3JAKB

Cryo-em structure of gtpgammas-microtubule co-polymerized with eb3 (merged dataset with and without kinesin bound)
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
429
structure length
429
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 151
structure length 429
sequence length 429
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jakB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jakB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jakB01
3WGLA 5CB4A 5EYPB 4DRXA 3E22A 5JH7B 3JAWA 3M89A 2VAPA 3E22B 5JH7A 3JARA 4TV9B 5ITZB 5IYZB 3WGKA 5LOVA 2R751 3HKCB 5C8YA 2VAMA 4EB6A 5MN5A 2XKAA 4X1KB 5LP6C 5LYJB 4EI8A 4X20A 5MN4A 4U39A 5EZYA 4I55B 4ZI7B 1Z5VA 5LOVB 2RHOA 3HKBA 2BTOA 4O2BA 4O2AB 2RHLA 3JAWB 5EIBC 5M7EA 4ZHQA 3UT5B 1TVKA 4O4HB 4KWEA 4YJ3A 3JARB 5IJ0B 3RB8A 5KX5B 5CA0A 4O4LB 4FFBA 3ZIDA 3JASB 3HKCA 4I50B 5C8YB 5CB4B 3C8LA 3VOAA 3VO8A 5CA1A 3HKEA 3JATB 2R6R1 5ITZA 4X20B 3JASA 4I50A 5FNVB 1TUBA 5KX5A 5JQGA 4TV8B 4HNAA 4LNUB 4YJ2A 4B45A 1Z5WA 5JVDB 5BMVA 5J2UA 3WGNA 3UT5A 3JAKB 4O2AA 1W5EA 3RYHB 1RQ7A 4ZOLA 5J2TA 4I4TB 5CA0B 3ZBQA 1FFXA 3JAKA 4YJ3B 4O4JA 5IJ9B 5JVDA 3HKDA 5LA6B 4F6RB 4ZHQB 2VAWA 4DXDA 5GONB 3RYIA 1JFFA 1FFXB 5FNVA 4X1YB 2Q1XA 4ZOLB 5JQGB 4B46A 1W5AA 3N2GA 4IHJB 5EYPA 4X1YA 4O4JB 5IJ9A 4TV9A 5IYZA 4HNAB 4WBNB 4O4LA 5GONA 3N2GB 3RYIB 5MN6A 1FSZA 5J2TB 5LP6B 4XCQA 1OFUA 4EB6B 4X1IA 4TV8A 3M8KA 4DRXB 1RLUA 3N2KB 5BMVB 5LP6A 5LXTA 2BTQA 1TVKB 1W5BA 5EZYB 5JCOA 4M8IA 3VOBA 4WBNA 3CB2A 5LYJA 5CA1B 5IJ0A 5JCOC 3R4VA 5J2UB 3ZBPA 2RHJA 1RQ2A 4I55A 3JALA 4TUYB 3HKBB 3HKEB 3JATA 3V3TA 1W5FA 3HKDB 4IIJB 2BTQB 5LA6A 4F6RA 1W581 4O4HA 1JFFB 1SA0B 4IHJA 3RYCB 5EIBD 3JALB 4TUYA 4O4IA 4X1IB 5KMGB 4EI9A 4ZI7A 4LNUA 4YJ2B 1W59A 3WGJA 3RYHA 4U3JA 3RYFA 1SA0A 3RYCA 3VPAA 2RHHA 4I4TA 2Q1YA 4X1KA 3VO9A 4FFBB 3WGMA 3N2KA 4U3JB 3RYFB 2GVIA 1TUBB 4O4IB 5KMGA 4O2BB 4EI7A 2XKBA 2VXYA 4E6EA 4IIJA 5LXTB
chains in the Genus database with same CATH superfamily
3U4MA 2FLWA 1XK7A 5KHKA 1IM8A 3FYDA 4G4VA 1O96B 1JLKA 1I5RA 4K6GA 1PT7A 2Z3ZA 3R7FA 1XTTA 3ICVA 1FS4A 2P90A 1NI8A 1AOXA 3UV6A 3HPRA 2OECA 4B3XA 2B7LA 1JR6A 1WJGA 3G2LA 3IGAC 3VCZA 2B4KA 4RTSA 4UEKA 2EIHA 3KYIB 3M4XA 5E6RA 1H2SB 3IQIX 2O8EA 4W4KA 2R84A 3Q3CA 4K8RB 3TZBA 3UBTA 4UHCA 1RADA 3CV3A 1ZI9A 1VOTA 1GKUB 4AMUA 2AL7A 4H3VA 2BCGY 3W04A 4PO1A 1W4ZA 2JIZG 2MCFA 1P3JA 3NRBA 4CMIA 3JVIA 2XT0A 2PUSA 3CLRD 3TM5A 1J23A 4HVTA 4A4DA 3F7YC 1MP0A 3U39A 1TVMA 2ZB3A 2FQYA 1YULA 3FFXA 4LJSA 4UTXA 1NU8A 5CBFA 1XMVA 1B26A 4RU1A 1FD9A 3U9TA 4DC1A 1I08A 3U1BA 1RZRA 4GR4A 5IYDO 3IBSA 3L01A 1XHFA 2RGUA 1WDKA 1WXXA 3LE8A 521PA 4AWAA 5AUOB 4I7ZB 1NONA 4I50A 2M6SA 1TYAE 3QBTA 2Y4OA 1R3UA 5CG2A 3NU1A 4KWIA 2R72A 2ZXEA 1R6VA 4J7AA 4YI5A 4M38A 5JD5A 4OPMA 2C92A 1TUGA 3IVRA 5JCPA 2Z1EA 1NXTA 4CQLA 4DIBA 5T4EA 3NHFA 4KPGA 3RE1A 3QHAA 3EPHA 4L75A 2K9PA 2JGEA 3VTFA 1RP7A 4COOA 1N36B 2KHZA 3I01A 2CXNA 3IJPA 2H8CA 3IMGA 1R6XA 3OKCA 4WWHA 3MCAA 4TZKA 1Z0DA 4GLLA 5JYDA 4JL6A 1FFXB 4MUMA 1QE5A 1T4DA 1UKEA 2XB9A 4QU8A 4RY9A 1QGYA 1WY7A 2WVJA 4ND4A 4TLAA 2HIMA 5HJ2A 2R8OA 3EAFA 4KVFA 1IZ8A 3GO4A 4LYDA 5CVCA 4BX9A 2A0UA 3QBJA 4DC0A 2F1KA 2RONA 3B48A 5KHIA 3BWDD 2C7GA 2PUGA 2J7PA 1WBBA 1WW3A 5CIQA 3RABA 4AYTA 4GZ6A 4W4LA 1DKMA 2WIBA 1W0KD 4XCQA 1MCZA 2ZM6O 4KK4A 3EA4A 3T15A 4M9XA 5CNKA 2XMDA 4HGZA 1SO8A 5JSHA 5TQ0A 5SYAA 1DCFA 2CN1A 4IFBA 3HLKA 4F5YA 1JE0A 4R5HA 2W37A 2D0DA 5H02A 4JI2B 2NWQA 3WLHA 3PNVA 5J2UB 1ISGA 1YI8A 3MJDA 4XOIA 4CPDA 4E4RA 3ZHSA 4KRYA 1NIJA 2HA7A 3D00A 3ETQA 1QE0A 4QDXA 2XRYA 1IPHA 3PIRA 4I4LA 4CKCB 3PWTA 3V3TA 2X2OA 1AB6A 1CP3A 1BAPA 5AXCA 4CV0A 5HRCA 4KV7A 2FRVA 2J9YB 4NJEA 2YJ4A 3P3PA 2NO6A 3K08A 3SOZA 2Z1DA 2YQ4A 4EDFA 3RVMA 2IXDA 1QJ4A 2O8EB 5K8UA 3A2FA 4WN3A 3NXSA 1YBFA 4LPKA 1YS7A 1GNVA 2B94A 2EF1A 4D1YA 3DEFA 5TVGA 1XQXA 2H1SA 4BLSA 4RKEA 3QKRA 4YRKA 2BGRA 4QSHA 3VBEA 3O94A 5DULA 4Q7MB 1SUCA 2OHOA 3HU3A 3AG5A 4H1TA 4U00A 1JEEA 3QVVA 1Q7RA 2DWCA 2Z58A 5JJ5A 5CURA 2XI4A 1X1DA 3C3MA 2GAFA 1C9NA 2Q8PA 1CD5A 3ZCQA 1XMIA 1CLUA 3GJSA 3L9DA 1SRYA 2MHCA 4W82A 1VQNV 2XB8A 3ETEA 3WGQA 1B0UA 3KZKA 4JVMA 3WL7A 4OMCA 2A14A 1QU9A 2WQ7A 1BE8A 2ZB7A 4RLHA 2Y0PA 4RK0A 4KUMA 3ROZA 1ZU5A 2NSHA 1YR6A 1K75A 2VP6A 2PRZA 4MW3A 3BKWA 2PMEA 3RIMA 1YUMA 5DGCA 3V7YA 5IHXA 2IH2A 3EQZA 1A8UA 1JKXA 3HBMA 2JFOA 1CG6A 2XZPA 3A1CA 1RLOA 3GRUA 2A0KA 4ZEMA 5DK6A 1CN7A 4KPFC 2JANA 2HM7A 3BXOA 4WNIA 3SJQC 1XHEA 5TLSA 3IV9A 1I0LA 2HGZA 3HCAA 1P80A 2GPTA 4JJEA 1QS0A 3YASA 3BSYA 1EFLA 1PEAA 2W71A 4IEEA 4S1NA 5ARDA 4BO7A 3SX2A 2BPOA 3GFSA 5KOHB 4GRIA 4ZYZA 1J8MF 1U7OA 1W30A 1R73A 1G6UA 5ALYA 5AJUA 1ZM3A 3PKZA 1OB5A 5BSGA 4KWTA 2PV7A 3U19A 5IEJA 1KJ8A 5C8YB 5ALWA 2YS6A 1IMJA 4ZPJA 4S1PA 3WGYA 1YJ9V 1UDRA 2A1IA 1XWIA 2HCJB 5G02A 4MRPA 4UCOA 1Z0FA 3LVRE 3THWA 3VPHA 1ACJA 4IIDA 5ICFA 1BGXT 1XTJA 2EEZA 1CJVC 4HDKA 3FCYA 2H11A 3VQWA 1PNKA 1NVMB 2EGGA 2I2CA 1ECPA 4IWYA 4BFLA 4EG4A 4O2AA 3RTAA 1HLPA 5BV7A 5JARA 5KQMA 1KRWA 1VSQA 4HAYA 3CCUF 3GHHA 4U2DA 2ONCA 4C87A 1G8FA 4KXWA 1YS1X 3I7TA 3ZI0A 1U8CB 4QLAA 1XILA 1VB5A 2QRLA 1REQA 2UYNA 4BWAA 2F1IA 1M72A 2ZOSA 3FUVA 4V03A 1YZNA 5CH8A 3ZWXA 1Z75A 4OO3A 4HMOA 1UPCA 2OMKA 2YS8A 4UU8A 3FOWA 2PJUA 2PYIA 1K0UA 2C3YA 2Q67A 1YMUA 3RRJA 2SECE 3FYSA 2AE1A 4B35A 4KI0A 4WW0A 3QY0A 3E3NA 5AOAA 2CXHA 2EILB 1ZUIA 2L17A 1CF9A 2PX3A 2B8TA 1UDXA 2VBFA 2ESRA 3ML0A 2GN4A 2HO5A 2PO7A 3HHPA 5T6MA 2QZSA 3C1OA 3HJNA 4C4PA 5GTIZ 3CCJF 1M8JA 2WSMA 1N0HA 4TS9A 3R4VA 5LA6F 3UA3A 3V7FA 4DDHA 3QUTA 2ZRGA 5AKLA 3CB4A 2GN0A 2CB9A 1N0WA 4IYIA 13PKA 4XDZA 3NDBB 3R5JA 3T5TA 2G9RA 3ZY2A 5AVSA 5DSXA 1C0KA 5KKAA 2CW4A 1B3QA 4ASUD 4CTOA 2ZOVA 3KIZA 5CJPA 4RKFA 1QLEC 2A30A 4FCVA 4S35A 4YAEA 3TAHA 4DNQA 1CUCA 2Q8QA 5BW4A 3GOQA 1SZJG 1Z0SA 2I4MA 2H6LA 2WIJA 2WLLB 2ZSIA 5AVTA 2FWPA 2D06A 1ODSA 2HJHA 1OV9A 2P9CA 3ND5A 1LLCA 2J85A 3LFUA 4WRRA 1GPJA 1HO3A 5AMXA 4PSCA 3TDMA 4BNFA 4FFBB 1TU3A 3W7VA 3FM9A 3TW8A 3CINA 3NV9A 4QD3A 3LX4A 3WG9A 5EE9A 5TB5A 1TT7A 1TPZA 2AEJA 2H07A 3EXFB 5GP1A 1KTVA 4YX9A 3D36C 5AW9A 2MR5A 1XNQB 1OZ0A 1IN4A 3AV3A 1GZSA 2A3NA 3G88A 4FDMA 4J07A 5CD9A 5KNLA 1YGYA 1ZOOA 1EZJA 5HXUA 5EVCA 4OB8A 1SKAA 4GMXA 1E0DA 1S4MA 3SDSA 4NTYA 2WDPA 1B3RA 3HEAA 2IW3A 3KWLA 3OJLA 1ADGA 1IUNA 2AYXA 3ZXUB 4TLBA 1HTTA 2VLIA 4Q7EA 4C9BA 3D01A 2BGTA 1FU8A 1AK9A 1NX9A 4OLJA 4Z4FA 3NNSA 2NV0A 3AJ8A 1NR7A 4MIOA 1F0KA 1UR5A 2W6ZA 1SDSA 3E5MA 1L5NA 1U7TA 4RIGA 4C08A 4QDOA 2VJDA 4RKYA 1VQLV 4HO1X 3ZJVA 1TADA 2X6RA 2PKRA 3KVRA 1DKLA 1WAMA 2A0YA 3GGCA 4KFRA 4M9CA 4MUYA 3BICA 4BLUA 4ENTA 2F55A 2DTXA 3OD1A 4F11A 1UODA 2CV0A 1K2VN 1NF3A 3AR5A 3GLGA 1ISHA 4GMDA 5F1YA 3V4RA 1GAEO 3DVQX 3WLJA 4YCSA 5JZVA 3NUQA 3DDOA 5FD8A 4FPXA 2E0IA 3JQBA 4KE6A 4C3ZA 2Z0AA 3TXQA 4JI7O 2AN9A 1FVHA 2YL2A 2Y9PB 1J97A 4JI5O 1YJ5A 2CXTA 4R16A 4YFYA 3NGLA 3VSDA 3HKEA 4OPAA 2OO5A 3WOHA 5IM4A 1CUWA 3WMRA 5CJJA 1E5TA 1W57A 4IOKA 2A5YB 4JYPA 2CD9A 2GKOA 1PL8A 1T9KA 3CZ9A 5E6UB 4XSHA 4JGSA 1YKSA 3I23A 3E8MA 4WZAB 2JGAA 5J63A 3ZK8A 1DRKA 2OOSA 4TV9F 5LFAA 1HMPA 2VA9A 1YR7A 3A1NA 2HJGA 3OBIA 1RTKA 1JBQA 4KMMA 4B0OA 5CW1A 4ETNA 4TYNA 5LD2B 2XV1A 3PYXA 5DSTA 1DBQA 4P5EA 3PTAA 2HHLA 1X3SA 3X2SA 4XFKA 2VQ3A 3JQDA 4RXMA 2X0KA 1TAEA 2LBXA 1P4HA 3B36A 3R40A 2F62A 2W8BC 4KJXA 3GWOA 1XTIA 2QMOA 4MVJP 2Y1LA 3VHRA 3G9XA 4F3KA 4P22A 1GFWA 1H05A 4LF4O 1ID1A 3EIQA 4OM7A 1TJ3A 1QORA 4CKWB 3F73A 1W76A 3IUPA 3MTAA 4IGAA 3GT0A 3WMXA 3H9VA 2RMKB 5C93A 5J9PC 2EF0A 5I8WA 3SBOA 2DW4A 1VL1A 3BRWD 3GG2A 4NQ3A 1M66A 3KYCB 3PXCX 5KWSA 5EJ8A 3AC0A 3MMSA 1R9GA 4RJTA 3AB7A 5L3CA 1HSOA 1KZ6A 2E5LB 2RJOA 1QTRA 3RF7A 5EZYB 2XT6A 3FDFA 3HYTA 2VT2A 4WUVA 5G0SA 4HS4A 1NG1A 3IPXA 1IK4A 3S1AB 3M5PA 1FXKA 5A5FA 2CGOA 2OXRA 4LCUC 4I1RA 4I55F 5K03A 3JQ9C 2NYVA 2CTRA 1N5IA 1A2QA 4P7GA 3RREA 4KNVA 1SKQA 4QPNA 4LH7A 3VI6A 1NXVA 3VNVA 5AVQA 4MS2A 2PUVA 3COWA 2UYJA 3I76A 3MTBA 5FOTA 1M2JA 4ZGBA 1VK3A 2Y1GA 2NLJC 3FYTA 4FEGA 2A9VA 2F1OA 3DEYX 3PR3A 2EYUA 1XL0A 1V4BA 3DDSA 4L87A 2F93B 1B1AA 5F51A 3V9AA 4IDDA 4IYJA 4KKXB 3M1LA 1R8JA 3TLGA 2E37A 3IQFA 3QHQA 3CEJA 4XD7D 3CXHF 3GRFA 2UZ4A 3D54A 2CMGA 2PD4A 1MMMA 3RT3C 2ZR3A 4UB6Z 1K6MA 2UV8A 5J23A 4IXTA 1KH2A 4RVGA 4C03A 1IQUA 3M3HA 1HG1A 2PWZA 1HOTA 4ND3A 2JHCA 4WOCA 1XPOA 5GZ3A 2YMLA 3R7WB 1OHHA 2WFMA 4DTCA 1T8UA 5BP7A 2C5SA 3ZN2A 4XYLA 2KBEA 4HGPA 1I94O 2FN4A 3OLXA 2AXTZ 1DJMA 3MELA 1IU9A 4WESA 3S5JA 3JYPA 2HXGA 3S2GA 4A5SA 3ZTYA 4CCYA 2ZB4A 5SZHB 2OLEA 3FYUC 4M87A 1NYRA 3PHLA 2JGFA 2R7MA 5LBTA 2VPXA 3SKVA 3TAUA 5EZYA 3BJMA 3PSAA 1GG5A 1YHNA 2CHFA 2R6DA 2F9FA 3IEIA 1C8KA 3GGOA 1MC4A 3CPEA 2PZFA 1PJZA 2YXLA 3BIOA 3W5AA 3CIFA 3WZLA 4K87A 1PJ4A 2W00A 4C0JA 2HVKC 5K0CA 2RBEA 4JELA 4PC6A 3RRNA 5A5GA 3EDRA 1GN3A 4FMTA 1QCEA 2HT6A 4H7PA 3GPBA 4K86A 1B0AA 1VPEA 2IW1A 2CFRA 2OCBA 3FPKA 4QXRA 2CD7A 3U4DA 1GPAA 5L9AA 1CX9B 4GI3A 5LUBA 2ZYTX 3MS7A 5DHFA 3P30A 2G7MC 4DZZA 2OIGA 4PSDA 5EKSA 4X20B 4NDNE 4D6XA 2EU8A 1B6RA 5FNVB 1NSYA 3FMIA 4WEQA 5DYNA 2HP3A 1S89A 2ID9A 3K9FC 5JY1A 1QTQA 1Q0ZA 5L4NA 3H7AA 3LOQA 3EY9A 4UTZA 4QGSA 3NWEA 1BGYH 4X9QA 2RHMA 4NICA 3RSQA 3QXSA 5DSZA 3G6BA 4N01A 5AKGA 5DXFA 4ZZ0A 3AI3A 1FFBA 4A0FA 5F1PA 5E1AC 1EFKA 2VG8A 2XUDA 4RH1A 2VRBA 2ODPA 3FOCA 3S2YA 3D6FA 2XDQB 4CN8A 2P3LA 3OEEG 1S2NA 2HU2A 2Z01A 4QATA 4DWVA 2ZQZA 1KHTA 4XUEA 3AJDA 4C0AC 5IABA 1B3BA 1EZ1A 2YW9A 1JIQA 2IY7A 3VAZA 5GGYA 2X5OA 2YYYA 5KNDA 3OF3A 4CV3A 3KVYA 1M90H 1TT5B 3GBVA 4LXQA 3FWKA 4X63A 2F3RA 2REQA 4IMPA 4RIFA 2FOXA 1SC9A 1EFCA 3GVCA 1GNRA 2FPPA 1M2EA 2DHRA 5TGZA 1NJ5A 1QFXA 3GZJA 5SY4A 1XSEA 2D7DA 3OIVA 1SKUA 3RDPA 3TQCA 4W7HA 1F2UA 1C1DB 5B1NA 1CU1A 1QYXA 3LX8A 4UBNA 1V4VA 3RNOA 4JUIA 2W2MA 2NW6A 2WF9A 2C31A 1JG7A 3A9CA 3EZFA 3PNMA 3U3KA 1KP2A 2QRVA 2Y93A 2OAP1 1YVWA 4GPEA 4OHZA 3UQZA 3J81k 1DV1A 4PLZA 3C1AA 5HF6A 1IM5A 3VGPA 4F38A 1BEUB 2H6EA 1WMBA 1ORTA 2AMTA 1GQYA 3BFKA 2FEPA 3R7WA 3SP1A 3GPDG 3CMCO 4BNYA 1M3SA 4JLSA 4E07A 1JXAA 2IBTA 2FPIB 2H85A 1SBZA 2R8RA 3GQBB 5KB3A 5EMJA 2D3WA 1AC5A 4K6MA 2NN4A 4EI9A 4NESA 5FAXA 5CYPA 4OUDA 3O9OA 2MT9A 4IIBA 4NFLA 2APJA 1EHYA 4I19A 3QE0A 3FXAA 2W6IA 1NG9A 2P9BA 4OQPA 1I01A 3KJNA 1E1KA 4P4SB 3V3KA 1CPYA 4CR6A 3AYZB 2D8MA 2G5PA 2V3WA 4UBMA 4A2PA 2FR1A 1G1MA 1Y1SA 3T1YB 3MAJA 4XQEA 1PR9A 2GM3A 3BIFA 1T5OA 3HWX1 2P6NA 3P4UA 3EDCA 2OAQ1 4ESHA 1NDHA 621PA 1AS0A 3NC4A 3BTSA 4MQEA 1RI5A 1TMOA 1U9YA 1Y7TA 1BCCH 2O2HA 3KTDA 2AS0A 2EAUA 4R3WA 5DW0A 3U1VA 1K68A 3KVNA 2WJWA 3NRCA 2ZE8A 4MEBA 2IDMA 4JB2A 1TDJA 4WL0A 3W9SA 2HS4A 3T7IA 1SKMA 2DUWA 3IMPA 1PFWA 3GP5A 2OTCA 1SU6A 1NYQA 4DHWA 1OZGA 4A82A 1JUDA 2ZJ5A 4N0PA 2J46A 3QELA 4L0QA 3L7MA 2FZEA 4HC4A 3C7TA 1IY2A 4O08A 1EWTA 1N2GA 4ACAA 2Q2QA 2EBWA 1NSFA 2AKEA 3VJMA 2K7ZA 2QRVB 4ZKIA 3MFQA 3SJAC 4IINA 1L5LA 1GITA 5E7QA 1QRTA 2JF0A 2QTPA 2G8LA 2ZAMA 2RK4A 3LBHA 4FGJA 2ANBA 2PYZA 3CXUA 2O0KA 1C81A 4FR5A 3AFHA 5EWMA 3X2QB 4OBEA 3HO1A 1P73A 3X1WA 1TTHA 1DRJA 4U0KA 1ZOLA 4II2A 5HFNA 3VR5H 3G1TA 2VGMA 2R25B 1WB8A 3THSA 4D97A 1GR1A 1C8BA 2QS9A 4U9HS 3SYPA 1LBSA 2P6MA 3K6JA 4WECA 3PFGA 5FT9A 5L6LB 3DDZX 2KE5A 4I81A 4OP3A 1OI3A 1DC6A 3DHYA 2OORC 1D5AA 2V7QG 1R6DA 3EVEA 4IIYA 5HOQA 4Q9HA 5T57A 4FB5A 1WUTA 3EMBA 5E1BA 4Q1CA 4L8JA 3EYAA 2CJWA 2FUG1 3GFQA 3I9FA 4P86A 1DXOA 4FOTA 1F20A 1MA1A 1BGWA 4LKOA 4ES6A 5I7EA 4Z4IA 1FSPA 1ECJA 1CZLA 2QENA 4N8EA 1Z5WA 4LWQA 1KB9F 2DFTA 5IP5A 3I56V 2I34A 4Q4LA 3MCZA 4LOAA 3URKA 4HRYA 1T43A 5JALA 1OX5A 3HA7A 1W5EA 1YE8A 1XK6A 1SVMA 3KB8A 4WFEA 3PYLA 2W4QA 4LXHA 1JAYA 1ULBA 1NTKH 1ZH8A 4P80A 1D0IA 2NV6A 4U2KA 3FNRA 4YP0A 1F0PA 5CGQB 3E9QA 2VAWA 4LY9A 3T1TA 5IFKA 1LI7A 5HPYB 1RPAA 3LWDA 4H15A 1CQIA 1FFYA 1KE1A 5HE8A 3WDKA 2X0JA 3TVYA 4C82A 3TD3A 1TTQB 5T3YA 2H7VA 5D7BA 4BE9A 5G1PA 4AQDA 1G3RA 2X15A 3KU4A 1OXKB 4GQIA 2V7UA 4J0JA 3G2PA 1GLVA 3QEAZ 5K2OA 4BX0A 3CKKA 4QGFA 4EH1A 1F2VA 3M9WA 3R0JA 2Q6VA 3E4CA 1YOVA 3AHHA 5H83A 1YVDA 2UU9O 4L5BA 4BXOA 2BBOA 2ZWOA 3B8MA 1BSMA 4EPYA 4EPWA 2ORWA 1WM1A 5FLYA 4B76A 1UM9A 3B20A 1NGSA 3N2ZB 4UBKA 1QHTA 5AWFC 1ISMA 4TL6A 8GPBA 4B2YA 4C2UA 3SIPA 3BJIC 3HVIA 1IEQA 4TRJA 1R00A 2QE7D 5FF9A 5LMUB 1QH9A 2W6IG 2BMVA 2CCKA 2HC9A 3TW4A 3WO1A 3B2EE 4YMWA 3W4JA 4FZVA 5I9IA 1YVPA 1H2KA 3GXOA 3ZIUA 3A32A 1Z4OA 4JI2O 3PWKA 3O95A 1D7AA 1SEVA 1Z47A 1P60A 2PX2A 2WFAA 3V8MA 4BNXA 1E1QD 1KK3A 4M9RA 4DV2B 3FHJA 2R8YA 3PVCA 1PZFA 4IG9A 1JG2A 3C9TA 2JJ2D 4OKNA 4A92A 5KOYA 4AYWA 2PTMA 3CC7F 1H6DA 2BUCA 3UFBA 3ZX6A 1T4BA 2HD4A 3GAZA 1HM5A 4KFSA 4UCWA 5I4BA 1MAAA 4Q4DA 3HPLC 3IC9A 4TQFA 2MSNA 3ON5A 2X9VA 4HD8A 4UUQA 3BCCH 4MGYR 4QPDA 1RMQA 1WOMA 2X58A 3DOCA 1X1BA 4G0NA 4L8GA 1NQ5A 3ZOKA 5GPBA 2BMDA 2PBZA 2QLBA 3W2IA 2QN3A 4EL5A 1JP7A 4P8RA 3JQBC 3ZCRA 4KXYA 4M37A 1A7JA 1E5XA 3BA1A 3PQCA 1J5EO 5FWNA 2ZRAA 4L8WB 1MENA 4C01A 1DIOB 4IIGA 4DIMA 3K0SA 3RRMA 2RHGB 3RWOA 3GEPA 1MABG 3GRPA 2R1VA 3OE7D 5E6SA 4OX9O 5JQGF 3LA6A 4DBLE 1XTPA 2XMGA 4P3YA 1MJGA 3B1KA 4LXXA 2DHQA 1WA5A 1ODEA 1RCUA 2ZYRA 3B85A 4PPGA 1I8TA 5IN5A 4A8HA 4ZPXA 4OQYA 2O23A 2G67A 3LPLA 1EK1A 2CLHB 3T5PA 2ICAA 2WFLB 3E9EA 4HRAA 1E6KA 1X39A 2HU5A 2Q28A 3SJBA 3MCAB 5AKZA 1QG6A 1QHHA 2YWFA 2KG4A 5JJIA 1VE7A 4XVHA 3NBYC 5BT9A 1R4AA 3EVKA 1MGOA 2XQKA 4WKOA 4OQZA 1QLEB 1Y1PA 3L92A 4O2BF 4Z1OA 1LDMA 1HE8B 5J2UA 1JQEA 1JXQA 1S2IA 2FN7A 1H2YA 3AQIA 3FOBA 4QRIA 3W4KA 2AG8A 4DR2B 2RGNA 3Q9SA 3QYFA 4HYYA 4L7QA 3PFIA 4BVAA 2X0IA 4BXOB 1MXHA 1GADO 1T5BA 2P9JA 4N7BA 4BTEA 1ZAKA 3ZE9A 1OXTA 3FE2A 1FMCA 2P2LA 2PV0A 1R0YA 4KI7A 1TEZA 4CIXA 4DJTA 3F97A 1UMBA 5E95A 4V1CB 3L2OB 1WCXA 5DBGA 1RPJA 2IU0A 4FIPC 1P81A 4FE4A 5H80A 4AD8A 2WB2A 2ZD9A 4ZOLB 4DR5O 2PS1A 1GH6A 5LL6Y 4HB4A 1CUXA 3FPEA 1MW8X 5EI5A 3IR6A 1G20B 2GEKA 2XUOA 1B74A 3LIPA 3R41A 4JLPA 5FAKA 4G5RA 4BTLA 3O65A 2NVOA 4JITA 2PTHA 5FA5A 1FS5A 3FSGA 3D59A 4YJ2F 3UATA 4YMHA 5HVNA 2C57A 5TVKA 2J3HA 1BYUA 1T3ZA 5IZCC 3PRYA 2POQX 4CL0A 4KFMA 4WNYA 1N7HA 4TXJA 1RHKA 4W7IA 2GARA 4ZODA 3TS1A 2ATKC 5EGSA 1U3CA 4C81A 3LRPA 3LNMB 2JLCA 3HEMA 4TSFA 4LDJA 1AR1B 2EEPA 3FZYA 3N2YA 4KN6A 3W5IA 5KEIA 3DO8A 3N2EA 2VHEA 3QA9A 3T7TA 5F23A 2PL3A 4K3AA 2J9GA 1TD9A 3L7QA 1W9HA 4KX5A 3NM5A 5I3CA 4IKPA 1H9CA 3S28A 4K9KA 2KTVA 4DO2A 5AVVA 2OPBA 1W581 1RKXA 3UJ6A 4ZK7A 4JLOA 2EKDA 2GLTA 3BCRA 3FDXA 1R0RE 3E7FA 4L4RA 2WP8J 1VQPV 4HMQA 4DSTA 4GXTA 2BI4A 2DERA 2CL7X 1EE2A 3C16C 1IXZA 4AO6A 2GASA 5IT5A 4NARA 3OA0A 3W6OA 4E94A 2QJ1A 3LVBA 3ADCA 2AN3A 1UFOA 4G4SO 1P1RA 1A27A 1Z0KA 2CLDX 3MS2A 5FI0B 5FBVB 5KOJA 1KQSU 7MDHA 1TMYA 4TTIA 1NFRA 1SC6A 3PE6A 4X91A 5JDIC 1AH2A 4KR2A 1OPXA 1J1ZA 1X80A 4JP8A 1L7AA 1XDZA 4LHXA 4RFVA 4OGQB 3WGZA 3K6RA 5HQ3B 4P58A 2WTAA 3G2IA 1QYWA 1SC4A 1WCIB 1I3KA 1SVLA 2ADFA 3WLRA 4ZYLA 3MQ4A 3Q7RA 4CETA 5EIFA 3RF6A 4LWPA 2JCGA 3WXMA 4R9SA 4D79A 1KEEB 3JR7A 3G0IA 4QTZA 1LTHR 1X9IA 5E38A 5DBEX 4RD3A 3P0HA 4WVFA 2D5BA 4NYKA 2I1WA 4OHWA 2JFXA 2FEOA 3WGHA 5BPFA 3F6BX 4H7JA 3F9IA 2QJTA 4HEA1 1B06A 3QBDA 1AXGA 4MW8A 1CDZA 5FFNA 4WA7A 2QW1A 1VQ7F 4W5WA 3HYNA 5C1BA 4HAUA 4PHHA 1IBMO 4CNBA 1UP4A 5TV2A 1J8YF 1ZC4A 2PR2A 4IF6A 3DNPA 5EMMA 4UTVA 1H22A 5IU6A 2BFDA 2C20A 2ZIGA 1VQ5F 4GQAA 3ZNOA 3EUFA 3PCTA 4KGXA 4JBWA 1TJ5A 1W87A 4DWOA 3J80N 3IKTA 3TZ6A 3AINA 4DSAA 1M1KW 2OTLF 1FCJA 1SF9A 3HG7A 4YJGB 4Z9BA 4FFBA 3NWJA 3NOVA 4OB6A 4K40A 3H5LA 1FXUA 5DLDA 2FW6A 1E92A 5AXAA 2DWEC 2KTUA 5D1NA 2WILA 3FPGA 1GCOA 2CDYA 3ZGYA 1N6NA 3CLKA 3GFOA 4JFAA 1EB9A 4YT2A 4UZSA 4HZIA 1F60A 2O8NA 1GPMA 2DQ4A 1WETA 2DFDA 4UD6A 1JA1A 3TFOA 1SVNA 5DHQA 4FJ0A 5FI5A 1TB4A 4F93B 1MNGA 1KBZA 1YC2A 3PLAE 3ZWYA 1K7FB 3G9ZA 2B1QA 2LRHA 3DF9A 3DBHA 3KTAB 1XN4A 2C96A 2IJHA 4G1BA 4M99A 2HRBA 5JDIA 5KC9A 4QE7A 2IFTA 2GRAA 2ILMA 1SFRA 5HW0A 2W58A 2OCYC 2RH9B 4NFHA 2FZKA 4Y6LA 5KYUA 1UQTA 3JQRA 3HB7A 4TYPA 4UKDA 5D5HA 5DF1A 4NULA 4GKJB 1V11A 4QASA 5T4BA 1ESCA 1NAIA 2XCSB 3FN4A 2UYCA 4P9NA 2DR0A 1HMYA 3HNPA 4DG5A 3OQIA 3ER9A 1WMSA 3KUUA 4GVPA 1VHTA 1YE3A 2WOJA 4INZA 2O2GA 1ZQ1A 3EAGA 3RHSA 3ZE7A 5LHGA 3ZWOA 4YV0A 2V0CA 1US6A 1A9OA 2AUTA 2W7TA 1G8HA 1KI6A 4DV4O 1ZI6A 7REQA 4HR7A 3DLBA 1H4SA 5DMHA 2EZ4A 3K4PA 2LFRA 1OAOA 2CXQA 1H6BA 2EJTA 5ALDA 1TAUA 1CQWA 3KE8A 1ONIA 4FS8A 2QW8A 4QAJA 5ECDA 3OPQA 2V9ZA 1WIWA 2JG3A 4Y6GB 3OD5A 1SHJA 3AK3A 1SK8A 3C8MA 3RVKA 3ANYB 3FCEA 3K1ZA 3ZLJA 1AN0A 3D02A 5DIFA 2DWDC 1FQKA 1FF9A 1HFWA 4N3CA 3SDLA 4ZK2A 2JLSA 5IZ4A 3OQJA 1T0KB 5I7OA 5IT9A 3GUVA 3MQWA 1GWNA 2GETA 5KYKA 5L95A 3O8LA 1NNEA 3HRKA 1JKIA 5KNDD 2EJBA 2VWHA 3RYCA 3C3CA 5G3YA 1VRVA 3RRZA 2HZ7A 4ZT3A 2CHQA 1WW8A 2J5KA 2HJ9A 1W85A 4HTFB 4BZQA 4J4HA 2X7JA 1G63A 1SC1A 1VQ7V 3NUGA 3WMWA 4MX8A 1VKJA 1WXDA 2WHXA 2GJ9A 3INTA 2B92A 4MMZB 1RWVA 1RSOB 1RWPA 2HF7A 2QZ4A 3ZWAA 3VR5A 3QMVA 2QTSA 1I2CA 2MK3A 1V25A 5TDHA 2D1QA 2WUWE 3WGLA 3K2QA 4X3OA 3RVQA 4DRXA 1LS1A 3Q0EA 3VNQA 3WMEA 3RVLA 2LBTA 4DLPA 3K6SB 2WWGA 1Z83A 2KX7A 4R1PA 4PXSA 4J7ZA 3QE9Y 1C5KA 1P1FA 3DGFC 1N9GA 3G89A 1BCRA 2AWNA 3N28A 3ASOB 4QBTA 5F4ZA 1OGJA 2IHBA 2QWPB 5B4UA 3UK1A 1T0AA 2NIPA 2FYUH 1V54B 4JI8B 4YONB 1HYQA 3DM5A 3N8NA 3HSYA 3KPYA 3QNUA 3QUBA 5AK0A 2HT1A 2OXFA 4XIGS 3C5WP 4LQ4A 2ZRPA 3O47A 1O08A 3VPFA 1S9HA 2UYQA 4D99A 2W6NA 4K88A 4DLXA 4MR8B 1A9XB 3WTCA 3GJXC 3MWYW 1NY5A 4TT3G 1UJ5A 3WLNA 5E6UA 1TC1A 4O2BA 2CH7B 5TC4A 1RYYA 4LIPD 3K06A 3BIXA 2J4DA 2NZ8A 4FC6A 2GCIA 2C98A 4DAOA 5DLPA 4EGJA 3MGKA 3HXQA 2AHRA 4EB3A 1VB3A 5A4KA 5FLXA 2I8LA 1PS8A 3EPLA 3DH0A 3DKKA 2GD0A 2EWCA 1DAPA 2VNHA 2HWXA 2VO1A 2XRMA 3DA8A 3K72B 1QE3A 1BNCA 3LGAA 3MHTA 3JRNA 5G0UA 5FTKA 1NJ6A 4QPZA 4IF4A 1N2EA 1U28A 5GJCA 3MBOA 4YMSA 1SZTA 1P6XA 3AV0B 2O5RA 3F98A 1SMKA 1A9PA 3V2GA 4E12A 5ALFA 4D8VA 1ESEA 4HWKA 4AF6A 1U31A 4IXDA 2F3PA 5FL7G 2WHYA 2OQIA 5T6BA 1Q2UA 4XIIA 2I7TA 4ZP1A 2XLCA 4D9EA 1N3BA 1YMQA 1SC3A 3OMNB 2Q0HA 3W7WA 1JDJA 2V7PA 1VGQA 2V98A 2GDSA 4LJ8A 2H4JA 5EKDA 1XV5A 3K9QO 1CNEA 2RC5A 5BW5A 5CP8A 4LBYA 5FI1B 5JVDA 1NQUA 1OR8A 2ORIA 3FPSA 1KVSA 2C04A 2Z2IA 5A06A 1QYRA 2A84A 2CFOA 4GZMA 5DEOA 5FULA 3O8RA 3ABKB 4GKJO 2QLJA 3OTQA 1C3JA 2J5QA 1W5AA 2FJPA 2NTJA 3A06A 3X1ZA 4E70A 3N27A 1XCBA 3IDOA 4W1PA 3NYQA 2R1UA 5EIHA 3ZD6A 5DYGA 3RW9A 1KO5A 1HRDA 2QQGA 3A10A 3BULA 3DBLA 4URHA 4CIAA 2QYTA 2WJ4A 2GJKA 2XE8A 3K4HA 5EQTA 1VL6A 2TRSB 2W6OA 3EXFA 5DT9A 3WNVA 3HRIA 4S1WA 3VNRA 4ZU3A 4XWGA 1U0EA 3UO2A 1ZWLA 3W9YA 4ARZB 3TIGA 5EHXA 1JA0A 2W9XA 1H1DA 5GY7A 3A2NA 4WFJA 2YICA 4ZAXA 4O0LA 5DASA 3C7CB 4B7EA 1PQYA 4R6WA 3HKBB 1WJZA 2C2WA 4DLAA 1GL3A 4TUYF 4LYFA 2JATA 1N75A 4D02A 4I1PA 2IY8A 3ZWWA 4UUMA 1Q81H 3PJEA 1KJQA 4C21A 1RI4A 2JKZA 4OPHA 5AHWA 3WHPA 2O8BB 5HGXA 5F5NA 1Z18A 3L7DA 2ORYA 1LRKA 1W2WB 3IXMA 2J09A 3RT1A 3O8DA 2ADOA 2ZUVA 3UGTA 4F2WA 3KKLA 4XH9B 1ZGCA 4KQKA 3DMNA 1CS4C 4B7UA 5CB0A 2MOKA 2O48X 2Q6OA 2ZYDA 1W49A 3H6KA 4E21A 2JLQA 3IL2A 3N58A 4RGBA 4OY3A 2NZJA 2AIZP 2OCGA 5TX7A 1RKBA 3RKSA 1EVYA 1KXJA 5MFZA 1EBOA 1AZWA 2DWQA 3V1KA 5KHAA 4LV5B 2ZBRA 2YWCA 1G2OA 3AWDA 3H9JA 4FYXA 4XD7A 3PRKE 3ZOZA 2O2EA 2VK8A 3ZWKA 5KUMA 1A1SA 2NNLD 5ALVA 1UFRA 4GPTA 3C3SA 5AT1A 3HLYA 4FOPA 3TQRA 4BT5A 1EG2A 3K3PA 4DANA 3EZLA 3P0FA 5B1IA 2E76B 2JHAA 5EO3A 5CB4F 3P9SA 4I55B 1GZ4A 4EVSA 1J0CA 5SYMA 3RT7A 1CY1A 3NM6B 4XFJA 3ZZ0A 2ZTHA 4ENRA 3IP6A 1YEWA 3R3WA 1C50A 4GF5A 2JH9A 2GRUA 2RB9A 1TXGA 3EXHA 1SEPA 4KR9A 3MGAA 4IOMA 2N48A 2OQVA 3ZIAD 3HV0A 3CPHA 3HWSA 1TECE 2Q5JA 3BB1A 3H17A 1IK6A 3K73O 3CLTC 3ORHA 4P98A 4R2KA 4R31A 4U2BA 4BZZA 2BAGA 2CFCA 1M1KH 3BCUA 4YAKA 5JIBA 1VIBA 3C4VA 2YZKA 2HUPA 1K4CC 2ST1A 2R6R1 3BE8A 3K0KA 3L40A 5JSZB 2YV5A 4OJMX 4LMPA 2X3YA 2PMKA 4TTPA 4CC6A 4ZT7A 3WKDA 1UZMA 3H1IH 3SSNA 3ZV3A 5JCJD 3OJOA 3WIBA 3W7XA 2FPWA 5LWQA 4WI1A 5EWLA 4QVGA 4X6LA 3VU0A 4JASA 1DCKA 4X7RA 4G65A 1JPXA 1B43A 3K9LA 3OZFA 4E11A 4L4XA 2IHTA 3CX6A 2NUAA 2WZQA 4CRWB 3L7IA 3L6CA 3ZP4A 4YP1A 5H4GA 5KKNB 4HQ0A 4RS4A 3ZQJA 4L3WA 5CCDA 2JI8A 4LZWA 3AKZA 2CAZC 1R64A 3I1JA 3QP9A 2FW1A 1K8YB 2JW5A 2NSYA 3TLAA 3CT4A 1F2UB 3DWIA 5GONF 4ZHQF 3D4OA 1MJNA 3O7WA 4JI0B 1Y4ZA 2ID4A 1XZKA 1K2WA 3F3SA 1V2GA 4GPD1 1RR6A 1JAZA 3BMCB 2B9VA 2JCYA 4P53A 3EEQA 3F7NA 3V1LA 3EOBI 4AUEA 2QVBA 1A9ZA 2DMXA 2X4IA 3RKRA 2YDEA 1SVOA 5BVHB 1P0CA 4AZ3A 3FPHA 2AA3A 4QLBA 4OJTA 1Y8QA 1DT9A 1TVCA 3E9YA 2DBQA 4JJKA 4KV9A 4UEOA 1N77A 3CNOA 1FSZA 4O4JF 1L7NA 3HZZA 4URWR 1RM4A 1G5IA 2DFVA 2EFJA 4YLEA 3FDJA 1L8XA 4A2WA 2IZ5A 2DYSB 1R1MA 1KMNA 2IJKA 3LTNC 1NXOA 3SIUA 1P72A 1RWBA 2P4VA 5I7FA 1GGVA 4WADA 5D3KA 1VECA 1O6FA 3A9VA 4RDCA 1N3LA 1JSZA 4Y2VA 1M1YB 4YALA 3CY6A 4MHTA 1QFZA 4CM4A 3AIIA 3RS8A 2ZUFA 4NMLA 1E1MA 1O94A 1TYBE 2ZPAA 4AWBA 1E99A 1GIAA 4R7GA 4MCIA 1K8XB 3UK0A 5JAZA 3NT2A 1P7CA 4FDUA 3NNDA 2HSDA 4DCVA 2FSVC 1ZH6A 1V2HE 5KTNA 1RCTE 2G88A 5KBYA 1G55A 1PSWA 1QUEA 4GKAA 4KBGA 4RAOA 1DQSA 3GBSA 1I13A 5CA3A 4YHHB 1CB7A 2FP3A 3I9KA 1Q8RA 4GGMX 3CWBH 4FBMA 3P97A 4XW2A 4G1FA 4BQEA 5JAHA 2AN4A 2RI0A 4NSNA 2PLRA 2HP0B 4S0XA 4BQQA 3V1YA 2ZB8A 1JQAA 1RKUA 3FIUA 5BO5A 2J41A 2A0XA 1QVFF 5C8YF 4RHFA 3J80A 5I7UA 4XEUA 3UZUA 2JNWA 3ZU5A 1J21A 1U4OA 3BGIA 3UQ8A 1V1JA 3B78A 5AIAA 1JQ0A 5A9TA 3OE5A 5DO9A 1XOIA 3I9V1 3T0IA 4JA0A 3ABZA 4GXRA 1Z22A 2FMHA 3MNFA 1TAGA 3OZSA 1PFGA 1ENYA 4ND6A 2CCJA 3K0FA 4D9MA 5IS2A 1OLSA 4JDUA 1Y5NA 4DC9A 4I50F 1VQ8F 1VLMA 4MUAA 4KNYA 2XTJA 3D8SA 3RWBA 1DARA 3ROPA 4B3JA 2IZ0A 4FOLA 4G8CA 2J3IA 2H1LA 3CWCA 1EWYA 4JUFA 2W0MA 3VR4D 4CM4B 5A2QA 5FEUA 1GRJA 3HVJA 5JNTA 1TVKA 5FWYB 3TRKA 1XZIA 3RFCA 5JDCC 3T3GA 2BM1A 1R66A 1HT1E 3DZIA 3DC2A 1RJ9B 4M7PA 2CHTA 4BGDA 4GEGA 4PG4A 4LDRA 4Y1EA 2VCHA 1JMYA 4FNGA 1BMFA 4M46A 3VPGA 4EO7A 2FSHA 3ZGLA 1DWOA 3E3OA 1NI4A 4NOKA 2B4QA 5KWEA 1IN6A 5GM1A 4FMBB 3V34A 2EVWX 3VR6A 2B37A 2VDKB 3EZGA 1BKSB 3I30X 1XP5A 5C8XA 1FTQA 4RKRA 1FMTA 3WB0A 2ZI4A 3KCQA 4H6WA 4YP9A 2ZDIA 1A5ZA 4I14A 4QWMA 1KWKA 1WXEA 1ZW6A 5KAPA 4JOCA 1ZVQA 4JODA 2CSLA 1XDUA 1OYYA 1PTJA 1Z6ZA 4WLNA 5TGTA 3B3QA 1L7EA 4MVJI 1U3UA 3RRXA 3ZRVA 1JEOA 3TXAA 2OXEA 4UOEA 1V6AA 1VIAA 3V7UA 2VUHB 3K0BA 4B87A 3M8AA 1P9RA 1WUKS 3R1IA 2R9AA 1W1UA 3H1AA 2YIAA 2JCVA 4PLCA 3D8BA 2XHEA 2XAUA 3VC3A 4PSVA 2CYBA 1VHLA 3I5AA 4LRSB 4O1IA 2I2XB 2X13A 1X7PA 1MJFA 3ZE6A 4DBVO 2RK6A 4O4LA 5CFOA 3H11A 3E05A 2H8GA 1H2BA 1TZCA 2PX5A 3W3AA 2QWRB 2GCGA 4P0TA 3DR3A 1I3OA 4R40B 2ZJYA 1R12A 2GBCA 4F97A 2FRDA 1ZJ5A 4N23A 2IHVA 4DSUA 4JJFA 4RS3A 1CCWA 3P9IA 5B66Z 1TVKB 1DQYA 3V8VA 1ZX3A 4YHHO 4RABA 2GBFA 2YWBA 1N5DA 1DWUA 1I0ZA 3CLVA 4QAQA 3UOAB 2C4VA 3PL1A 5KHGA 2PBRA 2SHKA 1YJCA 1J0BA 4FJCC 1RXUA 4GOJA 4OXKA 4LYAA 2AWOA 3E5RA 1I2BA 3JALA 3T4XA 3BFVA 2AHYA 2BMAA 3GEEA 1POXA 3WP0A 3GJ4A 1PK8A 5KU1A 4ZN6A 5EIBD 1LX6A 3UY4A 1JFTA 4F04A 1YKGA 2KWIA 1ATIA 2ZS8A 421PA 1N78A 2H5IA 5AW1A 5KYXA 2ZU0C 3G3EA 4UULA 1SQ6A 2R8XA 2V97A 5DM60 3ILSA 3HN6A 2YXPX 1LVUA 3R3VA 3DLHA 1UOPA 2OTLV 1N25A 2AB0A 4WY5A 3WQHA 5TIIA 5H8WA 4FKBA 5DECA 4XCXA 2ZLBA 1V16A 4GM1A 5CDFA 1MF7A 3A9SA 4UHBA 4UJ3A 3NMUC 1CR6A 1OBOA 4LWOA 1U6IA 1DRVA 1W52X 3M82A 2XOXA 4V3BA 1SWWA 4A0SA 4BNDB 1PP4A 3BD7A 2I1QA 4JLBA 1Y9ZA 4PAWA 3V1MA 3WYNA 3ZDXB 5TS2A 2WJZB 3WIEA 4CKYA 3WIOA 1YF2A 3PQ7A 3K5WA 3AG2B 2YHIA 4OTZA 3TRJA 4WFAV 5JCZA 2ZNIA 4BP9A 2ZUBA 3FFAA 1B0PA 5J2TF 2Q5FA 4JOBA 1PR2A 2VDWB 4WV3A 2XW6A 1K73W 1QVGF 1G2PA 1Q7TA 4NYMQ 5EFZA 2Y6UA 3V4ZA 4HMPA 4URUR 4IP0A 1ZBQA 1AHNA 2WD8A 1LSUA 2OK8A 5C3MA 1E7KA 3O9VA 4FCWA 4H6VA 1HFJA 2P41A 2G5GX 3AFIA 1XDBA 3KWJA 1IIBA 1N0VC 2IOHA 4JLKA 2VJKA 4HAZA 1JIIA 3PF9A 1CRZA 1OCEA 1T1SA 2E89A 3DJFA 4LDNA 1BD4A 1GM5A 3T9BA 1FVOA 4GYYA 1BFUA 4KR6A 3EXEB 4MPTA 3UPUA 4WBXC 2R65A 5DGTA 1JQ3A 4LV8B 3MCWA 3TLYA 4O2AB 2D2XA 2AJTA 5EK0A 1LV8A 3ETNA 1IVNA 3AY3A 1TFRA 1XALA 2REXB 4M86A 5DJ5A 4B3GA 1Y34E 4BZXA 4RE6A 1IHYA 2FWMX 1T2UA 1KNKA 1PJTA 1RYBA 2NYRA 3SHFA 3GX1A 4W1QA 2F8SA 2YRWA 1KO8A 1UMKA 3CZQA 5DM6V 4TKUA 1SESA 1SR8A 2FJ0A 2IUTA 2P40A 1VQPF 1W0KA 5GOZA 2DWUA 1HK7A 3DMFA 2A0WA 3IHTA 4TMZA 2JH8A 3FTCA 2A5GA 3BGOS 4FBLA 1Q0HA 4KXUA 1BMTA 2CWWA 4I2VA 5F98A 2A1UB 3EN0A 2PX0A 4G07A 4HB0A 2Y4UA 1P1BA 1Q15A 2RSLA 2DWOA 1RBZA 4Q3AA 3QVMA 3W6NA 1Z2DA 4CKEB 1ZD9A 3FB1A 3MB5A 4NOMA 3OGCC 2YH2A 3EB9A 1MAHA 3VM6A 4QUGA 4JAVA 4YJ3B 3H2HA 3PEUA 4QRDA 1W2GA 3VTZA 1EHIA 1Q7GA 4KZKA 2C58A 5C34B 4JBYA 1A4RA 4RANA 1JQDA 4D8TA 4CF3A 3RGBA 1XZPA 1SQGA 2GN6A 1E2KA 1MOZA 3EBOA 2HJFC 1UJNA 4FHZA 4K0RA 1XEFA 4NH0A 5BRAA 5KINB 1L5HB 2XCOA 4IHKA 3SDZA 4LDZA 5HZKA 3CZ4A 1IHPA 3REQB 5H9VA 4YRTA 1IXYA 1CR1A 4QU0A 4JYMA 4KQWA 4EJSC 3H0EA 1OX6A 2FPGB 4QC2A 1NBME 2YFQA 3GUHA 1HV8A 3NHAA 3P9XA 1EUZA 3UHPA 1EN6A 1ZL8B 1QDLB 3RSZA 2GB4A 3KETA 3SSOA 2B25A 5B1AB 5EY5B 5LMCA 4RUEA 4TGLA 3KR2A 3BFXA 5BNTA 1UOOA 5KVAA 4I1YA 3K1YA 3ZHYA 1OFIA 2EL9A 3SJ7A 2XVMA 4RAIA 2WU8A 2PUTA 2BE7A 4RELA 1DAOA 5HMLA 4YUWA 3NEYA 4WY8A 2Y4TA 5HKKD 1TM7E 3O82A 3BC1A 3WZMA 3WICA 4A73A 2YVAA 4B1FA 3QKIA 1UFQA 3R3YA 3BAFA 4WXRA 3VXKA 4B34A 3RYFA 2EQAA 3JS5A 2GJAA 2EKLA 2J9FB 4I5DA 4EY3A 4ZAFA 3FFMA 1KFEB 2QT9A 1EFPA 1RQXA 2DH5A 3BXZA 5FOWA 4C4SA 4UE2A 4YMTA 5IAOA 1N5JA 2EV9A 3DFUA 3TLEA 3THYA 4JYAB 1VE6A 1K06A 1M8KA 1TCVA 5HY2A 2C5EA 2V7XA 1AGYA 2YZNA 1L1EA 3HVHA 2CUTA 4NG5A 1XMSA 3PZRA 4U2GA 4LECA 2GT1A 3AL2A 3REGA 3VO1A 4RK1A 5KTSA 3U7FB 4BY9E 3ZE2B 3IPYA 2WYHA 4AQYB 2J3JA 2ZEJA 1AS3A 3AR2A 1A9QA 2N3ZA 4GP7A 4MA4A 3IJ4A 5DV9A 1YR2A 2Q29A 1FFAA 1R18A 2QSAA 5CBPA 5D3QA 1OROA 1K34A 1J2TA 3LNNA 1GTOA 2DMRA 2AZ4A 4H08A 4ZT5A 3RS7A 1E79A 5DNVA 1FDRA 3E9DA 3QFSA 4DCGA 2PZSA 3DW1X 5KQLA 1QYVA 4E13A 1GTJ1 3G8YA 1M2OA 3LX5A 3OQVA 3K0EA 1A71A 4LMAA 3ZW7A 2HWKA 2UKDA 4ZBMA 2HK9A 4CUZA 1SXQA 1J42A 3KHUA 4K9DA 2IS1A 1ECFA 4J03A 2IYYA 2E5FA 2EHJA 3IIJA 4I6EA 2H5LA 1QOZA 2EIKB 3OQMA 3A58B 3OQIB 4HQNA 5K1ZA 3SYQA 3W8NA 1XHXA 1G41A 1NN0A 1NN3A 2HRCA 1GGEA 3QFRA 4J7CA 4OJQA 3TINA 4Q66C 3A3NA 1CERA 2GBPA 4C0XA 3FZQA 2ZG6A 4ZANA 2VIIA 2VOEA 2LXNA 2JGUA 2YC2C 3BUSA 1AK1A 1JT9A 3WRYC 4AURA 1QYDA 1BQEA 5F3WB 1SQSA 1K3FA 4LDQA 2O50A 1JU4A 1L4NA 3OSZA 3PGKA 1P9WA 2G1JA 4G5HA 1HX7A 2F1HA 3WV4A 1KGSA 3HYRA 1UKVY 2O19A 4PS1A 2IP1A 4A10A 1AKTA 1NMEA 1XNRO 3UWKA 1H2EA 1UT5A 2R3SA 5KKCA 3V6LA 3T3DA 3WWEA 1H3EA 1CDOA 2J67A 3UJBA 1GCGA 4N03A 3IFXA 4UOQA 2CNLA 2UYNB 1E9SA 2NO7A 4UCRA 3CC4V 1VSVA 1PKXA 1QMPA 3MDSA 1WS6A 3F3MA 2IYZA 3TKAA 4F1WA 3FRIA 3LLCA 3L73H 3PFHA 4I8IA 2F1RA 4D0RA 5FXMA 1NOKA 1CVIA 5JRZA 3OUFA 1HNZB 3IE1A 2NUBA 2FQ1A 4I8DA 4X3MA 2AUNA 1Y6QA 2FPLA 3V8QA 4ZTZB 1J1UA 3FNBA 1U0GA 4QOIA 3WWYA 3VSBA 4RY0A 4RPKA 2YOHA 1O5OA 5CT6A 1LC0A 3IELA 4UXHA 5EWRA 5ESWA 1GU1A 4PYIA 5DISB 1INLA 3SIRA 1W5BA 5AM0A 2BC9A 2F8TA 2DJVA 1KH1A 1Z8NA 2XTZA 3CCBA 1JQKA 4WCEV 2OLKA 2XGGA 3C6YA 2H29A 1T2FA 3D6HA 3KJGA 4XM0A 4BLQA 4TUYB 1B93A 2YIBA 3MK31 2GDJA 3P2MA 4Q3KA 4R9UC 1V3UA 3SEFA 3GRRA 4BX3A 1CVLA 1II8B 2BTQB 2HV9A 5CAEB 4DY6A 4OK5A 2ZQ5A 2C5FA 2HMVA 4BGIA 3M9XA 1L7BA 1PD1A 2ANCA 4HGNA 3CCEV 5K09A 2B2NA 3NONA 1Y8ZA 1C0PA 2CJFA 1UEIA 1FJXA 1LZLA 3IUEA 4NG4A 4I99A 2G25A 4EHIA 1LK5A 1VJDA 2CH7A 2IS4A 4ML3A 1JX6A 3CRW1 1VQ8V 3B8EA 1CYDA 4ODIA 4ZO6A 4X60A 2WFLA 3GLRA 2UYHA 2A35A 2NO0A 3ET5A 1ZOSA 3OT1B 4KEAA 3QO8A 2XKBA 5B1EA 4RK6A 2WU1A 6REQA 4B7ZA 1F0YA 3R76A 3BXEA 4A9AA 3T3OA 5DHSA 3U09A 2R6HA 3ZCCA 2PS9A 3BFJA 3DULA 4L95C 1UAYA 4YB8A 2WVHA 3QF7A 1DQNA 1K5DA 3U2QA 2ZPUA 4YJGA 2OBYA 1WVGA 1ZQ9A 2ZT9B 2EFDB 2LKDA 2NVUA 2ZIWB 2GPJA 3EXG2 2F9MA 3BGWA 1G2IA 1F8FA 1QG0A 1Z12A 1S01A 1QP4A 1RHUA 1JD1A 821PA 1M6HA 4C7OA 1I6KA 4RQFA 3DVAB 3UIEA 1IN1A 2Z9CA 1PR6A 4JL5A 4Q15A 1GZDA 4P9OA 2HMAA 2PH7A 1P9NA 1E2DA 2QRUA 4XDLA 3PN1A 1ZVMA 2XOKD 3C8DA 3DGEA 3F2VA 3Q6NA 4J0FA 4WJKB 4WVLA 1AX9A 2P27A 3HUTA 4W1SA 4JQYA 4YAJA 3JZMA 4AK9A 2O1XA 2BR5A 1JHDA 2JI4A 4L5YA 3CCCA 3ODGA 4CUKA 2R44A 1Y8RA 1RD4A 4MQ5A 4Q03A 3V32A 1QR2A 2EP8A 4P3OA 2Q45A 1RW4A 4AJPA 2X0RA 2PUWA 1E9RA 4H6XA 2VZ8A 2J33A 2W6MA 1BE0A 1GPBA 4Q4HA 3RLFA 2BDTA 4CMBA 1QP7A 2I71A 2H3HA 2QVZX 3L72H 1TIBA 1AKMA 4ZA2A 1NQXA 1AT1A 1DJOA 3C7KA 1DAKA 1NJSA 3L49A 4I5IA 1H9BA 4N5IX 3C8LA 2VJMB 2O2XA 3SYAA 2CZGA 2QX8A 2MINB 2WJAA 3TLZA 5BWNA 2IYLD 2PUJA 1EZVH 5FA8A 4PA3A 2HNKA 4KLZA 3ZRWA 1H4VB 3X1DA 2E4VA 3D0QA 3OT1A 1XI2A 4YT4A 5JADA 5B12A 4MI1A 4LNUB 2LDBA 2NYUA 3SCZA 3ECAA 4JTDB 2JAHA 3WYAA 5C35A 1OW3B 2AOTB 3Q15C 4LWZA 2GWRA 2BFMA 1BFDA 4NOLA 3WGTA 3ROMA 4KXVA 3TLXA 1N7JA 1ND6A 3RPEA 4DDMA 4QBGB 3VZBA 1JV2B 1RLTA 1GTZA 3A1WA 4AX4A 1C9EA 2V6FA 2VS0A 2JHGA 5LZ7A 1II8A 1N33B 2H4WA 2VYVA 4KIWA 4BAYA 4MW4A 5LN1A 4DQDA 1EFAA 4D7SA 3TI9A 4MDYA 4DJAA 1SBQA 5F35A 1B42A 4DMMA 5ED4A 3OAAG 2A88A 1V39A 5KOIA 4PIMA 5SY9A 2E2WA 3GW8A 3V8NA 9LDTA 4G0VA 4QM7A 4EX7A 4CM9D 1NW8A 2FAXA 3RH0A 4YN3A 3OWXA 1Q3TA 1YQXA 2DQSA 3U49A 2X7RB 3NTVA 5GV7A 3PLRA 1OI2A 4R98A 2ZT6A 3D54D 3GJ6A 3JQ9A 4K6OA 3ABQB 3I2YX 3GZNB 2Y1CA 3FA2A 5JZ9A 1IUKA 3WB1A 4QUDA 3NDIA 2AJLI 3PQFA 4DMGA 1VBNA 3DXFA 3STVA 3H04A 2LPMA 3ZK7A 1SOUA 3CKMA 5KNCA 1XJ0A 4F84A 3FMOB 2GX6A 4B48A 3EMDA 2V59A 3IQWA 3HJBA 1TKAA 4MI3A 1B41A 3GLIA 2C1EA 3QNWA 2OWOA 4L74A 1NE2A 4IO0A 3UJDA 3LDFA 1SD1A 2H48A 4AUNA 1Y89A 5K01A 5KHHA 1I0IA 3HVRA 3V42A 3J81A 4JI4B 4R1MA 4BW9A 3T1HB 1BW9B 4PO3X 3IOYA 5LB4A 2FETA 1WMAA 4PWYA 1TO2E 4LZLA 4C30A 3CVJA 1JH9A 2PH5A 2YXNA 4CR8A 1HE2A 4HGYA 4DIFA 1H5QA 2CDCA 4MAMA 3U4GA 3D7KA 1OBFO 3FUCA 3QHPA 4XUDA 3VQTA 4TTTS 2IC5A 3SIVA 4DR7B 4OLFA 3REFA 2IYFA 2CK3A 5BVHA 4ZVMA 1P1IA 2WHPA 3LXUX 3D7RA 5L3ZA 3OETA 2HHHO 2O5EA 4TVSA 3WNDA 3X43A 1IBLB 4A2CA 1YSCA 3B9QA 5B36A 4K9PA 2PHNA 1RFYA 1XDWA 1HLGA 4J0QA 4MVJG 4NMXB 4JI3O 1HNZO 1JBEA 1V9SA 3OUZA 3ABMB 1I94B 1UXGA 1J33A 3K8ZA 4HNQA 4RQAA 3UKJA 3F6MA 2IPLA 1CY2A 3AKDA 3ANNA 4BNNA 1NASA 4C4YA 1E2GA 1A2KC 1CBUA 2AIFA 1JDTA 1GYPA 1JYSA 4J9ZB 2FGYA 2AOTA 2D00A 3GC6A 4K05A 4RVDA 4TKZA 2D5AA 3U5ZB 1UXJA 7AT1A 2VR1A 3AIMA 3B9BA 4KE8A 3H5RA 5L3RA 3CZAA 3B6ZA 3GFPA 1P5HA 4HZGA 3AY7A 3L43A 5CPFA 5GIPE 3MWGA 3QVXA 5C3UA 3IC7A 5EIWA 4YWHA 4O5AA 5IG2A 3BILA 2R85A 2HI0A 3AYXB 3BCHA 1XCGB 1L7VC 3BEDA 3LAWA 4DLSA 3OONA 2FW9A 4Z0HO 4BO8A 3E2EA 4MDFA 4BE4A 5EB1B 1F3OA 4EHFA 2JGJA 3QTCA 1WCYA 3NLLA 3C1UA 3KQMA 5D3MB 1VPDA 5EGNA 3UJNA 3EW7A 4XJSA 2RNBA 1UKZA 3BZWA 5BWBA 3I62A 2E4WA 3EMVA 3ZZNA 1R1DA 1ORIA 1MA3A 2JD2A 2HOQA 1LLUA 2Q07A 1ZP6A 4IHAA 3A26A 3AH8A 1II9A 2OE2A 3FZNA 3TQHA 1Z07A 2QP9X 2DPMA 1IOZA 1ESNA 5C4GB 2UXDB 4FEYA 1DMRA 3SYNA 3VYVA 4BIOA 5IHPA 2GEVA 1NMYA 4UNPA 3A6KA 3OAAA 3I2KA 3IEQA 2UXCO 4LS3A 2X1MA 5LA6B 4HPJB 4PYMA 2OAGA 3VH4A 2ZSDA 1NVGA 4M0FA 4MQFB 3QVUA 3RIHA 2BYTA 1XQVA 1ZA2A 1MPTA 1OMOA 2WABA 1YR1A 1ZN9A 4LI0A 4X93A 4LF4B 2ZAYA 2VDMB 4FEAA 4GW3A 1WDMA 5DGHA 3LT0A 5EPUA 3ZCTA 3MTJA 4I3FA 4HNAB 1SK9A 3OJFA 5B7NA 1FDVA 4L8YA 5JANA 4J3NA 1YT5A 1ZWZA 1MDFA 2WV9A 3TZEA 1RYNA 1O95A 3L8GA 2E4UA 1Q43A 2GXAA 3OHPA 2VPPA 3FNHA 3B5JA 4GXNA 3G5AA 3O1JC 1UQUA 2PZAA 5EE5B 2H2AA 1W4BA 4JYAO 1GAXA 1N3YA 2DB3A 1CJBA 1UC9A 5ESXA 3ZHTA 5KA6A 3GF4A 4ZDJA 5LJIA 1FW8A 2PY6A 5DM0A 5A4IS 1VKRA 4H59A 4G24A 2AFHA 5BWOA 1OJHA 2HA6A 2DEUA 4EMUA 1QVFU 2VF4X 2WJJA 3OF5A 5FWYA 5EE3A 3AJAA 4M0LA 3ZXSA 4YPOA 3AL0C 2H0AA 3F6RA 4TTRA 2H54A 4UDXX 5DTQA 1CNMA 1ML3A 3I2IA 4ZQGA 3OHSX 1WPQA 3EEYA 1MSDA 2UYYA 3E35A 1U43A 1KC3A 1KVRA 1WDTA 1IAVA 2HJVA 4YREA 3F5FA 3T7SA 1R0ZA 3IJRA 3VHLB 1TJ4A 3PEVA 1T6XA 3WNBA 2RCNA 3WL8A 1E2EA 2DFLA 4NTZA 4A8TA 5A0TA 5A05A 1H2NA 2ZZKA 3KYDA 2AG1A 4TTVA 1RJ9A 3MUOA 4YECA 4AZWA 4NATA 1G16A 3DC7A 3L05A 2ZREA 3C6BA 3MMXA 3OJXA 2PN1A 2O2DA 3BDIA 5DWDA 4RY8A 4BVHA 3P10A 1Z8FA 2VNIA 4RJLA 1SXIA 2QTLA 2XBLA 2KSQA 1UANA 2I80A 5H6RA 1W48A 3WGKA 1BH6A 1NIPA 3KCXA 2FPRA 5A2QN 2HO4A 2PWBA 3JZFA 4P5DA 2AFRA 5EJ2A 4F2PA 4S05A 1MABA 3EE6A 1P8AA 5K8TA 4DGSA 2GAOA 1GN9A 1O03A 5LP6C 4KH0A 5CTAA 3T4UA 5FPTA 2Z1NA 4RJKA 1XYYA 4XLTA 5G4LA 3IAYA 4ZZ3A 3F7TA 2V55B 3U0VA 1ZTEA 5CMLA 1GFIA 3WSVA 4YPVA 4LVCA 4BO3A 1NN5A 1GU7A 1X15A 2QNIA 2IU4A 1ZSYA 3I83A 3TMKA 3DB2A 1XEQA 2VXOA 4DXWA 3HB5X 4CQNA 3ABKC 4W63A 5AM5A 5JG7A 3JQCA 2ZTMA 3QITA 4RL4A 5A4JA 5ECYA 3OX1A 1NJFA 3LKDA 5TPZA 5IMSA 3VVMA 4DEXA 3K5PA 2OAEA 1X1AA 4OD0A 3NPAA 4MPDA 3NHLA 4B7XA 1Y76A 1A97A 4Q4AA 4PN3A 2IPNA 5F64A 3T9EA 5B2FA 2ZIEA 4ARBA 3JASB 1NVPD 3OIWA 4NU8X 4K5QA 4R50A 1M1NA 3TCNA 3E58A 1XV2A 1L7MA 3UGJA 1QF6A 4Q01A 3IPCA 1ZXBA 3AG4C 4J1NA 4GC5A 4LJ6A 3NHPA 4JNKA 4BDSA 2Z6AA 1HTWA 3E8HA 2GQ0A 1D1TA 4D9CA 3C3XA 3HB0A 1JLHA 3HACA 4PCVA 1DIGA 1CK4A 4PG6A 1EE1A 2VH2A 1KRXA 2WKWA 2WTXA 3ABIA 4QGGA 1NMUB 5B1YA 1LJUA 4FYJA 5B30A 4RK7A 3UTCA 3KZXA 4CEHA 3ZHCA 1WLSA 4AJOA 2D3OW 1EFTA 5FL7A 3DZFA 2IA5A 3KKQA 1KDZA 4Z7QB 1AUOA 5EJ6A 3PHBE 1JSXA 4JB8A 4QJ5A 4GMHA 1N2XA 1TPYA 4R7TA 5JTTA 4UNIA 4JXZA 3WJ2A 5IYZA 1G5HA 3B7GA 4PAOA 4AJHA 3KSAC 4X66O 4Y1GA 5A5EA 2Q1UA 2RDMA 3FR7A 1U99A 3QH4A 1PNQA 2QROA 2PS3A 3HO6A 1MH1A 3DT8A 3LZDA 3ZWVA 3QKRB 1DBVO 4B4OA 3DPIA 1G0OA 1JDBB 4KUHA 4PYRA 3ASUA 4NE9A 3V33A 4DM3A 2V4DA 3JQGA 1GFSA 1Z33A 1GZUA 1K6IA 5JE8A 4FYMA 1KMIY 3MTEA 4G81A 4I55A 3AVYA 3EVTA 2ZR8A 3R24A 1GSOA 2WJPA 4D43A 3OWOA 4HZUA 1WP8A 1X87A 1Z7GA 2HWYA 2W2KA 1X0VA 3KPVA 2EGHA 3L0BA 3OKFA 5AK6A 2XHBA 4OL9A 1B8UA 1ZISA 1ZGAA 5DW3A 2O8DA 1NULA 2RGBA 1NQ3A 3ODPA 4CL8A 1CUEA 2ENUA 4P6VF 4BFSA 4F46A 1W59A 1YJ9F 1HT3A 3EIWA 3UFXA 1DBSA 2X8LA 3WC4A 2QI2A 3ZHUA 1DL5A 1I2AA 3FNIA 3H9QA 4RH0A 3LY7A 5LNK6 2NR5A 3AM1A 4IUDS 1PSDA 2AMFA 1WQ1R 2D54A 3H5VA 1RM1C 3COZA 3TEJA 5BV8A 3RA5A 5GIOC 1E3WA 2QTGA 4K26A 2FEAA 1WDLA 1UBCA 1VL0A 4TWIA 4H1UA 1NOJA 2P6OA 2PKEA 4J2HA 2HLDA 1GRQA 5AK5A 3AGKA 1AA6A 1XKLA 1SXJC 1YD7A 1IULA 3CW8X 4FX2A 4BVJA 4IM7A 4Z3OA 1L8DA 3V7NA 4C06A 5JC1A 3EJ6A 1KNJA 4MVJF 4IQ8A 4EHHA 5B1AC 2HLPA 3G7SA 4IDGA 1Y6ZA 1OYWA 1YC5A 2GPNA 4F6EA 1H8HA 2PBFA 4OYYA 3UN1A 3BXPA 5EIOA 1KKLA 2P2NA 4LH6A 4Q16A 2CF5A 5B3JA 2BHNA 3BXFA 5CEJA 3OICA 5I9BA 3PLAC 3RIGA 4D96A 3PEYA 4C88A 1RQLA 4URFA 2O3QA 1VCOA 2BFEB 1VGVA 1WTCA 5LYJB 2WKPA 2NPFA 1Z73A 5GQSA 2I6XA 5IH7A 2R4QA 4TQDA 2N1BA 1G7TA 1I6LA 2WD9A 4D44A 2QV7A 2VF5X 4BMPB 4EYOA 4UUOA 3T4PA 1ODCA 2PT6A 3LWBA 4PGGA 4AZ0A 1T0HB 4UTNA 5K2MA 3EXHC 1QPBA 3IIKA 5K1XA 2E48A 4ZWNA 3F74A 1E3EA 3NDJA 3K71B 3O74A 2QLTA 4Q05A 4KUGA 1G8GA 3KWFA 1UQRA 4RPGA 3ILHA 3LUTB 2MYPA 2OM6A 3EODA 4J41A 3STLC 1E3LA 2OZLA 2QR3A 3QBEA 4FNAA 2ZWAA 4L78A 1ID8A 2I0FA 2ZAIA 3HCEA 4I50B 2I2WA 4BN4A 1K88A 4KWHA 2PR7A 3G6EV 1A8HA 4GX0A 2FE1A 4QGAA 2D0OB 5FO0A 4DMKA 4PXYA 5ILGA 3X2FA 3LQRA 4N0DA 4RZXA 5J47A 2XOKG 1MO3A 2MR6A 2MWMA 3LFOA 5FBQB 1A04A 1GT6A 2WYWA 4IUBS 5EP1A 5HCIA 2XRZA 2OV3A 2FWAA 2DETA 4QYXA 2OB1A 3FCSB 3S2ZA 4J49A 3VR6H 3KQOA 3B6MA 5AVKA 5IAJA 2YQZA 3VBCA 3ZEAA 1SB8A 4BJ1A 4GDFA 4JR0A 3K15A 3GN1A 2CTWA 4TXHA 3HBLA 4G5FA 3VVBA 2BSQA 5EUQB 1K63A 1IXRC 5DXJA 1GY8A 1KAQA 5H2FZ 3MHHC 3TD4A 1V41E 1IVYA 5EB0A 5EEHA 4G67A 5SYNA 5T5QA 3ZV5A 3FTFA 1CUUA 4JF3A 1SQ0A 4AILC 4NL4H 3BWEA 4TQ9A 1QONA 3FYIB 1E2NA 1QV7A 2UUAB 2A67A 2IYAA 2NZXA 4J1SA 4ZCQA 1NKSA 3VR4A 1W25A 2WQ6A 1ZY2A 3ND8A 2IVZA 2OK7A 5LMNO 1GP2A 5B5SA 2WM2A 1I1HA 1SCIA 3TWOA 5L4SA 4BGUA 4U2CA 4R6XA 4RMNA 2HEIA 2EBFX 2HA2A 3SE7A 2WG0A 3E1GA 2QG6A 3IMKA 1Q2XA 3WX0A 1ZINA 2C2YA 4UCUA 1BS2A 2QTOA 3EK2A 4DQKA 4JOSA 3KFXA 1FFDA 1RRGA 2Q8VA 1OSNA 1E3IA 3DCIA 1GSIA 2YI9A 1DT3A 4ZOQI 3ZMZA 1IY1A 3PF8A 3VTIC 3PR1A 3LVFO 5CYFA 3E3MA 1RC0A 3D6JA 2ONZA 3QMPA 5DCUA 3JSNA 3S2IA 1KRHA 2GEUA 1Z56C 3GD5A 3JR3A 4QDJA 4B7KA 4DG9A 3IPAA 4Y2SA 3L0YA 2C95A 1U9JA 5FPSA 3R7NA 5BOVA 5BXYA 4PJ0Z 3FMGA 4LTDA 4E5PA 2R8ZA 2UDPA 3WAGA 5F2VO 2E55A 3EXIA 3L5KA 3DJYA 5L4LA 4BFVA 2IYUA 2F43B 2ZRCA 4O4IB 2H2WA 2RKOA 4D8XA 1OKKD 3RUPA 2Q4RA 3O03A 1I10A 1EDBA 3CCJV 2X9NA 3V5NA 3T3IA 3VC1A 3VKFA 4NCIA 2LV8A 2V8OA 1NR1A 1OLUA 2XWBF 1ZMBA 3FB4A 3FWYA 3SHTA 3W77A 5A4DA 1GHTA 3IUBA 3KJXA 3P45A 4KR0A 2AFIA 4HDSA 1PS0A 2OYSA 1VI6A 5H4HA 5L7TA 1X2BA 2PMWB 2RHTA 3WDLA 4C89A 1U28C 2E7ZA 1WRBA 3OIGA 3QYJA 5F21A 3HKCB 2VI5A 5KSPA 4OYHA 1ORHA 1N5KA 4PIPA 3GLGB 3HZOA 4IJ6A 4JK3A 4RK4A 5CN0A 1P29A 4HLQB 3HFJA 5E7JA 1SQQH 4CU5A 1B8OA 3IVMA 3LM8A 1JHQA 1DTSA 1TUEA 3PC7A 5ADVA 4K7JA 4PLGA 1O4VA 4FC7A 1JMVA 5CNIA 3VNAA 1Z5ZA 3OFNG 2XA9A 5AVRA 1Q8IA 3GH1A 4J4BA 4KR7A 1P18A 5AW6A 2CDAA 1ZN7A 4Y18A 3ZYCA 1WVIA 4EGFA 3NHBA 3PCRB 1JOYA 4O33A 1FAFA 1XI1A 4PA7A 1DZ3A 3A11A 3BZBA 4Z2YA 4NYIQ 4ENVA 1RRMA 3AB3A 3RS4A 2BM9A 1CF2O 2JHPA 2VDUE 4PY2A 4BO1A 1O0BA 2WDZA 4ZVRA 1NZJA 1RPNA 1P2VA 3ANXA 1OZHA 3GUCA 4AMYA 2OENG 3ZCXA 4QUEA 1MRNA 4G01B 4MUGA 3ZCVA 3EVAA 1U1EA 4EG8A 2PZ8A 4X88A 1DG3A 3O3OB 4QFBA 1X7DA 1MX1A 1RRKA 2J5BA 5KX5A 2R1TB 4B74A 1O8BA 4Q1DA 4WBNF 1VE1A 3LQKA 3H2YA 5F5LA 2X4GA 2GF2A 2BFBA 1AUQA 2UAGA 3BJZA 3OM0A 1JB9A 2PYJA 1Y66A 3KZNA 2FCAA 2VVTA 4F60A 4R6ZA 1N6HA 5CA0B 1A50B 3D3WB 1HRKA 3TZHA 5F1KA 5JTUA 3CNLA 4WTOA 1M34B 1V11B 2NT4A 2RMKA 2X3UA 1FXKB 2QWNB 3PYMA 5ALJA 5K1PA 3TTXA 4B3HA 1Z25A 4N0EA 3AZQA 3E27A 5H7XA 1O54A 3ZD8A 3C8UA 3PHGA 1BE3H 1FNKA 4BKQA 1S6YA 3EGCA 4JLAA 4CDNA 5B8FA 4LCKA 1L4GA 1XQ1A 1CSEE 1T2AA 1Y3CE 4PC3A 4QBIA 2B4AA 2DKNA 4WEOA 3ZH2A 4OVKA 4OI0A 4G27B 4F7DA 1V6SA 4EITA 2PDAA 3L46A 1L7XA 1WUJS 3A0RA 2WIDA 2WSBA 1HP8A 1CV2A 3QTYA 2GR9A 3LUPA 4TX1A 5LQSA 5CGZA 5FUQA 2YIBD 3CWZA 3O1IC 4J76A 3WE7A 1RLUA 4MZXA 5DRTA 3SOPA 4CNQA 2W42A 3THOA 2EZTA 1UBTS 1WCWA 3PJRA 3FX2A 1NBIA 3JQ7A 4EB8A 3DF7A 1W46A 2ZDGA 5DGDA 1UADA 1UKAA 1VJ0A 3AY6A 4QXOA 4TRMA 2XCLA 1Z2OX 5AKKA 2DFNA 1WXHA 2PD6A 1F23A 4QOEA 5K4AA 3CC2V 4ETIA 2G04A 3VO2A 1LSSA 1NA5A 4LXGA 1NVUQ 4F5EA 3P5SA 5L3VA 4U8GA 3T1QA 1JEAA 2FUNB 3IB3A 4IRMA 3GJ0A 1FP6A 3CRRA 2I3DA 2XQIA 2Z95A 3A1DA 3MJSA 4PPNA 1QWSA 4H18A 4Z0TA 5LQAA 3WJQA 2DYKA 1D6NA 2NSLA 1DSSG 1OU4A 1PR4A 2M6LA 4UJ5A 5DNWA 1UBLS 1DXHA 4CLDA 2GZDA 4GBJA 2XITA 4PTZA 4LX8A 1RC8A 2PGXA 3DP9A 3KEQA 3LPDA 2YW2A 3T0FA 5FTNA 1TUBB 2BHSA 2DQYA 2HMUA 2WJIA 1LGYA 2HV8A 4B4WA 2UUPA 6Q21A 1VMGA 4LJ7A 1T29A 5JNWA 5IWAO 2XNDG 4TS1A 1X92A 3DT6A 3PDJA 3U11A 3SI7A 3L82B 1N5RA 4A6XA 3DDCA 1KU6A 4ZCIA 3JAWA 1S3IA 4BFYA 4WFBV 2J3MA 1KMHB 2QRPA 1C7EA 1Z5UA 3B1FA 3EF3A 2RB4A 3AGQA 1YDXA 1E9CA 3P9ZA 5G0WA 3RSSA 3KKZA 1HNXO 1GCUA 5JH7A 1THGA 3F0TA 1KKUA 2HJRA 2ZT5A 3C0KA 4HI0E 4KYUA 4F9EA 3LLUA 1EUCA 1SS3A 3LY5A 4G3XA 1BKYA 1OKKA 3PL5A 4ZT6A 1LU9A 1YJAA 3KUKA 2W2LD 3W2HA 2IEAA 5HNKA 1JLSA 1T3GA 3OFNA 2SICE 4KPYA 2QBYA 3KL4A 4X20A 1WMFA 3PFCA 3WQRA 4MVMA 4B6GA 4E5MA 4CGZA 1G291 2BE9A 3PPIA 1R7RA 2OV2A 4A26A 4XVCA 4G88A 3FHCB 3SEZA 1G9SA 5DWQA 4BMNA 2IX9A 2OP1A 2J0SA 1QK4A 3MJEA 4KQGA 2FNAA 1E1DA 3QKUA 3LK7A 3KKEA 4FZ0A 3FD5A 3AVOA 4WA8A 5JZOA 3RVYA 2BWJA 2IZ1A 1L3IA 4M8NE 3GJQA 3JARB 2DYSC 2WT4A 4RMIA 2RBKA 5D2CA 4GXQA 6YASA 2WIKA 3II6X 2NTYC 4UXNA 1AXRA 1G60A 3N59A 4PG7A 5FPRA 5KAMA 1RXVA 1RU3A 4RZUA 4RJIA 1QHIA 1EFVA 2YXDA 3ZXYA 3OPXA 4PLTA 1WR8A 1GNSA 1REQB 1TKCA 1TUBA 2DG2A 2HBQA 1KU9A 2JJQA 3S7ZA 1NC3A 3TX2A 3KCNA 4RTJA 4FKMA 2PI5A 2GA8A 5H3HA 5IYZF 4HYOA 4TWZA 4FVMA 3NVIB 1BW9A 1FUIA 2CL5A 2UYGA 3AG3C 5FV7A 2V1XA 3O8OB 3MINB 1NH2D 4LFCO 4M1MA 4MUXA 4RNDB 2NU9B 5K9ZA 3IAS6 3OW2F 1YIDA 1T5SA 2YXBA 4H1WA 2EW8A 3OQ6A 1QV6A 1XWWA 1ZJJA 3B89A 3GVXA 3X1YA 4D9GA 1U8UA 4TROA 4TXLA 2WLKA 2FW7A 2BKEA 3PGVA 1W2BF 1O4WA 4A3SA 4J16A 3VKWA 2LP4Y 3S3XA 2LP7A 1X7YA 2FMXA 2VTEA 3JW8A 2OHVA 3DZKA 3KYCA 1MPXA 1YNSA 1HKUA 2BSXA 3H2JA 4QL3A 4UE6A 1Z7BA 4O1MA 2VK4A 2WKSA 2YV2A 3RHZA 4F12A 5JZBA 1XMJA 3CWQA 3QOXA 3I4LA 4Q9NA 4UM8B 4PDLA 8ABPA 1Y9DA 4JJIA 3WLLA 3BKXA 2POCA 1TJYA 2QUZA 3WRVA 3CP1A 2DHCA 3CJHB 5I9NA 1PYOA 3GLKA 1K5GA 1AGXA 3AP3A 1PN3A 1L7QA 2QL5A 3MUFA 5B3LA 4B44A 3FDIA 4YQFA 5C32A 3DV9A 1LQUA 2VHJA 3N75A 3U9SA 1UPAA 4WCFB 4UOZA 4GPBA 2ECQA 3ZVLA 2F6RA 4X64O 2OLJA 4U9UA 3KLPX 3B1ZA 1A5TA 5LZ2A 2Y0EA 4GM4A 4I5SA 5C37A 3A31A 4R2XA 3RIYA 4EEZA 3P7MA 2I67A 3K59A 1R8YA 4DR6O 1SXJA 1Q44A 2JJ1A 2FN8A 5CDGA 1NZFA 5DM1A 4J0GA 2H2IA 5K8VA 3QXJA 2GGSA 2UU9B 2VRWA 2VPYA 1JFVA 3T0GA 3B1VA 4L07A 2G09A 4UD2A 1P9LA 3O73A 2R96A 2EJUA 1E0SA 2W83A 4HUJA 4MSUA 4P5PA 4QU5A 4XSVA 4YS6A 4BN5A 4C0WA 3FSEA 4X62O 4E03A 3NXKA 3NPMA 3WTBA 3DAOA 1SVWA 5CVTA 4Q6BA 2H2GA 5F9HA 4ZOAA 5FTJA 3L0ZA 3ENQA 4OLHA 4RTPA 2IS2A 4K35A 5CB4A 1KK1A 3UH1A 1KI8A 2NU7A 4C4RA 3FTDA 3EEFA 4YWJA 1B8NA 3D5QA 4L0MA 3EWSA 5CT4A 3RSOA 4IYHA 2IYWA 2WF5A 3ORYA 3PIIA 3LC1O 3TZKA 3ZPXA 4BE7B 4F4DA 5F2OA 1J56A 4ZDKA 5CM9C 1Z5NA 4PZLA 4KC0A 4R1SA 4H0LB 3EQ6A 3HR7A 1QH8A 2OCHA 4EMSA 3U60B 1WPRA 3AFMA 5EXPA 2P6RA 1T24A 5BUCA 4ZYTA 3MCTA 4MRAA 1WHSB 3EULA 3O7MA 2B4RO 1VQ1A 3AX6A 4G5XA 1MU0A 3R6DA 3CH7A 1P77A 3RN4A 1CY4A 3V1UA 1L5KA 2OVFA 4QX6A 4B6FA 1CKEA 4MI6A 5CDHA 1EBFA 4M8KA 3ID6C 2N05A 5KAIZ 4LF7B 4D8UA 2YXYA 1VZ2A 1J8VA 3S4YA 2DYRB 4E3ZA 1J24A 3CPJB 1DKOA 5KCMA 5JISA 3MD9A 3M6AA 4XGQA 1NVXQ 4F0JA 2H2FA 2Y0CA 3QWBA 1ATZA 4A8JA 4YCMA 2FOIA 4E08A 1ZICA 5FOSA 5EJ9A 3AR3A 2Q3FA 2ZKOA 1MIOA 1MQSA 3VR3D 1UFYA 3IUYA 4CQMB 4AKTA 2AQKA 3MWEB 4E46A 1NVBA 3U4CA 3VUFA 3HMKA 1PJBA 3RUAA 2PSDA 1K8ZB 3CXCU 2R4UA 4K9MA 2PSJA 3SSAA 3GZNA 4N76A 5IE9A 3KSUA 4NK5A 4P0PB 1K8RA 4WDQA 3NYRA 2B5WA 4DMHA 4Y2GA 1T4CB 1XXHB 2OHJA 3BTOA 4HL6A 1ZHFA 4PFSA 3CN7A 3WAKA 4B47A 1QO9A 2D1RA 5ICGA 2XRFA 3ENVA 4AP5A