZDZB 4UNRA 1JA8A 1FXKA 3EXFA 3ZK9A 5J2TA 2UYNA 2CXOA 3LGSA 4URUR 3EIEA 3PSHA 4ANFA 1W30A 3WWYA 4CNBA 4W5HA 2FJUA 4F7WA 4YV1A 4JVLA 1NTMH 5HFNA 3VDQA 4AYXA 4EHBA 5LQNA 4Q3EA 1V9LA 4R8LA 2OGZA 4AG6A 4KMRA 4BTLA 2P4SA 2XAUA 4S0ZA 2WMDA 4ZV7A 3UPTA 2IAFA 3ND8A 1E3LA 1WETA 1P0CA 3SCZA 4DW8A 3MJ4A 4RHXA 1R8JA 3PE4A 1VQMF 4NMLA 3A0RA 1ZIOA 3I0ZA 1OYVA 1ZMXA 2ZRGA 5EXSA 1N3YA 2Z9BA 4L5YA 4C6TA 2XHZA 3O3OB 1NQUA 2X0FA 4L6IA 1ZU5A 3IP8A 4UUMA 4XWGA 3VC3A 1Q19A 2SBTA 1NN1A 1MMFB 3UFXA 3AYZB 2YOHA 5D86A 3VR4A 3H11A 4DHWA 5K0EA 1XVTA 2ZTUA 3F6MA 2QQ0A 3GCGA 1NT4A 3VKVA 5CB4A 2ZSDA 1QRTA 4ZJYA 3LAWA 2JCYA 4IILA 1VQPF 4RJLA 1KQ3A 2K87A 2QF7A 4X54A 4YASA 5LKAA 1FFSA 2CSLA 3QHPA 3BWCA 4R1OA 3F7MA 4TROA 5MN5A 1SCAA 3GYBA 4G4JA 5EKSA 1OWMA 2DU8A 3R8CA 5EKTA 4K9MA 3MRXA 1KIMA 4LF5O 5M34A 1IBLO 2YUIA 3I9JA 4TTJA 5TSDA 1PHRA 2JGAA 2LE0A 4R3NA 4C7OB 3TTWA 4FJCC 4MTXA 4JKOA 3D31A 2C9YA 1FD9A 2QRZA 1AGRA 3STZC 1EVLA 2N3ZA 3PGVA 4Y9RA 3FTPA 3U9SA 3WL5A 1QAMA 4BKOA 2WM3A 3T15A 4IDGA 2IGTA 1BCRA 1SAYA 1WLYA 2B4RO 2VYND 3RFUA 4AY6A 4LYJA 5HM8A 3LP8A 4RA9B 4NLLA 3ZI0A 4F2WA 1DOAA 3RYIB 5DHSA 1KDRA 5I6DA 4NC9A 5GIPE 1GM7A 1E89A 1QFSA 1C29B 3LFUA 2QRNA 4IRUB 4JI1B 2OTLF 2IUSA 3H8VA 5JJNB 4WBXC 3VU9A 4A0HA 4B09A 1NM5A 1FUUA 2J07A 3OWXA 3PIDA 4BVJA 1ZOOA 4GEGA 4YK7A 3W4JA 4ALLA 2B99A 2XUMA 1BFDA 3QVGB 3ZLBA 3HCNA 5JDCC 5J4VA 4V3BA 4NYMR 4D4MA 4Q4AA 3LSQA 1ND5A 1WHSB 1C1YA 4JODA 4KHZA 2BTUA 1XLVA 2Z9DA 2C7QA 3AWIA 4R1MA 3F0FA 5G2OA 2GM4A 4FW9A 3GG9A 1OI3A 3E53A 1W42A 4W8OA 4LDJA 5LL6P 1MB2A 4ZQCB 3JTMA 2X6TA 1JQLB 4GP7A 3LX4A 3EH1A 2M6LA 4EY3A 5IVPA 1KJYA 3TD6A 1ZH8A 3ZGVA 3VKWA 4EMTA 2VQSA 5F35A 2UYJA 3T35A 3DCIA 4AKTA 2O2XA 3HQ4O 2W48A 2COKA 2K7ZA 4YALA 4J2OA 4A2WA 4OLAA 1F8XA 2DLDA 4RHCA 5IKMA 1NMUB 1GNRA 3PT9A 1ZJZA 5TQ2B 1MH9A 3L7NA 4JGBA 1T9ZA 3INRA 4LC0A 4QXPA 3ROGA 3RVLA 2G4LA 1WXEA 2PCLA 3H5RA 3K3PA 4A5SA 4DIMA 4U3JA 2OP0A 1OCRC 1W34A 1F7YA 4F8EA 1L5HA 4ZMRA 2D1RA 1P74A 1X39A 2HPVA 2P0AA 1XV2A 1FP4A 3ESRA 1ZMTA 4UEKA 3RRXA 4D9NA 5IWCA 4XAQA 1P1BA 4QL3A 4MVCA 4RELA 5DCWA 3SPJA 5C1IA 8AT1A 4DCOA 4M7OA 3BFXA 2GXAA 4C4AA 2BWJA 4WNCA 2CVQA 2I76A 3ZCQA 5B4TA 2A5DA 2WF8A 3OP4A 4X24A 5HW0A 4C1BA 2ANBA 1NVBA 1QNMA 2H48A 2ZAYA 1L8XA 3I53A 3NH6A 3O0DA 5E4TA 5DBGA 2A9KA 1I2ZA 2G9QA 5DX0A 5BNFA 2DBYA 2VXYA 1CQPA 1BXKA 3A3NA 4X71A 4X84A 5GZ6A 4HAMA 3IO3A 3W5HA 4I2NA 5CT4A 4WCEV 2AKAB 3RYFB 1QS0B 4M9RA 4WKCA 3ZUPA 4BMVA 4OI0A 3GLIA 3TPCA 3ELWA 1T9GS 2QMYA 2OHXA 5GONB 2VXBA 4L6AA 2I7XA 5AW3A 1W36B 2QX8A 4GD3Q 3B2EA 4O02B 4F2GA 5DBHX 3GYGA 3T3GA 3FB1A 4BMXA 3CLRD 4NXNB 1M2FA 4FMCB 1US6A 3AOEC 2UV8A 2IBMA 5IX8A 2YC4C 3C6YA 3RVMA 3VIUA 5CJJA 2RCNA 1Y5NA 2QD4A 5LLSA 1AF4A 1DEKA 3E2IA 1KU0A 3LE8A 3TE6A 3D0KA 3V1MA 3U4AA 5ICGA 1XCJA 5CXUA 4JJZA 3SNKA 2EERA 4Z9AA 3A3OA 2NZ8A 4IMJB 4HZUA 1WW8A 1J1ZA 3E7DA 5M2QA 4OGLA 4DXAA 3A3YA 1PV0A 2PMWB 1FX1A 4LDRA 1R74A 2COEA 3X2SA 4PBSA 5B58C 3CSDA 4TTTS 2ZYWX 2CL0X 3AH8A 3RJTA 2J0QA 2JASA 3AEXA 5ADUS 2XZLA 1ZD8A 2LVBA 4RXMA 2CHEA 1AP5A 4I1UA 2CHSA 3EGEA 4J4TA 4EKIA 1TO2E 1VE9A 2VYFA 3GG2A 1H1LA 1KJIA 3MCTA 4RC9A 4F0JA 2WM2A 5JZBA 5LQKA 4KXRA 2VNHA 2PIDA 2YOGA 1P4RA 1YIJF 1P17A 1A4XA 4JDUA 4M9XA 1N33O 2YJGA 2ZJ7A 5CA0F 2B92A 5EJ9A 5I9BA 3IV7A 3WX0A 5FEUA 2UXBB 1B74A 4GMHA 2QJOA 3UMMA 1DX9A 4R31A 2Q5CA 4HGOA 5IT9M 1RC8A 5AVMA 4IHJA 3PGMA 1EE9A 1DHTA 5JAPA 3OBBA 2J6IA 1JQ5A 4PC6A 2VYCA 5FKJA 3FPAA 4UCFA 3CUSA 3OIFA 3U09A 4F6CA 1XREA 2QRPA 2UUBO 3BE6A 1YKGA 3SZGA 3BHJA 2J08A 2WDZA 2Y1EA 1NT2A 1U31A 1E9EA 2WJZB 1RM1C 1EVEA 4XB1A 5B58T 4BFXA 3KPJA 4RK7A 1SUBA 1DWPA 3BA8A 4Q12A 1CBUA 2D4AA 3E7FA 3WHKA 4EQ6A 4GT1A 4ALNA 1YV9A 4HLCA 5BQ5A 3WADA 4X6UA 1EUCA 1POWA 2C94A 2FE1A 5KHKA 3OQHA 1G8HA 4O2AF 4X3CA 5AQ1A 3FTFA 2UYGA 3GPBA 2VWGA 1UIMA 3L4EA 2LCIA 4YC7A 1TGVA 3AEZA 3MHTA 2R79A 3W5IA 1YFZA 4M4SA 4AWBA 4KPEC 2OCBA 2HWUA 3F3KA 3I1IA 3NB0A 5DBIA 2ZR7A 1EDOA 3DFIA 1Z4KA 3LKDA 2ON6A 2PUGA 1RKBA 4UD2A 2Q5FA 4K9RA 3ESZA 5FPTA 5K0JA 2GDJA 2Z83A 3WGLA 4IMIB 3KKPA 4FM9A 4JP8A 3S1LA 2JK0A 1QRUA 3F5WC 2PZSA 1U2TA 4KYVA 1KR5A 1ODKA 4CM8B 4YFYA 5HZKA 3HTXA 4WLEA 1BOFA 3L7LA 3THSA 3LD9A 4FYPA 3ZNNA 2CHVA 1Y6JA 1EFUA 3LDHA 5THQA 1GG9A 3K92A 1AVMA 4ZVPA 3M5CA 3VNUA 1WZEA 3KPVA 4RF3A 3CEIA 1YJ8A 1QIJA 3F7OA 1YO6A 5HF6A 3A32A 3DVAA 3VR0A 1PR0A 4WJZA 3AUUA 3W5AA 4NDNE 4ZPXA 2PH7A 4YGYA 1U2PA 4TSFG 2AMVA 2NSYA 3HKBB 3N5CA 5C1BA 4DV5O 3OQ6A 3P0FA 1CP9A 4O3MA 4BX3A 5IUKC 3WLQA 4UHCA 1QQCA 4B40A 1KO8A 3LT2A 3H1AA 5BY1A 4Q9HA 1X1TA 2GPJA 5EQTA 4JL8A 1KQNA 1NVDA 3M34A 2G08A 2Y6UA 4G1MB 2Y9MB 1SUDA 1N34O 2YVLA 1OW3B 3H1IH 1DEHA 4JENA 3SAJA 4BO0A 7REQA 3CCMV 3KTAA 3RSOA 3DF9A 1JPXA 1ESCA 3FOWA 4JBXA 3VZDA 1MA3A 3H5LA 2J3HA 4AZWA 1YHQF 1MJNA 3NCTA 4ZYZA 2DQSA 2OHWA 4CKZA 3ZLUA 4JYYA 4I50F 4C05A 4MX8A 4BQOA 1U63A 1G21B 1MC8A 4NE2A 4PN7A 4PONA 2GKSA 4QTUB 1FMJA 3MUEA 4HNQA 2ZIWB 4U2KA 5EIEA 2IW5A 3WBJA 4MVRA 3ILSA 4AT1A 3HABA 1AKEA 1WSBA 2VUHB 1KBQA 3CGGA 3DM5A 3JWHA 3B8HA 3KQWA 1GTSA 1AUXA 1MG1A 4W5NA 3TNLA 3DDNA 3IUEA 3V00A 2X4GA 1E1DA 4B3JA 4C21A 1XVIA 5F7OA 4CM6A 1TUGA 4JXKA 4LTDA 4WK0B 4ZAVA 5FXMA 1XTKA 5JLAA 4KGXA 5B7PA 4R8SA 5B1BB 4CMEC 1H3FA 4HAXA 3CPSA 4RVGA 3UXHA 2XBUA 3WS7A 4Z2YA 3TLAA 2UAGA 1N2GA 1BGYH 4C82A 2PGJA 4X3OA 3K2IA 3GFTA 4FE3A 2X1HA 2F3QA 4LXUA 3CXHF 2Q5HA 4OUDB 1NVAA 1O0CA 3OI7A 1FMCA 3RRMA 4Q9DA 3A1SA 4RTLA 1I6MA 2OFPA 2IXDA 1B00A 3O8OB 5JZMA 4CL0A 5BNWA 4DUGD 4KPUA 1FTYA 3BM5A 1UK7A 3MCAB 4YRNA 4NABA 4M0MA 3UMRA 2QWXA 3TPFA 4K6HA 4MUYA 4GF5A 3X1KA 3IAUA 2GESA 2K7FA 3OTWA 5A03A 4DCTA 2WWYA 4UHBA 2GOYA 1G21E 1RWMA 5FBZA 5BYJA 2NVUB 5FAKA 2IEZA 4NBLA 4CMCA 4CQMA 3DFZA 4ZZ2A 1JNYA 3ZR4B 1SQPH 4V0SA 4GLXA 1C0PA 4BRUA 1Z2GA 1UBHS 4HUQA 3AF2A 3G2NA 4EJMA 1W0JD 3N1UA 1ZCFA 1EIZA 3T5BA 3PR3A 3UW1A 3WYCA 2PXXA 1E6WA 4DLTA 1X7ZA 1K2VN 3CVXA 2FK7A 4LF8B 1GX1A 1GGNA 5LD2B 4DXDA 1IHPA 3A1TA 1HEIA 3K4PA 4KBGA 2HLHA 1KU9A 4MRNA 4UVHA 1H66A 5C8YF 3LG2A 5KJFA 2BEUA 2W6MA 2D2IA 3CW8X 3IIKA 4LNAA 5AUOB 4PNHA 4B84A 4XYLA 4I1YA 1BZKA 2H29A 3EW9A 1GHTA 3H1TA 3R0PA 4RWEA 1EWTA 1NXQA 4JI0O 2VDQB 1EM1A 1GCAA 3DDOA 2Z09A 3N8IA 3S70A 1QF7A 3N07A 3DMTA 2JHCA 4JI8B 4GZ5A 2GJSA 2NN3C 4BMYA 1E62A 4BW0B 4TV8F 1QHSA 3T06B 1GQ2A 2AFHB 1RIFA 2BCJQ 3I2HA 4LDPA 1M4UA 3S5UA 2GT1A 1GP2A 1SUWA 4WK4B 5GTDA 2CLKB 1UPUA 3PHLA 5I8ZA 4DUZO 2RCVA 4XQGA 1SQFA 2V45A 4KX5A 3A37A 3LI2A 1K88A 1SZQA 5F51A 2O7QA 3CZQA 5A2GA 4B1FA 3B8MA 1LBEA 1RXYA 5EWLA 4Z7JA 3C90A 4CHGA 5BN4B 3E23A 2R9VA 1QZXA 2GPYA 4PW0A 1ULBA 1CJVC 2I7DA 2R72A 4GKJO 4V0LA 2PWZA 4Q01A 4KREA 3SHQA 2DUWA 1U8CB 2Z58A 1G8PA 2PX8A 2FPRA 2ZDGA 3CPHA 3D7MA 3UT5A 4JB2A 3HKDB 1Q20A 2FEMA 3P0JA 3HI4A 3IUNA 4QA9A 1A2QA 1B42A 2IOQA 3G5MA 3HZRA 1Q3HA 3RG8A 2ZS9A 1NMSA 2FPPA 3VNVA 4NECA 1DPFA 3B70A 3N58A 4AIRA 4U7PB 2DBVO 2C0QA 2VPZA 2WG2A 1ENZA 3CCFA 4WHMA 2VHYA 3L6UA 5KSPA 3TNJA 1TLLA 4AM8A 4AYWA 3G2HA 5IUJC 2QRHA 4OHUA 5T3UA 1AIPA 4MTLA 4Y7DA 2VKTA 4LI3X 2V7QD 2XWPA 5FP0A 1QG2A 3HEBA 1CQJA 4UE3S 1ZIDA 2IYRA 2MR6A 4Q37A 5A4KA 5KS2A 3FNBA 1YR2A 3FZEA 3RS2A 3VZRA 5KTPA 1OU4A 3ZVMA 1L7AA 1P7WA 1VH8A 2F8MA 4XM0A 4L4RA 2PI5A 5FH9A 1Q22A 1UJBA 4TN5A 5TPZA 1Q7YW 2Z2YA 3EUWA 2V74B 1DB3A 5HXZA 3R5FA 1FA9A 1S8AA 3EISA 4DV4O 1ILWA 1NLYA 1PUJA 4FPPA 1HE8B 1Q95A 4KLCA 3OCXA 4AY3A 1M2VA 1FMTA 1AOXA 1K9SA 4ISCA 3ZRWA 5ALZA 3O0TA 1TUIA 2YXHA 1Z39A 2DBRA 2DBQA 5G1OA 3AI2A 1H2RS 1E2KA 3AQIA 5IWAO 4O4JA 4WEOA 5F5NA 3U0BA 4FX2A 1DP4A 3H1FA 3S2UA 1G4AE 4CQMD 1ZVQA 4JUCA 4BIUA 4J16A 3OEWA 5AVZA 1BHBA 3QVLA 4JH0A 4Q18A 2RGUA 1JHVA 3L5OA 1V26A 2B2XA 5TGDA 3K7EA 4QU0A 4QBFA 1P31A 2H54A 3RB8A 1BHSA 2HCJB 1NBHA 3B8EA 5ULLA 2NQ2C 2EBWA 3QMWA 4MGKR 4YDSA 3NHFA 1UDCA 3NIBA 4ZCLA 3ZQKA 3GGJA 2VDWB 1VBMA 2VXOA 5TMBA 1Q81W 1NI3A 4YONB 3AF0A 1EXMA 5HG0A 1E3TA 1VP7A 3C8MA 4OBBA 1GFIA 3L7MA 2I3DA 2WJ6A 5FJ4C 3HNPA 5FBLB 3GWKC 3HRIA 4P53A 2A5YB 5H68A 2GX6A 2CKDA 3CE6A 4M1WA 3KQUA 5FNVA 3ZCPA 4F96A 2R66A 5A6VA 1IQPA 4GE3A 3A1EA 4ND8B 1YAJA 4OGKA 4TVSA 3B1JA 3KXPA 4ZVQA 1MORA 3H6GA 2NO4A 3H9GA 3ND6A 2HTFA 3H05A 4PA3A 3CWQA 3C1AA 1GSHA 4HWOA 3LGAA 1Q8IA 4NBWA 4ZD6A 1HNWO 3CSUA 5I8PA 4QECA 1NH2B 4Y6GB 2YXDA 1DO2A 4JBLA 1ADCA 5FPHA 3T1HB 1RQPA 1O94A 2UVDA 2J7PA 4WXYB 5EPUA 3V8QA 2JLQA 4B4UA 2YZ2A 4QULA 4DMGA 4WI1A 1KYZA 2LCFA 3OAAG 4K0KB 2Q07A 2X41A 3I2JA 3KCYA 3DPUA 3PXUA 4KH0A 3KZVA 2F1OA 1PWXA 2O0JA 4ARUA 1EE1A 1TM5E 3D3JA 4R9RA 3OM0A 4P5EA 1NXXA 2R62A 2OCCC 5JWPA 4KQ9A 1E0AA 3E7XA 4OKIA 4AKSA 2UYPA 3H8SA 4KXXA 4XE5A 3ANYB 3WV5A 1W47A 4BCCA 1XHFA 4H18A 3AG2C 3EWSA 1W46A 2YNMC 3P4UA 3WGVA 4C0AC 3H5IA 1MFZA 1LLFA 1HE5A 4PV7A 5CXSA 1Z68A 5AJZA 3SZLA 1M1YE 2Q50A 3AESA 4JLMA 2C31A 4OXSA 1TU3A 4K88A 4KFCA 2DEUA 1FU7A 1L7PA 3Q3CA 1BRMA 1SBYA 2BJVA 2IZ7A 5DKFA 2YS8A 1WDMA 3ICPA 3WWEA 1CVIA 4FOOA 4N0PA 1QGED 4W5RA 1YS2X 4MR9A 5IZCA 4L0CA 3MJFA 3TD2A 4UBOA 2JL1A 2O5VA 2QJFA 3N2IA 5LC1A 4IYJA 3TIIA 3W7AA 4M76B 1BWSA 3A31A 3M1XA 4CLOA 4P93A 1GLNA 3G8YA 4AWXA 1LF0A 4GZMA 5EHQA 3T5TA 5FFMA 1TVMA 5CHYA 3RUEA 3ZP4A 4XKJA 4A8JA 5AW0A 1JAYA 5T6BA 2Y2UA 2J0UB 4GR5A 1M72A 1YACA 3R3WA 2WFLA 1SHZA 3C4QA 4MMXB 1YIDA 2BMEA 2QJWA 1BS3A 1XDUA 4XEUA 2BFOA 2I7CA 1ONSA 5IBPA 4KHPO 1O6CA 2P6NA 3NM4A 3NG1A 3HZOA 4IGAA 2CMHA 2ZDHA 4XYGA 4YJFB 4ENTA 1OFGA 1RT9A 3IP9A 5I8WA 1EVIA 2GR9A 4JQOA 5IXYA 4WA7A 2VT7A 1E2UA 2HG5C 2ATCA 2BYTA 4AMBA 4QELA 3FE2A 3W7UA 2NUPB 4NL4H 5E7QA 2Y0PA 2XA9A 2KTUA 4MP6A 4JI0B 1RMQA 4RZ2A 4BLOA 4QPKA 1F2UB 1T3LA 5EC1C 1BTOA 2ZJFA 4LHVA 4DMKA 3ZHQA 4H16A 1EG7A 1Q2XA 1XKQA 5LYJB 4D9KA 5JTUA 3SE0A 2WLSA 1JHAA 2X8BA 4K9DA 4EY5A 4RDHA 1N9KA 5EP4A 2Q0QA 5IZCC 2W37A 3WXMB 2V9CA 5BSRA 2O1SA 2GNPA 4N21A 4JXZA 1Z2AA 5MHTA 1B73A 3K0CC 1N6KA 1QU9A 3Q9UA 1N9GA 3LJKA 3IEPA 4ZJUA 5IZ4A 3DBIA 3RBAA 2GLZA 3C98A 3UOGA 2CDNA 2WSIA 3PS9A 2CW5A 1K7XB 3D4PA 1G3QA 3GGOA 4LJ7A 3KQOA 3UT0A 2A78A 3R8XA 3KTFA 3FY4A 4BAZA 1ZISA 1AV7A 4RCYA 1BN6A 1G1AA 4DUPA 2GFHA 4FHFA 4IXWA 1DQRA 3T9BA 4GWGA 4AKEA 3H4VA 5DOVA 3ZKAA 3DQZA 2BH2A 3IDFA 1TCUA 5C81A 4CT5A 2RMKA 4W6QA 3I7TA 2GTPA 2QMHA 1X8KA 1YCHA 4FFMA 1XQ1A 1L0BA 1EN6A 2G4VA 3CLVA 5LR6A 1WBDA 2ISCA 4B3TO 4ZZ1A 3V8VA 3CR8A 4MI1A 4RAQA 3D6AA 1P60A 2DX7A 4R1NA 2QRGA 1DAMA 1GKKA