3JAKB

Cryo-em structure of gtpgammas-microtubule co-polymerized with eb3 (merged dataset with and without kinesin bound)
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
429
structure length
429
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 151
structure length 429
sequence length 429
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jakB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jakB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jakB01
1SA0A 3HKCA 3RYCA 4O4JA 5EYPB 3N2GA 5LA6A 5IYZB 5C8YA 4I4TA 4U39A 3V3TA 4X1IA 3E22B 1JFFB 3RYHB 3HKEB 5JH7B 1W581 2RHOA 4KWEA 1FSZA 4ZOLB 3WGLA 5EZYB 4F6RA 3UT5A 4X1KA 3JASA 4TV8A 3HKBB 4X20B 4WBNB 5BMVA 5LYJB 5MN5A 5LP6A 3M89A 1Z5VA 4HNAB 5LP6C 3HKDA 4EB6B 4U3JA 3WGJA 2XKAA 3RYCB 4O4JB 5IJ9B 4O4LB 3N2KA 5FNVB 5LA6B 1Z5WA 3JATA 4I4TB 3VPAA 4IIJB 4DXDA 4O2AA 3JAWA 5J2TA 2VAPA 4DRXB 2R751 1OFUA 4IHJA 3JAKA 5CA0A 1W59A 5MN6A 5CB4B 4LNUA 4O2BA 5IJ0B 4M8IA 4F6RB 3JALA 4TV9A 4YJ3B 5J2UB 5CA1A 4X1YA 4YJ2A 5LXTB 3VOAA 2R6R1 4U3JB 1FFXA 5KX5B 4I50B 1RQ7A 4I55A 2BTQB 5GONA 3JARB 4E6EA 2BTOA 1SA0B 3HKCB 3RYFA 4ZI7A 4O4IA 1W5AA 3C8LA 3RYIA 3N2GB 5JQGA 1W5EA 1TVKA 4LNUB 5C8YB 2GVIA 4X1IB 5LOVA 4B46A 5CA1B 4X1YB 4O4HA 5IYZA 4FFBA 3WGKA 4YJ2B 2VXYA 4EI7A 3UT5B 4X1KB 3JASB 4TV8B 5BMVB 2VAMA 3E22A 5LP6B 2Q1XA 4I55B 3RYHA 3HKEA 3HKDB 5GONB 5KMGA 3VOBA 2RHJA 5ITZA 4ZOLA 1TUBA 4ZHQA 2RHLA 2Q1YA 3RYFB 4TUYA 4EI8A 4WBNA 2XKBA 1RLUA 5JVDA 3N2KB 5JCOA 3VO9A 3JATB 4HNAA 5JCOC 4O2AB 3JAWB 4EB6A 5J2TB 3ZBPA 4IHJB 3JAKB 5CA0B 5IJ9A 4O4LA 5FNVA 4O4HB 4FFBB 4O2BB 5M7EA 4IIJA 3RB8A 4DRXA 4B45A 3JALB 1W5FA 4TV9B 4EI9A 1RQ2A 5EYPA 5CB4A 3VO8A 5KMGB 5ITZB 5IJ0A 1TUBB 4ZHQB 3ZIDA 3ZBQA 1FFXB 4TUYB 4XCQA 4YJ3A 1JFFA 5MN4A 5JVDB 5JH7A 5J2UA 3CB2A 2VAWA 5LXTA 3WGNA 3M8KA 5EZYA 3R4VA 3HKBA 4X20A 4O4IB 4I50A 5EIBD 5LYJA 4ZI7B 3RYIB 5JQGB 5KX5A 3WGMA 1TVKB 2BTQA 2RHHA 3JARA 5LOVB 1W5BA 5EIBC
chains in the Genus database with same CATH superfamily
3CVXA 2ENWA 2AZMA 5BSFA 2ZRLA 3M9WA 1KQPA 4NZOA 1SQXH 3O9MA 2HNAA 2NT4A 4B32A 3QNEA 4FEEA 1GFSA 3ADPA 1I6KA 1NVFA 3MRSA 3D0KA 4MIYA 3W2IA 4QBFA 13PKA 2FN7A 4G8BA 4Z3KA 4FHEA 4QPNA 4K9KA 2FWJA 3BEDA 2A9RA 5CDTA 2RKOA 4AROA 1EI9A 5DNUA 3BOSA 4B2LA 1SZCA 2ATEA 1GCUA 3OUTA 3QF7A 5EWLA 5LQMA 3DDZX 1M56C 5A6VA 4BBZA 4C7OB 3QF4B 1W2GA 3DQQA 2Z8ZA 2P5UA 1Q3EA 3K35A 1PDOA 3AQIA 1H5UA 2W22A 2JZOA 2IZZA 3K0DA 1Y7LA 2P78A 1PJZA 1P8AA 3PK0A 3FUTA 5EQDA 3HB3B 2X7RB 3SJZA 4RPIA 2GXAA 4G4SO 3MIIA 4KYVA 1H6DA 2NTJA 4HN2A 3Q6IA 4B08A 4XKJA 4K6KA 2WMDA 2XJ4A 3MJFA 3B3JA 1CJCA 1U2SA 3MAAC 4RD4A 5EP4A 1DXYA 3I05A 5DNVA 5BYKA 3ROQA 3FDZA 3MCQA 1AV6A 4ZAFA 1NBMG 3TRIA 4RS3A 2WMYA 4J16C 2AL7A 1JJAA 3RF7A 3GFSA 1CDDA 2XDYA 2PUBA 2P4SA 1WD7A 3ZWBA 4D4JA 4MTLA 2HM7A 4W82A 1R0RE 3D6JA 2QTPA 1CZHA 5EC1C 2BCGY 3JQRA 4PYQA 3E9CA 2Y0CA 1QPGA 2GUZB 1W94A 1YK0A 4NEGA 4FMDF 3RUDA 5EJ2A 4ENSA 3AK4A 2B9EA 5JXIA 2AB0A 1EHCA 2EG9A 1IATA 3NHRA 1O6GA 1RXYA 4BC0A 1JSXA 2BM8A 4LF7B 1B1CA 1R6KA 3LUFA 4V2UA 1Z4PX 2JIZA 4AZTA 1Q2XA 4JZKA 1GQ2A 2FPPA 4UTNA 2ITCC 4JLWA 2FZ4A 5AJZA 3DR3A 3N5CA 4R7ZA 1JHRA 1JSCA 1JKJB 3PVZA 3DXYA 1U0GA 3V1YA 3ZBTA 1E79G 1K9SA 2BFBB 4PSDA 1VG0B 1R8YA 2KE5A 2OCIA 2ZR0A 1QH0A 1Z5VA 1A8IA 3UN1A 4ZZ0A 3V42A 1HSZA 1VBMA 5GINC 1H65A 2R4QA 2WVAA 1XDZA 2I3ZA 1Z0IA 2Z2JA 1MRZA 5HEKA 5BPFA 1P31A 3RUCA 4MR8A 3VNQA 3I6ZA 3UO8B 3L49A 1UM9B 2OKGA 2WA3A 2Y1EA 3H2KA 4AIRA 4WBNA 1IB6A 3OMXA 1UIMA 1WE2A 4OJMX 3FUVA 4YMSA 3R7BA 5SY6A 4IIJA 1RSOB 4JBYA 2HMWA 2MMCA 2WTNA 3W5HA 1NI5A 3RROA 1XVLA 5GVSA 4B43A 4DR5O 4UTPA 3R9WA 4KAXA 4DYDA 4G81A 1JRLA 1C9YA 2WK1A 5CGQB 1F20A 4QQRA 5TEWA 2EJVA 1DC5A 4BKMA 3SOPA 2GHTA 3LUPA 3SY8A 2WJZB 4GMGA 5CG1A 1QOQB 3CNBA 1L0LH 2H3OA 2KG7B 3DBHA 1Z06A 1N2CE 1XCMA 1O0SA 2OYCA 1YOBA 4U7OA 3WLQA 2VAVA 4D26A 4MDYA 2ZYRA 3TETA 3KJIA 1VMGA 1VQ8V 2R97A 3E82A 2AVNA 2VWKA 2GJ9A 1RHRA 1T25A 4BQIA 3I5YA 1I5RA 4I5SA 3UKJA 2F1JA 4GVLA 2NYAA 3AGQA 4JASA 4U7TB 4YAJA 4HNVA 2QAIA 3JAKB 3SF0A 3SQDA 3ZKWB 4YIHA 2OXTA 3OZUA 1EFDN 5EYPA 4JI2B 3LA6A 3NORA 2NO0A 3IPXA 5J4YA 3PGJA 3ZW8A 1ZN8A 4B7UA 2GJKA 4X6LA 5L4SA 1QHTA 2O5VA 3IYLW 4M1KA 5BR7A 4L22A 4QICA 3A06A 3G4SF 5JCXA 4GI2A 4HG2A 4NQ3A 4PN7A 4PG4A 4TYMA 5IF9A 2JCVA 3C3EA 1V6CA 5HG0A 1V25A 2IM9A 1MC8A 4RIIA 4U2KA 4FFMA 5F2KA 421PA 1UBNA 4PFSA 1F2VA 1QCDA 4TS3A 1G59A 1U1GA 1SOVA 2X6QA 4F84A 3TSZA 3LUDA 3G59A 2IYZA 4D2IA 4ZHSA 4IFTA 1YF2A 2M32A 3GAMA 3QKRB 3EWAA 1B6TA 4ESOA 1OX6A 3CUKA 1U9IC 2V7QA 4PGGA 5JISA 3SDSA 2QLJA 2UV8A 2ZVZA 1CHDA 4Y6SA 5JS8A 4CDMA 1MO5A 2V55B 2FHPA 5I51A 4DM3A 5EJ4A 3JV7A 1RADA 2O2JA 4UDNA 4GR9A 2A86A 3B3AA 3WYEA 5HKKA 2WWYA 2P9JA 3FTPA 1I0ZA 1NVTA 5BO5A 1VQ1A 4E6PA 1K8AW 4EUHA 1JFFB 5L8VA 1JHQA 3HA5A 3K94A 3SXUA 1U9YA 2XYPA 2JLXA 3AKDA 1CJUC 2FWBA 1X7HA 3D5QA 1NJ5A 1C9JA 2JAQA 3QMWA 1KMMA 1V9CA 4BZXA 2ZBEA 4D9EA 1E1QD 3OZGA 3KETA 1MDFA 2GNPA 2Q46A 1QPBA 2P9YA 4DLKA 4OHYA 5CM9C 1JQLB 1XDDA 2B78A 2VHCA 5G0TA 4RVFA 2DCMA 2C5HA 5IVIA 1X9IA 2ZXWC 5K6AA 2YVAA 4UVBA 2JGIA 4K05A 2X15A 2GNAA 3QVMA 1N2CB 5TC4A 2OENG 4AM8A 1MB0A 3TE6A 1HV8A 1CQXA 2ZRPA 3HA3A 3JCMM 1VKNA 4BMVA 3HHPA 3MS4A 1L8XA 4B80A 5F7ZA 1B2RA 1BCSA 3DE0X 3AYZB 4HLUA 1CD5A 1JHUA 5CFRA 3N76A 2I3BA 2XIJA 3UT0A 3OFSA 1K73H 2H0AA 4UVIA 1FNCA 3TTUA 1KY3A 2QVXX 3RTCA 2XZTA 4J4TA 5GVRA 3SYOA 1AU9A 3GGJA 1E9AA 3RS5A 2JAOA 5CFLA 2V6FA 1H8HD 3N2GB 121PA 5EPEA 4WFIA 4B4OA 5F7JA 4YJ2B 4R1NA 3R6GA 2XI4A 3PC8A 2J6HA 3JR7A 4OL9A 5LZ8A 2Z1FA 3CMAF 3OQBA 2R2AA 2APJA 3THYB 4COKA 1FBTA 4OHUA 2FOXA 2XYVA 1P0QA 3AKCA 4PVDA 5EJAA 3BFKA 5B58T 1Q84A 2KM1A 3VXKA 3BGDA 4BU0A 1I8TA 4EG4A 1N1EA 3RS7A 1MCZA 2X0NA 1MDBA 4Q01A 1YCGA 3TZCA 3L7KA 3H0CA 2GK4A 1O95C 1QB7A 1OAOC 3QFTA 3OF2A 2B2NA 4MB6A 5KYTA 1GEGA 2HQBA 1F2DA 1H2BA 3L9XA 4K0KB 1AXRA 1LDNA 3GPDG 3WADA 2D2EA 3HV2A 5G0UA 1H2NA 2R751 2DSNA 4F11A 3JD1A 1XOUA 1N8KA 2AD5A 1CB0A 2RGDA 3MJHA 2V5VA 4G0XA 5IHXA 1YRQA 1U0BB 2D13A 1S5JA 5BUQA 4RK4A 4JWKA 4FVTA 4AK9A 4XYEA 3S2GA 1BWPA 1JEYA 2M6SA 3UWOA 4CIWA 4PDLA 5JNLA 3IHWA 3AIOA 2Q3CA 2JIBA 4CRWB 5LC1A 1U3TA 4M37A 3NTXA 2WHRA 1DCTA 5FBQB 3U9SA 4BATA 1II0A 2A57A 4XCXA 1RKXA 1X3SA 3OX4A 1GAXA 1PP9H 2PKXA 1G5PA 1XZDA 1GGJA 1S2GA 3QFRA 5KMGB 1PGPA 3SS7X 2JIPA 4NTYA 4P2GA 3FYUB 5IFLA 3MIZA 2X0LA 3K6RA 4WXRA 1OB5A 1XRSB 3S81A 2IZ6A 2N47A 2NO5A 2P0AA 4MRMA 2ADQB 1OILA 5I01A 2K4MA 1LK7A 3JD2A 3TLJA 4NE9A 5BW8A 1WL8A 2JIQA 5CFQA 3F6CA 3PX2A 3K9LA 2H8PC 3MHSC 1XUQA 1KC3A 4TT8A 4Z9FA 4LHXA 1J06A 1QHXA 4LV6A 3HL0A 3ZWWA 4RUEA 4MTGA 3GPBA 2PS1A 2DKFA 4H4EA 4MSWC 5CHEA 4DS3A 5HSGA 2GPBA 4OFZA 5J1TB 3QRWA 4UUNA 5A0VA 1ZD3A 3WLNA 3KQTA 4NDAA 3SX4A 1XELA 4Q03A 3TPCA 1I2DA 1TRKA 4HQ6A 3WLMA 5IF3A 2IOYA 1YDGA 4Y1RB 4N6OA 3GCWA 1KFCB 1QO7A 4TTRA 2V7EA 1SHZA 2CBGA 4YYZA 3DFFA 2HJGA 4Q1EA 2B7LA 1J5PA 1TQ8A 3IH5A 3NNSA 3LSSA 4O25A 2GAOA 5A6SA 1K7EB 3BA9A 1RWNA 3DL0A 3C3TA 4YRRA 3QVWA 5KVQA 2A5JA 1LI4A 3MGBA 4ZREA 4ASUA 1KY2A 5F78A 4BV2A 4C6TB 5AUNB 3QBTA 1HYHA 1V8BA 1B3BA 4LV5B 1HMYA 4HB3A 1IY1A 1NQAO 4FGLA 4BAYA 3E7DA 2A3NA 2ARHA 2UUCB 1SUAA 2LXNA 4ZJPA 4ZK6A 1CUDA 3FNQA 4NULA 1PZMA 2YFHA 1P75A 3PHIA 3DOEA 4FVMA 1Q7RA 1U81A 3FGZA 2P2LA 3A1NA 5LJLA 1R50A 3MMNA 3F49S 2EBWA 5KOHB 2UZ0A 2D06A 5IEBA 1S72V 4IKOA 2WWXA 1I3NA 2A78A 3C87A 4E5SA 3STTA 2OZBA 1C3OA 1M1UA 5EJ7A 1ULSA 2CB9A 3OR6C 3MQFA 4Q93A 4QDKA 5J23A 1RXWA 2OBYA 2JVJA 5TQ2B 1A8HA 3E5HA 3ABMB 2YFKA 4E70A 4P98A 5THXA 1TK3A 1JDBC 2UXDO 4Z4GA 1X1CA 2YHIA 1E2IA 2IVFA 3AEIA 1LGYA 2GM4A 1EBOA 1YR7A 1E1QA 3H5LA 1DKOA 4NXMO 1JN1A 3HP7A 2E75B 2UXCO 4LHWA 3SYLA 1C9NA 4ARZA 2VTVA 1JUDA 4GVXA 2YUAA 4YCMA 5ALUA 4TRJA 2YXBA 4P86A 3IBCA 3T1TA 4HDSB 5H9VA 4YK7A 1Y4DE 1RM0A 4TLDA 3M6WA 4S12A 1KKLA 2JGDB 3STVA 1UT6A 5ALSA 2ZXFA 4IUBS 5DLEA 3WVNA 1JYEA 4CG0A 3RVBA 5JT1A 2D0DA 2Z4SA 3OECA 3NO4A 3ZCCA 2OHIA 4JYZA 1DWQA 2RNBA 2I0FA 2XPCA 2BEVA 4EUKA 1M66A 4R98A 3SZUA 3D8BA 1GYPA 1ORVA 1P4HA 1ENZA 3H4IA 4YAKA 4D92A 3DEJA 1U0LA 1K9MW 1SVMA 3BXPA 2A92A 3EC1A 4G2TA 2BBOA 2NO6A 4BVEA 1A1VA 3MPOA 3ZNPA 2VRNA 3DO6A 3KSUA 4ALKA 1DOAA 2UUOA 3R3UA 7REQA 1PDVA 5IYDO 2RAUA 2PEZA 1P1RA 4D97A 1H8HA 1YI1A 1WBBA 5ALOA 3CWQA 1PNRA 4HD8A 3UJNA 2GH1A 3OCXA 4JBIA 1TO6A 1RJGA 2GBLC 2I66A 3LH5A 5DOVA 4QOFA 1VI5A 3VQVA 4BVJA 4UHHA 2C29D 4BDSA 8ADHA 1LA2A 4AY6A 3COSA 4BZWA 5TSDA 5IYZF 5HQ3B 3RU9A 3EQ6A 1HDGO 2LKCA 3E58A 3GK3A 1RKUA 3W5UA 1SETA 2ZJ0A 4BNUA 3ANYB 4UZFA 2YI8A 5J58A 1GDTA 1Y66A 2O8CA 1E6MA 4V3CA 4A8JB 1WVGA 5AJYA 1B41A 1D5CA 1U9ZA 5JRJA 5ITVA 2ZI5A 1WSBA 2HSGA 3LPDA 3IOCA 2VAPA 5IASA 3QYPA 4M1OA 4MW7A 3I2HA 2VTBB 5JEDA 1WLEA 1NKDA 4RQAA 2G70A 3FZNA 4R0NA 1QORA 1E3DA 1XMOB 3CC7F 2ZJ8A 1Y5MA 4E4RA 3ROXA 2CXOA 3WQRA 2GRAA 2HMUA 3H75A 1LPPA 2NNLD 4CIDA 4PC6A 2IYTA 4KQHA 3PG5A 3MVEA 4IIVA 2H54A 3ZTWA 1U0NA 1GZSA 2OA0A 1TAEA 1L5ZA 1UJ5A 1RAAA 4AKEA 3VC3A 2ZT9B 1FFSA 3AB8A 3NRCA 4YT5A 1JKIA 1B1AA 3C2QA 1VYUA 3A6EA 5BQXA 1OCZC 4UVEA 4LF9O 4F5EA 1GNQA 5KVCA 4F56A 3M81A 4EJSB 3IR9A 4U02A 1ELOA 3M7MX 3X2FA 3ZWQA 2HU8A 3L05A 3PNYA 2ZDGA 4CKBB 3V4RA 2XEXA 3MOIA 4TVSA 3IAM6 4KR6A 4M9ZA 4NG4A 1PNLA 5CVTA 1LQ2A 1B8UA 2VWJA 4PCVA 4FFKA 1UPXA 3E1GA 3OJCA 5F76A 4EB6A 2VP9A 3N7AA 3V4SA 1ZGZA 2JFZA 4J43A 5ALEA 4MV7A 4WSOA 2F66C 2AC2A 1NOJA 5LMZA 4YEDA 3RRYA 1ZDMA 3GWZA 1J2EA 5A9SA 1T34A 1S4QA 4DQLA 4TT3D 2RHCA 3NVKE 1M1NB 1YITF 4A2QA 1PL7A 2WINI 3T0GA 4A73A 5FX2A 1I32A 4DUPA 1AUQA 1WF3A 2VH1A 3KT6A 4WY5A 3GLFA 2HHHB 4H0CA 4KQIA 3B2NA 1YS7A 1PJ4A 3VHLB 3VHRA 2VKQA 4RVHA 1Y98A 1P4GA 1LTQA 3GJYA 2DOSA 2BJHA 2PQ2A 1ENPA 2Q5CA 2D59A 1PGQA 1S1MA 1KPIA 4YUVA 3O38A 4WNAB 1LX6A 5JY6A 3U3XA 3VQTA 5SYMA 4AX8A 1K08A 3H01A 1U1CA 1YJ9F 4AQYB 2ZOSA 4L78A 5TPZD 3C8DA 2X4IA 3FN4A 5A03A 5LZ2A 2DBQA 1DEOA 1D8TA 4ATNA 2BPOA 4KK4A 3IV7A 2RBKA 4J8PA 4Q4JA 1KAOA 3H17A 1VCIA 3U16A 1V16A 4BXOB 4U2EA 5E95A 3DHYA 4P58A 4E14A 5B1YA 2Q5IA 2Z6VA 2M9MA 3JYHA 2R8YA 2HWXA 3BRWD 3QVVA 2RI6A 2V7GA 4BZQA 3O93A 4X71A 1AQUA 4LYDA 2I87A 3E3LA 2OCGA 3WIUA 3ZRWB 2ZUVA 5AH0A 2BRUA 1YBVA 1V4NA 3DKIA 1YSCA 2FW1A 3RUAA 3RFCA 2NM0A 4BL5A 1NQTA 1XMQB 1YUMA 1DG1G 2GZ3A 4DQXA 2QRJA 4C4RA 2PSFA 4LOLA 1G21E 5F3WB 1AKRA 3BFPA 1YT5A 2H5LA 1RXCA 2C77A 5FNZA 2NO7A 3BVOA 4A0HA 1Q91A 4QASA 4GE0A 3DV0A 3ABSB 2HXSA 3GDOA 3I1IA 5DO9A 3V7WA 1IDOA 4FPPA 3ZJ5A 2IEDA 2PO7A 1M2OA 3JQ8B 1WBJB 4NR0A 2ZKLA 2OP1A 4WF9V 4IDPA 4FIZA 3HYTA 5KB3A 4NU0A 2IYRA 2GPYA 3A11A 3U3KA 2J3LA 2QP9X 2B3DA 3PUIA 3LBHA 1BE0A 3DKVA 5IBRA 3FG9A 4LDNA 5DYIA 3D8SA 3AUAA 1XDWA 4FYXA 1YQTA 4GOKA 1N5LA 2P2DA 1TF2A 2AYZA 4BLOA 3UV7A 2OD7A 3PNQA 1EP9A 4DQVA 1P2GA 1UR5A 4R1OA 3MTEA 1Z83A 5FOUA 4BFVA 4I19A 1ORQC 3KJZA 4BWGA 4QRDA 3OLQA 2DQZA 2G09A 4DCVA 2HU2A 1WZUA 4ENTA 2MSDB 1EESA 2HCRA 2AQHA 3OCVA 3JVVA 1ETUA 2ZJ2A 1Z7BA 1NU6A 1SXJE 2V9ZA 2XKBA 3UGKA 2GN6A 5KJ1A 3T9EA 4G56A 3QE4A 4N39A 4A0RA 1ZUIA 1ZZGA 3ZHBA 1PEDA 4QU9A 4LVOA 2HJSA 2IEGA 3PUYA 3JVHA 2IUEA 3CRNA 4CE6A 1U7OA 4X66B 1DGQA 3I4FA 1VXOA 2WSYB 2EGHA 3O6VA 2ZVPX 3EXHC 2F9LA 3AP3A 3AUYA 3PCRB 2NV2B 4KMRA 2OZLA 3RVDA 5EUCA 2ETVA 4ZU3A 4F92B 1JJBA 1ZNYA 1RC0A 4Z6KA 1SZQA 4OU5A 5BV8A 3N05A 2QU8A 4IOMA 2SECE 2HRZA 1V1MB 1QFMA 3F5WC 1OLXA 3L1IA 2R85A 4TRMA 3UCSC 1YC2A 2DR0A 3MERA 4LJRA 1DBSA 2Z08A 3K0SA 3BIJA 3CSXA 3CKLA 1F2TB 2B5VA 2X1VA 1YJCA 1QF6A 4ID3A 2IQIA 4LR3A 4XBFA 3FWPA 2RB9A 4Q6BA 3LGAA 1J1IA 5EIBD 2HQRA 4U6QA 5H6RA 1G4AE 3WNCA 5IVKA 4LF5O 5E7IA 1NZDA 4CQNA 4G36A 1BU8A 2QQEA 3L9DA 2FW6A 4OGLA 2BGNA 1J99A 1G21B 1OLUB 2OXCA 4MWGA 4E21A 4YGXB 1Z5NA 2Z3WA 4OP3A 4TTSA 2YHSA 4OKSA 5CCDA 2Q2NA 1XF9A 2CHGA 2VOEA 3PKIA 2E48A 1VQPV 2RGNA 3HDYA 4KEAA 2YV2A 5ENVA 1GH6A 3CUYA 3GEDA 4ZVUA 2PX4A 2J7KA 1H2AS 1Q0QA 1VRWA 3FM9A 5FTKA 3QPWA 3I61A 5K8UA 3P4XA 5B2FA 5EY5B 5ER9A 2HTFA 2P6YA 3PEYA 2WHEA 2PF4E 3GDFA 2ZB4A 1Y6RA 3OZTA 1YR6A 3TXAA 1VBFA 3A58B 2C3YA 4TT3A 3CRW1 3PIRA 1KP9A 3EW9A 3KZ1E 2NVOA 3IAHA 1SXJB 3O3NB 2NP7A 3KPJA 1LKZA 3S7ZA 4HDCA 4BNDA 1H4QA 3A04A 4JI5O 3UXMA 4NKRA 3U4QB 1V7PC 3BXFA 5EAIA 2AQKA 3AY6A 4HC4A 2Q3MA 3H11A 4F3CA 1NVUQ 4KDRA 1JKFA 3EK2A 1EJ2A 5CCBA 1M34E 2NX2A 4YP1A 3SX0A 1U28C 4CWAA 3TQRA 2QEQA 3I04A 1XZCA 2PSHA 2FN3A 5COBA 4IF4A 4EQ6B 4OUDB 3K09A 3OBBA 4A16A 5C37A 4ZYTA 1LNZA 3RU7A 1CF2O 3VISA 4ZC8A 4WFAV 1JNXX 5TPZA 3PQ7A 4CF3A 5M7EA 1O2DA 3REQB 4DQKA 1QMPA 1QWOA 2HLPA 1J0EA 2FFAA 3JQ7B 2AGVA 1KOJA 1S76D 3EG5A 3K57A 5F5LA 3E8SA 3P0HA 1XQ9A 3PQ6A 5AJTA 4RF2A 5B1DA 3H2ZA 2VJOA 2FA9A 4I6EA 3TMKA 3ZTYA 3BRWA 1YS4A 4RFVA 3OR7C 1FNBA 1QCCA 3PR3A 3R0VA 4Y6GB 2O2ZA 2G08A 2JASA 2MYPA 2YWEA 3EIEA 1JX9A 3ZOPA 4IOLA 4E1AA 1RWMA 4WJLA 2BHRA 4RPKA 5JNSA 1BT8A 1N2EA 4F91B 2Q0HA 4BMZA 1ZCAA 5KTPA 3PFFA 1SCIA 2VF7A 4RK0A 4JYAO 4K6GA 3PQ8A 1M90W 1PN3A 4EFMA 2H94A 1T9HA 4QGFA 2R3SA 1H2RS 1KI9A 1Q14A 4L76A 2VEDA 3GVMA 2QTBA 4FYMA 1F4MA 3IELA 3VPSA 1W6RA 2BD0A 1CE8B 4ZCSA 4YXWG 3GT7A 5F4BA 4MQ5A 4EJFA 2ZGVA 1YZYA 1MR3F 3N28A 3HDTA 4J9VA 3RSHA 4DB2A 1EXDA 3P32A 1KBZA 3S0HA 4P9PA 1QYWA 2PGDA 1PG2A 2FEPA 1UKYA 2XMPA 4PG6A 2UUAB 3QLVC 3AVUA 1FZTA 1YJBA 5HF8A 1GUDA 1YO6A 1UAGA 3PD1A 3HKBB 4WUVA 4JZYA 3BWEA 5EIHA 1S2OA 4RK6A 3UJAA 2YICA 1WXDA 4E5UA 2ACVA 1QK5A 2X9VA 3IE0A 4LTDA 3ORRA 1FS6A 3K53A 2DPXA 1LK0A 2WAXA 4X5OA 2R48A 1EJ6A 2FE4A 3S1AB 1YJWF 3H5AA 4R2LA 2VXYA 3NBYC 3E9DA 1T5HX 2XYHA 1K4DC 2YZNA 3VOBA 2J07A 4XD7D 1NIJA 4N8EA 2RMKB 4QUDA 5L3EA 4WT7A 3KZKA 4L50A 3GJ8A 4FFDA 4G3XA 3F6RA 3AR2A 1V96A 1X42A 4BX8A 3T7RA 3T80A 3N3AC 2BBTA 2Z9BA 3DC7A 1M34B 1Z56C 5T8KA 1JL3A 2E4AA 1X9HA 2VZ0A 1S02A 2VHQA 1KL7A 4IDFA 3SR0A 3DHEA 3BM5A 3RYCB 4ZYZA 2RI1A 4WOCA 1X9GA 5BVGB 5AM2A 4H35A 3QLEA 5BWMA 4P38A 4KFMA 1BDJA 4AECA 3ID6C 5FTNA 4DCCA 5J2UB 1X7PA 2WLIA 5EMLA 3JU3A 2OV1A 4CM1A 4DILA 3CS5A 5C80A 3ICVA 4D82A 2Y2UA 3R7WA 2N05A 3TTXA 3UYLA 2C2WA 1U6JA 2H63A 1U1DA 1KGSA 2CMKA 5JRDS 1AN0A 2DERA 4PRZA 1N0JA 4L3OA 2DN9A 1V2HE 3W8FA 5KYUA 2ORWA 3SCZA 2GASA 3QXHA 3G0OA 3EDOA 3CYFA 1E32A 1XTTA 3UO3A 4JI8O 2PUFA 4N48A 4ZKEA 1UK7A 4RULA 3ABZA 3C5HA 3GFTA 3ZDYB 5JASA 5IT9A 2ZTMA 2XUDA 4ARSA 1JQJC 2C99A 1LBQA 1SU4A 4U7JA 3I52A 4Y6QA 3NYWA 3TSCA 3I9LA 3SBDA 2DHRA 2A1IA 4UD6A 4DY4A 1OH8A 2ZSAA 2AV6A 3GZNA 5K3AA 4LMRA 3LW7A 4NABA 5FLXA 4CN8A 4GKKO 3JVEA 2PU5A 1H42A 2QDOA 4FMTA 1YIOA 4CCYB 3K4HA 1GHTA 3O2NA 1ABEA 2QN9A 1CCWA 3O4VA 4KOEC 2QTCA 4M60A 1VQ5V 3CLUD 1U0SY 5K3FB 2IH4A 4A7PA 1IPHA 4I9FA 1SQPH 2AUMA 4KLZA 3FMIA 1B0PA 2FQQA 4ESHA 2J87A 2Q4RA 3X1ZA 5C32A 4FOTA 4K3AA 4LIPD 2EIKC 2OSVA 1J70A 5F1OA 1UBLS 4QM6A 4S24A 4NPCA 3PU6A 2QTNA 1EVZA 4YRZA 3JAMM 4BNTA 3IP7A 5A7GA 4DVGA 3U4HA 1RPJA 1BMDA 4ZVNA 1NG1A 4AKSA 1J5EO 4A82A 1CR2A 1ZY2A 1K88A 5EEHA 4ZI3A 3IJEB 2RAVA 4M6WA 5CBFA 1IULA 1DG3A 4I14A 4MS3A 4DDMA 2ZSBA 1L1EA 1BGWA 1TA9A 1Z4LA 2WE8A 1S0VA 1YZLA 5KX5B 4QJBA 1KZGB 1I3OA 1Z4NA 4LJSA 3PP8A 4ZXPA 1YS1X 1OXKB 4KHPO 3KQLA 4OHPA 2C2OA 3IT0A 4PFQA 2QLBA 3OTQA 1UBJS 1BN7A 4KUMA 2QE6A 2V6JA 4MV4A 1UDBA 4PPGA 1P7BA 2O3UA 4P0QB 4WXEA 1L5OA 1P2FA 2A9QA 5IDYA 1DDIA 1KDRA 3HWX1 3R66A 1V1RA 4K2AA 5DISB 5IJ9A 3PCTA 2IH1C 1NUSA 3PZBA 3KL2A 2YIDA 4XDZA 1LJLA 3K9CA 2FG5A 4JI1O 1W49A 4I7EA 4IIDA 4BLSA 4BQNA 3ASYA 1G5IA 2QVZX 2V7BA 2IFTA 1TCUA 2JI4A 1E6WA 1Y9DA 3OEEA 5CFZA 1Y7PA 4P3KA 3BB3A 5LIPA 2Z5UA 3DP9A 2HF2A 4G5OA 2Q9CA 1R1DA 4F4UA 1UFYA 3T1NA 3HGMA 4YB8A 5HFJA 1G2OA 1T4BA 3KE8A 3PFNA 1ML4A 5TMEA 2G28A 3LLSA 4FM9A 1Y63A 2YBDA 4DV5B 2HK8A 5B1BC 3NS7A 4ZPJA 3B4SA 3UAWA 4E11A 4BLRA 5CVVA 4I50B 1RKQA 1QIMA 1W4CA 2XUMA 2NSHA 2C04A 2X6TA 3O84A 3QWHA 3PFBA 1JF8A 2PXHA 1D2AA 3JCZA 2YMPA 3ZHSA 2J33A 4ME6A 3UMRA 3W6NA 4CFSA 1E61A 4YUZA 4UDYX 4YCDA 3ZYCA 2OEPA 1DUIA 3GJ4A 2XT6A 3LYAA 2PL5A 2XNCA 1ZEMA 3VZDA 1LDYA 4RU1A 3EIWA 3T9DA 2QSYA 1H3EA 2CFCA 3WK4A 1BEUB 3WL5A 1J8YF 3ZV3A 3IBYA 3U17A 8AT1A 4XM2A 1NVVR 1LLFA 1D0SA 2AI3A 4PNPA 2R6JA 2YS7A 4RVUA 2P9ZA 5DYTA 2FZKA 1OYWA 4MVWA 2V4UA 4XPZA 2XOEA 2EZPA 3NAQA 3I53A 1K8RA 4RL4A 3ZGOA 3MRVA 5JV5A 4JEUA 4L0MA 3WC4A 3AHIA 3OWHA 1DTWB 3IHLA 4HQOA 1IQPA 5JI3E 3ROPA 4RCVA 2V7QD 2W2TA 1ZOOA 1KJ8A 2BKEA 2HADA 2CNWA 2H2AA 4NCKA 4M55A 2VDPB 4AG6A 4QYSA 1ECBA 4Y6OA 4ZV4A 1JEAA 3DV2A 2X7XA 2XCSB 1YKFA 3Q7EA 4GWGA 2VQ3A 1YZQA 3IE2A 4MHSA 2CUGA 2FUKA 4XD7A 1WY5A 3V4DA 1IV1A 3UPTA 5B2ZA 2NLOA 5HM6A 1IXRC 5ESRA 2CTQA 3SC4A 1UK9A 2NZXA 5JVDB 3R6DA 1EM1A 3L2OB 1X7YB 2DWDC 4ZT7A 4DBVO 1P17A 1WB7A 2B20A 4W4LA 1T5SA 4KGVA 5EZSA 1JX6A 2WHPB 3NBQA 3OOYA 4HAZA 2ZZMA 1RZVA 4EUSA 1H1LB 2F3SA 1A4RA 2W4IA 2FQ1A 4LQDA 3IPRA 2XRZA 2G4CA 3HCDA 4OIMA 3OCUA 2Y8EA 2PSJA 3JSAA 3RVYA 2WZCA 1HL3A 3WGZA 3W7UA 1L4BA 4CM8B 3OJEA 4YTEA 4RK5A 3AZOA 5AVZA 3G8BA 1QIEA 2RHDA 1LXCA 3BD6A 3EGEA 2FK7A 1VQKF 4MW9A 1C0KA 3P3PA 1UMDA 2AR0A 3NW9A 4JI0B 3D2AA 1FLDA 2JI9A 2W8BA 1IN1A 4EUNA 4RL6A 4D0SA 3KHSA 2BDTA 4X8OA 1P9LA 4NOMA 4AZ0B 4EYSA 2X7JA 2MYTA 1VQVA 1OH6A 3GV0A 1H2SB 4MB0A 1PW7A 4Q7LA 4CIXA 3HNRA 4HDAA 1BW9A 4DSAA 1F38A 1XXHE 4YQFA 1A95A 2P4QA 3MJSA 2VS1A 3LO8A 5H83A 5FWYA 1YIAA 2KMLA 2QM0A 2PTHA 3COJA 1HTTA 4URHA 1Y89A 5LMNB 1UPTA 5LA6B 2ODBA 1BX1A 3ELDA 3GGDA 4NBSA 1NT2A 4LFCB 4MR9A 1IVSA 3OA2A 1ROPA 1GARA 3IPYA 5KUMA 2G88A 4RSHA 4P7FA 4ARIA 4MKIA 4U0KA 4FYJA 2RCNA 3UG6A 5LPNA 3OQPA 1TIPA 2CLHB 5GJVC 2VEOA 5AKYA 3S5JA 5TISZ 3E6AA 4EF4A 1FXUA 1I30A 2VJLA 3DOCA 4BNWA 1NYQA 1AIPA 4M8SA 1GLVA 2HRUA 3VYUB 4KSYA 1NXPA 1RXIA 4DSTA 3AG4B 4YRPA 5A1JA 5HFMA 2UYNB 2PAFA 2PMDA 1GO0A 1XEWX 2R86A 1TAGA 2FR8A 3EJWA 1FFYA 1SM4A 1WCIA 1GRNA 1OZFA 2VWPA 1F48A 2YV3A 1XA0A 4FZ5A 2BVNA 5FUBA 3T99A 2VNHA 3VGPA 3DZIA 2EHJA 5CN0A 3EUEA 2PL3A 1UKVY 3NHWA 1P6XA 1NLMA 1D4OA 2BGKA 3T7SA 3LECA 3HR7A 2G72A 1ACMA 4GUNA 4NZ9A 3QQ5A 4AS3A 1OWMA 3CW8X 5LQJA 1K66A 4LXUA 2A9OA 3Q10A 1C81A 2XRMA 2RONA 1QYDA 1NM5C 4KIUA 2DFKB 4BEBA 3ZDZB 4PC2A 3WLEA 4NCNA 1UWVA 3OT1B 4JBXA 1CUAA 2JIOA 4HQ0A 4FONA 3LUJA 3KU4A 2FKXA 2XT0A 4NH0A 4MUBA 4YMWA 5GAPK 1F0NA 2QVLA 1ATZA 3W2TA 2E7ZA 4XRGA 2FGKA 2Q3HA 2O07A 1BRMA 2GV9A 3WA6A 3HGQA 4Z2AA 1Z0FA 5JSHA 5EHXA 4AMYA 3UFXB 3W04A 4LJ5A 4FFVA 3TGLA 3U7FB 1YRBA 5JUWA 1W30A 2O3SA 1ZVJA 4XYLA 2FN4A 4KO3S 4QFCA 1H93A 4X85A 2VQFO 1RM1B 1S89A 2Q9AA 1A9YA 2FZ5A 3HDQA 5I7VA 2LKDA 2NPIA 4Q9KA 4BWFB 3JQFC 3GFGA 1H8EA 1NQOA 5JSQA 1XXHB 2MOKA 1QTRA 5LQAA 2GM9A 2CZGA 4B2IA 2IZ0A 1VQ7V 3QUAA 5FNVA 3EPKA 2ZE6A 1YD7A 1DQNA 3JWIA 3DMNA 4US1R 4KVFA 5EJMA 2DYSC 1H1DA 2XYRA 1AI6A 1QH9A 4PSKA 2ZSIA 2ZYTX 3UOAB 1ODLA 1B76A 1S5PA 3LFHA 5IN4A 2PLAA 5BXZA 4MVJE 1WZEA 3QVJA 4MPTA 3TJZA 5JD6A 4ASUD 3I64A 4JLOA 3A3YA 5IUKC 1FP4B 1LPOA 3K8YA 4YJHB 3RFFA 5E1MA 3B9PA 2DXIA 1KYIA 1DUSA 3TLXA 5B3KA 4MA5A 3C3PA 5JAHA 1FMFA 1O89A 2JJ2D 4KITB 4K8XA 3G0BA 2XCTB 1RI2A 3R5XA 4HDKB 4JC4A 3NWEA 3ZVLA 2QJ1A 4RETA 4X97A 3L8DA 4EF6A 3GLTA 3DTYA 1ZHOA 1A9OA 1M2KA 3V1NA 3F8TA 4S04A 1C3LA 5BMVF 2IKSA 2QUAA 2AFIE 2QQGA 2XUHA 3BXEA 1Z2PX 1EP1B 4OAOA 4AN0A 4NMWA 1NTOA 4OXIA 1JHZA 4TKUA 4I1UA 3STYA 1Z34A 4BT2A 2JANA 1QS0A 1XZFA 4D25A 2ASEA 5FD8A 3U09A 2Y05A 2IS6A 4ZGBA 3T2MA 3EQ8A 1AQLA 3NHAA 2FEWB 3AIMA 3ILSA 1FRQA 2O2SA 3QLUC 2RCYA 4JWTA 2IPXA 5TLSA 5TRTA 3DCIA 1SZJG 3L0BA 3HB0A 4NEQA 3TXYA 4C82A 2L0XA 4RV4A 4TSKA 4F4JA 1RVV1 5JANA 4KP7A 1TJPB 2QMHA 2JHCA 2IOFK 2GZSA 3CEJA 4ZYUA 1CLIA 3G6WA 4I9GA 3U5ZB 1U3CA 4AUEA 4FUQA 3A4LA 1N0VC 1KI6B 1VL8A 2FRVA 2J6CA 1K8YB 4MZXA 4J7UA 4P80A 4B3CA 4KXMA 1CG6A 4BGUA 3LCMA 1Q21A 4N12A 5E0KB 3HJGA 5ALXA 1UDCA 2JIMA 4CNBA 1TVCA 4LWPA 2YQZA 4IL6Z 2EZ8A 4IIXA 5GONF 5F1KA 4YQZA 3RADC 1IAQA 2VRZA 1QONA 4RZ3A 5CPFA 2B1JA 1KK3A 2CUKA 1WRBA 4IV8A 4UUQA 2JK0A 5ALDA 5BV7A 1MVLA 5AOVA 2DFNA 1VMDA 4U3FH 3P4YA 4U4AA 4C05A 2YINC 3LC0A 3WLOA 2PQ6A 2XMSA 5E1AC 5MGBA 2QZJA 2QMUA 4OBEA 1VJRA 3NMUF 1U4SA 2B8JA 2ZYHA 4K9OA 1WW2A 4P30A 4UBJA 4FJ2A 1I10A 4KVAA 3ZK7A 1GGEA 4ZGGA 3TRHA 2AEEA 5EXXA 2BOBC 4JYPA 3D8CA 3OMAB 3Q3CA 3OTIA 3QKSB 3VSBA 1ZOSA 3KJGA 4C7KA 3IPAA 4G5HA 1IEVA 3O75A 4IKPA 4BLWA 5K3BA 4RSRA 2AKEA 5B4VA 1UXHA 4H4CA 2EIJB 3KC2A 4C3UA 2FMKA 4U00A 5LB2A 5CBHA 4AVYA 1EWTA 4RQTA 2I1VB 5JS6A 5KUTA 3EVGA 4XB6B 2XYGA 2B37A 1TUIA 3ZKAA 4EEQA 3SJCC 2PBRA 4L5BA 1M2GA 4R9RA 1ISMA 1ID1A 4JR0A 1VF7A 3W7AA 3HCFA 2BGGA 1DP4A 2GARA 4B40A 1KRXA 5A2QN 1XTKA 4NEHB 3DE7X 1ZOLA 3WMFA 3M8AA 1YB6A 3C3MA 4PI2A 2D3WA 4KOAA 2AFIB 4RFSB 3OJOA 4I9NA 4XX0A 4TV8A 4X20B 1FFTB 1M5RA 5DWQA 2AXTZ 1DZIA 2PM8A 4BNXA 3ODGA 4K40A 3NKLA 4MYCA 1CSEE 2FFRA 1M6VB 1GTMA 4JFAA 3E0XA 3QE9Y 1SQSA 3BL6A 4QWMA 3QVLA 1O6ZA 3D6UA 3IIEA 2M2IA 2JAPA 2IV3A 3Q8WA 3G89A 1PHPA 2VTEA 3X1MA 4CLRB 1H2WA 1JWLA 5BN5B 1BXRB 2Q1XA 3K05A 2P5SA 5BQOA 5J2TF 2P30A 2HQSC 2LP4Y 5F3DA 4HWPA 2AVDA 1EZJA 3WLIA 1M93A 2LBXA 4BQFA 4EG1A 4HNRA 1TZ2A 4MR7B 1JYFA 4FBGA 1DINA 2WLMA 2EJCA 2WD8A 5T5QA 4JBLA 3U26A 3IAFA 1UEIA 4JENA 2YWFA 4WA8A 3HR4A 2W48A 1AD2A 4WADA 2TSYB 2X8AA 5JXWA 1W55A 4P2BA 1E1RD 1SUSA 4UNSA 1U9JA 2WU3A 1MIOB 4OGGA 1GZ3A 2IYAA 1MNAA 2A1TS 4PVCA 2OYSA 4LC0A 5MN6A 2CLSA 1AGYA 4WY8A 4UTZA 3OU7A 2OHJA 2GJSA 2CNNA 4QPPA 4CF7A 1T5EA 1FTWA 5ERGB 1Y74A 5I8PA 3PX3A 4GU5A 4JT9A 2KSDA 4DEXA 4P33A 2ZOVA 3EXAA 1XJWA 4JI3O 3ZCSA 4Y1FA 1UWKA 1T9GR 4LHSA 3H42B 4D9HA 4KN9S 4JI7O 1TUGA 3A6ZA 1GKKA 1NVDA 2GTSA 1F1JA 3IUEA 1NKSA 4WI1A 3TW8B 1GFWA 1XP8A 3ANLA 3FB5C 4P0TA 3EOBI 3ZCRA 1JECA 3UEOA 1MGOA 3HWUA 3VYWA 2HSEA 1IOVA 1TMOA 2HVYD 2L6LA 4PZ0A 1X13A 1I6MA 1X8LA 1CR0A 3AR3A 2W90A 3DFUA 4HRVA 1NVBA 2BSKA 1FTGA 3NH9A 1OI7A 1E63A 3OLYA 1ZHHA 4YFYA 2KLHA 4LXQA 3I5XA 4NIMA 3PLRA 2JJ2A 2JBAB 1IZ3A 3QK7A 4ZI7A 1DMRA 3UM7A 5LOVA 2QKAA 3DE5X 3H2BA 1D2EA 1WXGA 2PH1A 2Q1YA 3WFIA 4U6NA 2WF5A 4LZZA 4LPKA 3H5IA 5HS6A 1F8YA 1SG6A 3NASA 1EFRD 3DAYA 1UBEA 2J1LA 3TCUA 2VZ8A 1YHZA 2VXCA 2ONJA 1KMCA 1O5TA 3WGUA 3S2EA 4ZCMA 1B6RA 1QQBA 3UA3A 4D0NA 2BEWB 1C7FA 2IJHA 1F4LA 1XL1A 4AJ9A 3ONDA 5EGNA 1PF5A 1KO4A 2DG2A 4DANA 2PUJA 4ZXFA 4DC9A 4X24A 5L3VA 1LS6A 2Y27A 4D57A 4YUXA 3CMCO 1X94A 4CC5A 2H4FA 2MSWA 2XGGA 1EFVA 2KBFA 3IQZA 2OIEA 3EGOA 1GPNA 4MYSA 1O87A 1QZZA 4EG6A 3D36C 1YOVB 3P9SA 4UKDA 4DREA 3VU1A 2F00A 2G9QA 3QKTA 2O7RA 1RP7A 3DPUA 2YZGA 4D98A 1BQEA 1BHO1 3PUWA 3VZCA 4YV7A 4DR6B 4HJXA 2BJVA 2X2EA 2Z9CA 1AMOA 4ZT3A 4YBRA 3GCZA 1P84F 1ZGCA 2VYQA 3PDUA 1L3BA 4S2UA 4DNQA 1CS0B 3BGSA 2BC9A 3K9WA 1IZ8A 3I76A 1WETA 3HSKA 4OPAA 2YDEA 1AKQA 5HPYB 2VCYA 3CCUF 1G0NA 4JUDX 4B44A 3ZIAG 2WDZA 4AZ3B 3M3PA 3RIMA 1QDLB 1E7YA 3HUFA 4F2HA 1YFLA 2CMFA 2ZSJA 1K06A 1BJTA 4PX2A 1HYQA 3SKXA 4BY9E 4MUHA 2WFZA 5BRNA 3NHBA 1VIVA 1UMBA 4F5DA 5YASA 2GLUA 4QUEA 2JZCA 3V4ZA 4MUEA 1SVUA 1PFQA 5IE9A 4HHEA 1JVMA 2NAFA 1NBHA 3TF5A 4IICA 3ONVA 1JTFA 3RVLA 3GNLA 1P1BA 3I7TA 4LOAA 4UD2A 3RH0A 3FFXA 4GOMD 5A9TA 4I1RA 2IU4A 3KTAA 4O2AF 1HP8A 5CXXA 2KGWA 2IOHA 3WG7C 2H31A 2WF9A 4UEWA 2WPDG 3HXKA 1RAGA 4U2FA 4DTCA 1C3JA 4BFZA 3PQ5A 4LY6A 1XNJA 2HJ9A 3AJAA 3KKQA 3KWFA 5A5DA 4R2MA 2HA7A 4G84A 1DNPA 1GMGA 1PR4A 4O4JA 5K3EA 3AEXA 3PHCA 2KW5A 1EVQA 2I1LA 2ZR8A 2PMWB 5TT1A 2G06A 3MSXA 2VYND 4IG4A 3RU2A 3UHAA 5LKAA 1YZUA 1JLRA 3V6LA 3FBTA 4DMHA 3N0VA 4R81A 3LUTB 1QQ5A 5CA1A 1I1OA 1NL3A 2D3OW 5CX4A 4UM7A 5JG7A 4IWYA 1YZTA 4OYHA 3CC2F 3J7AC 2AFRA 3NYRA 4C88A 1SUDA 1EWYA 1US8A 1TJYA 3O1JC 2B34A 2HCJB 3LQQA 4J9UE 5IXYA 3IUQA 1WQ1R 3WMGA 5K0ZA 4C0QC 3HFSA 3I2JA 3ROMA 2RAPA 3AFIA 4BECA 3SBOA 2M6LA 3MWLA 2H2FA 1G5FA 3ACBA 1TF5A 1DBPA 3RHFA 1GSHA 3A2KA 4ZALA 2Q1WA 2H8EA 3O4RA 3OJLA 4FGZA 1EBUA 2QN6A 4MVJM 4M98A 3RAFC 1JILA 1WQ4A 2GOYA 4CQLB 1E1RA 3D1LA 3HJHA 1OC4A 5DLPA 3H83A 1GCOA 5A62A 1W4BA 4DBLE 1VH8A 3ND9A 1NMEA 1W57A 2JLYA 2VPIA 1POWA 4KRYA 2HS4A 2VFAA 2ENUA 5BSTA 4Z8XA 1ZWKA 3EF3A 3HP1A 2IEIA 2OCCB 4LNUB 4W1PA 1SUEA 5DNWA 4F5ZA 1E6CA 2IZ1A 1WU8A 4I55B 1GG8A 5KOIA 4C78A 3CNLA 2PZFA 3I45A 2BI4A 2EBUA 2NR5A 4NYIQ 4B2PA 1QG4A 2E5FA 3RFUA 3UV3A 4C08A 4ZEXA 1K5QA 1WP4A 2WTUA 3K5MA 4JODA 3VAZA 3IOBA 3UMYA 4EVSA 4EHAA 3OLCX 4AI6A 2YW9A 2EF0A 1PFYA 3KL4A 4IQ4A 3H2GA 1FXWF 2FPIB 3D6MA 3KTDA 1XCGB 2VTKA 2Q7EA 1EFAA 5AI5A 4QTYA 4OG2A 3ZCQA 2EKBA 1Q20A 3UMVA 3SPIA 3LZDA 5JH7B 2MSEB 2ZULA 3W5SA 1S8OA 1MT3A 3N86A 1V5IA 3KRTA 3CG4A 1TIBA 4KTTE 2R62A 1B8NA 4REMA 3R8FA 1MW8X 2HCTA 3MWDB 4E94A 1IWPB 4QJ5A 1XJ5A 3LCCA 2GCPA 4ONEA 1NF9A 1AQYA 5LUAA 1L4YA 4DW0A 1JQ3A 1LJUA 3WYDA 4DLTA 1CNFA 3FAKA 5H16A 2W11A 3LKVA 4M9CA 1YB4A 1C1DB 1MJGA 4GMXA 1YJNF 1AHHA 3AO0B 4M3NA 1IHDA 1XLWA 1CUUA 3IB3A 1G20A 2DTDA 4RO0A 2PVSA 4DR4B 1Z6YA 5EMHA 3D00A 1RWVA 4YIKA 4DG9A 2G36A 1RWBA 1D4FA 2AIFA 1EFRA 4H27A 1ZK3A 1R4MB 4RMIA 1D3AA 3WK6A 2ZBDA 2VSFA 3EUAA 1Z4QA 3KEMA 2KPOA 5CB0A 5HTKA 5TF4A 4C5AA 3QPUA 5K5EA 3C74A 4CT5A 4Q9LA 4NHOA 2Z6QA 4XEUA 3D8HA 4X3CA 5DNAA 4O08A 2QXYA 3I2FA 3T9CA 2ECQA 2P9BA 1SVLA 2QORA 3A28A 1QBZA 1TECE 3AY7A 2MJLA 1GL6A 1BWQA 2PQMA 2PZBA 3QLTA 1GZ5A 2WHYA 2AHYA 4J0JA 5KLVH 2D7DA 1J00A 3OCWA 2EU8A 2HX0A 4KXVA 3G6EF 5IDXA 4PDVA 4B46A 1SXIA 3RNLA 2YBEA 3WGQA 1F0KA 3OZ7A 1DCKA 4O4HA 4LW8A 4G86A 1WZNA 3JD4A 1J9GA 1M7BA 1RIIA 4RABA 4OSOA 2ZTLA 3WX0A 1LK5A 5DYNA 1UQRA 4G65A 3ME5A 1VSQA 1KRWA 2IAFA 1QGYA 5JAPA 1PWHA 2FUNB 3LM8A 2VJYA 5KJFA 1TZBA 3RVJA 2QRPA 1ZINA 3AHHA 4M8LA 4J16A 4X92A 5E2BA 4OSPA 3P2JA 3NXSA 4BT3A 2Y1KA 1M2VA 3IFSA 3BH0A 1YB1A 2PLRA 4KNWA 4Z9YA 2O48X 1GCAA 3GRVA 2UXNA 3C9SA 3R7DA 5AI6A 1Z35A 1II8A 4E6EA 4HRAA 1Q22A 3EF1A 5C4IA 4FP9A 3CD6F 3U37A 2BZSA 1QCYA 5E6UA 5EMNA 3KJKA 1Z5GA 3RK1A 1IHYA 1D2GA 3FMFA 1W4LA 4Y2QA 3UW3A 2XAFA 2TECE 3LA8A 4LGVA 2NU6B 3C6QA 3K0FB 4UJ3A 1W48A 3TQHA 3V8MA 1N8NA 1G6UA 5DGTA 4HN9A 3E3MA 4INAA 1SBIA 1VHJA 4ACAA 2DECA 3TFQA 2A0WA 4C5CA 2GTHA 3UAXA 4GSLA 2R9AA 5CLJA 3SJ7A 4C20A 1YQDA 3D1VA 2WHXA 1H3FA 2CTRA 2VYNA 1USWA 3KU1A 3EEYA 1KMHB 4CF5A 2BR4A 3KUXA 1CUIA 3EFEA 4LA4A 2CVLA 1EJ0A 3Q3IA 2PQ0A 1SQVH 4GZMA 4NFHA 1TQ6A 2SICE 2ISSD 4MLPA 1Q7CA 4F2GA 4CTMA 3RFTA 1IY0A 3VU3A 1D6NA 3A4MA 4RF5A 4WXYB 2XZOA 4KKVA 4J7JA 1YR3A 2H9YA 1V8OA 1IBMB 2JATA 2J08A 3WJ1A 2J48A 1B3RA 5JHGB 5L3QB 4BO6A 4DL9A 4MUFA 3TJMA 2V3WA 2WLKA 3P19A 4PAOA 4FEAA 4FR2A 4PY2A 3VKUA 1H9BA 1QB8A 3G9XA 1EX1A 3PUJA 2FRDC 4DV2B 1GILA 3VPCA 3FTFA 2VPXA 4WBNF 3VKHA 1VE6A 1AKMA 4UBIA 2G8LA 1O6FA 3AETB 4KFSA 4A4DA 4IIJF 1Q7YW 3E2PA 3R7FA 2GN0A 1OV4A 4V0NA 4J0IA 3D6HA 3PWTA 1P0FA 4P83A 4Z3DA 1TTTA 3ABUA 4YJ3B 3HC7A 1BRTA 2Y4NA 4FFNA 1Z08A 1PJLA 2QWOB 4NBUA 5AI4A 2CTPA 3PFWO 4YCBA 4MJXA 2LE0A 3E1YA 2Q6TA 3B13B 3TFWA 2EDAA 4N5LA 1RFYA 4ZD6A 3CVVA 2ZITA 2JS3A 2RGEA 5IDWA 3GY0A 1WV0A 1XC7A 2IZ7A 4QNNA 5I7WA 3WWYA 3DUFA 3APQA 2C4MA 3ZPXA 2X9GA 3B09A 1CUHA 2C2BA 3UHOA 4P92A 4V0KA 4OP2A 3OW2F 3K6SA 1C9MA 2VJKA 4GXQA 2DYRC 3U10A 1Z0KA 3FF4A 1PNMA 1R0YA 3BIXA 4PSAA 1U11A 1RQLA 4QFBA 2V45A 4PZDA 4TMTA 3ETHA 3OPVA 4QTZA 3F96A 2BE9A 3EH1A 2AHOA 4PAWA 4AUKA 2ONKA 4ZOBA 3HZOA 4CLEA 2XB8A 3LOPA 4FEYA 4Q9IA 3URKA 2WWIA 3Q8MA 1LNQA 1LDGA 3K8QA 3PQ3A 1QVWA 3RGGA 4LRYA 3HEAA 1YRAA 3FFBA 3ZHCA 3BA8A 1FFDA 2N3ZA 2FWIA 2XEDA 1SN7A 3DNFA 2YOHA 1N5RA 4YMVA 3FNBA 5BSMA 1W3EX 3EPLA 3FW1A 4PG8A 2GYUA 2JGMA 2EDCA 3SFTA 1JMVA 2PKWA 4QRIA 4US0R 3OEED 3DLHA 1FVXA 2CJWA 3TRFA 1U9IA 4RZ2A 3PJFA 2X76A 1GR1A 3HUDA 1DEAA 4OD0A 5HIMA 2PPLA 3KV1A 2OTLF 5JD4A 4UHDA 1QVVA 5HVNA 5EZYA 4PBRA 3M89A 3ICXA 3TQOA 3PUZA 2I9PA 1DS6A 4G9BA 3EVDA 2R6DA 2XUZA 3I58A 2JDIA 1E3MA 1NUUA 2O5RA 3HY4A 4K03A 4IGGA 1ZN7A 1T6BY 4GBJA 1HWYA 2QTHA 1YVWA 4KRXA 1DELA 2PJUA 1TJNA 4GMHA 2AFHE 4NBNA 5AW7A 1BX0A 4C7XA 1CP3A 2N74A 2XLBA 2ZSEA 3HI4A 5AKLA 2JF0A 3V97A 2AX4A 1C5KA 1Q1QA 3D3JA 3KEGA 2KHZA 1CYDA 2VDNB 5B1EA 1TUBA 4JL6A 2QG4A 3EFBA 2AMTA 1BEEA 2FP3A 3KXKA 1J33A 3KB2A 3TVTA 2W6ID 2F23A 1TC1A 1IM5A 2Z4RA 3RS4A 1SUPA 2CNDA 1W5TA 4WDQA 5FUYA 1XRPA 1ZAYA 1NF2A 4N5NA 5IMSA 1VIBA 1P72A 2P9FA 2FOLA 2WAOA 3NHKA 5EUQB 2OIGA 2CNWD 1AKTA 1NJ8A 5EZ5A 4QBGB 1Q95A 3ASOC 2A5GA 4RVOA 3I1JA 2V6MA 5M3BA 3LYUA 1G64A 2BP7B 1BGYH 3IAAA 3L3BA 3M49A 1OX4B 1GR0A 3G2NA 4QG3A 2G9UA 1OI4A 2LBWA 3C5WP 1MOFA 5COQA 2SCUB 1I3KA 3FNRA 3H4MA 4P7GA 4CIAA 5HCUA 2CGNA 5DBGA 4UBMA 5C7OO 4DCTA 2PY6A 1X7ZB 4KXLA 3GJRA 1Q1ZA 2CV1A 2BFOA 1KYWA 3DOFA 3SDZA 1GV1A 3LWOC 1YHQV 4K9NA 4C6SA 1KPGA 1O95A 1OAOA 4PTLA 2BE3A 3TSYA 4X1IA 4O2RA 4CT4B 2BFAA 3P9ZA 1C0EA 4L5YA 3DSRA 1Z73A 2UYYA 1JHXA 4XH9B 3RG8A 3NDIA 2CV0A 2ECOA 2H51A 3BABA 5LD2C 4EO7A 1DJLA 3WK8A 2DWOA 1JV2B 4AY2A 4FIPC 1NJIW 1WXXA 2JA1A 2OO7A 2Q6KA 3L75H 3T1OA 1OJLA 5KYWA 1G1XB 1DARA 4B17A 1FFXA 2WAYA 2REOA 2AIZP 4EHLA 5SYNA 3TLGA 5BSGA 4WWHA 2RE8A 1VMKA 2Y0BA 3NHLA 3OVMA 1I5YA 4D0RA 1IXSB 4JV5B 5TVKA 2IYSA 1QFJA 1YGPA 3MCAA 5ALKA 5EJ9A 3GWKC 5AFSA 3MAGA 5CVDA 3ZHQA 4TV9B 4PANA 4JT2A 1H7MA 1CX9B 3OAAD 4IWXA 4QSMA 5DM6V 3GO4A 1TFRA 4B4DA 2PCLA 4QOJA 3FD6A 1B6GA 2X7HA 5TGDA 3WIVA 1OZHA 2FDCA 2GKGA 4YJKA 4NF2A 2I2AA 5FXMA 5K0EA 4ZEWA 1R1MA 2HBZA 2Q21A 1ZLZA 2MU1A 3BY6A 3K70C 3U62A 1IU9A 2NUAB 1NY6A 4BN5A 1N4AA 3OJFA 4JVOA 4MRNA 3K8ZA 5CJPA 4MS1A 1XF1A 4MDFA 1TJ4A 1X52A 1X92A 2AEMA 4G5XA 4CKWB 2GR9A 2NN4A 4MUIA 1BYUA 1PI3A 1KGDA 3GZTB 4TXMA 3T9BA 3YASA 1XKXA 1Q2UA 3JAMN 2CCKA 2CSXA 1BS1A 3WKDA 2NYUA 1QU9A 4XARA 5IN5A 4OQ4A 2ZAMA 1BIFA 4FYIA 1MQSA 1R12A 2AW9A 3O95A 1UI9A 3WGMA 5DTEA 1ZIXA 5IBQA 2HZ7A 4J29A 5C8YA 4HGQA 2XVZA 2QJTA 3K5WA 3GLIE 4C4XA 4CN9A 2GFHA 4HTFA 4XFJA 1J4AA 2WG0A 4JMPA 3B5IA 3QWIA 2FPWA 1G8AA 4DUZO 2CGOA 1ODFA 3LDUA 1N7JA 4YCNA 3BWYA 1TOAA 5AKKA 4DUYB 3N4YA 5JNVA 2J41A 4EM6A 1G1AA 3JQQA 4BGEA 2UYOA 3KHUA 4YBZA 3CURA 3N2KB 2RBGA 1C1XB 1PR9A 4RA6A 4B73A 2QXTA 2F43A 1KI4A 1T36B 4L9SA 1KIMA 4AXXA 1LLCA 1X25A 4F38A 4PIMA 5GZ6A 4R31A 3GYGA 3ENWA 3DJFA 5LLTA 4YMIA 1GNSA 4EB8A 1H8ED 2NO1A 4DRYA 5KWSA 3A2MA 1NYRA 2G71A 3TD4A 1E2FA 1D2RA 2M6YA 4CIVA 3BFRA 1I6LA 3EZGA 5F2NA 2P27A 2L17A 1OBHA 5BW5A 3HCOA 4EATA 1ULAA 2ERXA 3B7PA 1UKAA 3CX7A 3K14A 1BDBA 3TSWA 4K6OA 1QP0A 4RDIA 5KCZA 4G5FA 3HKCB 2HCBA 2PWZA 2BFEB 3FPJA 1J8VA 2PFGA 2N75A 4EVQA 2CFRA 4ARUA 2Y69C 1YIJF 1IV3A 2ZAUA 5ABPA 1DIHA 3M1YA 4ZQFA 1EDOA 4HWRA 2D1YA 3BF7A 4MS4A 4L7VA 1J07A 1QAHA 3O4GA 4BGVA 4GYYA 4TUYF 1RM3A 5IKOA 1VQMV 4B3DA 2WFLA 1ZUQA 5KOYA 2PGNA 1NT4A 1A71A 2W6IA 3KVRA 2V96A 4KGXA 5ESDA 2HF9A 4JLSA 1W5BA 1Z2OX 4X61A 2HJWA 4DDKA 5A06A 1N0NA 2INGX 3AL2A 4HQKA 5GM1A 2C4NA 1K68A 1KH3A 2N48A 5G4LA 2WKQA 2XUQA 4KQWA 1KSGA 4E4TA 2BELA 1O08A 1TNDA 3K0AA 4C4WC 3HBNA 4ZTUB 3DTVD 4FB5A 4UVHA 2Q45A 4AIIA 4KXRA 1MA3A 4H0LB 1BDMA 3JYNA 2O1XA 1XKLA 3IOMA 1NVMB 3TEFA 4BO9A 3SJAC 4YJGB 3GLIB 4G27B 2EIMC 4RJKA 5JC8A 2GBLA 1NLFA 4BYGA 2QT0A 3KCYA 5BNIA 2IPLA 5AUPB 2QQ0A 3QI7A 4HZIA 5EC8A 4HX5A 3A2NA 1IB0A 1PAUA 3ESYA 4DV1B 2R7LA 5C81A 2LCAA 2VQEO 3RT7A 4CL8A 3X1DA 1Z0ZA 2PKQO 3GPCA 1KXJA 2D7CA 1V45E 4D8XA 3KD2A 1JJIA 3G2PA 1A7UA 1AUXA 5TT0A 1QJ4A 4O4LB 4XJVA 2PYZA 4I0XB 4EEKA 3C7AA 1ML3A 1CZKA 3FZYA 4A03A 1PJRA 4BV8A 4PYOA 3DMTC 5IABA 3SM9A 3AFNA 1EVIA 5K0BA 4RTRA 5IPFA 4CS4A 3N27A 4WOJA 3OIWA 3RE3A 3OKPA 1JGTA 4J0HA 2C8LA 4BIIA 3U0OA 4E5YA 5MGNA 4UVCA 1QRRA 4OQDA 1ZICA 4FZ0A 3S6JA 3HR8A 2E3CA 5A4FS 1D4AA 3AY0A 4H37A 4MYUA 1YGYA 3DC6A 4I5FA 3HO1A 3CLHA 2JFQA 4ZCTA 2HQOA 3NHSA 3A10A 3EAFA 3KLMX 2O3RA 2ZJBA 1CQIA 3OAAA 4HQFA 1NI4B 2W58A 2QMOA 3O3MB 2IS2A 4UW9A 3U9LA 4EECA 2H4XA 5HBRA 1F2UB 4JKYA 5AM4A 4GW3A 3T4ZA 4KV9A 5EQTA 1RFLA 3SF8A 3FCCA 2FEOA 4J3FA 4K9RA 4FFOA 5G0WA 3I0NA 3MOGA 2LFRA 3CZQA 4IS3A 1YRHA 5JPIA 3JRWA 3NQ41 1YI8A 4KXUA 5AW5A 4ARBA 4KRGA 1QHIA 1VHDA 1IY9A 4RV5A 4MTOA 2H1IA 2BDEA 5AK4A 1OHHD 2G5GX 2JD0A 4G8DA 1S5LZ 5DYWA 5E4JA 2C7RA 2LBTA 3KT8A 5ALMA 1KDYA 2OB2A 4H2DA 3AMVA 2Y0PA 1Z16A 4QTXA 4L7QA 4RTKA 4OHCA 1BHSA 5ADUS 3QENA 4LN1A 1RBYA 2WD7A 4DJJA 1V9PA 3G0HA 5JQGB 4FS8A 3VMFA 2ZUCA 2Z8YM 2O50A 2EX1A 2OZVA 1MABB 1R6TA 2LV8A 2VK8A 5AVTA 2EKQA 2PD6A 2VT3A 4WFBV 2ZRDA 4BO8A 1KBQA 3V32A 3ROTA 1DIOB 1NZJA 2Z98A 2CDRA 3D4NA 1BFKA 2IDZA 1XJQA 1YXMA 5BMOA 3O8OA 3T3DA 1WB5A 4HDMA 5CX1A 3WLFA 2FH5B 1NUHA 2ZRIA 5L6MB 1S2NA 4OX9O 4EB3A 2MW2B 3FD9A 1Q5OA 1R0CA 2CW5A 2NNWB 4R6ZA 3WHLA 1XMSA 1O0BA 1Y80A 5H6QA 1JDNA 1GAJA 2Q4OA 4XYMA 1I51A 3PI7A 3AVPA 2IHNA 1ZI8A 4HFNA 2KB0A 1IBLO 3HKDB 2QI9C 1ZW6A 1K6JA 3J80M 4QGSA 4KJZA 4YCLA 2QQ5A 4JXKA 3D3QA 3RR2A 4QUAA 3HB1A 2VYVA 2DKOA 1KU9A 3P30A 3G71V 3KSRA 1KZ1A 4OREX 1A27A 3EF0A 3X2SA 1DRJA 4Q47A 4IUDS 2IWHA 3HM2A 5FBZA 1B3QA 1F14A 5DGIA 5HXAA 3SZLA 2PE5A 1PFGA 5E6SB 3TSOA 3HQ4O 1KWKA 2EJTA 5FO0A 2VUSA 1H4VB 3LYBA 1VCNA 1H0RA 4RY8A 1SCUA 3I5AA 2BGLA 3N8DA 4HZGA 2ZRBA 1CJKC 3ZMZA 3SIVA 4MQEA 1M8GA 4UEQA 1KJJA 1D2CA 3A1VA 3FPAA 3IL2A 1SWVA 4YRAA 1U8UA 2ODAA 4JELA 4FMDB 3OI7A 1E7SA 1MB3A 1R3IC 3FYCA 2ZT7A 1CUVA 3I6QA 4L02A 1RD4A 1RU3A 3LWBA 3IT2A 1SNYA 2XUKA 4LG1A 3DFMA 3ZV4A 1JR3E 2FN9A 3RABA 1CN7A 4WXMA 2EWCA 2PTMA 4ZV9A 1DHRA 3W8EA 3SQNA 3ECSA 4KFCA 4PHCA 1WTCA 2IIPA 1G5QA 4W6ZA 1F8FA 4MHTA 1CZOA 4HLNA 1E1DA 2OSBA 5KJ6A 2YOFA 3F67A 1IEXA 4KC0A 1RJ9B 3JSNA 3LT0A 1V0JA 2Q0QA 5EE9A 3DTVA 1ZC3A 4IJ5A 1K0UA 1JJOA 1W5AA 3KKZA 4DLAA 5L3SB 1GPYA 3VR5D 3EASA 2AN3A 1OWNA 4U8HA 2PXCA 4Q6GA 5JJNB 1PJBA 2DPYA 4BKUA 2RHLA 2YYSA 1LBIA 1X19A 1BG6A 2ZPAA 4L4XA 4FQ5A 5HXZA 1R3DA 3RHSA 4MVJP 4P53A 2V7XA 1W35A 4OJYA 2Z5LA 4UZEA 5KHAA 1KVTA 4C0XA 4P4TA 3N39C 5L3ZA 4HPJB 1G38A 3FD5A 1OA0A 3BORA 5FH9A 4DIOA 1PFWA 4LCBA 4PF1A 2IKQA 2NV0A 5BZBA 1W85A 2J5KA 3FXAA 3EDQA 3AIIA 4YRIA 3VHXA 1FLNA 1U2TA 3EQ9A 3EXHA 1S3IA 2W6NA 2QU7A 2HA3A 1SIUA 1EUYA 1RRFA 2HR1A 4E33A 2ZUFA 1BD3A 1VP7A 1VECA 2ZINA 1SXPA 1DAOA 1UP4A 4I1IA 4L9WA 1Y3BE 3IUYA 3KBOA 1M5IA 3L6BA 3VBCA 4JLPA 1ZRMA 3QMPA 2ERCA 4E2XA 3JD3A 3CO5A 2F3QA 3S8MA 1ZD4A 3ETCA 5M5BA 4KW7A 4CL2A 4YY3B 3RK0A 5DKFA 2H3HA 1NVAA 5L3DA 3VQYA 16PKA 4RVDA 3OCCA 5EWJB 2R44A 4NCBA 4Q02A 4BP8A 5FL7D 1RJEA 4NHEA 3NOQA 4LWQA 1KH1A 2R66A 3IKEA 3WQBA 3N07A 5CDFA 4JJ7A 4XIGS 1P80A 3HAXD 2Y67A 3A2FA 3EQ7A 5A9GA 5H0IA 1LUAA 1RZUA 3K72B 5FLEX 3L84A 2K7ZA 1VM6A 3KQMA 3ZXSA 2H1CA 1U99A 2GEKA 4EHBA 1IQRA 3AJDA 2OHHA 2ZE5A 3RVNA 2QLTA 3WWCA 2DWQA 3NH6A 3F5TA 1HRDA 3TIVA 4LZPA 3LBIA 4NBLA 3E8MA 3LIIA 1KYYA 3IP1A 3FNHA 5T4EA 5F51A 4F4DA 2Q3DA 3WDMA 2JFFA 1QLEB 1N6LA 2PIAA 1PZNA 1P7YA 3WGTA 1K97A 3OUUA 1UKZA 3ACDA 1OHHA 3TEMA 3KG2A 3S29A 2YS8A 4EI9A 4IIFA 3KFVA 2CFIA 5I7OA 1QO9A 3QVOA 1CEQA 3W3AD 4X65O 2E1PA 4NS4A 4OLBA 1UOOA 4JUIA 4KXWA 1FLVA 3TS1A 3VVLA 1E89A 1M1YA 1ZH0A 4GGMX 3B7GA 2C8JA 2GVDC 2UZ3A 4EHDA 1BA2A 1ADYA 2C2GA 1GL3A 4UDOA 3QOFA 1JR6A 1YMQA 4QAQA 2FRXA 1NNUA 1N2IA 4AUNA 4ZK7A 3FRIA 4ZU1X 1HXHA 3WRXC 2FWRA 2D00A 1CETA 1U28A 4LRQA 2ORIA 3UMSA 5JS2A 3SC6A 4D46A 2ILTA 2PRSA 1UANA 3ABRB 3OPYI 2F17A 2X0FA 3L8YA 4B3IA 4OBWA 2PGLA 4PC1A 5FDFA 3COWA 4X90A 4CI0B 5GANK 2BGTA 5JYEA 4JLNA 1AH2A 5K0SA 4RAOA 5FPQA 3DBRA 3CRCA 1QGUB 2Q5FA 1CY1A 3Q7PA 5JBNA 3DXXA 5FWNA 2OWEA 3KEQA 2QUKA 4FKZA 5G4UC 3KXLA 4WLFA 3KHNA 2EJUA 4G5QA 1DRVA 2BGUA 5JJKA 1Z17A 1WUTA 1SKQA 4GSYA 1O9BA 2C96A 3RIEA 1JIJA 1H2GA 2P3OA 3O8CA 4R2HA 4XVCA 1G6HA 5HKLA 3T34A 1DQSA 1R4ZA 4FQ7A 5BQ3A 4NMLA 3MT8A 3JYOA 4MLCA 2IG8A 4DMMA 2G9ZA 1QC5A 4FDUA 4Z7QB 2W83A 4NL4H 4PO9A 3MWEA 5HP7A 2ZYSA 4G0MA 2IU0A 1N36O 1FRZA 2WQ7A 2OY0A 2GVZC 1YQXA 2CJFA 2XAGA 2NU8A 4YREA 5ARCA 2ZBFA 3RARA 1TVEA 3RHZA 2OQRA 3U1VA 3PC6A 4JTAB 3K32A 3FMPB 3QLVA 2HP0A 2RHOA 2C9MA 2AOTA 3MGGA 1MXHA 2VWQA 3ZDAA 5IKEA 3OF5A 4DV3B 2FMLA 1PEKE 2NUPB 1RBQA 3RBXA 3ENVA 3NTLA 4HMQA 2OP0A 3QELB 3QPVA 2HMYB 4FT4A 4MIOA 4QE7A 3OU2A 2I7VA 3BQMB 1S7CA 4BT5A 4GE3A 4RGVA 1ADCA 5IY5C 5DCYA 4QLOA 5EZ6B 5JBQA 4IAOA 3SR2C 1SZPA 2EG5A 1KNKA 1VCOA 4UMFA 4OH1A 4MAMA 3ICEA 4NFSA 1YU9A 3VR5A 3O7MA 1EX9A 2B9VA 4KBGA 5BN4B 4IX1A 1JR4A 3VNAA 3RPEA 4WVFA 1FFHA 1I2CA 1VDMA 3SS9X 4MXDA 5DX8A 1AXEA 3TZEA 1BGXT 3CIFA 4W99A 3PNBA 3UAYA 5TQJA 2KB1A 2C7BA 1L3CA 3FHJA 1HORA 4Q66C 4RS4A 5LXTA 2E4WA 3HYLA 3ZD6A 4KXFB 1P0PA 3IQEA 4YPOA 1IPAA 2CMHA 1IZYA 3LDHA 2VWGA 2Z3YA 4M0PA 1OLSA 2WQ6A 2I4NA 3F9RA 1NONA 2JNWA 4UU7A 1EFPB 2D74A 2QG6A 3PUKA 3PD7A 1Y5RA 3N8GA 1K3UB 1XRRA 1A4IA 5CPBA 4B85A 2QEXV 1Z39A 4ID9A 4IFEA 5ED4A 1OH7A 2C84A 3V4VB 4AF8A 2B35A 2PKRA 2R8PA 5ALLA 1NDUA 2CD9A 4NBRA 4HR7A 3DGEC 2NW6A 1P1IA 3OZAA 1XTBA 4AO8A 2NQ2C 1G291 1QIIA 4HNAA 3ZXIA 8GPBA 1O3YA 1YJXA 4YV0A 1M74A 3CO0S 3B60A 3WYNA 2V0GA 2ZR2A 3IEPA 1MSWD 4PPNA 1BE6A 3DXRA 4Z0HO 5FL7A 1JBKA 5IP5A 3OHSX 1W8IA 3RNOA 1PQYA 3KWLA 1ZRSA 1ZPDA 2GT1A 2OO3A 3IE1A 3PHHA 2ARKA 1T2EA 2WLHA 4NTWA 1JBEA 3WKBA 1C0LA 1GTL1 1R5BA 3GZ4A 1MRSA 1TUEB 2H07A 1VG1A 2EFHB 4PWZA 3C24A 3VZPA 2XVXA 4AN1A 4HDNB 3ADOA 5E8RA 1AB5A 3BWDD 5BQ5A 1OFVA 4BJ6A 3NOXA 3WP0A 4JJ6A 4YP9A 4FOSA 3V3KA 2FFBA 1BCRA 4DPLA 3WV5A 1O77A 3DZJA 3TR5A 4GCZA 2PA0A 5KTYA 5FULA 1DAIA 3BULA 5F7XA 1I6WA 2YS6A 1Z37A 2OR3A 4HAIA 3STZC 2R7NA 2I2CA 4UAJA 3TR0A 3M4ZA 3BXZA 3VYSC 1UEXC 1GVNB 4YALA 3VC2A 5KQPA 1QYXA 4PYIA 1ODSA 3GX1A 3W3AA 1JJ7A 2A9HA 4ZVVA 3ZNQA 1ZFNA 3TZBA 1IEQA 2OECA 2H1SA 1E0DA 1OROA 2I7TA 4P3NA 4OVKA 1BS2A 3GGPA 1KI3A 2FVYA 2NZJA 4YV1A 2RJZA 1XNQO 2VGMA 2EP7A 3QEMB 1XL0A 2ZI6A 3B9BA 4MPRA 1NKTA 5C1BA 4ZHYB 4OBBA 5JAMA 2GKSA 3MTJA 1RAIA 1R8QA 4R2XA 4TSFG 4CM4A 3K96A 4ZHWA 2OTCA 1FFEA 1PIWA 1YVPA 1DPFA 4YMTA 2O52A 4GIBA 5AW9A 2HIHA 3COVA 5IM4A 3KCXA 3K59A 1FVFA 3EUFA 1B6QA 4B84A 3TLEA 3SYNA 3CEPB 5TPWB 4CM9D 4NI5A 4WCFB 2JHPA 3IFXA 3ZS8C 4F60A 1XK6A 3GJ0A 4MYTA 2ZUSA 3VNVA 3A3OA 2OFWA 3MT7A 1ZZEA 1PBNA 1FXSA 3P0IA 2I71A 1A5TA 1KAEA 1TYEB 2I6GA 1LSSA 4QOEA 1OFTA 4CMBA 4U3JA 2G6TA 2Y92A 1W44A 1FU4A 3BFXA 4GUDA 2J85A 2B61A 5CEJA 1TB4A 1PFKA 4FYYA 1L5LA 2JLUA 1V9SA 1L4EA 1N2ZA 3W4IA 1I33A 5FI5A 5JECA 1ZUNA 3E7FA 1P5ZB 1U8YA 4FFBA 2NUTB 3S2IA 1Z4IA 1N32O 5CNIA 3TOSA 3FA2A 3AB7A 2QW0X 4MPJA 4DWJA 4J11A 4C8IA 3BERA 5GJWC 2Q8NA 1QP4A 1IWOA 4BZPA 4ETMA 4QIHA 2FB9A 2JKYA 4MH0R 1QP8A 2AMYA 4EMBA 1JSLA 1U2QA 4R05A 3DTNA 2B0JA 2CWJA 1Z25A 4GPIB 2HI0A 1GPBA 1EFLA 4LFBO 3DYBA 3ZZ0A 2EHDA 5AR1A 5IYZB 4PI0A 2YTZA 1GD1O 3KUKA 3OEWA 5REQA 4B3XA 2EV9A 3AEZA 5LHGA 2AMFA 3WB2A 2FTKA 5KPJA 5KVVA 1HYBA 3MDSA 1C9KA 2OFXA 3VDNB 4Y6PA 4JLAA 1H9CA 2V6GA 1H2YA 4RJJA 4W7SA 1CR6A 1SBHA 1D1SA 3RAJA 2ORYA 3NEYA 2XNDD 1GPAA 2HK7A 4R68A 2G63A 4N0PA 2F4NA 2E18A 3Q2KA 1PUIA 2E21A 3GG9A 6YASA 5AHOA 3H1PA 1PR0A 2JDID 1U97A 3T5CA 3DZDA 4D3SA 5ITWA 3GRKA 5GZ1A 4DT1B 4MWZA 4HEA1 4YMGA 1W1IA 5LDGA 5IDJA 1CQJB 1AB6A 4MS2A 4TWZA 5EQFA 5BN3A 3FBWA 2J9GA 4JVLA 3S2ZA 2O59A 2DSTA 1WHSA 3Q11A 4IIEA 4Y18A 3M0EA 3V2UA 1JA8A 3IXLA 4MV0A 1T3ZA 2EF1A 3L8MA 3FSRA 2QZ9A 3B6KA 5FBRB 2O9JA 2B4RO 3H5RA 4UCTA 1KK2A 3Q7RA 2LGJA 2V98A 1GZVA 3BJEA 3ET5A 3CJHA 4MVRA 3P26A 2QTVB 3LCRA 2OQ2A 3WNVA 2VHYA 4E3ZA 2B4QA 4UFPA 2DFPA 1LH0A 3CLKA 4DB4A 4RHYA 2O8EB 4IGKA 2XOKD 3DMTA 1JVNA 4XJTA 4WZBA 2IXAA 3OM9A 2K2WA 2YC0A 2O2CA 1DKMA 2I99A 3EWNA 2QTGA 1IHUA 2BZ1A 1VDZA 2WKPA 3B53X 5FAKA 3SOZA 5FBVB 3PFCA 5HJ5A 4L5JA 4OGKA 2ZS9A 3JZMA 4CXMA 1NNEA 4BE4A 1RQPA 1T0BA 4P7JA 5B66Z 1N78A 5CLQA 3G2KA 1YVEI 4YJFA 4ZT4A 1OI3A 3T5DA 5TXGA 1T2FA 4D99A 3ENKA 3C4VA 2W93A 3T1HO 1W73A 4JB0A 3G67A 3IVMA 3C4QA 1HLGA 3K6KA 1J7KA 4RKWA 4H08A 2ZXUA 5I9BA 2R6GA 2JCSA 3RTDA 5A3QA 4ALLA 1C4WA 1F5SA 3I9V1 4WEOA 2R9RB 4EMTA 1FC0A 1OJHA 1U8AA 2FSFA 3WWDA 3T3MB 5TMPA 4ZOLA 1O95D 1GCGA 3SKVA 3HH8A 3KKYA 7MDHA 5BXYA 4DF3A 4PZPA 5GM2A 1U0HC 3AT1A 3DMFA 4CETA 3K9SA 4H7EA 1GPUA 3H2JA 2P5YA 1RJDA 5CBPA 4CH4A 1K4MA 1SIOA 3OD1A 3WGNA 4PONA 2G82A 2O2EA 4H1HA 3WV4A 3TIGA 1XZNA 5CFNA 4DMRA 5AOBA 2VCEA 4N7BA 1Z38A 3QO7A 3TAHA 2A4MA 1I5XA 3ER6A 1T5DX 4EX7A 2WA4A 2QRMA 5B1SA 5LQDA 3L1VA 4UFZA 3Q7TA 2I29A 1QIHA 4YRNA 3F74A 1MO3A 4XQEA 1CEZA 2W5UA 1WUIS 3W6OA 1JLHA 2V54A 2ZIEA 5CW1A 4DNXA 3EDRA 3C3BA 5CRIA 2UAGA 2QRLA 3LX6A 1NLZA 3GVCA 5KQSA 1LQUA 2Q07A 2KTVA 1XEFA 5CHYA 3ICOA 3QX7A 3MHTA 4HFRA 4LRXA 2MTBA 2ZLBA 2W2KA 1E5DA 1NM5A 2Q0XA 5K0NA 4MUAA 3P0FA 5DM60 1FYFA 1MOSA 3KQUA 2WFAA 2EX3A 1Z63A 2OK8A 2BZGA 3DZGA 4CMIB 3JPYA 3M4NA 4I3GA 1B04A 5CP8A 3ZHVA 4NYJR 3AF3A 1J39A 1NW4A 3BZUA 3LVFO 4MKHA 1XL4A 2NO9A 1KZYC 3G17A 3U3OA 3DE3X 4PHGA 4CM9A 1CRPA 1XNRO 1OZ0A 4NVRA 2QR2A 3AVYA 3OFND 1FUKA 3V8QA 2H0QA 2REBA 1Y67A 3VPAA 1MX5A 10MHA 5AKEA 5ADHA 2A14A 2LP7A 4TQ9A 3A0HZ 4GNKA 2CHEA 2QUBA 2P9CA 1W5SA 2I54A 3GJ5A 3FGPA 1ZKDA 3WGJA 3GTZA 2I3GA 4N40A 1MTZA 1B0UA 1CLEA 5IHPA 2O2IA 3I5UA 3CKYA 2CDBA 3MMXA 1D6JA 3JQFA 3KLNA 1QUEA 3GLGA 1U8ZA 3MHHC 3OEYA 4ABYA 2XGSA 1T2DA 4RORA 3C43A 1ILEA 3EXIA 2W98A 4U1RA 4NJEB 4ZQBA 3PHGA 3O3CA 3LPAA 1BKSB 2VPTA 1JQAA 4OK3A 4GZ3A 4ND5A 2GK3A 2CAZC 1XAJA 1C3XA 3MQ4A 3QOXA 5DHFA 1YBHA 3IP6A 3O47A 4E0BA 5H2FZ 1O54A 2V58A 2ZE7A 3DVSX 1GQSA 4NDZA 1QF9A 1VGQA 2ZRAA 1HE5A 4UCQA 4HKTA 2FUEA 2CLKB 3OPQA 5EWMB 4DLLA 4OQZA 3F7VC 4MTFA 1B8VA 4OXQA 4QUIA 2QNBA 1VF6C 3LCUA 5FNVF 1EUCA 4NNOA 4JBNA 4C89A 5COAA 3O8QA 1WB8A 4LOIA 3KVVA 5CCEA 4UVGA 4URUR 1G8PA 5DRTA 1KE1A 5KSOA 5FHQA 1G6Q1 1QJCA 4NENB 1EM8B 1P0IA 1TEVA 4AS1A 1ATIA 5F9HA 2QN8A 4DDWA 1LD3A 2PKEA 2HG5C 4LFAB 2VATA 4BVFA 1XT6A 1VHTA 1YDEA 2XNDA 4IYHA 2F48A 3FR8A 4V0QA 4TS1A 4WVLA 1V71A 4RNDB 1KC1A 1ORHA 3QLUA 1RWXA 3QX9A 3T94A 3TAXA 2WLLB 3NHYA 5KTTA 4EYKA 4PSUA 4KWHA 3LHFA 3SMVA 5TS3A 2B8TA 1YMVA 1L7EA 3LW8A 2B8NA 3QW4B 4IVPA 1QLJA 4LBVA 5F5NA 3VV2A 1Y9ZA 3ERCA 1N6OA 3ZMUA 3D1JA