3JAKB

Cryo-em structure of gtpgammas-microtubule co-polymerized with eb3 (merged dataset with and without kinesin bound)
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
429
structure length
429
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 151
structure length 429
sequence length 429
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jakB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jakB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jakB01
3RYHA 4O4JB 3RYIA 1SA0A 4ZHQA 2VAMA 5ITZA 3JASA 3JATB 4FFBA 3HKBB 5LYJB 4EB6B 1RQ2A 1TUBB 4TUYA 3RYCA 4X1YB 4IIJA 5LOVB 1W5BA 3HKCB 2BTQA 5GONA 3JALB 1TVKA 4YJ3B 3N2GB 3JAKB 4O2AA 4YJ2A 3HKEA 5CB4B 4B45A 3JAWA 4O4HA 4O4LA 5LP6A 3VPAA 5LA6B 3WGJA 1W581 2R751 4F6RA 3WGMA 3RB8A 4TV9B 4ZI7A 5EYPA 5KX5B 3VO9A 1FFXA 5CA0A 4EI9A 5IYZB 2VAWA 5MN5A 4O4JA 5JVDB 4LNUB 5JQGB 2R6R1 3JATA 5LYJA 5IJ9B 3HKBA 4X20B 4EB6A 3RYFB 3HKDB 4O4IB 4X1YA 4ZOLA 1W5AA 5LOVA 5CA1B 3HKCA 3JALA 5FNVB 3N2GA 5LXTA 5CB4A 3JARB 4TV8B 3VOAA 1OFUA 5JCOA 2RHLA 4M8IA 5LA6A 5EZYB 5LP6C 5C8YB 5EIBC 4I4TB 2RHOA 4TV9A 5IJ0B 2Q1YA 1RLUA 4I55A 5KMGB 5KX5A 2RHJA 5M7EA 5IYZA 5EIBD 5J2TB 4WBNB 5JVDA 5JH7A 3E22B 4LNUA 4U3JB 4E6EA 4HNAB 5JQGA 5IJ9A 5MN6A 4X20A 3HKDA 4O4IA 4DXDA 1W5FA 2GVIA 5CA1A 1JFFB 5ITZB 1TUBA 4FFBB 4DRXB 5FNVA 2XKAA 3R4VA 3RYCB 4B46A 3ZBPA 4EI8A 3JARA 4YJ3A 5GONB 5CA0B 3WGKA 1TVKB 3JAKA 5MN4A 5J2UB 5EZYA 2XKBA 5C8YA 4YJ2B 2Q1XA 4I4TA 5JCOC 4X1KB 4I50B 5KMGA 3VO8A 3V3TA 1Z5WA 5J2TA 4WBNA 4O2BB 4F6RB 4U3JA 4HNAA 3CB2A 3UT5B 4X1IB 2VXYA 3N2KB 5BMVB 4IHJB 3M89A 1JFFA 3RYFA 5LXTB 4DRXA 3VOBA 3RYHB 3RYIB 3WGNA 1SA0B 4ZHQB 4ZOLB 1FSZA 1W5EA 2VAPA 3C8LA 3JASB 3M8KA 3WGLA 4TUYB 5J2UA 4IIJB 4TV8A 2BTQB 4X1KA 1RQ7A 4I50A 1W59A 4O2AB 4KWEA 3HKEB 1Z5VA 3JAWB 4O4HB 4O4LB 5IJ0A 4O2BA 5LP6B 4XCQA 3UT5A 4X1IA 4EI7A 4I55B 3N2KA 5BMVA 2RHHA 3E22A 3ZBQA 4ZI7B 4IHJA 4U39A 5EYPB 2BTOA 5JH7B 3ZIDA 1FFXB
chains in the Genus database with same CATH superfamily
1XVAA 1KBQA 2JI6A 5PNTA 2VAMA 4HDRB 4MR9A 2OM2A 4LDJA 1XDWA 2W48A 3PRYA 1Y6JA 3N2GB 1OV6A 4POAA 1W4CA 3OTFA 1C3OB 4WCFA 2ONCA 1OXUA 2V7TA 4RABA 1VB3A 3EQ9A 4DCJA 3GROA 5ALEA 5AVSA 3EA4A 3HCFA 3D8TA 2BFDB 4Q3CA 3O47A 2B4AA 3L7MA 4KU4A 3ZHXA 4LY3A 2HZBA 3NWOA 3Q7IA 3K9CA 4HYOA 3RC8A 3CD6V 1XAJA 3UIEA 2FG5A 1HI9A 2GFHA 4DRXB 3V7QA 3MLBA 1E1RG 3LWRC 4X6YA 4M8LA 1XUOA 1O5TA 4DOMA 1K7YA 5EZYF 1MMFB 1SA0B 3K0CC 5JLJA 2BM9A 1P7GA 4KFSA 2I9PA 4TPKA 3MDOA 4L1KA 4C5AA 2P1RA 2FSGA 1FJXA 1S5HC 1J0BA 3DGEC 3BFKA 2QOEA 2C5FA 3UH1A 1BVUA 3MUFA 3D6TB 1VPVA 2WFZA 3MT7A 3OLWA 2VF2A 3PS9A 2J5QA 2REQB 3UKJA 2RK4A 5AMXA 3MILA 3V7UA 3UMVA 1ZSPA 2FR8C 1BH2A 3AEQB 5CT6A 1A1VA 3GEGA 4N41A 1E3WB 2LGWA 2I2XB 4BV2A 1LV7A 3NUZA 5IAAA 4ONEA 3UPUA 3L7JA 3A25A 1UXJA 4KNYA 1SWVA 3EGVA 4AP5A 4WA8A 1C0LA 3UCSC 3DOOA 3MS7A 2A35A 4MUAA 2D8MA 5EMKA 1X59A 4B73A 1JIJA 1U4SA 3G6KA 3OE1A 1YFKA 5COQA 4WN3A 4JYBA 4JBYA 5K8VA 2PO5A 4EF4A 3KWLA 3IAS6 1BE3H 1KU9A 4LF9O 1JDVA 1P60A 1O57A 1E1RA 3DCYA 3DEFA 4R16A 1DJNA 2Y1CA 3QMWA 5ED0A 1TO1E 1CYDA 1I4OA 1U3DA 2ISSD 4KX3A 2ZIWB 4IQ4A 2IQ5A 3PNBA 4ABMA 2Z95A 4PLFA 3UJCA 4DWWA 2ZR7A 3V7YA 2OO5A 3VAAA 3ZQUA 4GXQA 4HAOA 3ESXA 1XD8A 2QLTA 4XIGS 4XKJA 3OUUA 3QU7A 2BFBA 3AH8A 4IWNA 1IZ9A 4KWIA 1E0JA 1GN8A 4IO0A 3T0GA 4GZ6A 2HBZA 4DQKA 5THQA 2VZ9A 1W93A 1T2EA 3F98A 2ZTSA 5JJNB 4Y1EA 3ET4A 3PWTA 1DKNA 4HATA 4Q9AA 5C7IO 1GSAA 5AXCA 1ZK2A 3DD5A 1JECA 4HYYA 3FB5C 2WG2A 4FC6A 3W7TA 5E1BA 1BKYA 2Y1DA 1PZXA 3NNDA 1JJVA 4YLGA 5LCXA 1E1MA 5C8YF 4XSHA 4L5JA 4QQ8A 5C34B 3GP5A 3GVXA 1UBCA 4N65A 1Q17A 4AJ4A 3T4XA 5FA6A 4BAYA 1XMQO 4KMSA 5TPWA 4C1NA 4E08A 4EA9A 1LLCA 4EPWA 1YI8A 1QZ3A 1MB9A 4YDHB 2FOXA 2XGGA 1KQSF 1OH7A 3AG4B 1VE9A 4HADA 5D3MA 5L8VA 5FA5A 2Q2NA 4R01A 5BR4A 2KMLA 1FSPA 3E3OA 4UQOA 4LNAA 4QA9A 2DPHA 5CLIA 5EWMA 1XZBA 2YMLA 4KQCA 4FD3A 5CNMA 5B1YA 3WLIA 4WFBV 2QTWB 4JQOA 3IUMA 4QASA 3CZRA 3MRXA 5AJHA 4HOYA 4H13B 5TJHA 4QVIA 4Q7QA 4NH4A 1OZGA 4AJJA 1ISGA 1FUYB 4OP3A 2HWXA 5B6PA 2OCKA 3TLKA 4XASA 2PGOA 1T2FA 1K5GA 2VLIA 3FBAA 3G6EV 4BW0B 4QOSA 2OR3A 1HYGA 3OIVA 2ZINA 1CQPA 5AOCA 4HB4A 3FRHA 3R5FA 1A8QA 3IT0A 4RY0A 2C98A 1S3FA 5IH7A 1ISSA 4RSHA 2A5LA 3W04A 3LVBA 3FHLA 2X3UA 3DMRA 4ALJA 4GL2A 2VI5A 4X66B 3MWDA 4LJLA 3RU3A 2HN9A 4M7PA 1O77A 5JDIC 3W9SA 1ZWIC 2ZR3A 2FX5A 2PZJA 2HC9A 1JDJA 1W2WB 2YRWA 2PUCA 2IJHA 1C9DB 1NY5A 1I6LA 1L7PA 1GWNA 1O0SA 1OWPA 3OY2A 1ZOPA 2BTUA 3TPFA 4HR7A 3KOUA 1MFZA 1AVTA 4IGGA 3G5LA 5DGCA 1YQ9A 3ZD7A 2Z1MA 4J0CA 4I6EA 1Y98A 4IWYA 3ST7A 1I2CA 4A03A 5B8FA 4TL7A 5F9MA 2X77A 3GN2A 5C51B 1UFKA 1T5SA 5BSHA 1JU3A 3A0BZ 5ECGC 2FX3A 2Z8YA 3GQVA 4OH1A 3OUFA 4A6EA 1PZFA 4BVEA 2VDMB 4F3KA 1KTIA 1P18A 4R9VA 4DW8A 1YRWA 3X3HA 2Q4TA 3ES9A 3BMCB 4GKKB 2JD1A 3BJZA 3IYLW 3RIYA 1JVSA 1QH1B 2OCXA 3EW7A 2M98A 3MFQA 2IY8A 3ZKAA 1GRRA 3H04A 5B55A 2OHVA 3R7SA 4XFDA 3GZJA 1SKQA 5LMCA 1KVQA 4DV3O 3OAAG 3ORHA 3WB2A 3CINA 5GY7A 3WA7A 1GGFA 3CNLA 3WNVA 3L4EA 4UDYX 5KWSA 2GD2A 4E32A 4JQYA 3AKCA 4DCOA 1SRYA 1G3MA 3GDOA 4ALNA 5CN0A 4ZRDA 4B31A 2JARA 3IV7A 5SY6A 4L4YA 4D25A 3GDFA 4IH1A 1IG3A 4H1VA 4M49A 3ZD6A 3ASOB 4B33A 2OV1A 6ABPA 4OX9Y 1N0JA 4Q1CA 4NEGA 3JZIA 3UGKA 5KTPA 3TFOA 4IIEA 4X85A 4IHQA 3M89A 3VHRA 3D7RA 4HXFB 1CXZB 1W3EX 3MJ4A 2JFZA 1J0AA 1KL7A 3O2SB 4RK5A 1I36A 1NUUA 4GRDA 3DBRA 1E4EA 2YH2A 2QXTA 4MP3A 2I4TA 5EYPB 4FHZA 1J5XA 4YACA 1HE8B 3AUSA 1GO0A 2Y3IA 1DEKA 4K87A 1I7SB 4MHSA 2OIGA 3D02A 1TQ8A 4DLKA 3DPIA 2JAUA 2R2AA 2WUFA 2UVDA 2ZBPA 2GUGA 2OA0A 1SZPA 1RLOA 2HTFA 5IZCA 3ZWDA 3OAAA 4CETA 5I9IA 2DOSA 2IX9A 4N3BA 1JOYA 3AG2C 1PJ8A 1Z36A 1HRKA 1P2TA 4E2FA 3IFXA 3I1FA 1YGPA 5IX8A 1W8IA 3L8GA 3JQRA 1HE3A 1UJBA 3ORSA 1L4HA 1XILA 1A8SA 2NV6A 3GLHE 2R87A 2FSPA 5JJBA 1PG0A 1WXDA 2GTAA 1CUYA 1T2VA 3ENKA 3GVMA 5LXTF 4DM3A 1F8FA 3RJMA 5TQ0A 4HX9A 2CGNA 2I71A 3SC6A 2A8YA 7YASA 1BXGB 3BXFA 1E77A 1E32A 3ZTYA 5B7NA 1QDUA 3CRW1 3NIFB 4M8SA 5CH3A 1T0JB 1MF7A 2I6SA 4MQMA 5AW1A 1IHUA 4DYVA 4CNBA 5SYAA 2HHAA 4HWTA 3TMYA 2LW1A 2ZJ8A 4DA8A 4N3AA 5TS3A 5ALOA 3K08A 1SUPA 2NSJA 2XCOA 4OBBA 5CXUA 3SC3A 1XBLA 1Y6FA 1RBYA 3F49S 5EC2C 1L5GB 2EZ4A 5BYKA 1ABBA 1K7EB 4G5HA 1WUYA 3SOZA 2EFYA 3BSFA 2OFPA 4OLBA 5HBRA 2YDYA 3LKVA 3EZ6A 3QPUA 3H9JA 2CT8A 3P30A 3IC7A 3KTDA 3J81A 5IZCC 1VOTA 4EY7A 2JFBA 3IJ5A 1SG0A 5KNBA 1E2QA 6LDHA 2GEUA 2C92A 3K6SA 2BTEA 3NHLA 3T52A 3WYGA 4JR1A 1G19A 3UWMA 3I1IA 4ZO6A 1FUEA 1QUEA 2UDPA 3P9YA 3WYAA 1SC3A 2XZLA 1BHO1 1GN9A 4IIJF 5BV0A 4JC4A 4KR6A 4N0QA 5G2OA 4DLLA 2VLBA 2QN8A 1F0PA 4KQHA 1E6WA 3VH3A 2VQ3A 1C0IA 4CCWA 2C5BA 2V9PA 4YJDA 4HDKB 5B7GA 5CB6A 3Q2KA 1FUIA 3HE3A 2O2IA 2CXHA 5CVJA 5GOTA 4CIDA 2WM8A 3BAAA 4E5YA 3L7QA 2JLVA 1HYHA 4LYAA 1YI2F 5AVZA 2VHVA 3AZOA 1TD1A 1CVRA 1GPMA 1V71A 3OP4A 1POXA 1P80A 1USGA 5E7IA 4ZK7A 4LSZA 5WRFA 3FJ1A 4NCKA 1UPBA 3QPWA 3W5HA 3TCNA 2HA7A 1SCAA 5AVMA 3AL0C 1Z17A 2VJYA 3LV8A 1IPHA 1FDTA 4XGRA 3K2IA 3R5SA 3RNLA 2VRWA 4LUCA 4CF4A 5JO9A 1COMA 1U3PA 3OHMA 1X7OA 1X14A 5JZMA 4FOOA 1N3LA 3S3XA 4FYMA 3ZC3A 2GHIA 4KMMA 1V7ZA 3RI3A 1YRQA 2GH1A 4O08A 1U98A 2YI9A 3EUAA 4BNMA 2RN9A 5CB4A 4QGHA 5FUVA 1RZRD 3PR3A 2WTAA 4S2UA 3R77A 3DE5X 3VDQA 3ITDA 3DWIA 3EGXB 3QG5A 4AURA 3WWZA 5LNK6 3ZHVA 4EM6A 3ETGA 4NXNO 4OBWA 4M46A 1E2LA 3NX4A 3BGSA 2GB4A 1Z5PA 4UFZA 4MICA 3VPCA 1PDWA 1FOEB 1QIFA 3NEYA 2HK8A 3B1KA 4J4BA 1KI6A 4RMNA 2CLDX 1RPAA 1IHDA 4UVAA 5FCDA 3ZG6A 4B44A 3K0AA 2VC2B 2HSJA 3DE6X 1Z4LA 1YQUA 3UFBA 4PSAA 4LSGA 3EGDA 2IBSA 2JIZG 2Y0PA 1WXFA 3LYUA 4IHKA 4G85A 3ABLB 4IDGA 4UTXA 2NPOA 3QVLA 1MGPA 5KVAA 2ZUCA 5HXZA 4B47A 5DWVA 1ZONA 1AMNA 2QG9A 1DC3A 4G01B 1VFNA 4KYUA 3R8CA 3CNNA 3VVCA 3Q7RA 4NE9A 1JMVA 1Z4NA 1OPXA 2C3OA 3IP3A 1YS9A 4TTIA 3QVNA 5CK5A 4ARIA 5JD3A 4Z4IA 4MJXA 1C7EA 3KVRA 2Q1YA 4KQEA 1MOSA 1AGYA 5F98A 3P0JA 4M22A 4ARUA 4B6PA 4O2AF 1LTHR 2EP7A 2XKAA 3ITNA 2XSZD 3ZE8A 2JVJA 4H6VA 4HFNA 1ADBA 4YRSA 4WI1A 3KQUA 1HE5A 1WSBA 4KUMA 3HDGA 2G9ZA 4M87A 4H16A 2JVDA 3A2MA 1G8AA 1SPXA 1BGYH 3OD4A 2H4WA 1KJZA 2FSUA 4R9SA 1JE1A 2DFDA 3NKVA 4D44A 1Z88A 4YO8A 3I73A 2D5CA 3U7RA 4R8CA 1G5PA 1HYEA 5BNIA 3K4PA 3FY4A 3W1EA 3VMFB 2JIZA 4FK5C 1AILA 1E3IA 1U40A 1FDIA 3UY4A 5C3UA 4FR0A 3FBWA 3ZCSA 1KNJA 4FEYA 5DYGA 5I8WA 2AQ8A 1V9SA 1K73H 1W5AA 3NVDA 4CTNA 3VYSB 1FFTB 3QM1A 1R8JA 1BW9B 2PJZA 4M8IA 3ND6A 4C7UA 4G86A 1G3RA 5BSVA 4M9CA 1RFLA 4MVJP 3ID6C 3DNMA 2QRMA 3GYGA 1USVA 4W1PA 1XDSA 1R4MB 3NCHA 3TVDA 2RB9A 2YIBA 4CT5A 2H5IA 3W4JA 1EYZA 4FFKA 1N77A 3R9KA 1A8HA 1B23P 1J8DA 3DOIA 3AR6A 3G0CA 3CPWF 1OTYA 1TLFA 1R8SA 1NQOA 1PGQA 1LK0A 1A04A 2RG7A 4P93A 3B5IA 3NUQA 1OZAA 4K88A 5GMOA 4C76A 3R0ZA 4QOJA 2GWRA 2I6GA 2GLUA 1OILA 2HF8A 2QYTA 3L18A 4OOEA 4ZYVA 3O4IA 3GUUA 4Q5IA 4MYRA 5AW6A 5CFRA 4DBLE 1E5TA 1PFVA 2I6UA 5G53C 3HKCA 1WMEA 3ZQKA 5C2JB 2GJKA 3E4CA 3ZYZA 3B2EE 4LQLA 3F6MA 1JZTA 1EM8B 1PYGA 5FUMA 4HS4A 3NHZA 5JS6A 1IN4A 5LD2C 3ZD9A 1NI8A 1KTVA 4U2BA 2Q9CA 1SVUA 3ORYA 4TYWA 1U2PA 1FXUA 1SM4A 3SI7A 2AC2A 4ARCA 2VTDA 5CGZA 3HA3A 5AG2A 3CYOA 3QIAA 4UVBA 2EWMA 4P3XA 2JFVA 4QGGA 2DHQA 2FFAA 1Q0PA 2GNOA 3RA6A 1FBTA 3RUAA 1TMKA 2VF4X 2DU8A 3GEPA 2POCA 4G1CA 1D4AA 1AO3A 3FMIA 2JLYA 5JCZA 4KYIB 1MO4A 1GPLA 4PGGA 2AK2A 3ZLUA 2GEKA 1BCSB 3WLOA 3P4XA 3U4CA 4QT0A 3FPBA 1UMCB 2FG6C 2Z83A 3AEXA 1OLUA 1WULS 1V6AA 2FW7A 4YP7A 2KJQA 4R1UA 4E5KA 3AXTA 3LNNA 1CRZA 1Y76A 1H9AA 3PXDA 1NSFA 1VLMA 3TK1A 3I4CA 2ZJ5A 4EG6A 4WD3A 4I5FA 2FMIA 1KYYA 1W85A 3WK7A 4G0ZA 1XELA 3QQPA 4GSLA 4WXHA 3LT5A 5FUYA 3UATA 4WVLA 5JNLA 4M0MA 3WHPA 1E4OA 2J3IA 4UDOA 3RWMB 3OBWA 5FTJA 1M83A 2OSBA 4NTZA 4OGLA 3G2LA 2YN4A 1C1XA 3GLUA 4DLXA 1C1YA 2RDCA 3RFRA 3T9FA 4BMCA 3DZCA 3AETB 5JWRA 1VKZA 1USUA 4CLOA 2C7VA 2DX7A 3HC7A 4D9JA 4JK3A 2OAQ1 1ETUA 4OHRA 3HDJA 5KO2A 2HP8A 5ESDA 3CZ5A 3UOGA 3E23A 4J0DA 1BA2A 3SCZA 3PGLA 2OKGA 3Q0TA 4B6QA 4YAWA 5KIAA 1A72A 4I7EA 3UUEA 1AHPA 4O1MA 4CT4B 3W7BA 3Q40A 1RMTA 2HMYB 2B5UA 2A94A 3EIQA 3TI7A 1XQ9A 1GH6A 1D8AA 5DHPA 1ISJA 4XOUA 3TSZA 2I54A 3LSQA 2BRUA 1YF2A 4LWSA 1ULBA 3L6CA 3OCUA 4U7GA 1A69A 1AKYA 3OE7D 5EQJB 3X2QC 1U2DA 4FYYA 4H3VA 3O8QA 3PIDA 5L3EA 2C5LA 5JYDA 1BFDA 4NPHA 1GTJ1 2VGMA 3WGZA 4MKXA 4I7ZB 1T5IA 4N8EA 1MC4A 1WSAA 3W7AA 1UUFA 4D8VA 3PE3A 1TTPB 5EP2A 1VI5A 1JHQA 4QBGB 3TTUA 4DDHA 2HWKA 3DTVA 4G8BA 3RC7A 1CP9A 1KAQA 3FUTA 1BS9A 4YHHO 5B1AB 3EC2A 1MSWD 4MV6A 1WAMA 4A2PA 1G5RA 4ALMA 2E1RA 1S3GA 2EZUA 2HO4A 1UJ5A 3F3KA 4V0LA 1F06A 1WOMA 2B20A 4FW9A 1G4AE 1SN7A 2IEYA 2JLXA 2X1HA 1OLXB 4AYWA 5EP1A 3EBLA 1NBME 2IITA 1M1ZA 4IS3A 1RHQA 2PEYA 1E2NA 2GN0A 2HIGA 1GZDA 2QTSA 3CXCU 1RPTA 1J7JA 3TLMA 4K1LA 4E2WA 1Z2GA 1Y9AA 1DAKA 2H94A 1Q5OA 3DE2X 2FMFA 1ZCAA 1QIGA 1NA5A 1QLNA 4JSTA 4GUDA 3VTZA 3W2HA 3RRZA 1YI1A 3ED1A 1DIHA 1IXYA 3BK7A 1VKHA 4L50A 4KP4A 3CB4A 2AZ2A 5KJFA 1JA0A 3WR5A 2PYJA 1LZLA 4LRXA 2GGSA 4FILA 2BRUC 5IULC 2OHIA 1GPH1 1M8GA 2QL5A 2EEPA 2Q3FA 4U7JA 3NYRA 2Z58A 4ZT6A 3D2CA 4QBTA 1O89A 4LBWA 5AKGA 1T9GS 4PZZA 5IDJA 2JCSA 1U2DC 1BDMA 1EBOA 3UO3A 2BKAA 4QEZA 1SQBH 5LJLA 1ZNZA 1C3VA 4IUDS 2Q8PA 5KSWB 2G28A 3QXGA 2ITDC 4YCCA 4M1WA 1UFRA 2GMWA 1OXMA 2BL4A 3DOEA 2FMTA 5IJ0A 5B1BC 1H2LA 2FP3A 4B4DA 4Z8XA 2Q9BA 1KA9H 5AVRA 4X62O 1PP4A 3OZRA 2QY9A 4UZFA 3MBKA 3ZE0B 2RGRA 2P2SA 4DADA 3QELB 4OHKA 5HW0A 2ZYUX 1T6XA 3CPQA 3YASA 2I3BA 3FNRA 4MYHA 2ROQA 4J80A 1PFKA 5JCJD 4DR2B 1AKMA 4BP3A 5C80A 5K0SA 2JAHA 3JYHA 1RQPA 4WXPA 3OFVA 4BU1A 4PWTA 1QX3A 5CLFA 1YDMA 3H0CA 2Z5GA 2C59A 3VQXA 3KCNA 3W34A 3K6RA 2NVWA 4A1FA 3VI3B 4QRHA 3BCUA 3F8WA 4YJ3A 2XMPA 4UASA 1BZYA 1T0KB 1ZGJA 4URXR 2X6CA 1Z3CA 1NP3A 3IKLA 5LQKA 1P3DA 3PEEA 3LSSA 1JGTA 3BD8A 5JWHA 3UXMA 5EZSA 1TIKA 1A9YA 1N2IA 3ABMC 4QU9A 1PT8A 2ZJ1A 4N3CA 3ILXA 2PV0A 5FV7A 3VZPA 5C52B 3B1XA 2XBUA 1EK5A 4NZOA 1CWUA 2R6AA 1ZGCA 5ESXA 3STTA 5D7BA 1FVXA 5CIQA 2PGXA 3DLPX 1OCZC 3IHTA 3QEBZ 4FSXA 1SQFA 2QRJA 2ODMA 2IZ5A 3AJDA 3ACCA 3WK9A 5DIFA 5FA8A 3A28A 1LK5A 3CUYA 2OXEA 4N9WA 4PNHA 2JAQA 4M21A 3CCSV 1V8BA 2L69A 5DM4A 1T9BA 3NWJA 4MPDA 1V25A 2B5OA 4AJIA 1SVKA 1GKKA 4JUBA 4Z0TA 2H7VA 3ZDEA 1YJ8A 2CNLA 1Z63A 3I0NA 5IC6A 1CUJA 1LDEA 1CUEA 1XFDA 3PLAC 4B43A 1F51E 4ARSA 2WLHA 3BHJA 4TTPA 3CSUA 1T10A 1YZVA 4DREA 1WQ3A 2Y0EA 3VPDA 3TFQA 2VQ6A 3G1WA 5LFAA 2ZAOA 1Z0JA 2V4MA 1MT3A 1Q14A 3CUTA 4JI8O 3HADA 4B45A 3H17A 3FTPA 1KWGA 1T1GA 4WFJA 2NZWA 3WXMB 5EG5A 3IRUA 4TMWA 2Y9PB 3EPLA 5CNJA 5CW1A 5A7HA 5KNDH 2YHIA 4YJFB 3T9AA 3BHIA 2B61A 4DDWA 3L7AA 1H48A 2W4IA 2I6TA 3ZUGA 2PLWA 3T9EA 1J0CA 1NULA 4Q3LA 1EE1A 5EGNA 1V5WA 2CLEB 3L0ZA 3VC3A 1W0JG 4YA6A 1OB5A 1J07A 3F0TA 4N21A 2HBRA 4KE6A 3BS4A 4HXGA 1DBSA 1CX9B 3Q5DA 4DT1A 2WJAA 4NU0A 4A5SA 1KIFA 5FYDA 3N87A 2NXEA 3WWDA 3H75A 2LV8A 3CD6F 2LRHA 3ISJA 2EULA 3GNSA 4O29A 3A6ZA 2Q3BA 5AHXA 1Z29A 5ALRA 2HVKC 2WHXA 1EA7A 2XQKA 1LC3A 3T1OA 3D2BA 3WHKA 1GG2A 1QYRA 2EWCA 1E8MA 1GAXA 3IHWA 1H05A 4LBVA 1EG7A 1YTLA 3R7WA 2B94A 3EA0A 4DHEA 4XYLA 3QNMA 2TMYA 3ROKA 1T1RA 1G5FA 2E18A 5MF6A 2CUZA 3V2HA 3LIPA 2JS5A 3QHQA 1JH8A 3M0EA 4JI5O 4FZJA 3IUQA 1VQLV 1OPRA 2XVMA 1Z74A 1GTVA 1FLNA 4FCWA 2FN9A 4ZT4A 1WXWA 4RQAA 2CLCX 2Y0BA 4AULA 4JUCA 4H7FA 1V8PA 1XEWY 5ARCA 1XMPA 1W0JA 4ZHQB 1HKUA 3LUJA 5L6LB 4AZTA 5CFPA 5EJ8A 1ZL8A 4FBGA 4GM4A 4Y2GA 1JHRA 2WZBA 2OQVA 3B36A 1XN4A 4K0KO 3LT0A 4AY4A 4LJ8A 2VYND 3HY4A 1E9CA 1FFXB 5H3CA 2P9YA 3GGDA 3CCMV 5KWVA 2O4UX 1KK1A 3OCYA 4WNAA 2FDCA 2IUYA 4GEKA 3V48A 2BGMA 1K3TA 2ODBA 3K9BA 3B6KA 3OMIB 1U90A 2AYXA 1ZIXA 4G1VA 3KUKA 3MWYW 1WPRA 2P65A 4R3NA 9LDBA 3RYFB 5T57A 4KXMA 1LCIA 3E1YA 1VTKA 4ZO8A 5FLXN 4U2KA 4RQOA 5JI3E 2CXUA 1J95A 1Y80A 3WGGA 3ZLJA 4A6PA 2ZVJA 2F67A 1THMA 3NGMA 4XPIB 2B8JA 1QLHA 2OZBA 4I55F 1C50A 3QNEA 1F4VA 3AM5A 3N6XA 4EHAA 4YJ2B 2Q6AA 5FIUA 2LCAA 3ZMZA 1NN1A 4UHCA 1N32B 3EGWA 1H85A 2NV2B 5FOVA 3JQ8B 1BRTA 5ALSA 3DDOA 1KIMA 2FPPB 3W5AA 5EHIA 5BT9A 1ZICA 2ENUA 3CRZA 4L28A 4TYMA 3OQBA 3K8ZA 3UAVA 3F7MA 3U09A 2FVYA 3JCZA 4KXFB 5HJ7A 4F84A 5CNKA 5BUQA 5HHTA 4IVPA 4JJEA 4BMYA 4BKRA 1TYZA 3ZWXA 2IV3A 1IYZA 1M4UA 3COZA 4XQCA 3H99A 1PWZA 4CFSA 3JALA 2D8AA 1OE0A 3ANMA 4B6GA 3SM3A 1O9HA 1KAHA 3BIFA 1TK3A 1UJCA 3QIVA 1KS2A 4BPRA 2F1HA 1X77A 3TR6A 3SAJA 1U31A 3ETJA 3S70A 2FFRA 2C9MA 3UAYA 2MYNA 3RFXA 1NJ1A 4U7WA 3RWOA 3M9XA 5EE0A 1UT6A 4RVOA 3KO8A 3UXHA 2PWZA 1NM5C 3DV9A 3IQWA 2WUDA 3WQSB 2IPLA 4LOKA 3B89A 3IMPA 3G6EF 3ZZNA 3VR1A 1UI9A 5H6RA 1F4NA 1ZCJA 2WWHA 1E66A 1N8SA 1GD1O 2VP2A 3IESA 2PU7A 3S7TA 4CMIA 2GYUA 3ND7A 2FPMA 2NT3A 2QU7A 1VSVA 4MW5A 4P4TA 3ZEDA 8MHTA 4HSEA 4L16A 1P4RA 1FUKA 5HDQA 3C3AA 2IYEA 2C07A 1SBHA 1S9DA 3HU2A 3HCPA 2PZGA 3BE4A 3QYAA 4MMYB 5EJEA 1NZFA 4P1ZA 3I5XA 3PX3A 3U6BA 1FXWF 1PEYA 2AEJA 2I4RA 2QJWA 1BD3A 5DDIP 4P4SB 2QT9A 3HQ4O 3QLUA 3ZIAG 3NHBA 2Q8VA 1RPNA 3G6WA 3ZWYA 2Y0IA 3KL2A 2JIMA 4PTZA 2XUZA 1BHQ1 1F5NA 2WJVA 3S02A 2GEFA 2IBMA 4CKBA 2Q9AA 2MMGA 4HLDA 3KJJA 5DM2A 4ERHA 2B4QA 4BE7B 3VO1A 1XYYA 4NULA 1TO2E 3ZN0A 4I4CA 3SVTA 1WXQA 3I34X 4TKUA 3SX4A 3A31A 4L5AA 4MVJH 3RVLA 1UK6A 4IHJF 1P0PA 1TYBE 4G0XA 5LA6B 3IILA 1EFRD 3ZWMA 3AQ4A 2YS8A 4AF6A 4WACA 5CJ2A 5G02A 3KB6A 1D07A 2Q2VA 4X41A 1PQWA 3V7EA 2WLJA 1TEHA 3OQPA 4TYQA 1KB9F 2ZIZA 3QVKA 5F1PA 5DHSA 3ER8A 3W05A 3U26A 4ZCPA 3V1NA 4JYAB 3CLUD 1IEQA 4L8LA 4FNOA 1RQXA 1EFVA 1U11A 3GFOA 2R60A 1K8AW 5JAMA 5E3HA 3KXLA 2EBOA 4LYJA 1L9KA 4DGQA 5TQJA 3SZMA 1L5VA 4NBUA 2OECA 3AI7A 2DY0A 2JJYA 4ETNA 1L8LA 1D6MA 1RP1A 1QQAA 1PXWA 1J9GA 2VP5A 2HVJC 1Z0IA 5AKZA 2P3QA 4MVCA 3ZIAA 2OTCA 3R0PA 1DADA 1Q0LA 1KJQA 3B48A 4KFUA 4PHZA 1JHDA 1ZL0A 2JGMA 1DCKA 1AJNA 1E6UA 2P77A 4GDMA 4B8ZA 4RGVA 4EFBA 3QLUC 1IBMO 1DSSG 3EF0A 1O97D 2PM8A 4GAEA 5E4YA 4DV5O 2W6CX 1J5EO 5C5EA 2P9BA 5LPNA 5D1HA 1B8NA 4UQPA 4UB8Z 2OCPA 1H5UA 4WJZA 5KSZA 2H4JA 3WK6A 1DC4A 5ALTA 3L6DA 4M0LA 3AY7A 1XTQA 1QO7A 1JMYA 2PTGA 5T6MA 5C8ZA 2DYSC 3CMCO 1IOZA 2RHRA 3M1YA 3QFFA 5JAUA 4FWBA 4H0NA 3WYCA 2Z2JA 3V8QA 3ZE9A 1W87A 1WWKA 3WIEA 2OEPA 3AT1A 3UXEA 5GINE 1UWCA 1K7CA 3ODGA 1FYWA 3DZFA 4C7OB 2QDKA 1DF5A 2GYYA 2QUIA 3C7DB 3DYBA 1RIIA 4GMHA 2QW0X 4O3FA 3EDYA 2DFVA 4BLRA 4DR3B 4XX0A 1T1IA 3OOHA 5B7QA 5INTA 2WE7A 2A1IA 3GFSA 1E5DA 1UH5A 3R3XA 1Q90D 3UENA 1QH9A 1XU7A 3M99B 4L85A 3JCUZ 1HORA 1OFIA 4BATA 3L9DA 2AC4A 3B40A 2F4NA 3EB9A 4X20A 1RXIA 3LSYA 2EJ7A 4N39A 2ODEA 1A2OA 5TPZA 3HXLA 2ILMA 2ID4A 2AFHE 3P5BA 1BFKA 2JK0A 2WAAA 3T94A 4PC3A 3WTCA 4DV2B 1YIAA 4JVSB 4ZOQI 5ESWA 1A95A 1YR7A 3H5OA 1O94C 1YMVA 3ICEA 1L5SA 4XE5A 2K1EA 4YQYA 4M83A 4FDLA 3Q87B 4RPHA 2GZMA 5L53A 2J09A 4A5UB 1U28A 2H1LA 4MMZB 3I1JA 2G1AA 2LTAA 5CMUA 2ZWVA 2DB3A 3JAKB 4CKEB 4FU0A 4LYYA 3QY0A 1GAQA 2JFUA 5J23A 1ULTA 1SVWA 2WSYB 1ZM9A 1IZ3A 3S06A 1QLWA 2VYCA 3QEKA 4KQMA 4B6EA 1DDOA 4D42A 5B3SB 4RKWA 3WS7A 3U3JA 2OCIA 4LHZA 4R7TA 4DWVA 5ALNA 4ZEXA 1U99A 2FTKE 1NVEA 2Z2YA 2P11A 3C3JA 2JIRA 4WCDA 2OQRA 2ZWIA 5F1OA 3EEBA 1ESDA 3U56A 1WL8A 4B3MB 4N8SA 4GNKA 1XTUA 2VPIA 4NATA 2IDJA 3O3OB 2GF0A 4UVDA 4BCCA 4GPZA 4DG8A 2MINA 3NB0A 1HE1C 1KI7A 4EO9A 3CW2A 1WRBA 5CTJA 3RVPA 3GFTA 4ZA2A 3EJWA 4AQYO 5AOVA 3S8YA 4I6JA 4TRRA 1D2HA 4MA5A 4JCOA 2GN9A 4IGIA 4UPDA 3PHHA 5IXJA 1XREA 4M9RA 1E63A 1OH6A 2C82A 5AOBA 1JH9A 1QS0A 1XU4A 1N2XA 2KLHA 3S0JA 1HP8A 1LU9A 1ZJJA 1WVGA 3WMXA 4A23A 3HDQA 4KUGA 3BFPA 4OXRA 3C2QA 2QP3A 1Z6XA 1H0HA 4K28A 4D9BA 2CXQA 3ULKA 2QZPA 4FHEA 1QU3A 4WCFC 1W2BU 2GPAA 4CS3A 4BT6A 3ZJTA 1U28C 4TQ9A 2E5LB 3V3KA 3R7LA 5DEOA 1N36B 1IURA 2WJIA 2H54A 4EHBA 4HRVA 2PHZA 4JUAA 1CZRA 1XE3A 4ZYXA 4WZAB 1VKRA 3DKPA 3GLGE 4H33A 1XHZA 3SX2A 2PKRA 1W4ZA 3BMOA 4JGBA 1QBKC 4QBIA 4P5PA 2J5XA 2WU1A 3WGLA 3JYLA 1S8OA 3X2SA 4J0KA 2E4UA 3WL3A 1JDNA 2PT5A 2J5BA 2WSLA 3QNWA 4YRAA 1R6KA 2ZS9A 2R7KA 1GUYA 4DR1O 3HR7A 3M5CA 4W63A 3VU0A 3ZHRA 3I9FA 4LVNA 4X44A 2B98A 1NIPA 3Q3GE 1QFMA 2ZNIA 5DO9A 5IUNC 2BT4A 1PT9A 5CPFA 4H7PA 4LK2A 1VQ5V 1P4HA 3OC0A 2L19A 2FFQA 4AMZA 5JJCA 1AB6A 1FRNA 2Y93A 5DM1A 5DNDA 4FB4A 1TUEA 3TBFA 1ZCFA 3RPEA 3HWUA 2QMUA 3VQWA 4HEHA 4ND8B 1Z6AA 1YB1A 5B58C 3NYWA 3KP1A 2CXTA 4E12A 3NAMA 1CLIA 5KHGA 3I9LA 1HT2E 5FBHA 2AG8A 5D6OA 3U4DA 3M6FA 1VBMA 2CDAA 5E9AA 3ZHOA 5A4DA 4IOLA 1E58A 2RBKA 1KEPA 2VG8A 3TQIA 3I53A 4LGMA 4FS8A 5E7QA 3SDBA 3FMOB 5AO9A 5EXEA 4Q00A 1JEYB 4IDCA 3K0SA 2RAPA 3GMSA 4R83A 4F6RA 4RSGA 2ADOA 2F48A 5AUOB 4PV7A 1FNKA 4K86A 1DBVO 2OO5C 1TQ2A 1VXRA 5A4IS 4Y67A 5GJWC 3W5VA 3RT9A 4DM7A 4D8TA 1ZVMA 2WIKA 3P0FA 3Q7PA 4OUDB 4JP1A 2NYRA 5IDQA 4NFHA 3FKQA 3HS3A 1OAKA 2GV9A 3N7TA 4HKTA 2PMBA 1EUDA 3GT4A 4MV8A 1KKCA 1M73E 3PFKA 3K15A 2YDXA 2D5BA 3KETA 2FFHA 1GK9A 5JJ5A 4UEWA 3HXTA 3C48A 1T3TA 4RQUA 3H5TA 4RUFA 4I5GA 2UVQA 1J99A 1SBYA 4AKHA 5EK0A 4XYBA 5KTNA 5J5VA 4N01A 4Y1RB 5LLDA 4Q1EA 1GDHA 2YCBA 3WSVA 4HG2A 1FDSA 5IDVA 1CUBA 2HHHO 5JD4A 2I2CA 5H70A 4MV4A 3WIOA 1G8KA 2ASEA 4JTCB 4R1QA 1MV8A 2I8LA 5HXUA 5GIPC 1P2FA 1TD9A 4WHMA 4EEKA 3V1YA 1Y8AA 2PUTA 4MDFA 3LLSA 2GK4A 2PGDA 3SPIA 2HMAA 3K9HA 1M6YA 1FQKA 5HP8A 1DOAA 4DIFA 3KQMA 3AZPA 2MU1A 2B5VA 3ZRWA 2CNWD 3AG6A 2ZE7A 1ECCA 4RJKA 4UBOA 3WKDA 1HRDA 5IAGA 4PIPA 1R0YA 4LE2A 4JY7A 1XZNA 4EUEA 3NK7A 3I5DA 1CYEA 1H2NA 4PQFA 1EFAA 2W0MA 4R7CA 1ULSA 3R76A 1AROP 3TO5A 2WF6A 3K59A 3BORA 2ZI6A 3IPRA 3I72A 2IEAA 1SHLA 2XUAA 1YQQA 3L8YA 1D7OA 2V6JA 2HRRA 4I5EA 4DLUA 3EEOA 4MGYR 4YRQA 3VPFA 3U81A 5DCYA 2WINI 3PEFA 1SGWA 2YXZA 1T3SA 4Z1MG 1RMQA 4L51A 2OTLV 1VL1A 2PANA 1SHTX 2O7VA 1EUYA 5FOQA 3FNEA 2KBFA 2RKBA 4LDZA 1E5VA 4UU8A 4CGYA 4RPLA 1UDAA 2RJ3A 2NU9A 4JVOA 3I5AA 4HGYA 1QP0A 5EBMC 2I1WA 3CNEA 2H2FA 5KYWA 3PC6A 1PGPA 3PEYA 1YV9A 1RM1C 3DP7A 4I0WB 5IF9A 3JQAA 5DBEX 3VU9A 3O8DA 1Y1RA 3EUWA 3ZN1A 1AV6A 5GWXA 1ISPA 1H2XA 1ULAA 4YMVA 1KP2A 4YY3B 4J1SA 4KXXA 1QMGA 3DDNA 2H4HA 4BMSA 2UUBO 2GDZA 1EVJA 4WNYA 2HBQA 3TL3A 5IKEA 1UXKA 3HDYA 4DUYO 5HS4A 4JBIA 1Z39A 4HEA1 1RXYA 5JBNA 5IVIA 2R8BA 2QRHA 4PQGA 5KWIA 3E3MA 2DLNA 4QPCA 5JC1A 1HNXB 3V8BA 3H84A 2BGRA 5DLPA 4OLJA 3M83A 4FYWA 3JQQA 4LXGA 1T1SA 4RE6A 3BD6A 3SYPA 3K30A 1YR6A 2AQKA 3IE0A 5BSMA 1K06A 4CHGA 2HF7A 3RSCA 4MKRA 3IUPA 2R97A 2E6KA 4C20A 2H4FA 1OKKD 4Z1MA 4YMUA 5EINA 3G5MA 4UUPA 2FL4A 1GDDA 2IUUA 3KAPA 1WA8A 5EUCA 3D3KA 3TKAA 2QRLA 3CEAA 2NN4A 4H31A 2OGWA 5IC4A 1P6QA 4O4LB 1U6KA 4QUGA 1CUFA 1J2TA 1XLTA 3IUSA 5K4HA 3R3WA 4YX9A 2K7FA 3NDPA 1QK4A 1GUFA 5A2QA 4B2LA 3CCFA 4MS1B 4LFAB 4E2LA 1CUSA 3ZLTA 2D2CB 5JOQA 2H5LA 5LMZA 4FLXA 2ZSUA 4QUKA 4UEJA 3BX1A 3MW8A 2C2AA 4MHTA 2C5EA 4EIWA 1SIOA 2A0LA 4WKPA 5FAKA 5TLSA 1X42A 1YB2A 3IPXA 4AJHA 4W99A 2D13A 4LV8B 4GKVA 2R9AA 1E89A 3SLKA 4S1NA 1PJTA 3GLFB 2HCTA 2I65A 3IR9A 4LFBO 3VPGA 1FDUA 1MO6A 3FYUB 1XMOO 4IFTA 3RAFC 3KQPA 3IC5A 4XWGA 1JR9A 4IDNA 2V7QG 3EYAA 4CHTA 3R40A 4XWKA 4OBXA 5LQAA 4QDKA 2PZKA 5BSUA 2P69A 4PIMA 2PXCA 1Z4OA 2EINC 2L42A 2AV6A 4KH0A 4DLNA 1UBEA 2BH9A 3W6UA 3GYBA 4BWVA 2XITA 4QQNA 3WGNA 2OG2A 1N2JA 5AI9A 5B1IA 4IILA 3BTUA 3SJBA 1DRJA 3D2LA 3GGPA 3LUTB 3IKTA 4LRSB 4UCXA 4B09A 1E7MA 5U1PA 1MIHA 1P75A 1BE6A 3NIDB 2YVAA 4KDCA 3PFFA 2WU3A 4A0SA 3I1YA 2D3OW 2Y66A 1I1OA 1Q3TA 2EKDA 3B12A 5DRTA 2OMEA 4LFCO 2OAGA 3C3KA 4QPNA 5CYFA 3NONA 5FUXA 2NX2A 2AJ8A 3H9VA 4FFRA 1B00A 3VKHA 3A7EA 5A0TA 3OQHA 3R9IA 1EHIA 3CCVV 2O2DA 4LDPA 2Y1KA 4BNKA 1XLTC 4EHKA 1GGKA 2EJRA 9ABPA 3KPUA 1PKEA 1OASA 5K8UA 1V5FA 4ITVA 3BWVA 1J0DA 3D4IA 1IONA 2ZM5A 3MD0A 2V7QA 3NIBA 4ND4A 3ODPA 2P0YA 5B30A 5NLLA 4B3BA 3LF2A 4G4SP 1TJNA 1N2CE 3IPYA 2P2YA 1KYQA 4KE9A 1RC0A 2ODPA 4HDMB 4BKQA 3KD3A 4FOPA 2YN0A 1CR2A 2ZR0A 4TMXA 4EFLA 5KZMB 3GT0A 1TE2A 3RYIA 3O0TA 4EFKA 3VDNB 2QAGB 4FFPA 4XRGA 4FVMA 4RFLA 4F6CA 5EERA 1TVKA 1MX1A 3U80A 3KYBA 2ZUSA 4XM1A 4DPMA 4JL8A 3H11A 4GQAA 4P6VF 2EFJA 1W73A 2OAEA 3S1LA 1ADCA 3W3AH 4IQGA 2ZSIA 3VH4A 5FL7D 1D1TA 4IJUA 1PVVA 1IDSA 3CWCA 1SQXH 3APQA 4FZVA 3LA6A 3CJRA 3K8OE 1TECE 4TV8B 3M4YA 1W29A 4NR1A 2ZVZA 2QRPA 3DSQA 4Q4AB 5EIBD 5AM5A 4HV4A 1XNRO 1U0RA 3CJTA 4NJEA 4LY6A 1SEPA 3L8MA 3H1GA 3JQBA 4LF8B 2PUBA 4L6CA 3LIIA 1TKBA 4MUXA 4JI1B 3O75A 4YJGA 1R4NB 2NPFA 1K34A 4JJ4A 3G7SA 5TS2A 1EK2A 2UAGA 3KM0A 2EBWA 1YGYA 3QLTA 3P4YA 3RC3A 2L0XA 4JT8A 3CPJB 3BHNA 1HTWA 4UE2A 4PXSA 2VH1A 2QUJA 1VPLA 1PNLA 3A6GA 3CYFA 4QQKA 1GRVA 3RVDA 3TR5A 3MBIA 1N9GA 2XYPA 2XDAA 5KYKA 5MN5A 1P61B 4YGYA 3G89A 3KS9A 4CM6A 5LQNA 2H3HA 1MO2A 1YNOA 1DGQA 2BCCH 3SZUA 2XNJA 5LMNO 3EEIA 2H9AA 3U31A 1FPQA 4GMFA 4ND7A 1QO0D 2WDZA 2YVKA 1EFCA 4BT7A 3I2HA 2XTMA 3ZHUA 3LFHA 3QE2A 2GZAA 2NIPA 4R2KA 3P2YA 1TW2A 2DPMA 2Q0AA 3HI4A 5HQ3A 4YYZA 4BJ5A 3CCSF 4QFCA 3ZBTA 3BWXA 4ESHA 1A5BB 3HA7A 2XLBA 3QZUA 3FTDA 1C9MA 1R10A 3BICA 3LKBA 3AL2A 2BM8A 4R2XA 2ZIGA 3SE0A 1E3MA 2IBTA 4RVHA 4M0DA 3KQVA 2EC5A 3K7EA 2F00A 2XNDG 5BSWA 3DCIA 1XTTA 4JU9A 1GEEA 4Z4EA 4H18A 4DF3A 5KTYA 5L3SA 2O5EA 1GTMA 3RAJA 3WOHA 5JDCA 1UZAA 3SVZA 5KHKA 4D5GA 3IFSA 1RBQA 4IIXA 4PLVA 1KK2A 3AMVA 2UUPA 4BYMA 2GA8A 1FFEA 4V0KA 3NOVA 2HF9A 4NBSA 1OFTA 1SVMA 1ZD9A 1V4VA 3OLQA 3AB8A 4XQ0A 3QMMA 5AKHA 2GBOA 3KJNA 5JY6A 4PXYA 2FZWA 3DDUA 2P6RA 3QU9A 2ILTA 3ZGZA 5B1SA 4HGOA 2AFVA 3GZ4A 1L6RA 4FYJA 1G20E 1T4BA 3VYWA 3OFSA 1ZCZA 1KQOA 4RACA 1NI4A 3CZCA 3HJAA 3V8NA 1X7WA 2KX7A 3A2KA 4HFRA 4QJIA 4G09A 3M9WA 4GRAA 5FFFA 2F3TA 1F0KA 4LR3A 2Z0AA 4PFQA 2IZ7A 2X42A 4BNYA 3KZNA 4WUTA 4B7XA 2OUKA 5FTMA 3JATB 3AW8A 3IT2A 3ZDRA 2XNDA 3LXXA 1GTZA 2ZBEA 3OZWA 5B12A 4WK0B 1ZH4A 2FETA 1B3QA 1FE8A 1UBJS 4E51A 3ZDDA 5LC1A 1CS4C 4G4IA 1L8AA 3RIXA 1NQAO 1FF9A 1YS7A 2Q5EA 3T5GA 5TGTA 1Q1EA 5EJ9A 2IW5A 4D99A 1QTQA 2FEOA 1AU9A 4L6AA 1YCIA 5L3FA 1T91A 5FWYB 3JARB 3SZ3A 3IOBA 5AP9A 4JFAA 2VDWA 3CUWA 1OUMA 3WJRA 3AL3A 4X65O 3R20A 1OV9A 2JNBA 5EFZA 2H17A 2Q62A 1NRIA 3RS9A 1GU7A 5FI0B 4L5IA 1SD1A 3TUJC 5GONB 3CR3C 2DE0X 1D2RA 3ENVA 4L5YA 1VQLF 4BVTA 5JSZA 5B1NA 3STVA 4MVJM 2JDID 4MPTA 5G4KB 4NHOA 3PNSA 1NVPB 1KDRA 5M04A 2FQXA 5K0CA 4N5MA 2JFNA 5EO3A 3W2GA 2HK7A 4BVHA 1ZK1A 3B7WA 2NO1A 2G38A 4KJXA 2BHTA 4L4UA 2QWXA 2WYIA 4MARA 1VJ5A 1RCTE 3QBEA 4C2AA 5KOYA 4BLQA 1QGZA 1T8SA 2VO1A 4X5OA 3JAWA 1F60A 1FX0A 1UBUS 4M7RA 2G70A 1U1CA 2AVDA 5KJCA 1U8FO 2HDWA 3RDPA 1SCBA 3UA4A 3CCMF 3A2FA 1SUCA 4RF2A 1TAEA 4BLTA 5H83A 2CSXA 1XP5A 3ESCA 4HCJA 4BLWA 1JJAA 2B4KA 1J90A 2WIAA 4EGFA 1ZXBA 3ER6A 2OGSA 1XA3A 4NY1A 2XMRA 1ICIA 3LF1A 4ZVRA 1IRXA 4K8RB 4K1XA 3DQPA 4Y2JA 3U3ZA 2F3UA 4OV6B 3GJYA 4WFQA 3NRBA 2F4VB 2BFDA 1SB8A 3HB4X 5A3SA 5AK0A 1LPMA 2CHTA 1N1DA 1KQNA 1RJWA 4O4HB 4A82A 2XBMA 4P86A 4ZIRA 1E94E 1G4YB 2OFWA 5KTOA 4ER0A 4MUGA 1R1MA 5IE9A 3K04A 4LW8A 4CS4A 5IJ9B 2H2IA 1OBOA 5FFMA 2D0PB 1TPZA 2AJLI 4B4OA 3T1HB 2XMCA 2X22A 4HWPA 2VWJA 2H1CA 2WVAA 4FGKA 5C1DA 4CM7A 4UM9D 3N8IA 3HBMA 4ZQFA 1CJBA 2BMJA 3ZTTA 1IK6A 2ORIA 2B1QA 1PNKA 1I4WA 3BGIA 4LY9A 2OBXA 1N0HA 1AIPA 3EDRA 4YONB 3G2NA 3AY6A 3HYSA 4BFCA 3IHKA 1D2DA 5LGUA 4P33A 1WXEA 2GBFA 2AW5A 4AWXA 4P82A 2V0NA 4W4LA 3DQQA 3WB9A 2QW8A 4JV5B 3CRQA 1PJSA 1BAPA 2Y4TA 2Y48A 2AN1A 2KSQA 4PSDA 1FTYA 4N3GA 1GPKA 4EGSA 2HSWA 4PFKA 2HJ9A 1NKDA 3GLHB 2FQ1A 4RV4A 1A4RA 5MFPA 6ADHA 3AESA 1ZESA 3SBOA 1NLZA 4IEEA 1EFLA 3C39A 1LBHA 2WWIA 3COSA 3K03A 2PMPA 2DHCA 3WKBA 1QGED 1Q0QA 4JIGA 3H1LH 3ET5A 2IODA 2OLKA 1MEJA 4BFXA 1FY2A 3ZDCA 5JJLA 3L0SA 1D9XA 4MULA 3ELYA 3QVSA 1P31A 1SVSA 2PF4E 4AG3A 2VYVD 4L95C 4P3PA 1G1AA 4HNGA 1XZHA 4IVQA 1G8HA 2JKZA 2WMYA 4RTNA 5CDSA 2YZGA 1AGXA 5HFMA 4S0XA 1JB1A 2AD1A 3O8OA 4C0KA 2HI0A 4HX5A 1CUZA 1YS4A 4XVUA 4NKGB 5CYOA 4BMDA 3SP1A 3FWZA 2E0IA 4I1PA 4PNPA 3UJPA 4INJA 4C08A 3QRWA 1UFQA 3K1AB 2AI3A 2NAPA 1ENPA 5JROA 5DOVA 1MDBA 4ESEA 3TE7A 1JIXA 4XPZA 3X1DA 4Z9FA 4GI7A 1B6RA 3EMVA 2FH5B 4IEFB 4WPGA 5HCIA 3QO5A 2J6BA 3EIUA 3B38A 3CCBA 2VEOA 4Z7NB 2AYYA 2UUAB 3FNHA 3E8MA 5CA1A 3RKSA 1NIJA 1Q43A 1L7MA 1CTQA 2WLIB 1JRLA 5H8WA 2XGJA 3DVLA 1E6LA 1ZN7A 1PJ2A 4GD3Q 2PWPA 5FI5A 2UYNB 1I6MA 3SXJA 2MYTA 2WICA 1WNFA 3G23A 3P94A 3DUWA 4B3SO 3IKMB 2FG7C 1YAJA 1WZ2A 3BDVA 4AECA 1FTNA 1KEZA 3H2ZA 1D2MA 3OF5A 2R1VB 1V3TA 3QP9A 4LWPA 4RPJA 2AN3A 1P9WA 3Q9LA 2CHGA 4XD7A 1DJOA 2Q3LA 5DJ5A 1BMDA 2HYDA 3KLNA 1VMGA 2A0YA 3U6KA 2X9NA 1H8ED 4MV7A 4PAWA 2IHUA 1ND5A 3OIFA 3TSYA 3HKDB 2D2FA 3C15C 5KTRA 4EZIA 3AXSA 3ZIUA 2NUAB 2D3WA 2JAXA 4X3PA 1Q57A 4OPMA 1TZJA 2JGAA 3BOSA 1C29B 2OSVA 3PUXA 3UGQA 1JNYA 1QCZA 3SS8A 4KL8S 4EI8A 4IXMA 1LI7A 5FPYA 4X45A 2RGBA 4BLUA 2X8BA 2XCSB 3IMFA 3AG1B 2C96A 4CV0A 4LPKA 3ZMSA 4BIIA 2GZSA 1XXLA 1Z45A 2J9ZB 5B2EA 3KKZA 4D4JA 3QFHA 2ZCEA 1LQUA 3ETNA 2EG5A 4PBSA 3VR5H 2COEA 5DYIA 3HCWA 2JJ2G 1Q1NA 2ATXA 3H9QA 3NR2A 3ABQB 5EJGA 3T2MA 2AT1A 5FJ4C 5I4BA 3LWDA 1CY8A 2PI5A 3OO1A 5C8VA 3MYYA 2H8KA 4UUNA 1UBLS 5KVSA 4QIHA 3FZNA 1CN7A 2C2XA 5EIEA 4BQIA 2OK7A 2CVPA 2XDQB 2I22A 4CFYA 2JB9A 2HBYA 2SECE 1K88A 3D3NA 2Q4RA 3EJ6A 5B53A 4IW3B 4O02B 3BMCA 5KSPA 3GCXA 4MYDA 4MRPA 5KSYA 1NT2B 3AKYA 3DL2A 5CIWA 3TI9A 1V37A 3EVAA 4NXMB 1Z33A 2P6YA 4KAJA 4DILA 5HKKA 4PZEA 4BBJA 2VSXA 1CK2A 1T2AA 3OP1A 1UFYA 3WIBA 3NVAA 2VK2A 4G8CA 5LUBA 4PA6A 3EVNA 1PK8A 3UK1A 2FN3A 4ENPA 4W1QA 4MUNA 4PC2A 4I50F 1LWNA 3BE6A 1IV3A 2VJDA 3B70A 2FWRA 1QF9A 1WDTA 3MMXA 5BUCA 3A4VA 4AJPA 1E2FA 2JJ2A 2FKXA 4ECAA 2X6TA 1QYWA 3KQTA 6Q21A 2BISA 4FGLA 2X9QA 1X7DA 1D3AA 2HUPA 1EH5A 1ESEA 3FYIB 2AX3A 4NCBA 4Y9DA 3U5ZB 2EAUA 3JQ9A 1GL9B 1O9BA 1U65A 1UMBA 3EG5A 4NARA 1E4VA 2KG7A 4PZCA 4GOKA 3TTVA 3V00A 3WI7A 1GPUA 5DOZA 1LRKA 2FZVA 4ARBA 3THYB 4M1SA 3DFZA 3EXEB 1IQ0A 2YUIA 3EQ6A 1SZQA 2Z1TA 3L04A 3DC2A 1IQRA 1OI4A 2Y76A 3OOJA 4I9NA 1NLFA 3MAAC 2HA0A 4QHTA 2H08A 4O59O 1XT6A 2P2GA 4CF6A 3KUCA 2RJZA 2BZGA 4TKVA 1XNJA 4RNCA 2HMSA 4ZCLA 1BMFG 1IB0A 1Y81A 4WASA 3C85A 4WNCA 2XAAA 3KE9A 5TARA 1VLJA 4XB6B 2YWRA 3Q8HA 2RBGA 4K9KA 4RZHA 1G291 3QXXA 2DYRB 4B8WA 3RFUA 2ZUBA 4BDSA 1VP3A 3STUA 4QNNA 5KNDA 4US1R 1JTFA 1XR3A 1R9JA 4TWJA 5IEBA 4OX9B 2OQIA 3A11A 3WMGA 5D01A 4ZGGA 4ZEVA 1GGJA 2IHYA 5GOZA 1GZ0A 1ZMBA 1XF1A 3KAQA 3SEZA 3C4JA 3VVBA 1GGVA 1VP9A 1XL4A 5IS2A 2RHBA 3V9PA 4JJGA 4RQFA 3A0HZ 1M56C 4DC1A 1P2UA 3ZV6A 4H7DA 5K8TA 3ROXA 5KVCA 2X6AA 4Y0VA 1II8B 2XD4A 4KO3S 4LWZA 1M6VA 5IY5B 1K66A 1T1JA 1JBKA 2G8NA 2E3CA 1KFKB 4V0MA 2WALA 3FFXA 1JEQB 3C8ZA 3CY6A 3WSTA 2GKGA 2BGTA 3HU5A 2XUHA 1G6OA 1Q1GA 2FY8A 4JJKA 2P30A 3GAFA 3EMDA 1GO3F 1BMFA 3UPTA 2HS3A 4D9CA 4ZYYA 3C5CA 1DT5A 1Z25A 1FSSA 1VKOA 4DC0A 2UXBB 1DJMA 4B9AA 3E15A 4QTUB 1KRWA 4I3HA 3DT8A 3TQCA 4I9HA 1K68A 3UTCA 3ZK7A 1Y1LA 1VQ5F 1MB4A 3PD7A 3CMEV 4E11A 2IP1A 5IAJA 4P2ZA 2YY5A 4TLCA 3OJLA 1EGMB 3U7JA 3CLTD 3LXRA 2NTVA 1WHTB 4GC9A 3VZBA 4X97A 3WGVA 3D7KA 3L8CA 4RMJA 4HBZA 5D8DA 5KBYA 1PHRA 2UZ4A 3CS5A 5E6RA 1W5EA 2W6QA 4G5YA 1LDMA 3PHCA 4KZKA 3PP8A 4FYXA 1S1CA 4HDKA 2MYPA 1SVNA 1HNNA 3T7TA 3I8OA 3ZDQA 5K0TA 4RTPA 3V8PA 1V2HE 3OECA 2FUKA 4Q48A 2FLKA 2ZLBA 4EQ6B 2O7QA 2JJMA 1YE3A 5AXDA 4H3SA 3I6MA 3H4IA 1EZ1A 1K73W 3BJIC 3OZSA 3ZXIA 1XGKA 2H3EA 4YN3A 2GPSA 1LUVA 4EGJA 2VNAA 5IYZA 4EB0A 2QI9C 4QD3A 1MN6A 2O5CA 4RDXA 3DFFA 3PL5A 1P62B 3OX2A 4ZMBA 1HFJA 1N4CA 1C1DA 4P9OA 2ODNA 3H65A 4EZEA 2PGAA 3FRIA 3C8DA 3EODA 4Y6QA 1FFWA 1KI9A 2X76A 4EELA 1XKTA 3KJIA 5I47A 3E8XA 3KOWA 1E2UA 3EGXA 3HKBB 3A0RB 2UUCB 2Q28A 2PRSA 5T64A 3QWBA 4QHSA 5HF6A 3G8YA 2P9TA 1N9KA 2NU8A 1QFYA 3DGFC 1RE0A 4LYHA 5EWJB 3OZXA 1E1NA 1FYVA 2CVLA 2O8BB 4BFUA 3MRVA 3LZCA 1NP7A 4IGKA 4K9QA 5E1MA 1N0UA 1HYQA 5JPCA 1C7FA 2MYUA 1Q7EA 2X0EA 1M0TA 1L5WA 2REBA 1SZXA 3DEIA 1Q15A 1E3LA 1MOPA 3JQGA 3F6SA 4LVCA 5JLAA 2HFKA 3FPGA 2WF5A 2DHDA 1FP4A 3L84A 3IH5A 4B5KA 3LPMA 3BAZA 5KCMA 3QMVA 3A04A 4RETA 2VRNA 2X23A 1AJEA 4WLVA 3LNTA 1SETA 1DT3A 2CFRA 2VP3A 1E6KA 4FE7A 4GLXA 4UJ3A 3M5PA 2ZFUA 1U7UA 3LMKA 4ZVLA 4FFMA 1SIUA 4RSMA 2J4FA 2P7TC 4EFDA 1KEWA 1M5UA 4ZC8A 3ESAA 3SXPA 2RGNA 1H94A 2I55A 2R6FA 1BE0A 4MHOA 1K3UB 5H81A 3AJ9A 3TM4A 4ZDWA 2CZQA 3LLMA 1QB8A 4WV3A 1BMTA 1G63A 4FFSA 3THSA 4LP8A 4WLOA 4NABA 1P7YA 1EVYA 1PWXA 4GNRA 3KD2A 1SXJD 2ZM6B 2ZJ6A 4QUAA 3NV9A 2W6JG 3DHNA 4MJ7A 2OTLF 1VL6A 4HP8A 2WLKA 4TM8A 2IZ1A 1UODA 3V34A 3HU1A 1W36C 4FGSA 2QRKA 4KO4S 4G5RA 5H5NA 5CA0B 4AXXA 4LZAA 2QGNA 3FYSA 4UCTA 4WESB 1DAFA 4KBYA 1R4MA 4FN4A 1WD5A 2JGDA 4MA0A 2GPBA 1FW8A 2WFAA 4ZK6A 2R6R1 4QAJA 4KOEC 1Y6GA 2NZXA 2QTRA 1F2VA 2IXTA 3BBPA 5B1OA 3ZJYA 3E5RA 4OQEA 4N40A 3FCCA 4MRMB 2XIQA 3A6PC 1G64A 1C14A 2ETVA 3N2IA 2AFIE 1NQ3A 3R8FA 1PLLA 4GP7A 4XEUA 3EA5A 1UZUA 1MHPA 3DLCA 1FMCA 1GL7A 2X40A 3NHUA 2YQZA 1HT3A 2W58A 3NANA 1AI4A 2FRVA 2RGNC 3G85A 1KGDA 2GYVA 3QWFA 3UKMA 3ADBA 4WKGA 4CT0A 2IC5A 4ND6A 2BR4A 2W6JA 4FONA 2GF2A 1YH3A 4YJHB 3K0HA 1QRTA 4Z0PA 4U39A 2A5YB 1PJ4A 3GZTB 2P9FA 4CI9A 4NCAA 3O91A 1HEIA 4GKBA 2UXCB 4EUSA 1RJFA 5DLYA 4L73A 2BW0A 1Y3CE 2PBZA 1NMQA 1WJGA 3TLYA 2EIMC 1CBUA 1X7ZA 4ETMA 4EW3A 2JC3A 1J0XO 3P2IA 3QLJA 5FNVB 3H5AA 3LDTA 1K6MA 3AYZB 1GY8A 1WY5A 1PEAA 3TW6A 1ZL2A 1HOTA 3TLGB 4AUKA 2HADA 2IH5A 3W4IA 1T8WA 3EHBB 3EQ8A 2BOVA 5DYTA 2ZU6A 1JHPA 4JX8A 4IMPA 3W4KA 1JJIA 2JIDA 4HNAA 4IJKA 1BXKA 4DR2O 4FIPC 3AEKA 3ML1A 2ACWA 1E6CA 2P3OA 3KEFA 2M6SA 1WW3A 2C3MA 1I4LD 1EN5A 3JR7A 1TQHA 2BP7B 3G1UA 1EU1A 2G80A 2AVNA 5JNWA 4WL0A 1ROPA 4PONA 3UWPA 3WLRA 2NO5A 4NBNA 3V2IA 4A3SA 4ASUG 2FP4A 6REQA 2OHGA 2QRNA 1NNUA 4GZLA 1XRQA 2AW9A 2Y69B 3N0WA 2O6HA 3OWXA 1RAEA 4PTYA 4FHGA 3D3EA 3IVMA 4MIEA 1T2DA 5BVGA 4D4LA 1Y1KE 4Q16A 1FL9A 3AYXB 3CCVF 2Z1DA 2J30A 2PVSA 4OQPA 3EUEA 4NAVA 1S6YA 2WSBA 4AKSA 4YRIA 4BIZA 4MCHA 1LW6E 4M99A 1UPAA 3AETA 1Q81W 2MTBA 3NWEA 2HYIC 4MV1A 3WBKA 3W5DA 4IOJA 4MYSA 2P79A 3LVRE 4XCQA 4H2DA 4INZA 4KYVA 2ZAUA 4WJKB 2HXSA 3OZIA 2M6LA 5DXAA 2DETA 2PJDA 2LWIA 4NJMB 1P5ZB 3I05A 1J2RA 5AVQA 1Y37A 1M1KH 4TLLB 3VNQA 2YYEA 2HW8A 3FLMA 4NZYA 3K4HA 4CFZA 3UGTA 3PI6A 4HWSA 3SF8B 2X2FA 4ED9A 4ZVNA 2JNWA 4ASUA 4MV9A 2GRJA 3LCMA 2CH7A 2BFPA 1JHUA 4MS3B 1WLEA 3WL7A 5HIIA 4L76A 2ZRMA 3W9YA 2N75A 3KFLA 1YEWA 2G77B 1PS0A 4BAZA 4QE7A 4BWYA 4UJ5A 1KMHB 3Q5EA 4FC7A 1S8FA 3TZBA 3W6NA 5IM4F 1L8XA 2BGLA 1AP6A 4B3TB 2YJ6A 2CFIA 4LYFA 3LK7A 1Z06A 1KZ4A 2HT1A 2XVYA 1WKCA 3OT1A 4BNUA 1RBMA 5B6JA 3UAZA 1ILWA 2ZYDA 2D2XA 5K0GA 1ZGHA 2VJKA 1RI5A 1JCHA 4BUZA 1NNSA 2GM4A 1QHFA 4M9XA 1U63A 3SD7A 1QRSA 2O2SA 4YJKA 3NTOA 2BR5A 1VSTA 5JR3A 3LHDA 1IX9A 5KYUB 2BFNA 1HBJA 4PY2A 1CDEA 4U7OA 2WAMA 5EHZA 2YXNA 3NYIA 1C7QA 4OHYA 5CJPA 2GPWA 2ZR2A 4MGKR 4LCJA 4CH4A 2JEOA 1XJ0A 1JDSA 1O54A 2YHBA 1J33A 2VZ0A 4A15A 4KPUA 3BJMA 4XEHA 3KTAA 2HRYA 2GLTA 4LDNA 4TRNA 3C14C 5LL6Y 4ZOLB 2NU7B 3BXGA 4TL6A 2RIRA 2ZVPX 1N57A 1QR2A 5H6QA 4C7MA 1Y6RA 3IEUA 3IULA 5HFJA 1GAJA 4F1KA 3RIHA 4W5NA 4NAUA 4QYSA 1P0QA 2Q6LA 1PZMA 1P8AA 3TD3A 3BCHA 5ALFA 4ZTBA 5FR2A 3WMWA 1OHHD 2XUKA 3O3CA 2FWJA 1ZIYA 2MSCB 2P40A 1DWPA 4PC6A 5LYJF 3D6JA 4RY2A 2HMTA 4MQFA 1BCRB 3E22B 4P3KA 3GEEA 4HO1X 4E5UA 5ERXA 5C7YA 5AD1A 2PKWA 1JAYA 3PAFA 1UJ6A 5JT1A 3LCRA 3Q3EA 2OXFA 5JH7F 1G7CA 3IBYA 1ZD8A 3A4IA 2PVCA 3MJRA 4R7GA 3H1EA 3GUCA 1MJGM 5JE8A 4J76A 5I7RA 5K7SA 3P9NA 1RXEA 3JU3A 5JATA 1XVIA 1FK8A 4KQIA 2XOEA 1LVGA 2C9CA 4Y7CA 1M2KA 3MBOA 4MS2A 5ARDA 2NUTB 3LZDA 4A2QA 1LTQA 3M6VA 3FSGD 1Z8HA 4H27A 4GMXA 3WDMA 1SB9A 3CGGA 1CB7A 4JJZA 4X7BA 1DPGA 1KQGA 4EVQA 5I7VA 1ZZGA 1LGYA 1R8YA 3ASNB 5T4FA 1ZG3A 3ANTA 4TROA 4PGAA 3KSRA 3ZWWA 4MI6A 1O08A 4CU5A 3ZWAA 2VTBB 5LB4A 1ZD2P 3B8EA 5DSTA 1A4XA 1TMGE 2VBGA 4NNJA 5GANK 1ZD5A 3MWKA 1R66A 3DDWA 1OTHA 1P1BA 3S81A 3ZI0A 4MTXA 2A3QA 1H1TA 4GLFA 3AVPA 1TU0A 1ONBA 3U3KA 3E2IA 3BA8A 3WFZA 1T9HA 4HQOA 1L3BA 1QZTA 3RLIA 2Q07A 4WNIA 3U1TA 7REQA 4ZYWA 2CEKA 4MW8A 5EL0A 3OZBA 4U7HA 2O1WA 4LJ5A 4GZ3A 5JNTA 3KQOA 2JGNA 4Z4GA 1DGSA 2OGUA 2D5IA 1GZ7A 5BYJA 4CL0A 5L3CA 2NG1A 1AI7A 3K5IA 1G3QA 2B6HA 3DL4A 1U6JA 1X70A 4Z0HO 1ZYUA 4XIIA 2BSAA 1TAQA 3GZNB 1RLTA 3HUFA 2QSUA 4UOZA 3R7BA 1T9AA 3WC4A 1NR5A 5T3YA 2CC2A 1P7VA 3PFGA 1CF4A 2GCGA 2FV8A 1YZGA 1E9VA 1NZJA 4WFIA 1S5JA 2A14A 2RB5A 4PR3A 2XGMA 3HP7A 4DV6B 1CQWA 5C37A 1K97A 5JPIA 1YCGA 4I14A 3TNFA 1XWWA 1QGDA 1ZN2A 1JQ5A 1JDBB 4IF4A 3A9TA 1QD9A 1E6MA 1JEDA 2VJPA 3CCUV 1QR9A 2EILC 2OT3B 3ZHTA 5SY4A 4M6WB 1GL6A 2RSLA 2X7JA 3U40A 3OCWA 3WBJA 2DBQA 2JJ1G 3FPJA 5I7UA 2B4RO 1HXHA 4K6KA 1O87A 4KXWA 3MJDA 1OR8A 5KWEA 4CE6A 1TUIA 2XB2A 4R1MA 4LJRA 2IIBA 3QQ5A 4KI7A 1RLUA 1NJ2A 5J2TB 2X9GA 3VKWA 1D0IA 4XB2A 4EPXA 1OC4A 4LECA 2I7XA 3NBQA 2NO9A 3RU9A 4D8WA 5TF0A 3A27A 3D3IA 4OXYA 3A0UA 4ZV4A 2H59A 1VHQA 4B79A 1JFFA 2C2ZA 3TLJA 4TKMA 4UHEA 2KBEA 1PW7A 2ASVA 2J4DA 4RD3A 1A7JA 3AIIA 3TAHA 3TZHA 1ORIA 3VISA 3KZKA 1P2SA 5C9ZA 4F56A 4I1YA 1Q1QA 3IVGA 2I2WA 3RBVA 2ZZMA 5HWSA 1TT5A 1Z26A 3CEMA 4CQJA 3THXB 3AFNA 2HU8A 3ML0A 3SSAA 1Z6TA 1NFRA 1EMDA 2QR3A 1TO6A 2FW6A 4AQ7A 3N2LA 5KYGA 5KQPA 3OT7A 1V6SA 3WWPA 2JJ1A 1X8KA 4R1NA 1FSFA 3R0JA 3O2JA 2HPZA 4MPJA 1I3LA 4ENRA 5LLTA 1X7HA 4YAJA 2GBLA 3CIFA 2HV9A 3P0IA 2BV3A 1X2EA 5IEJA 2ZKIA 4MUJA 1WB7A 1J2YA 1E3DA 5LZ7A 1KORA 4N6OA 3N2KB 1L7DA 3RYFA 4V1CA 2WLSA 4MP6A 1NQWA 1KS9A 4HZ3A 4B80A 1P84F 1E1QD 1QIDA 2AFHB 3ZWOA 2QJTA 4CLXA 3MCQA 1W8DA 2YY6A 1Z2AA 2A9RA 3GRPA 2IZOA 1G7TA 4OIFA 3WBFA 4UZSA 4XSGA 3TTWA 1ZMOA 5LHGA 1HTBA 4XUDA 2N46A 2ZKLA 3C3XA 1AGRA 2XMSA 3BTVA 4U0KA 4ZAYA 3DD1A 4TXLA 1Y4DE 4YJ2A 3WL8A 1GLGA 1B8PA 1DX9A 3BWMA 4TQDA 1GJRA 1A5ZA 3KHKA 3A6FA 2GCOA 1DCMA 4MRVA 1PSZA 5DX1A 1TXGA 2FPPA 3ROEA 4B4KA 4DQ0A 2BFAA 2QXYA 4LSMA 4ZXPA 1UWLA 4K3AA 2QU8A 1NC3A 4YAKA 4KLRA 4BO5A 3QXSA 2WQ7A 5ITZB 3DZIA 1ZIPA 2GASA 2J1LA 5BT8A 2X0LA 4Z51A 4RS3A 4L8FA 4P3YA 3RIMA 1Z0DA 4EX7A 1FDWA 2Z8ZA 1DTEA 2AF3C 2IU6A 1OLSB 4G2NA 3WRWA 1L7RA 1CHDA 3TXXA 4U9IS 3FWYA 1AN0A 2FLVA 1XZGA 1BYUA 5ECDA 1QF6A 5LIPA 1VQ9V 1TADA 5CT4A 2OC4A 2B1JA 1TCVA 4JI6O 1AKNA 4X1IA 1GNTA 5DNAA 3KT3A 2X4GA 3TE6A 2CZCA 4W5OA 3I5YA 3IJPA 4BY9D 1WY7A 1LEHA 1U2EA 3BIJA 1TEZA 1S7GA 4HAXA 3SJBC 3FKSG 4OXQA 5DBFA 1DVRA 1FTSA 4ZCSA 3IX7A 2QVCA 4RY9A 1NY6A 3K58A 4BMXA 4MKZA 4RY8A 1H8HD 2P9HA 4MYCA 2FVXA 3OZ7A 1M54A 1P0CA 7ABPA 5BW5A 5JVDA 2W6PA 4G4VA 2CHFA 3FAZA 1VIDA 3NM5A 3W5SA 3WGOA 1GRQA 4KFMA 4HN4B 1MV5A 4NPCA 1TQ4A 4QLOA 1XZDA 3WZMA 3TLEA 5DNWA 2V7VA 1N7JA 2WM3A 5KWJA 2X13A 3TSAA 2R11A 3VHQA 3Q2IA 1RWKA 3MGKA 4C03A 3NHWA 3GLGB 3D59A 5EIWA 4BUJA 4A9AA 2QNIA 2MHCA 1I5EA 1X52A 4B2PA 4FXOA 1XLUA 1TB4A 3OF2A 1NVDA 1P9RA 1JBEA 1T4DA 5B64A 4B3IA 1YOVB 3VQTA 3U9TA 4KR3A 3F73A 3OOEA 4B3MO 3IP8A 5HRCA 4YP5A 4MTFA 3TZ6A 1Q6YA 2X2OA 3RS7A 2E7ZA 2ZTUA 3CVOA 1Y3IA 3W3AA 1CY6A 4DCPA 3FKSA 1OU4A 3RRBA 2AN5A 3FMGA 1PJQA 3UAGA 1CEQA 3FZQA 1PR1A 4UATA 1ZD3A 4IXDA 3D9QX 2Q5QA 5EJ4A 5BUZA 1SHZA 2RMKB 4J94A 4BKUA 4H37A 4YMHA 4TT3G 5I7WA 5L9AA 2PD4A 1XPRA 2QTAA 3UNXA 3HM2A 5AXAA 4IL5A 1KBZA 4FHCA 1XCGB 5J2UA 2CMHA 2NU6B 4PZUA 3JQBC 1DMRA 3M7IA 1CZHA 4Q4HB 1N2OA 3O73A 3NEJA 4Q3DA 1YQGA 3MHPA 1I3MA 1SC5B 1RRFA 4Z3DA 2QBYB 2KSDA 1BTOA 1FIUA 1N36O 1HUQA 2KKWA 4MWSA 1IU9A 3PC7A 3NTLA 1ESZA 4TV9B 5L7WA 3EIHA 2H4ZA 1ZTEA 2O7NA 3K5OA 1TK2A 5KJEA 4GOXA 1EHYA 4CQMB 3WQQA 3FBTA 4BQNA 3OSUA 2LFRA 2C5SA 1LBEA 3QITA 4CCAA 1PRYA 1ID8A 2PGIA 4C3OB 3CURA 3CKMA 4UM7A 2A9PA 4UVEA 4E4TA 3EXIB 3R3ZA 3KOXA 2VHTA 3IAM6 2LKCA 3RVBA 5H59A 3KELA 4P3NA 3AU8A 3R65A 3I76A 4TT3A 2J5RA 4KDFA 3E70C 3WG7B 1JKJB 2QWOB 1UXOA 5ALUA 5AI4A 2HA3A 1M8JA 1PBNA 1DLIA 1WUIS 4TTAA 4RVUA 5TF4A 1XNQB 4MUMA 2GCNA 3BN3A 3E89A 2PHNA 1X8JA 5JDCC 4FN5A 5LOVA 4MAAA 3UMFA 1RHRA 2H1VA 3KX2A 4EG5A 4MQ5A 4BUCA 1ZBQA 2PSDA 2OUIA 2ZF8A 3Q9UA 2YSUB 1B0AA 4TXJA 4BMPB 3AG3B 2IF2A 5H3LA 4CV1A 2UYKA 3SLRA 3HRIA 3WKEA 4LDQA 2DKFA 1Y7IA 4LC1A 1WUKS 3KYCA 3LTNC 3VYUC 2PXHA 2ZIXB 5DVZA 4V0RA 4M36A 4HEQA 1NZDA 4BQRA 3AGPA 3NEPX 3PQ3A 5LP6B 3J7AC 4ILEA 4DZTA 3TYXA 4ZK2A 1U7DA 4OB7A 2BFEA 3D8BA 1N8TA 3LDAA 3BTOA 3AVTA 1OWMA 2ZJBA 5DN6D 2W83A 3RVSA 1K4CC 2G88A 1AA9A 4LF7B 2NQ2C 1VRCA 2HXYA 3LBNA 4X66O 2BOCC 4EJ6A 4HDRA 4P7FA 1I01A 3N2GA 2FN7A 1FVHA 1C3OA 5CTAA 4LI0A 1CETA 1L4FA 2DR0A 2Y2UA 3HB5X 4QLBA 5CVCA 3JAKA 2D0IA 3BGWA 2OE2A 1L7EA 1XQ8A 3IIEA 3VR4H 1Z37A 2WWXA 1FPOA 2JZOA 4B34A 4DRXA 3CRNA 3ZPXA 3CMEF 4DCNA 3CMAV 3W6PA 4HLQB 4ZALA 4PYJA 2EYQA 3ERCA 3M1IA 1NVFA 2QJ1A 2YBEA 2YINC 4C0AC 3PQFA 4KH1A 1SA0A 4J07A 4D4MA 4KIFA 3TEJA 4IMIB 1YBFA 4B0OA 5FLEX 3PFHA 4NDAA 3C5VA 3BT7A 3ZY2A 2H1SA 4J2TA 4GKKO 2KQXA 5HR5A 4EAQA 2OB2A 5FHRA 4JOQA 4ZZ3A 3UT0A 2C4HA 2EZ8A 2REQA 2GJ9A 2FPRA 1R9MA 3QE4A 3K35A 4GI1A 4J16A 3AEQA 5CB4F 3FPEA 4U7FA 5JISA 4YRFA 1E3WA 2FMXA 1AX9A 4F9EA 3ABOB 2JH8A 1QE0A 1XQYA 3VJRA 2ZYHA 5HYVA 4KYTA 3WE7A 5J4VA 5FWAA 1D09A 1HDRA 3UG7A 1IK4A 4YT5A 4MIOA 3B1WA 1W46A 3DHEA 2O54A 3C3CA 2CBGA 5BV7A 4QXMA 4DR7B 1I30A 4IYIA 4AZSA 5LB2A 3FB8C 3K9SA 1QV9A 5JHGB 4DR4B 1IY8A 2HU2A 4P58A 5CEFA 3B5JA 2QN6A 3ZV7A 1GTSA 5IPFA 1WP8A 3A4NA 4BX2A 2EIJB 4P9PA 2ATKC 1M7HA 3UM7A 2H3OA 2P9QA 3NP9A 4OI4A 1IDN1 1E79D 3JWIA 1SC1A 5BPFA 5E3IA 2ZE5A 4CLDA 1ZHOA 4DY4A 4EKNB 2NZYA 1KQPA 4JLBA 5JMPA 3RUDA 4U8GA 3RABA 4YY3O 1MORA 1CQJB 1NVMB 3TRJA 5TMPA 1YI0A 1LPNA 1ONPA 2XZOA 1L5MA 2ANCA 3TQSA 1IFXA 3PA6A 1YZLA 4HDOB 3C45A 2GN6A 2B3DA 3LK6A 13PKA 4G9BA 2YOFA 2YZKA 5IFLA 1Q3HA 4JMPA 1QKJA 2FEKA 4G25A 2D6FA 1T34A 3KQWA 5DCWA 3SC4A 1O6FA 1U7OA 2ZRGA 4J16C 3N74A 2EV9A 1A5AB 1VP7A 5GZ1A 3HVJA 3C3WA 3EDOA 3HBNA 4PDMA 3B3QA 3T3HA 3F8SA 5EJ6A 4ZCIA 4MSWC 2XUFA 4BYGA 2LDBA 1EGHA 4IS2A 4PO1A 3IQZA 4I3GA 2QYHA 1LLQA 4M1YA 2XCTB 1P9NA 2ZQZA 2VHEA 2ODWA 3HHEA 2CK3G 2PUVA 1ID1A 5KSOA 5KU1A 4PA3A 1KDZA 3U0OA 3QKSB 4B8YA 1VLHA 3WLEA 3KSBC 5JNSA 1PE0A 1JEYA 4D92A 4KMRA 5GJCA 1EXNA 2IGBA 4TT8A 3V5NA 3KLBA 2NLJC 2BR3A 4NOKA 1CKEA 1UANA 4Y8VA 1WB5A 2J48A 5JNRA 3UMRA 4F04A 2QD3A 5BQFA 2IH1C 1D1QA 2C31A 3D3WB 3CO0S 1PN3A 1GCIA 2ZUTA 5F64A 3J81N 2M6RA 2YEVB 1N3BA 5K0NA 1SCKA 5DM60 1GADO 1N2CB 5I45A 3MAQA 1N34B 2GM3A 3C9RA 1EWKA 3CW9A 1PU2A 2JI7A 4AU1A 2P5YA 1DQSA 3WGIA 2ZTHA 2YV5A 4OREX 1BN7A 1PV1A 2QX9A 1OFUX 2H1HA 3F8TA 3O2QB 5THKA 2QEXV 4E6EA 2WUEA 4ZT2A 2VF8A 2CK3A 4ZV7A 4TS4A 2Z3WA 4E4RA 3JAMM 3PJDA 1XMVA 3Q4HB 2PX8A 3E86A 3BCSA 3H2HA 2ZANA 2P0EA 4G5GA 4HVLA 3B52X 1DAIA 4Y2XA 1PL0A 1OXSC 2HDNB 5BRJA 3OPQA 3CHYA 4Z49A 1X7YB 3O9ZA 3OURA 3U7GA 1YR3A 4IUYA 3AY3A 3OTQA 1BL8A 4YVFA 2W2LA 1KU6A 4R31A 3RAGA 4ZU1X 3PGKA 1J56A 1L7QA 3RVZA 4DJEC 3E82A 4JZYA 2XD9A 4UFOA 3S5UA 3EXG1 1PIWA 1BYIA 4D46A 3AHJA 3ZDXB 1NDQA 1QH1A 1QTNA 3UVEA 4P5EA 4IDEA 3CVWA 1L1EA 2CKMA 3RGBA 5EUMA 1IQUA 4N7RA 3GRCA 1NNEA 1HZZA 4UPVA 2XCQA 2HGSA 1DELA 3PTZA 4DMFA 4NBWA 3I12A 1E2DA 1TAHA 6NULA 4IPTA 2IOHA 2N74A 5SYNA 3PK0A 4CZ2A 3KZMA 1G2PA 1OXXK 1DQPA 1UKEA 4MZDA 4K6HA 5P8WA 1DTOA 3ZWVA 2FCRA 3BVPA 3V4VB 3RHTA 2IXFA 3N8HA 3QYPA 5F21A 4DIMA 3QX9A 3TTXA 3SJZA 1U94A 3MTJA 4PYRA 4LWOA 3ZCTA 4FS3A 5T4BA 3KB2A 1EFUA 2EJUA 1Z16A 4DQDA 2PUWA 1NVGA 1KAOA 4L8VA 3IEVA 3GJTA 1ADGA 3VR5A 4F2WA 1CXZA 1KH2A 5ENZA 4F2GA 4D26A 3DL7A 2C3YA 5LQDA 3LCJA 3LM8A 3OKAA 4BVAA 3KL4A 4EO4A 2GAFA 5EYPA 4R5HA 4UXIA 1PD0A 2TMGA 2Y99A 4YUZA 2CWWA 2B82A 2FZEA 4J0GA 4JZ2A 4BO1A 3CZ4A 4RMIA 5CFOA 3B7GA 3RANA 3MSCA 2CCKA 3G9UA 4CLRB 2RC6A 4QGBA 2P06A 4E70A 2N05A 1EXDA 3H97A 1RWPA 1A98A 2FPWA 3Q6NA 4FPPA 3BKXA 4QDJA 3DB2A 2XHEA 4M2LA 2I8AA 2YMQA 3PVSA 1Z12A 3Q9SA 2H8CA 3GA0A 1KPGA 3D5QA 4CC5A 1RHKA 3CX3A 3E8GA 1G20B 2GTHA 1IHPA 3DLTA 1REQB 2XUJA 4Q9JA 1JPVA 3KNZA 5ELXA 1Z6GA 3PFNA 4IUBS 4BMVA 1RRVA 4MW2A 4PSVA 4TTTS 4BOYA 4MNTA 1AR4A 3GFQA 1E0AA