2VXYA

The structure of ftsz from bacillus subtilis at 1.7a resolution
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
306
structure length
306
Chain Sequence
LASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATGFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN FTSZ
publication title An Inhibitor of Ftsz with Potent and Selective Anti-Staphylococcal Activity.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Cell cycle
total genus 111
structure length 306
sequence length 306
ec nomenclature
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 2vxyA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 2vxyA01
5BMVB 3HKEB 4EI8A 2RHOA 4O4LB 3RB8A 4DXDA 3WGNA 1Z5VA 1TVKA 4O4IB 1Z5WA 5ITZA 4F6RB 5KX5A 5JH7B 1FFXB 2R751 4X1YB 5CA0B 5MN6A 4EB6B 3ZIDA 4I50A 2XKBA 3UT5B 4ZI7A 5IJ9A 4X20B 2BTOA 4U3JA 3N2GA 4TV8A 4O2BB 4U39A 5CB4A 4B46A 5IJ0A 5LOVA 5EIBC 1W581 3RYCA 4EI9A 2Q1XA 3HKBA 5EYPA 5MN5A 5GONA 5IYZA 5C8YA 5LP6B 3HKCB 3RYFB 5LA6A 4TV9A 4I55B 4O2AA 5JCOC 5KMGA 4X1KB 1SA0A 5J2UB 3JASA 4LNUA 4I4TB 3N2KB 4YJ3B 5EZYA 5J2TB 1TUBA 5EIBD 4TUYA 3VOBA 3HKDB 4YJ2B 4ZHQA 4X1IB 4IIJB 3HKEA 2VXYA 2VAMA 3C8LA 3VO8A 4O4HB 4XCQA 4O4LA 3JARA 5FNVA 5JVDB 3JAWB 1RLUA 3ZBPA 1W59A 1JFFB 1W5FA 1W5BA 5JH7A 1FFXA 3R4VA 4X1YA 3JATB 5CA0A 4EB6A 2R6R1 5JQGA 3V3TA 1FSZA 3RYHB 4X20A 4HNAB 3E22B 1RQ2A 5LXTB 4FFBA 4O4JA 3HKCA 5LP6A 2GVIA 5LYJB 5CA1A 4I55A 3JALB 5J2UA 2XKAA 4I4TA 3N2KA 5BMVA 5J2TA 2RHHA 3WGJA 3CB2A 4ZI7B 1OFUA 5IJ9B 5IJ0B 3HKDA 3N2GB 3RYCB 2Q1YA 4X1IA 4IIJA 4DRXB 4WBNB 3HKBB 5EYPB 5GONB 4ZOLB 3JAKB 1RQ7A 4O4IA 4F6RA 2RHLA 5JVDA 4IHJB 4TV9B 3VPAA 2VAPA 4O2AB 5KMGB 1SA0B 1JFFA 3RYIB 2BTQB 3JASB 3UT5A 4EI7A 3M89A 3JATA 5M7EA 4TUYB 3WGMA 4O2BA 4ZHQB 3RYHA 3VO9A 5MN4A 4HNAA 1TVKB 3VOAA 3WGLA 1W5AA 3E22A 3JARB 5ITZB 3RYFA 3WGKA 5KX5B 5FNVB 3ZBQA 5LXTA 4M8IA 4X1KA 5LYJA 4YJ3A 3M8KA 4I50B 3JALA 5LP6C 4U3JB 4TV8B 5CB4B 4YJ2A 5LOVB 5JQGB 4O4HA 5IYZB 2RHJA 5JCOA 5C8YB 4DRXA 4WBNA 1W5EA 3JAWA 5LA6B 4ZOLA 3JAKA 4KWEA 4FFBB 4O4JB 4B45A 4E6EA 4LNUB 5EZYB 4IHJA 5CA1B 1TUBB 3RYIA 2VAWA 2BTQA
chains in the Genus database with same CATH superfamily
4G5QA 3OOEA 4B44A 1NW5A 3JZFA 5CDTA 5EJEA 2PXHA 4OGKA 1JWBB 4KXQA 3RRYA 1IM5A 4FCVA 3CNLA 4RFVA 1PZGA 4TLBA 2IEZA 4CM9A 5CFNA 3UUEA 4HGNA 4P35A 2QQGA 5TEWA 1PDWA 4Q7EA 1R6DA 4U6NA 3THRA 4BO4A 4CR6A 3BXOA 3E9QA 1DSSG 4RQOA 3Q0EA 5JUWA 4HB2A 1M7GA 5BW5A 2R6CA 4WSOA 3OZUA 5IJ9A 4B82A 3O9MA 4XYGA 3S1AB 1W581 3IUQA 4Q4AA 1CU1A 4CKWB 3FR7A 3EWAA 4D9FA 1E2MA 1JQKA 1P1CA 2M6KA 5JYEA 2FWPA 4F5DA 1T9GS 2QG9A 2HMYB 3S70A 4MQ6A 3T35A 3UIEA 1P9WA 1Y4DE 4GLLA 1VXOA 1HTTA 1NXQA 3F6BX 3IQDB 1RXWA 4XVUA 1X9GA 4C0XA 1RI1A 4HF7A 5I7VA 4MPTA 3E9YA 1S1CA 2JJYA 3CEJA 5H1YA 1CCWA 3NVDA 1VQ1A 3O9ZA 2VZ8A 3ZX4A 1UWCA 4GRDA 2QE7A 1BX1A 3BQMB 3OPXA 3ETHA 1M1ZA 3PEUA 5JVDB 1N2SA 1EJ2A 1S4MA 4LXYA 3TFOA 2ZUEA 3LAWA 4RKYA 1ZH8A 1DAGA 1ENYA 4RTKA 1AN9A 2DY0A 3KUUA 4NBWA 5FNZA 4DCJA 1Q44A 2JZOA 1R6UA 1VCHA 2ZR7A 3K8YA 5CA0A 3X1MA 4B4DA 2BH2A 3OY7A 1AGNA 1P7CA 3OPYI 1IZZA 5CTAA 2FN3A 3TMKA 5JCJD 1A71A 1F8FA 4EHDA 1MX9A 1NW9B 1PO7A 3GTZA 1UBCA 1UMCA 2P9FA 3NT5A 4I1YA 2P6PA 2XAAA 1H2ZA 2AIZP 3N53A 3U0OA 4ID3A 3RA5A 4F6CA 4RVNA 2H7CA 2JK1A 1ZD8A 3LK7A 4Q6WA 4S2UA 5ECYA 3ODPA 3QKSA 1KJYA 3AESA 4G2TA 2QP3A 4UXHA 5ADUS 5KVCA 3ZBUA 4HT3B 1QGZA 4OX9Y 3SN6A 4DVJA 1X0XA 3LK6A 1Y8RB 2DPGA 4C0QC 1XKQA 2JFFA 2JJQA 1XAIA 5IBPA 3PNPA 4AO6A 1BIFA 2O54A 4FMBB 2HOQA 2WKPA 4V0SA 4G0XA 4GI7A 4CDRA 3ZKWA 4KZPA 1CUWA 3QY9A 4K5QA 4YAJA 3TPCA 4IHJB 1FDWA 5C9ZA 1AT1A 5DM60 1ZH2A 4E30A 1A8HA 2WD9A 3AR7A 3RNLA 1P6QA 2J41A 3JX9A 1E2JA 3AINA 3M89A 3GK3A 3ELWA 1QRTA 3K4QA 4MKHA 1ORRA 1ZQ1A 5IPFA 5A0FA 2P1ZA 2REOA 3P9KA 4FFOA 3IR9A 4FGZA 3MTDA 5LQSA 2XYVA 1V6CA 3UHFA 1Z4QA 3QTLA 4MP6A 1UODA 1BQ3A 1RW4A 4RV4A 3WHPA 1J2RA 1WWKA 4R3NA 4OQZA 4ETWA 4NOLA 1XUOA 4FSHA 3JQ8A 4YACA 2AOTA 3WIUA 1J22A 2B5WA 4DM4A 1H9CA 3RVDA 2W8ZA 2DPYA 2L2QA 2YYSA 3HBNA 3HSKA 4ZCRA 2IC5A 2PCLA 4C89A 4FYWA 3FTPA 1VRVA 1UKCA 4OFXA 2BD0A 1M72A 5C8YB 1RVV1 2DFPA 1G5HA 3RABA 1QQ7A 1U0JA 1QH1A 4I5FA 4GOXA 2GQ0A 3FCAA 2CCJA 2FX3A 1Z75A 3O4IA 5AKEA 1MX3A 2ZYRA 2LDBA 4YAFA 1C9DB 2CVHA 3RIHA 4OQPA 4B76A 2HJWA 3E8XA 3ZOPA 3TWOA 2BKAA 4MIKA 2XCTB 4AX4A 4DC9A 1DOHA 2HIMA 3PC6A 3LT2A 2EW8A 1DKOA 3A31A 1WVMA 4PYQA 4RSHA 2D4HA 2QYOA 5TQ0B 1N57A 1EUCB 2PNFA 4ITUA 5FBRB 4DLKA 2A9KA 3K8ZA 1B3BA 5J4YA 3G6KA 1GL6A 3AM5A 3OQ6A 4CMIB 3UBTA 1TYAE 2H7YA 3OF5A 1N0HA 1TMKA 1Q12A 1M2VA 1SHTX 4U39A 1PFVA 3BT7A 4FGJA 5EIBC 1N5DA 2QMEA 2CSUA 1AHNA 3A1SA 3FFMA 3B1JA 3GC6A 3NU1A 4L5BA 4PRKA 5IYZF 3PX7A 1AS2A 1KIAA 4BKUA 4BZQA 2O7NA 1UAAA 4IO1A 4BT6A 2CUKA 2H63A 2X4LA 3C3WA 3NTVA 1UUFA 3C3DA 3TAUA 3NAZA 2ZR0A 3HRKA 2LP4Y 5JROA 2EJUA 2IE8A 3QA3E 2VRCD 1UK6A 3KHUA 1Y42X 1T4DA 2ZRGA 4AJ1A 1AK2A 1T0PA 1JYEA 3LDAA 3OQJA 2HSJA 1UI9A 3IODA 1GZ3A 1W9HA 1Y9JA 3JQ6A 3DP9A 4ZT7A 4ODIA 5I4KA 2W2QA 2J3JA 5JSKA 4JZYA 3RU2A 4U2DA 1HG0A 3FPAA 1RMTA 2EZUA 3NIBA 2Z8YM 1WW8A 1KVSA 3G5MA 7YASA 2P1RA 2UKDA 3P7MA 3WZ2A 3M1XA 4OV6B 1BHSA 1SG6A 2JFNA 1Z3CA 4WAUA 5D85A 2NP7A 2QI2A 1Z2CA 3FHLA 3PXGA 2BGKA 2JBHA 1JI3A 4FDMA 4WJKB 1X9HA 1N2IA 4U4AA 1FMLA 4CM8B 1QH9A 4PFQA 3ZO8A 3JQAA 3SC2A 2V45A 1GDTA 3UMSA 2F3RA 3KOUA 3QITA 1ULSA 2H9IA 1O54A 2YZMA 3LUFA 2ODEA 3HK2A 4UZSA 4MITA 4IJVA 4JITA 2RHMA 3EXG2 4HPWA 4LXXA 1REQA 5AJYA 3KJXA 1NAIA 1BU5A 3EGWA 5FTJA 3QELB 2PAFA 4K05A 2QTVA 4NY1A 1Q1ZA 5JVDF 1KI3A 1OA0A 2CLMB 3L49A 3ID6C 2XJ4A 2RB9A 3IDAA 5CFZA 5A0TA 1JHXA 4LK3A 4A5OA 3CUTA 4XDGA 1I30A 2VHJA 2G06A 4AP5A 1E9RA 4DLRA 1GT91 1JQDA 1IQRA 1IEXA 4OQQA 1P9NA 1U0RA 3CF4A 3MYRA 1GG5A 3VI4B 1TT5A 3ICOA 3ENQA 1CYDA 1N1GA 3V1NA 4QD3A 2NTJA 2P6YA 4NMLA 7GPBA 1OTXA 4Q01A 1HSOA 2Q3DA 1TMGE 2JHFA 1FYWA 3LG2A 2K5UA 2WMYA 3EUAA 2XOXA 3GPIA 2PBLA 3IPAA 3NIWA 3PD0A 4N5NA 1W42A 4Q3BA 4TKMA 4LQ4A 1J0XO 1RJ9B 3PDIA 4UKDA 5AIBA 2BW0A 3I3SR 1ZD1A 2WF5A 3WO0A 4D4LA 1R4NB 1RKUA 4XDZA 3ZHBA 2RJ3A 4ZOLA 1QFSA 3KE8A 1T5OA 4FIZA 1C7ZA 4QEKA 1GCGA 4IHJF 3GG2A 3I2GA 4PN3A 3HZHA 3TCKA 5AM1A 4FJ1A 2ISCA 4BFZA 4H7FA 1J97A 1VI6A 4RYLA 1G18A 2WVJA 1UEIA 1R0YA 2D59A 3I30X 3MIIA 4DWJA 4TOIA 2C7PA 5AI0A 1XA4A 1NVXQ 2PRYA 5CLFA 3ZDYB 2I71A 1W76A 4DR2B 1JEAA 2Z57A 3QJ5A 3RFTA 3ZW9A 3PYMA 3OH8A 1IY0A 3KKPA 2EBWA 3NM4A 4MLCA 5FLKA 3PI6A 3ZI0A 3VKHA 1CS4C 3L8CA 1QVRA 1H0HA 4FNMA 4EB6B 2NNLD 1Z8NA 2BR5A 1M5UA 3BL8A 2P5SA 1E7SA 5L3QA 2ZTUA 3EF3A 2FEKA 3NVMB 1LJ8A 4GI1A 1XFAA 4LC0A 4MUIA 1Q3TA 4GF5A 5C8YF 4YASA 2E7ZA 2Q3LA 3BTSA 1WZEA 3D8UA 4M9RA 5HRAA 2FQWA 3D9QX 1PW5A 1L6RA 1TUIA 2C5AA 4M7RA 3LFTA 3LQYA 1PKEA 2KBFA 2X4DA 3CBQA 2BGLA 9GPBA 1DKQA 2GA8A 3CONA 4RD0A 2KM1A 1RQXA 3LVRE 1O5IA 3Q0IA 3OY2A 2DUWA 2Q1SA 3D7LA 3DE1X 4QL3A 5TPWA 1F4LA 3LWOC 3E5RA 4KH1A 2IY7A 1DC3A 4IVQA 4H59A 4ZRMA 4FW9A 1R0LA 2EARA 3BJIC 1LPSA 3G79A 1VFPA 1WV1A 2CKDA 2VDOB 2YJ5A 1T9CA 2GZRA 3IDFA 1W46A 2B4QA 2VK1A 5D84A 3EAFA 3UUGA 1OC2A 2LD4A 3NYRA 4KN5A 4N3BA 1ZUWA 4W63A 4PC7A 3GUCA 1C1XA 2RGEA 3U3MA 4KDFA 1PJSA 3ILXA 1U8CB 5EJIA 4GVPA 1NVKA 3QMVA 4ZOEA 1C3OA 2I4IA 2I87A 4AZTA 2O05A 4UHEA 2I4LA 2O8FA 2E5FA 1Q14A 4RDHA 1GPBA 2H5EA 3AC0A 3P2EA 4A2PA 3OJCA 3WLAA 2XUKA 1ML4A 2WUWE 5LFAA 3BKXA 3CLRC 3M9WA 4MW4A 1BKYA 2HU8A 2RC6A 2P9QA 5IJ9B 1NUUA 5DNAA 4B2IA 3FDJA 4CN9A 1TK9A 2JRLA 4O2RA 2Y0EA 4NCIA 4MRSA 2C2MA 5EKTA 4YP6A 2VC2B 2YHAA 4XVHA 1R9GA 3RQIA 3WYGA 4DXHA 3VZPA 2PJRA 1WDWB 3RVPA 4DIOA 5KYKA 4M55A 4F2GA 1PEYA 3PUIA 2Q0SA 4EPTA 3EIUA 1YUBA 3X2FA 1RM3A 4OI4A 2CNKA 4LDJA 4CMGA 4DDVA 3K7EA 1TADA 3SSAA 1GGKA 1Z4IA 2CE2X 3GHYA 1V11A 4PC6A 4ZCIA 2P6OA 1Z5OA 2AEEA 2B9EA 1K7SN 1VIMA 2R8YA 3C8ZA 4KYUA 4IXWA 3P4UA 3K14A 1QIFA 2CB9A 4N3AA 4J90A 5KVVA 1G2OA 1YT5A 2XB4A 3QY0A 5JLAA 1GPKA 4J0EA 3AF5A 4Z4CA 3PCXA 5IHXA 5J5VA 1TM7E 1UMCB 1B0PA 1XXHA 1YDWA 1N5JA 3KVVA 1FU4A 3MMZA 4OG2A 3S02A 2FZ4A 3FA2A 4U8GA 2V0CA 5DCLA 1U8FO 1TYCA 3RWMB 1Q1NA 2PKQO 4MW9A 3SYNA 4JGGA 2ZRNA 3KKMA 1CIVA 2PCJA 4OJTA 5ALSA 4HDKB 1H1DA 1K4KA 4LBWA 4CVNA 2NT3A 4G5HA 1JEOA 1ZESA 2QLJA 4OL9A 2YBEA 3V42A 1W57A 1G20E 4KK4A 4WD3A 3LTEA 3NAQA 5KHLB 3ON5A 1QZZA 3PFBA 4C3ZA 3D0OA 3ZP7A 2Y6UA 3ER9A 2B34A 5HUHA 3NHFA 2W70A 1NTRA 2ZREA 5P8WA 3ZHYA 4EBFA 1GTMA 2VHUA 4UMDA 4DG5A 1G19A 1BRTA 3GJYA 3LJKA 1MQAA 1ZC4A 2XHZA 3VTAA 1U3UA 1Y9EA 5CLLA 1GAXA 4BFWA 2PVSA 3HABA 4CMAA 3PGJA 4HAYA 1ISRA 3PV0A 5I5EA 5AJXA 3K2XA 1F12A 3DOIA 4L74A 4RH3A 4HVCA 2X8LA 1RRCA 3MG9A 3QU9A 1Q50A 3F8SA 3IIJA 2IXTA 2O9JA 4I55B 4RA6A 4GOMD 4DR6B 4UU0A 3UC5A 3BA1A 3NWJA 4GW3A 1L1FA 4P4SA 3LLSA 2RK4A 2WBLC 5K51A 5CCEA 1GRCA 5D8DA 3O2NA 2ZIAA 1QFXA 4GQIA 3W9SA 2QP4A 3PIDA 3ZWXA 1KZ1A 4EECA 3G0HA 1ULHA 2CDCA 1P0IA 3FBGA 4C4RA 1RKQA 3JWPA 3TFWA 1KI2A 5KWSA 3TSYA 4MHTA 3EB9A 4Q3DA 4AMUA 2N9UA 3JQQA 2H4ZA 2Q1WA 2RAVA 2XECA 2HJRA 1OIVA 2L17A 2X9VA 1KZ9A 3DMPA 1UFOA 1BDBA 3N8KA 4U00A 2WSSA 4ZHWA 2C9MA 3VYRB 2JNWA 1WMEA 2RD2A 2A0KA 3G2OA 1XTJA 3MOGA 4BE4A 4F06A 4BGDA 4GM1A 1B1CA 2O1XA 3T95A 1OB2A 3IP3A 3IEUA 3EBLA 2FSVA 4R51A 2BLLA 5F3WB 3I6ZA 5EP2A 3FUXA 4Y2UA 3UKOA 5HQ3B 4AD8A 1L3BA 4HK4A 1V8DA 1KHTA 2C5LA 3LY7A 3ZY2A 2HEGA 4GSLA 4WVLA 4YYEA 3DE2X 5BMVF 2PGDA 2QEQA 3LWNA 1WUYA 1D2HA 2J08A 2ONZA 2QTHA 2V58A 3R5SA 3QHQA 4KL8S 3UJ7A 1SM4A 3HS3A 4CIBA 2XEXA 3AF6A 1M2VB 1CP3A 1RLJA 3C8MA 3GYBA 2Q1YA 2G88A 3E7XA 3L0BA 2BTEA 1OFVA 1X7WA 3RK4A 1PUJA 4BQEA 9LDTA 1JQLB 1MLDA 3GCXA 4CQLB 4P0QB 1XTRA 1Q3KA 5EZ6B 3PRHA 1TQHA 4OHCA 1TOAA 3REOA 1O6FA 4CR8A 3L6RA 4DLVA 4G41A 1AXEA 3F74A 4E51A 2PS0A 5CDSA 4I1OA 2PL1A 4RTOA 2UZAA 4NCJA 3WRXA 5M7EA 4R54A 2VPPA 3KUCA 2XF8A 5B2FA 1BQEA 3E3OA 4EATA 1HMPA 1X86B 3K92A 1VHAA 5CG2A 4PNZA 4G0OA 3DW1X 1L1QA 4HBZA 4X1KA 2V4ZA 1YKSA 3PJRA 4AF8A 1X1CA 4MRRA 3A14A 1X15A 1Z0SA 3VUEA 4XI9A 1LBSA 4CM5A 3M84A 2BSXA 1P2BA 1DX9A 2IOFK 3KLOA 4I1SA 2ZJOA 4KC0A 5HE8A 4A03A 3IP9A 4MVJA 3RIEA 2FJPA 4P31A 2QL7A 4YO7A 1SC1A 5CJJA 3ADKA 2PHNA 2CXHA 4PAWA 1ICIA 2JIZA 2ZB7A 4KQ2A 3T7EA 1SZJG 4YT5A 1F06A 2GGSA 1H2FA 1U2DC 2ZWVA 4EKYA 4QPJC 1B15A 1EQUA 1KETA 5IASA 4PX9A 2HIAA 3LA8A 5AI9A 5HOEA 1T4GA 5DOVA 2QPAA 3VC2A 1EFVB 1NG1A 2ZI5A 2FZEA 3K9BA 2QTVB 4GWGA 4N0QA 4Y6SA 5AJTA 4BYGA 3TMYA 3DV9A 2QTBA 1C1HA 1HFEL 2P6MA 2Y77A 1T1GA 4RHFA 4YA6A 3WZLA 1K9MH 2Q3BA 2XMGA 4MW6A 5H9VA 1P5JA 2HYIC 2X5KO 3NANA 1CUGA 1JIVA 5A62A 3IBCA 4RKFA 4GVXA 1R0CA 4Z9BA 3EA4A 4N5LA 4E4RA 2D2XA 2OXFA 4G23A 1PHRA 3LRPA 2UU9B 2J7PA 4CL8A 2PZEA 2QMUA 1LA2A 1VL2A 5D01A 2QRKA 1E89A 2RGWA 2LTAA 2V7EA 3PDHA 5FADA 1HYHA 3GFGA 4DA0A 2WHPA 4BO5A 1PT9A 2BSAA 2GSDA 3L9XA 2WM2A 1PV4A 1DX6A 1MX1A 3R41A 5DM0A 4Q7LA 1YQGA 1AIPA 2YIJA 4XGIA 3BOSA 1E6MA 3CZ5A 3WGZA 2EU8A 3ZI4A 1VCNA 3OE1A 1DZ3A 2PX8A 3Q6NA 1SUSA 5JMTA 3IBGA 2GYYA 1ZSYA 4MRAA 4YMIA 1G4AE 3WNQA 4EYKA 3HI6A 4H08A 1CZUA 1JX6A 5B55A 4JUFA 3KIPA 2QVLA 5HW0A 1NUQA 3GHHA 5I7UA 1YJNF 2SBTA 1G21B 1C9YA 1LLCA 3OPMA 4JK3A 3I61A 1U6JA 1EZZA 2GN9A 2QLBA 4JUAA 1OAAA 3BPSA 3B6NA 1MVLA 4J1TC 1MO4A 3UAGA 4B3XA 2HBQA 2NOAA 1F8UA 3QYAA 3DZJA 4MKGA 3FD5A 3NHSA 4HH1A 4UFOA 4I55F 3QE0A 3QQ5A 4YUVA 4A8PA 1M0EA 4BXOA 1K0FA 3HUFA 1P1KA 5EMMA 2A3RA 2LCAA 1JH8A 1JPUA 2K6GA 1SU7A 2V74B 1U9CA 2YUIA 5KVQA 3QVMA 4NFLA 5CIWA 1LV8A 3ZP4A 1ND6A 3WC4A 3H2JA 4BGUA 3QPBA 4Y2QA 2XYRA 1LI5A 1IUNA 4RIEA 2OR3A 2GRJA 1LRKA 2XNSA 3BD8A 3ZJ5A 1MXFA 4N54A 4BU1A 4KB5A 2BFFA 1YB7A 1KEWA 3UVEA 2G80A 2QM3A 5LQMA 3T9BA 3CVUA 1C81A 2WJ3A 1R8JA 4OYHA 4FB4A 3QU7A 1SD5A 2JGAA 3D2LA 1F51E 4B2LA 1WSWA 4GR5A 4Q16A 4J03A 1FDTA 5TPWB 3DR5A 4YVFA 4FUTA 3TBHA 2AEJA 2I2BA 3AF2A 4UTVA 3SYTA 5EZ5A 2V98A 4FYXA 5GVRA 5FPQA 2XOEA 3BX1A 1PR0A 1XCOA 1AKRA 5K3DA 1UZLA 2WA1A 5CT8A 3WQQA 4UPDA 2Z2JA 1XBIA 4KTTE 5A3VA 3QOWA 4US0R 4MQ4A 4KXFB 2JAHA 3CRW1 3I2IA 5AI6A 1S2OA 4K9PA 3QKWA 1PJCA 1C1XB 2VP2A 3GLTA 2PLNA 4YPVA 721PA 2NM0A 4RKWA 2RGYA 2WIFA 3RV4A 5JC1A 1F4VA 2P0AA 4JYAB 4HFRA 1OHHD 3H2IA 1TTTA 2O8FB 4LI0A 1ZH4A 3ZCPA 2W93A 2GKOA 1IMJA 2B37A 2B36A 2P30A 4ZGWA 3JCMM 4E11A 1Z4LA 5THXA 3O21A 1ZYUA 5DGIA 1ZH0A 2BI7A 2G5GX 2PJDA 5A4AA 2FMIA 2I55A 5EZSA 3RJ5A 2HXYA 3ZQJA 4UC0A 2AI3A 3OI7A 1EDBA 4ID9A 4CF4A 1E99A 4Y0AA 3AXSA 5DT9A 1DCTA 1FL9A 2ATEA 1KOJA 3IIIA 1KZHA 2O5EA 3HPRA 1BCSA 1AF7A 4REOA 5EWLA 5IT9A 2ZTLA 3LP5A 4JI5B 3F97A 3GVIA 3CBGA 4BEBA 1NW3A 3CRVA 4XGKA 3LLVA 1IOWA 4ZQFA 2XVMA 1TCUA 1W4CA 3MDOA 2UZ0A 2HC9A 3D4OA 3H5NA 3I01M 4D02A 3AW9A 3U9SA 1DKPA 1JR3A 2YVLA 1DI0A 1NW8A 2P3SA 3P9CA 2QKYA 2IY8A 4FHGA 2NAPA 3WGUA 1P1HA 2IOYA 1OVGA 4CM6A 2ZUUA 2GFHA 3CRQA 3UNXA 1J6UA 4BFYA 4DMGA 5JCPA 5KNBA 5L4SA 4FOOA 3SD7A 1PK8A 3DSRA 3S1AA 3KKEA 4DSTA 3JASA 1AUVA 1OFHA 1XELA 3IUJA 3KJQA 4EKGA 1CJCA 4D0SA 4QTTB 3WJQA 3NIFB 5CDUA 4X1IB 1LC0A 3O3OB 1N6OA 1W47A 3BAFA 3FTQA 3O74A 2JLUA 1DG9A 1Y63A 1VKOA 4XEUA 1J2JA 4C88A 4CEHA 3E53A 2AJTA 2P62A 1O97D 4JHXA 4MW1A 3W0LB 4DV6B 1GGHA 3D7KA 3FOCA 1YB1A 2WPDA 5F7JA 5BYBA 2JCGA 5JQWA 2W00A 3S8EA 1B8UA 1M1UA 2BHNA 2NVWA 2VXBA 4MPJA 3HSSA 1JD1A 1BG6A 1ND5A 2C57A 2R47A 3KFVA 3NBAA 3QUTA 5HFJA 2G5TA 2QUHA 1W85A 4KQXA 3S7TA 4JKYA 4OBEA 3UZUA 4F93B 4KAXA 5HUQA 3IMEA 3E4CA 1THGA 3DV2A 4QYIA 1OTHA 5DMHA 2PM8A 4HFNA 2EP8A 5JSZB 1V8ZA 3GDOA 5ALTA 1JAXA 2RH4A 3OM1A 1BO6A 3WADA 1L4NA 3NFRA 1ZA2A 4RFSA 4YCCA 2ZRAA 4K40A 4C08A 5K0ZA 4B6JA 1YC2A 5JFTA 4I36A 4MUGA 3UC9A 4TM8A 1TB4A 2PKEA 1V8PA 3EQ6A 1U7DA 2QPTA 3HQ4O 3ZHCA 1BSVA 5KOJA 2O8EB 3F1KA 1JKJA 2CCGA 4FQ5A 4F1WA 2EIHA 3R0PA 4OYRA 2KTVA 4L4XA 4W1QA 4RA6B 3H5TA 3VZRA 4GD3Q 4I66A 4P4SB 2ZUDA 1XEAA 3W3AA 3H9QA 5AVRA 4WIAA 1Q22A 4L0CA 1SB8A 3OHPA 4BFUA 2Q6TA 1V37A 4C4WC 1P91A 2W37A 5TMEA 1PAUA 4AF6A 1IY9A 3WGKA 4BAUA 2YNMA 2G63A 2BR3A 3HU3A 3P71T 1I4OA 5FIUA 2BE9A 1LW7A 5ALFA 3CV3A 1W3EX 1OC4A 1XYYA 2AQKA 3CZCA 4MSUA 5DW0A 5HMLA 1OUMA 2QD4A 2ECPA 3L43A 3PIIA 4MAAA 1JQBA 4RQTA 5HTKA 2FP3A 3EUWA 3LPMA 4J0DA 1JTFA 1SHZA 4BQNA 2J87A 1U63A 1DBVO 4ZDKA 1XJ5A 4HRYA 4XYLA 3ZD7A 1IE3A 1SBQA 4N12A 3DV0A 4G26A 3BHJA 4CHTA 5AHXA 4ZO9A 5TEVA 1ZMOA 4M76B 1ECFA 1V6AA 1DLIA 3IPCA 5CNIA 1HDOA 1T35A 4NE9A 5B5SA 4X5OA 3F9IA 3QM1A 4KVGA 3OP4A 4PNPA 1WB9A 1K2WA 2QUJA 4CDMA 1DU4A 4Q5IA 1JIIA 5LLDA 2DOKA 2ZS8A 2ZBVA 4GZLA 3U49A 1VZ2A 3G85A 4DDWA 3EORA 3OT1A 2QSZA 1EE9A 2OPHA 1EK2A 1SKYE 3QUQA 3QSYA 2AXNA 4LCBA 3D4NA 5DLYA 4AQ7A 1VQ4F 1M10A 1BD4A 3SBXA 3MGGA 4YJHB 5ALQA 5LOVA 2GAFA 3EA0A 2ZCJA 3DFZA 2CFIA 1JLSA 1LRJA 1EDDA 2MT9A 4J0IA 5DDIP 2GJAA 4B87A 4IUCS 2IPLA 4R1NA 5JNUA 4Y6QA 1F3LA 4A6DA 3AP2A 1DE0A 4U9IS 1LBIA 1ONPA 3IKMB 3STYA 1THTA 4X1KB 3T7DA 2QGNA 2IYOA 2ZP1A 4IICA 4MO9A 3CLSC 1JSXA 4TUYA 4HLCA 1M1KH 3ICQB 4DMLA 4OQ4A 4INJA 1W44A 1LGYA 5K6RA 4M88A 4TRNA 1TNDA 1I3NA 3JZMA 4W5JA 4UBKA 3UYKA 3VPFA 4GI2A 2FVXA 3CH5A 1GYPA 3ILHA 2WYHA 1HH4A 5CEEA 3H9EO 1L5HA 2Z2KA 2H4FA 4MA4A 4JGBA 2VHVA 3DMHA 1Y48E 1FCJA 2EFCB 4N01A 2Y76A 4FQ7A 1EUQA 4BNTA 4PYOA 1CEYA 1R16A 4TSFA 1KAGA 5H82A 2HTEA 3S0HA 2I7TA 4I19A 1TD1A 2ECOA 3LWBA 3G82C 4IGEA 5TVGA 2RGNC 3SBEA 2A9FA 5AW5A 1W2WB 2Q3MA 3GR6A 1PIWA 1KSJA 4J1NA 4D5GA 3EZ2A 4US1R 4WI1A 4YC7A 1ZI8A 1Q7TA 2GILA 2X8JA 4BV2A 3GAAA 4CL3A 1FP4B 4M1KA 3Q5GA 4DAOA 5JNVA 2TMDA 3KB6A 3HHEA 5E6UB 4JT8A 1VYUA 4Z3DA 4YV1A 5AVWA 3MJDA 2DT5A 1BGVA 2F1JA 5TR9A 5EMJA 4E03A 4YUZA 5FOQA 2GNPA 3E9CA 3EHDA 3Q8MA 3M4XA 4BPRA 2HLDD 2ZCUA 3SIWA 3IB3A 1OY1A 4KSYA 3CFYA 2GSWA 4AN4A 5IWAB 3HDVA 2B94A 2WU4A 3LUBA 3C5VA 4WOJA 4HR7A 2IZ0A 1B6GA 2PA3A 2QX7A 5JWOA 3LCMA 2VGMA 1KNXA 4II3A 1G1MA 3U7IA 1AZSC 3BWVA 4FLEA 4WK4B 3PYXA 2ZUWA 3PNMA 4UHDA 5AKGA 2QV0A 2FEWB 2WKWA 6PFKA 3GPLA 2VDVE 1TJPB 3IP6A 1R0XA 3W5IA 2J8ZA 3FD8A 1CKEA 4GE0A 2PO5A 2HHCA 3WL8A 4J0GA 3MMSA 3HWUA 4LMAA 1IZ7A 3CCLF 1I4LD 1N75A 1SKUA 2HBRA 2POCA 2ZJ5A 3GEGA 4A3SA 3Q41A 4YRNA 4KE9A 2F3UA 5L95A 4MR7A 3Q10A 4AW9A 5F5LA 2BIFA 1OZGA 2XDYA 2HP0A 1MO6A 2C2BA 3HGQA 3G2MA 3M2PA 5EAZA 4IW3B 4QUEA 4Y2TA 4O1IA 3RLIA 2O8DB 1YTLA 3AUFA 2WTAA 3R77A 5ELLA 4B75A 2AFIA 3OJ0A 4EMBA 2O3JA 3NNNA 3KOOA 5ALRA 4RJTA 3T1VA 3MUEA 2OBFA 3SKYA 4IJUA 4YY3B 1COMA 2BFFB 4EPYA 4W1PA 1XN4A 1LWNA 4DIKA 2YYEA 2YJTD 1FOEB 2GOYA 3HN7A 5D5QA 2AMJA 2P2ZA 1QOZA 3B5IA 1E60A 4RADA 4M36A 1QIMA 4XUGB 1KSGA 2IBSA 4GMFA 3F0DA 3LLCA 1XZQA 2OZVA 2AI1A 2F7SA 3EPRA 1O6ZA 3CUVA 3IUEA 3OZCA 3SC6A 1L7DA 3BICA 1EHIA 3D6JA 3FYHA 5KTNA 4TWRA 1JFTA 1T26A 1YK1A 1EXVA 3S0WA 4PSVA 5LCXA 2EZ9A 1XF1A 4KQ1A 1BHQ1 4FBGA 1AKEA 2RBGA 3BTOA 2R4QA 2RFLA 2WRZA 3AY0A 1ZONA 3LL7A 3MJCA 1NVFA 3MT8A 4DLUA 4NTZA 1SUWA 1V16A 2OFWA 1N2JA 4MRPA 2A78A 2H9YA 3FI9A 3R0QA 5B1DA 1ZVJA 2TMYA 2ZYGA 1AKMA 1II9A 3KC2A 3W6OA 4MS1A 3OETA 1W59A 3QE4A 3JYNA 2VP0A 3KJJA 3FYUA 1YR2A 1XEWX 4JEIA 3UOWA 4HSGA 3U7GA 4QYMA 2OBMA 4GYYA 5F5XA 2CZGA 3JYLA 1AU9A 5CK4A 3ZLJA 3NTRA 2W42A 1Y8QB 3I9MA 1YZVA 3BEOA 3OX4A 1UFVA 3F73A 2A5YB 3KM0A 5KKAA 1FUKA 3JQBA 3GHZA 2Q49A 2F59A 1SUBA 2B4KA 1OW3B 3R0VA 4RL6A 1BCSB 4I9HA 3RC3A 4A2QA 5KC8A 5CA1A 1N3IA 5I01A 3CE9A 1O0BA 3WWEA 2VDKB 4X85A 4PQGA 2CXUA 4CTKA 2JJ2A 5F7OA 3ABOB 5DT2A 2GZ1A 4RKQA 4BV8A 4JI7B 3H9GA 1NVGA 1X70A 3AVPA 4LCJA 3K05A 2YJNA 4QDJA 4DM3A 2CFCA 4DT1A 3GLVA 1W40A 3J81M 3LVQE 3NV7A 4TZKA 3LOUA 4RUKA 1K27A 1RI2A 2OV2A 4II7A 1TAUA 1UF9A 2XCLA 1X2BA 1C5KA 4F6RA 4JLMA 4QLOA 5HILA 4M7OA 4B83A 4ZJYA 1G1AA 4A0FA 3EG9A 3JASB 1WB5A 3FUCA 2PMFA 3O94A 5C31A 3OT5A 4PBTA 3WQRA 2HHHB 1I4WA 1P8AA 5PNTA 3MWDB 3SPXA 4UTPA 3SCZA 3ZZ1A 4D3XA 5A4KA 2PK3A 4OQMA 3GJ0A 4YI5A 4YRIA 3H04A 1F5SA 2UVDA 1WCIA 4LJ9A 3TNJA 1USKA 2OQIA 3HJGA 3UPUA 3UXEA 2WV9A 1N5KA 2YWGA 2ZIXA 3BWEA 1QONA 4M0FA 3DO6A 5DEOA 1W7AA 1J0CA 1NUTA 3CRNA 3KKOA 1DB3A 1M5TA 3LXRA 1OQAA 2HUPA 3QW4B 4RCVA 3QVGA 4NH0A 2OMKA 1CZNA 4R41A 5KREA 3WOHA 1PLKA 1VBFA 4QYIB 4Y6PA 4RMJA 4KGVA 4R84A 4UTNA 2WWFA 4RM2A 4LMPA 2OTCA 1XALA 2OZKA 1E0JA 5JCJA 2R2GA 1D04A 3QVOA 4Q1AA 3SBOA 4QYTA 2ZLBA 4OHFA 5G40A 3NVKE 2YMLA 3K2BA 4O4LB 1IV4A 1W1WA 1GZ4A 1XJCA 3CCRF 1W4RA 3WGNA 2GR9A 1BJRE 3OX2A 2BI4A 3NUGA 4JC8A 2WAXA 1YGYA 4KLNA 5E9AA 3WISA 3IVRA 1P2TA 1Z47A 1DXHA 1U0HC 5K3FB 3VXKA 4IIUA 3B7PA 3H5IA 1A8PA 2EX0A 3P1JA 3BUSA 4EUEA 3N87A 3RYCA 2B99A 2H3EA 4NIMA 5LQKA 5G4VC 2QN3A 2Q2OA 2EKPA 4Q18A 2RHDA 1WMSA 3NOVA 4L4SA 1FMTA 1J0AA 4EG0A 2ACEA 3I9V6 1YTUA 3JQPA 5LJLA 3UWDA 5HJ7A 2DH6A 3NOOA 4XX0A 1JDZA 1QNFA 1GPDG 1KDYA 3GVCA 4CNQA 3O0TA 1UBSB 1CLUA 3H2KA 1M7HA 4G84A 3B52X 1GHTA 3JARA 1SY7A 3PE3A 1YZYA 1QZTA 2ZJ1A 4QM6A 3EEIA 3HWWA 1Y7IA 3DV0B 3G5TA 2Y92A 4P4LA 3T3MB 3Q2OA 3RSOA 4CUJA 5FLXM 3T3IA 4OXQA 4NXNB 4GGPA 2PAAA 2ZAYA 2EDCA 1QX3A 3EXFB 5TSDA 4FYKA 1M2GA 4R83A 3HFSA 4PLYA 1V26A 4V3BA 3UJPA 1K98A 3NGLA 5E7JA 1QHHA 1OLSA 2K2WA 1JB9A 4M0DA 3FPKA 4QBGB 1N5MA 1Z35A 1GA6A 3IE1A 4DQ0A 1OU0A 3A3OA 1XZNA 4JR2A 2RGAA 3GB9A 3QBEA 2N0SA 4OHUA 4LJYA 4QXOA 4EQ6B 1MF7A 3CG4A 4YGXB 1NQUA 2FSIA 3E27A 3MA0A 3HM2A 2DFDA 2PUTA 3ETJA 4ZVOA 6ADHA 4PSAA 1NN0A 3CUUA 3LDFA 4JMPA 2FEMA 4ZCTA 2VLBA 5K20A 2ZVZA 2PZGA 2H65A 4HXGA 3DZCA 2X6TA 4HXEB 3SJZA 5H4GA 1FLVA 1PV1A 2XSZD 4N5MA 4D4IA 2C4KA 3HDQA 4DTCA 1YRAA 4URHA 1FU7A 3ESBA 5GOZA 4DDUA 1R6VA 4TUYB 3PLRA 4D3DA 1D4AA 3AUAA 1HLGA 2BWJA 4NBVA 1F7VA 1P2UA 2M1XA 1DUSA 3PXCX 1BMDA 2ZT7A 1FUYB 4MCAA 1YMUA 2VPQA 4C81A 1Z0KA 5BV0A 5J4LA 4R9RA 3STTA 4U5QA 3I64A 2C1XA 2E2WA 2VRCA 3QTBA 2YWJA 4OMFG 2AMVA 1I1OA 1YULA 1I8TA 1PVVA 4JSRA 4KLAA 4O0MA 2HKIA 2IPXA 4Y6RA 5EHGA 3GJRA 4TQAA 5KVAA 3VNVA 1Z82A 5JCOA 2WU1A 3DKVA 3H4VA 3JD3A 3NHLA 4L4ZA 4P2BA 5DGDA 3DLTA 3R8XA 4A6XA 1DC4A 2BFNA 3I2HA 1B16A 4YCBA 3DW3X 3L6BA 2EL9A 3FPSA 2IHKA 4WNAB 2ZAGA 1J7KA 4BTLA 5HKKD 4YBRA 2YKGA 2VDQB 4ESHA 3DB2A 1XRJA 5CGZA 5JFGA 5LMZA 3AWDA 1ZFNA 3MN1A 1JAZA 5JIBA 2MDTA 1KY5A 1J09A 1J8FA 3DHYA 4C21A 5KTSA 4IZIA 4OXKA 4GOOD 3ZNQA 2RI0A 4B9AA 5AUNB 5C34B 1KMCA 3TG8A 3VVLA 1RBYA 5LN1A 2RBEA 1CUXA 4JDPA 4KN8A 3QPCA 1FFXB 1RQRA 2BCJQ 1KERA 1VSVA 2Y2VA 3LPNA 3QIVA 4JP8A 3RAJA 3RHSA 4DNXA 5CYGA 2BYTA 1G2IA 1NF9A 1NVAA 2XMZA 4HB3A 5A5FA 2VT7A 2BY4A 4H4DA 4CDNA 5PGMA 1KI1A 3KPUA 2DSNA 4AY3A 5LQNA 2OAGA 5GONA 3LV8A 2CXSA 4PVDA 1IN7A 1E7WA 1U5AA 3ZHSA 4X1OA 3R2JA 1YE5A 1LPBB 2I67A 2MOKA 3DAHA 4BAGA 3IAFA 4PGMA 1PZNA 2IH4A 4D8YA 1E5VA 1QK5A 1ZIXA 3Q8HA 2UYYA 5EC8A 2B5OA 5B1YA 2AN3A 3C6KA 1DJNA 1ZHFA 2H18A 2PZMA 2XNCA 4O4LF 2FQXA 4R2HA 1ZM9A 4FFNA 3W8EA 4QXAA 4LHYA 4N65A 1PQPA 2A35A 2E9SA 3KHNA 1ZGBA 4HUQA 4HZUA 1ETUA 4MICA 1BW9B 1PQWA 1U9JA 2C4MA 4CGZA 3RRMA 5U9CA 2HRQA 4B6FA 2R6HA 5ALLA 4J1QA 3SHTA 2QVBA 4AU1A 4WUTA 4F3TA 2BGGA 3ROEA 3S6JA 1J8DA 1M74A 1UQTA 1CY2A 3DG9A 4P3KA 4EI2A 3ZJ4A 5BXQC 3CLUC 1NF2A 1CTQA 1FNBA 2AFIB 3IPXA 1GL3A 4L5IA 4YUAA 1YFKA 1NPYA 3GP3A 3HCEA 4QDUA 3WDLA 1U2EA 4IJWA 5H81A 3LDGA 4B79A 4W5OA 5JNLA 4CCWA 5KZMB 2QL5A 3T4XA 1L5MA 1OBOA 2XUHA 2IV2X 4CMHA 1ZOIA 4EW3A 3D81A 2H8GA 1K4YA 2IVZA 3R8FA 3DEJA 4LNHA 1CUCA 3QEJA 3A4LA 4OH7A 3QFTA 1EGQA 1W48A 4RLFA 4IR7A 2G3YA 2QX9A 5HK9A 3K9CA 1K0UA 4L7QA 4OBBA 1IYZA 4R31A 3V7QA 3MWYW 3ZV5A 1UWKA 3IVMA 3JAKB 2AI2A 1F6DA 1R6AA 4LRTB 5CFQA 2ZSJA 5IZCA 3I73A 1N0UA 2DZDA 5AXCA 2J59A 2O8BA 3I53A 3NP7A 2ZT8A 4D2IA 3WGIA 4ZMRA 3GEMA 2J0QA 4E2XA 3L4EA 3SXUA 5JT1A 1U9IA 3ABZA 4B9EA 1ATIA 3I09A 1NSFA 4O1MA 2R48A 1T4BA 4JMLA 5E3IA 4ZAZA 3VOAA 3TZ6A 2PMCA 4H6XA 3KSUA 4NICA 5LZ7A 3RVOA 1GZHB 1AD2A 1RKXA 1Z28A 4W5HA 3AV3A 4HG2A 3TZEA 2FFQA 4MS1B 3DJYA 3FFBA 3RWOA 1V2HE 3FYUB 1KARA 2C61A 3L7QA 3U3JA 4WXRA 1V5WA 3K0AB 2HLPA 4J76A 4U6QA 5K8TA 2W6ID 1ZWLA 3EVZA 2GK6A 4DNFA 2J1LA 2ZETA 4M8LA 1AQJA 1YIJF 2TECE 4CBVA 4CYMA 4B45A 4LGCA 2OTLF 5EEGA 1CRQA 1T15A 5CA1B 1U6IA 4KQEA 1FSFA 5KYVA 1L7NA 1RYBA 2OO5A 4IQ0A 5DLEA 3WBBA 1KO7A 3SEFA 5CG1A 1TFUA 5EJ9A 4X3PA 2IQIA 1Z7YA 1VLJA 3LXUX 5FBZA 4O3MA 3EF1A 2QLTA 3NV9A 1FTSA 4OA8A 4MJXA 3BD9A 3FWZA 1OOEA 4A9AA 4F6RB 1CIJA 1PV2A 3OLZA 3C70A 4UTXA 3WKEA 4CKYA 4P0PB 3AR8A 4EMSA 3BC1A 5L9AA 1BWRA 3OU7A 4A0HA 2YVQA 1K6IA 2VDRB 2Y99A 3OVMA 1FZQA 1BRMA 4FINA 1TA0A 1OASA 3IO5A 4E5DA 4QPCA 2BRUC 3KB8A 5DRTA 4EVSA 4FE3A 2VCYA 3WA6A 3ZGLA 3ZY3A 2IWHA 5CBPA 1WCIB 2GZ3A 1WVIA 2QN1A 1N2OA 2ZRLA 4C4XA 4ABYA 2BDUA 5L7WA 3PWSA 4GOJA 4IH1A 1UMBA 2J6BA 3N05A 3KSDO 4R1PA 1A9YA 1PUXA 3EDRA 4EELA 4DV7B 2QMOA 3A6DA 4AY2A 4CTOA 1JMVA 3RUAA 5DNCA 2RGRA 3IKEA 2X1LA 1L4LA 3GJSA 2ALEA 1AKVA 1Y80A 3CJQA 1HTWA 1HYGA 2V4UA 4ZOQI 5B8FA 2IP1A 4JLNA 4I9NA 2F1HA 5B3JA 3R6DA 3G59A 1Y1LA 2IUTA 4KQ9A 3VYTB 1FTWA 2YQZA 4KXWA 4DDTA 3AVOA 4NDZA 4CF7A 3I72A 3P5BA 5IG2A 1KTVA 1VFNA 3ESDA 3FNFA 1G2QA 2FFAA 3X2EA 4HAZA 3I58A 2FHPA 1UANA 1DC6A 2LIPA 3I4CA 3NONA 5J1SB 3KT0A 4XGNA 5K8CA 1UC8A 3D8RA 1SXQA 3V7EA 4UD6A 1RXIA 3PC8C 3QX9A 2ZTHA 3FUWA 1ZWKA 1XT6A 2ZJBA 1CP2A 2VP3A 3A32A 2ISQA 4LJKA 3SX2A 4F12A 1OVMA 1GR0A 4C8IA 1YDEA 2IZOA 4PHFA 2IF0A 4HQ0A 3WBFA 3V8QA 2FPWA 1KQFA 2HD4A 1UBHS 3R7FA 1HLDA 1KFJB 2IGTA 3U3DA 3RYCB 4EEKA 3L0CA 2AKYA 4FGUA 1JIQA 4WBNB 3CEHA 4KFRA 4WFJA 1UFKA 3OTIA 4B5LA 1YZ3A 1TC2A 3SU8A 4B4WA 2A88A 4H7IA 3KNZA 1DMRA 2NU9A 4IDOA 1XN1A 1FFDA 4NFYA 5EGSA 4ZDWA 2VAPA 5FEUA 2C9CA 1DVRA 2F1IA 2IGBA 1WQ4A 4XX0B 1FVFA 1SZCA 1NLUA 3IT3A 3K32A 3M4YA 4DSAA 3LGXA 1NY5A 2RK3A 3C9TA 1T8PA 3P20A 2VTEA 3TNFA 4BO7A 4CL2A 1S89A 4B81A 4RM3A 2AWNA 2E1PA 3KVNA 3E1KA 5LUBA 1AQNA 3JARB 1W5AA 1MEJA 4F72A 4QO7A 1O5TA 1QFYA 1CXZA 4CIAA 4D9IA 2ZXUA 3D7RA 1TQ2A 1UP4A 2WPNA 1DBSA 3IQZA 4M53A 2I33A 2CLEB 2BT4A 4OP3A 3U7JA 4KKVA 5KSPA 1QV9A 3AEYA 4MKIA 1Z7GA 4P6VF 3FBWA 3MAJA 3A3PA 4RJIA 5HE9A 4YRBA 2WJPA 2ZR8A 2P9BA 1OLSB 1XQ1A 4LYDA 5CD9A 2FPLA 1M7BA 2VWGA 3BIJA 4PPFA 1GTG1 4MEAA 2ZWIA 2G7ZA 4XIFA 1GEEA 5EKUA 1QCDA 1VLVA 1RP1A 3GJ5A 3H1EA 1JVSA 2PZJA 1X7HA 4BNWA 5CFRA 1Y6GA 4J07A 2B8TA 3NHJA 2OGTA 4FMDB 1E64A 1V1MB 2OT3B 5DF1A 3WK6A 4DXDA 1F9EA 2XODA 3IMKA 4NENA 5DI3A 1Y8CA 4GMHA 2HHLA 4N0DA 4D9NA 5JBNA 4L9WA 3RCBA 4ALIA 2NG1A 3JQCA 2W90A 4Z0NA 4ZVQA 2FPPA 1M0WA 4GPBA 2GHTA 4B3JA 4BWGA 3ND9A 2A9QA 1GV0A 1O9GA 3AEQA 1EMDA 2CDNA 2NSHA 4OTZA 2XZLA 2F90A 5A4MS 2XMCA 3HYSA 1HNZB 4W7SA 1K5HA 4LOJA 3TIFA 2IH2A 1SIBE 5E9QA 1OE0A 1Z5PA 1ADYA 1W93A 3PGMA 2DWPA 3A2MA 4R40B 1M2WA 2BEVA 4JP2A 2FYTA 1FTQA 3COJA 3FWKA 5EN4A 3EW7A 8MHTA 1C7RA 3AB3A 3FPHA 3HCRA 4U2GA 7MDHA 2ETXA 2EEZA 3C7TA 4OKSA 1H2AS 4B3FX 3H11A 4KDRA 1ZX1A 4KV7A 1PGJA 2I4RA 1SG0A 5AHRA 2I65A 2GF2A 3MQ4A 4CG1A 5K0BA 1M34A 1GKLA 3V4SA 4OHXA 2VEDA 2XZTA 2FFBA 3NR2A 4G24A 2PUEA 2X5XA 2CCKA 1V1RB 2UYJA 2I7VA 1HDIA 3CISA 5BW6B 3WGHA 4ARIA 4OHOA 4KODA 3GUYA 4ENUA 2JA2A 1ZUNB 3IEIA 5G1OA 4PZUA 5LM3A 5CCXA 1ISJA 3IQEA 3NGMA 5GQSA 3F4BA 3EZ7A 3G9QA 4B3DA 1GA1A 1CE8A 5JBQA 3RUHA 3N8HA 1F17A 2XVAA 2ZIFA 1PCXA 3FNHA 3KTOA 1PT6A 1E61A 1Y1SA 2C1EA 3FUVA 3LPLA 5TRTA 1YE8A 1J39A 3LHKA 4NMHA 5GONB 1EGVB 4URVR 5FWXB 4R1LA 3D8HA 5HZGA 2KSQA 2WHRA 1G8MA 2NQTA 3C48A 4ITRC 4MGIR 3SLRA 4YUWA 3UJNA 1VHWA 4BQPA 1U8YA 4P33A 1PFYA 1ZD2P 1B6TA 3F0FA 2F3SA 2WDZA 3SIVA 1MR3F 2XB6A 4FC7A 3ZCQA 4ENPA 5BWNA 2KWIA 4R05A 3G6WA 4P3YA 1TJYA 4G5RA 2GVZC 1DRWA 2R00A 2G9NA 4GOKA 1H85A 1YR3A 3ZHXA 3INTA 5HBGA 4OM7A 1QF9A 1UIRA 3QOFA 3DYIA 2FPGA 2II6A 2EQ5A 3RSQA 1QJ4A 4RSMA 1QP7A 4QYSA 2I3GA 4M60A 1XJQA 1YB6A 3VI6A 3PXDA 1T2DA 3R6GA 4IH9A 4L6IA 3R23A 4MK4A 3IULA 4Z54A 3GGDA 1A97A 1II8A 2WTXA 2IHVA 4NR0A 3X1DA 3ZHRA 3VJMA 3KKLA 1ZG3A 3A9VA 1GFWA 4R2LA 4ZICA 1MZVA 2WI8A 1NBME 4Z86A 3ROMA 1Z37A 3OF3A 1QE3A 4ZPXA 4COKA 4MYUA 4WBNF 2FLKA 1QVAA 4WTOA 3KU4A 1FU8A 1GVNB 2EAUA 1Z56C 1C8KA 2I03A 2LIVA 1SHKA 3T5DA 3ZCRA 1VQ7F 3L1JA 4PAGA 3TG2A 3GW8A 4Z5XA 2J5RA 2C96A 2Y1KA 1LPAB 2MR6A 3EAGA 4ZHYB 2GESA 2LKDA 1E4YA 2R5FA 3I2FA 2F1KA 3H8SA 1OBFO 3CMEF 2EZ4A 1QGDA 1HE4A 3HPQA 1ST2A 3IQXA 2VKQA 2GLUA 4FZ5A 5F23A 1Q6ZA 4TYWA 7REQA 3ZDAA 2Y8EA 2C5HA 1GAEO 2GBPA 4MQ5A 2ZUFA 2YIMA 1GNQA 4X97A 2GXQA 3HNOA 4QOEA 2RK6A 4WW0A 3WO1A 4E07A 4NCBA 1DC8A 3DBRA 1GGEA 4PBSA 2GFIA 2A3NA 4IKEA 1UXOA 3HE3A 3OZBA 4GBGA 4EMUA 1JTEA 1N6NA 4I4IA 2O8BB 3TLZA 4Q82A 2OHXA 3TDMA 4DCMA 2N46A 1M2KA 3WFIA 1KC3A 3SXUB 2QM0A 4Y9SA 1VYHA 4Y9DA 2QAGB 4K2AA 4NBUA 4E5SA 4YDSA 1E9AA 1MMFB 1PL6A 4ED9A 1DAKA 3SHVA 4RLHA 1W35A 1E6KA 4C20A 5JAUA 2OQVA 3HA2A 3CCQF 1N1DA 4MWEA 3IMFA 4ZGGA 5H3HA 4Q37A 5EE3A 1J1ZA 3Q15C 2A9RA 3AP3A 3O75A 3L8GA 4FMDF 1R0SA 3OO1A 1WW2A 3EG5A 1JKMA 1YE3A 4ZA2A 3H17A 5AM4A 4URUR 1DRVA 5FD8A 3DXZA 4EJSA 1W4BA 3AUKA 4LHEA 4NE7A 4D46A 5CVVA 4IYJA 1RACA 5J58A 3N2ZB 1WETA 5JASA 1E69A 2JJ1D 1AKQA 4CEJA 3WIOA 1J56A 2FU5C 1ORVA 3UW1A 4ZAGA 1L4HA 1TYZA 3HJWC 2C8JA 3T9CA 4I5EA 5IXYA 5KWVA 4CKZA 1JWLA 2JK0A 2AXEA 3R0ZA 1KMIY 3G0BA 4U7GA 1G5QA 3CW8X 3WJRA 1HURA 1OYWA 1XWWA 2C3OA 3HL0A 4IJMA 1OHHA 4WESA 3RRBA 2DFNA 3VDNB 5B2EA 1JJ7A 3KYJB 2XWQA 3JD4A 1VLHA 2A33A 4Q9AA 3U62A 3W8NA 3KQTA 3DOHA 3CM0A 4UNQA 4G88A 1R66A 3P94A 4AVYA 4Z4FA 5K8JB 5JALA 1Z17A 2I3DA 1KBZA 3IAEA 5J2TA 1Z74A 2FDXA 2GBLC 2IY9A 4GU5A 4Q1DA 4FYIA 3TJMA 3KUXA 5SZIA 4YP9A 2V7XA 3CLTC 3UJ9A 4AIIA 2F8MA 3G9TA 3NAGA 9ABPA 1Q7EA 4XIJA 2QTMA 3LT1A 4FOLA 2PWBA 1N78A 2YBDA 3GDGA 3FHCB 3C14C 3A25A 1P1RA 1J2YA 2HMWA 1A1VA 3VDRA 3R3YA 3PHBE 1CR6A 3QKRA 5LL6P 1UMBB 1VGVA 2OZBA 1CB7A 1R5JA 1U6KA 1NRJB 4MKXA 4RY0A 3URMA 2FJ0A 3UWSA 3B6KA 3HCBA 2XT6A 3HL4A 1DJMA 3PUJA 1H8HD 1R9MA 3DDHA 3T0IA 2ZIZA 4WLVA 3LH5A 2PV0A 2N47A 4MRMB 4QQKA 5AKKA 5TS2A 3SICE 5IM4F 5U1PA 4GGOA 5DYWA 1ODKA 2JRCA 5KX5B 2VF7A 1UBLS 2OAEA 4RZQA 2COUA 1DTWA 2AYXA 2DG2A 4WDQA 5A5GA 5B53A 4FYJA 4MPPA 2WAOA 3R1IA 1E0AA 2RG7A 4L22A 1DWUA 1E4EB 3C43A 4MV0A 1ZXBA 4GMGA 5ESRA 1NAHA 4B33A 3A4MA 3HRIA 5EFZA 4F1JA 1A4UA 1OFIA 4EOGA 4NEGA 3IEMA 4H1HA 1NMSA 2VS1A 1ODJA 1Y9ZA 2DFTA 3E7WA 3DCIA 3K4HA 3DEAA 3BFKA 1PHPA 4MI6A 2VOJA 2PMBA 1PJQA 1SXIA 2XLCA 1OI4A 3DE3X 5ULLA 1Q11A 1D0VA 4Z2AA 1NOKA 5BWCA 1MOQA 4KQJA 3PHGA 4EGCB 3O3CA 4EHLA 3G8BA 4DZRA 4Q4DA 5L3ZA 2FNAA 2FETA 1PG5A 1SBZA 2ZBDA 3IA7A 2BKVA 3C9SA 2SKDA 2BJVA 5LUAA 3CVWA 4HFMA 3A37A 2CJWB 1K06A 2J0VA 3S28A 4WEQA 1FNNA 1IAQA 3BWDD 3AJ8A 3COYA 2R97A 3LD9A 2P4QA 4LZWA 5H70A 3CYPB 1LVGA 3NC4A 3UAXA 2XUDA 3PD7A 5A3JA 4KOAA 5IC5A 2CN1A 2GJKA 3ZU6A 1T8SA 3QVUA 3WLOA 3UJCA 1FYFA 3WLIA 3NC0C 4JLKA 3S03A 2BM1A 4R1OA 3ZIAD 3NK7A 3GV0A 3LC7O 5DNWA 1F8XA 5ERGB 3ROTA 1U7HA 2PQMA 1R74A 3FVQA 1N2CE 2C95A 3M83A 5GM1A 4OOFA 3TLGB 1W94A 4H60A 2BE7A 2FEPA 3TEJA 1S0UA 2IBTA 5AXAA 1Y3BE 3SQWA 2V8OA 1UKBA 3DTTA 4F5EA 3P9IA 2JHCA 2ZIUB 1L8QA 1P75A 4U9UA 3GZTB 1L7EA 1DJLA 5AW8A 4IIVA 1G7CA 3LDTA 4BVSA 1DRKA 2IA5A 3RUPA 3KIZA 3WJAA 4UHFA 2C54A 1ODTC 4MULA 2HRDA 2I1QA 3GH1A 3WSVA 4EO4A 4N7JA 3MTIA 4QNNA 3CW2A 1F20A 2FUNB 2DBQA 2AE1A 3S40A 1D7OA 1T3GA 2VT6A 4I3FA 4HXYA 1AV7A 1E3SA 2C2YA 2D0OB 4AS1A 5DI3B 3W06A 2CV0A 4QECA 4BVJA 1V3QE 2ZJAA 3QLTA 4A0GA 2BFPA 1GR1A 1S9DA 2XMRA 3GNLA 3QTTA 5ALKA 3R7DA 3U3OA 1DO8A 3T54A 1WZ2A 5J2UA 4H18A 2P41A 3B51X 1PLLA 4I4TA 2G67A 3AEQB 3W8RA 2XTAA 3M49A 3SMQA 3UPTA 2P5YA 3GRCA 3PEFA 4UQOA 3SJAA 1L2TA 1S8OA 1WLYA 4K9RA 4MWSA 3FDZA 5KKCA 3QFCA 3S44A 4DANA 3WHIA 3NM6B 4P5PA 1RQ7A 3J7TA 2BEVB 3T06B 5EJ4A 3B3JA 2CWDA 1OYYA 1RM0A 3D0RA 3GEHA 1GPMA 4PLPA 1N6KA 1KAHA 4J0QA 4QBTA 2Q62A 3T7IA 4W6QA 4C3VA 4DEXA 3QU5A 1J7HA 5G3ZA 3L4JA 4V0LA 4LHSA 3ZWBA 5JAMA 4CM3A 1T1IA 5JW6A 3ZDDA 4OP2A 4QOGA 2P11A 1DKUA 3WLLA 5K05A 1MENA 3ORQA 5I7AA 5KSOA 2ZJFA 2VA9A 4CIYA 3VMMA 1HE3A 4KFUA 4ARZA 3I62A 1Z5NA 2I6GA 2HA0A 1JA0A 5FORA 3VR2A 1TPZA 3ZC3A 4WK0B 5K0FA 1RC1A 4LFCB 4DPLA 1HNWB 2XXAB 2DUNA 4O4HA 4KPEC 2XQVA 1I7LA 4H3VA 2I4NA 4MIYA 1NVMB 3P5SA 5DMXA 3U4GA 1GIAA 1YJQA 1YS1X 4MCIA 3V6LA 5CDGA 3DE7X 3VO1A 2YW9A 4KR6A 5C1BA 1VG9B 4YAOA 2BEJA 2WABA 5A9SA 3EZGA 2EKLA 2HSDA 1IWPB 1KEUA 3AFNA 4G0ZA 1NFFA 3BWBA 2OVFA 2Z5FA 1KH1A 4Y2GA 3VVCA 2D74A 3ANTA 1TZKA 1W4AA 3ZPXA 4I1UA 2X4IA 5K6AC 3ED5A 2PXXA 2W2VA 5LYYA 4R1SA 1TVKA 2Q3JA 3TX6A 5KX5F 1VYTA 3C3PA 3RG2A 2NZ2A 2PL9A 1B7GO 3Q1KA 4II2A 5TQ2B 2QRHA 1T3ZA 2XUZA 3QIAA 1SXJB 5JDCA 1LB1B 2ECFA 4TTPA 4OUDB 1HL3A 2DCMA 3A1WA 3EOAI 3B3QA 2DBVO 4B46A 3SK0A 2EBHX 4JVLA 3MQWA 4HH3C 2OKCA 4M46A 1G8FA 1ECJA 1EK5A 1SCAA 2Y9PB 3DBLB 4Z9YA 2RAFA 3BE4A 2BMFA 5AW0A 1ULAA 5IM5A 1IPEA 1ZIYA 1Y1PA 3KYDA 4YO8A 2DQYA 3KK0A 5KNDH 1ZGHA 4LPSA 4M6WA 2FQQA 2HLDA 4BOYA 2BEUB 2IX3A 5EIBD 4KFSA 3ZU2A 3U0VA 1VM6A 3EFOA 4JYCA 4LX8A 3OEYA 1N8TA 1YAJA 2P75A 2P9YA 4PS0A 2W4MA 3AYXB 5D3MA 1AGXA 3TIVA 3B6JA 2ZYWX 3KVRA 4R9VA 2GPSA 1E0KA 2VCHA 1EVJA 4JKOA 2G8NA 5I7HA 2GF0A 4B7XA 3ZE9A 2QSJA 2X40A 3HXMA 2XNHA 1YQXA 2SCUA 5DK4A 4D9KA 3ZOZA 3P0EA 5JQGA 4Q9DA 4OLBA 4KR2A 4NWOB 3G7UA 1NP7A 1JHDA 3LIPA 2JLAA 2WUDA 3L4BA 4BZWA 5CFMA 2F17A 3ZDCA 2XQKA 4ZU1X 3FPBA 3GPCA 3O73A 4XASA 3RREA 4XD2A 3T3PB 1DUVG 3K9QO 2HWWA 3PG5A 5CNJA 1U7TA 3U4QA 4HRVA 2UVPB 1H2BA 2DTDA 5CDHA 2ES4A 3AUYA 3COVA 1XZMA 3OTWA 5HWEA 2EBFX 1A7AA 2YR0A 3M6IA 4Y67A 5E8JA 3GBVA 1A82A 4EARA 2G72A 3PT9A 4G1FA 5F7ZA 1X7OA 5IF3A 1YH3A 3FB4A 5NLLA 2WM8A 3KKZA 1YRYE 4N6NA 3HZOA 3QNMA 5DYGA 3KQWA 8ATCA 2FXVA 1UM9A 1IN5A 1U0SY 3M1YA 2M9MA 3V5NA 4KFTA 5EKDA 3IR7A 3QSGA 1XA3A 4C0SA 4D4HA 1POWA 3F96A 1XMJA 3AHJA 3OJLA 4ZT4A 3TXXA 1GSIA 3ZYCA 4CQNA 4L15A 5AI8A 1OIWA 3Q7SA 1YOVA 2V6JA 4YHBA 3FFAA 1K86A 2IV7A 3S68A 4WKNA 3WIVA 2CUNA 1YD7A 2QD3A 2YY5A 4M22A 1O95A 5TE9A 2WF6A 2JLZA 4M8IA 2LBWA 3Q7IA 3TDKA 1AKUA 4UFNA 1ZIOA 2CZWA 2WV7A 1YI1A 4LGVA 4E4YA 1Q7BA 2X7JA 3UHAA 5AUOB 5KOYA 3E84A 1CZOA 2IIPA 4N0PA 5DASA 4QVIA 1OWOA 4WKPA 4EFNA 3CY6A 3GUUA 1E2FA 5DULA 5FBHA 2FWJA 1TZJA 1YKFA 1KMHA 5C8ZA 2FW7A 2QDXA 4X54A 4O02B 1QCYA 5REQA 1ZRSA 1P44A 2PYZA 2XZPA 1KRHA 2Y9MB 3G2IA 4RVOA 1PN3A 4XFJA 2HQRA 4FKMA 3SG0A 2O50A 3MTGA 3M5DA 5KDOA 2C58A 1IJFA 3HKEB 2XCOA 2BHLA 2Z3ZA 2QUAA 3KLPX 5LDGA 3V48A 1FRNA 1LF5A 4OXIA 5EHNA 4JENA 2VJQA 2XV1A 1XROA 3IAM6 3OD1A 3ESJA 5DHAA 4NDAA 1YRQA 1T13A 3DL4A 1ZI6A 3L07A 3PP8A 1DGQA 4J75A 3U40A 4KWIA 1VKHA 3RRXA 4JBYA 3WGQA 3W5CA 3RF7A 3C4VA 2N1BA 3QKRB 4PPYA 5BWMA 4R8MA 4DNQA 4S2EA 2BGWA 4KKXB 1R88A 4G4IA 4MS3A 3P0FA 4LSMA 4P83A 3EJWA 5EXSA 2Q41A 3ZOKA 5D00A 2A5JA 3BF8A 3X1JA 2P90A 4Q12A 1K08A 3DLCA 4REMA 4ZCMA 3FLAA 4ML3A 5A6VA 1DTWB 1USIA 2X4GA 1OFUX 4EHIA 4KO1S 1AGYA 3V8PA 3N2KB 2VJPA 2GBGA 1TUBA 2C8VA 3PNOA 4I99A 3LSTA 5IC6A 3W5HA 2V0GA 1PDOA 1YJXA 4ZO6A 1PX0A 2C4NA 1Q1EA 2I91A 2GX6A 1U5BA 1RHMA 4IDAA 1DRJA 3L7BA 3V97A 1CJKC 4LYFA 2G0TA 1SKQA 3O4HA 5JRJA 2O8DA 4KSBA 2OHGA 3SF0A 4DRYA 1GPLA 1RHKA 2XUQA 4F21A 4PZPA 5AXDA 1PDVA 1CDDA 4HQ6A 5B57C 2CLFB 4DQUA 4L02A 3KJEA 3C3CA 1C9JA 1E92A 1SB9A 5D6NA 1H2XA 2GRAA 2GWRA 2WSIA 3Q12A 1OXXK 1IXZA 4HEJA 1O77A 4EJFA 4OI1A 1QRSA 1L5YA 2I1WA 2LPMA 3DBHB 3LKVA 2A92A 3OIYA 4IYRA 3TJRA 2YICA 3KHKA 3W5JA 1FP1D 1N4AA 3K6SA 2IYFA 2BFBA 3T3OA 4K9LA 2OHVA 3TQCA 2OCAA 3TRJA 3FWHA 1DQSA 3T6KA 4AZWA 1AA9A 3PR3A 4MR8A 3ELUA 5TY0A 5C7YA 1ZR2A 4XB2A 1M1YA 1QIJA 1SO8A 1MRSA 2H1OA 3QI2A 4Q3NA 3CLHA 1EUDB 3TK1A 1KKUA 4LF4B 2C5FA 1X9IA 1FX0A 2EJTA 1P61B 3QVWA 3OOHA 3ZGZA 1CT9A 3KT3A 1X2EA 4M7PA 3AU8A 3CX6A 2YQ5A 3NBMA 2Q5EA 3CLRD 4XR9A 3ZZMA 1QC5B 2G5PA 1H3EA 1GCOA 2AN4A 1D6MA 4N48A 2HJSA 1TZBA 3IA2A 2VDWB 5I7FA 1NYTA 2BTQB 2OCDA 3CRMA 1UAGA 1ZZGA 1BH2A 4HGQA 2WILA 5FUQA 3NHRA 4TVBA 1YZKA 1D6JA 1SBHA 1DPFA 1SVUA 1OZ0A 1FLDA 2QR3A 3GDFA 4I7EA 3ZDFA 5BW8A 2FPSA 1RWXA 1J70A 4L51A 4Q1EA 2CK3D 3SM9A 1P80A 1OWPA 2B1GA 3EGEA 4IDBA 4FIDA 1U43A 4OQXA 5CVUA 4CLRA 4N9WA 1JRLA 3KDPA 3RAEC 3N0VA 2A1TR 3G2JA 2DBRA 3UT6A 4MW7A 3SNHA 4M8KA 4BUZA 3OA0A 1B2LA 2QAGC 4BNYA 3HRHA 5EWJB 5FCDA 1NW7A 5BVGB 2DYKA 1EWTA 1U1EA 5I9MA 4FS8A 4BWFB 4BQFA 3E9ZA 3VM6A 4OHZA 3PFIA 5A6SA 1JSCA 1P74A 3G5UA 1D0IA 4PC3A 3W1WA 3KJFA 1XCGB 2VQSA 1Z0FA 4HBGA 1FDUA 3VU1A 3DZGA 2VATA 4LSWA 1FFBA 1B8NA 2J46A 3TS1A 1WXFA 4HVTA 5ADHA 1WULS 2D5CA 4AB1A 4DPMA 3C41J 2D5LA 3HO8A 4LYJA 4S1TA 4A6EA 2P7HA 4PLHA 1E3WA 1O6BA 3QFHA 2G04A 4W1RA 1GFSA 2JLSA 4DMUB 2EW2A 1YNOA 5TB5A 4DUGD 3FLMA 2V5VA 2ZE8A 3C5WP 4U63A 4PN7A 1E66A 3ZIUA 5ALGA 1XZBA 2XSZA 3CG0A 1SOVA 4HZIA 4YCJA 2JAUA 3WL4A 1L7AA 3HKCB 1UJ6A 2O0MA 2WAYA 2X76A 3NGXA 4PF1A 2PU7A 2Y93A 2A84A 2AR7A 3PFCA 4OQDA 5FLYA 4BVLA 4CMJA 4JBIA 1JEDA 1MIOB 2D2EA 4GIBA 5THQA 4R68A 1KVQA 3QPAA 4ARZB 4E5PA 4LJLA 2FMKA 3K2IA 3K8QA 1CNMA 2O8NA 1K9VF 4O4HB 3GXOA 3H5VA 2O7QA 5DX0A 1IVNA 1X7DA 4UXIA 1F1BA 3E2PA 5B1IA 1XEXA 4BV9A 5IXJA 3IVXA 4L8VA 1T36A 1L5LA 2F8TA 2GPJA 1M2EA 4MP8A 5F35A 5BUSA 3ILSA 4DC1A 1EM8A 3K8OE 4ZZ1A 4RXTA 3HV0A 1UL1X 5AT1A 5A9SB 1V6SA 3QEAZ 1SKMA 4V0ME 5K0NA 5E9WA 4W7HA 5KINB 2JLVA 5IDVA 4PTYA 3KAJA 1IG0A 1PZMA 4R71A 1L7PA 2OV3A 4HLUC 1ID1A 1PNVA 4WZAE 1PT8A 3AIOA 4A4DA 2WY2D 4HN2A 4UVEA 3DHEA 4KQGA 5HK8A 2WINI 4HQFA 2OBBA 3TR6A 3UICA 3W3ZB 5JEDA 3JALB 1MB9A 4K6MA 1FRZA 4XKJA 3UMFA 1XDSA 2OORA 3ABRB 4ZQHA 3RK0A 4ZT3A 1H2YA 3VNSA 3AJRA 3RJTA 2NUTA 5BVHA 2XCUA 5TXGA 4D44A 2YTZA 5FTLA 4PLVA 1PEKE 4DRXB 1XI2A 1BFKA 4ZVSA 2I2DA 4DLSA 5GIOE 3DZHA 4MTCA 2BFEA 3NUZA 4HLQB 4CI0B 3T5AA 3FCSB 4IRUB 4BLQA 4E22A 3M9XA 4U7PB 3AWIA 5AVYA 1X3LA 1O4WA 4RTRA 1PJAA 3DEIA 3PKJA 3QUCA 3BAZA 1JTVA 1WM1A 4MB2A 3TZCA 3GX1A 2AC7A 4BHTA 3RVBA 4YPOA 4G0QA 2Y1FA 3HVIA 3DFIA 5A9RA 4ZTZB 4M9XA 1VSTA 3E03A 2B7LA 2LCFA 3LTNC 3SVLA 1GFIA 4MDYA 3LMKA 4GSYA 3L7OA 2J9YB 1E8DA 1JIKA 1ZJZA 1FTNA 1J2UA 2CUZA 1I4EB 2KBEA 3A11A 2SCUB 5CB4B 3JZDA 3KQOA 3Q8XB 4MUNA 4TN5A 2PKCA 2ANBA 5JQGB 1FMJA 1NI4A 1NBEA 5F78A 1OBHA 3SEAA 3IT2A 1W49A 3PLAE 1QDEA 3D7SA 4TS1A 2CLHB 1HE2A 1QOPB 1WXXA 2ZYIA 3VDQA 3GLHA 4DCSA 3KPWA 1LD3A 2P5UA 3STXA 4D7AA 1M5RA 4GKAA 1FP7A 1UJ2A 1X14A 1YSCA 3TB6A 1F2DA 4RK0A 1VI2A 4MKFA 2HUNA 3SYLA 3WIBA 4BIIA 5KJFA 3U4QB 3RC8A 1CUSA 2DY1A 2QZZA 2X3YA 3GGSA 3GMIA 3GN2A 4UUAA 5HF6A 5ADWA 5HKAA 4KRYA 3RBVA 1WHSA 2FEAA 3KXIA 5TF0A 5BN5A 5JECA 3WGGA 4G8BA 1SNYA 2H8EA 3CZ9A 5G0VA 4D42A 5DBIA 2W2LD 1POXA 4PWYA 3T7KA 4QFCA 1KYXA 1R6BX 2DM6A 4NS1A 3AL0C 3K73O 1E3EA 3DCYA 2I6DA 3AR3A 3IR6A 4WXMA 3VHQA 5GWXA 3ZXYA 3DVSX 1A27A 4OLJA 3G88A 3GJTA 5K01A 4DR1B 1PJZA 1W6RA 3B12A 3IKFA 4R1TA 3TAHA 1FNCA 5FPKA 3HLYA 3FVRA 4K3VA 4RPGA 3DEKA 3U31A 3PHLA 1YZGA 4Y6OA 1K6XA 1S2MA 3BHNA 1KEEB 5ERYA 1EGMB 5F4ZA 4OPMA 2JHAA 5EJ7A 4JXXA 4OJQA 5TGTA 1MAVA 2IIQA 1QGUA 4OQFA 5DI9A 3NHKA 3N4ZA 3EH1A 2BBTA 4QBKA 2ZS7A 4RDIA 3TLAA 3B20A 1N7GA 5HIKA 5EJFA 2OM2A 2YIDA 1T2CA 4FZRA 4KUEA 2QM7A 4QREA 5HKOA 4JBWA 2OZLB 1MV8A 5ICMA 2OK8A 1OWNA 1KMHB 2IT1A 1FQWA 2IU0A 5FLXA 4ZYUA 4HTFB 2Y1EA 4E5NA 1LQ2A 2LE0A 5G4LA 5REQB 4YP1A 1H69A 3OE7D 2WWTA 1W8DA 2O3QA 3BMQB 2YFHA 1L3CA 3DTVB 5LP1A 1NMZA 3FYSA 5C37A 5TIIA 3IAHA 2XD9A 1FNJA 1NRXA 2XB9A 2W6IA 3R7WB 5IT0A 3UBMA 5SYAA 4YAGA 2IS4A 2R79A 4IQGA 4TLMB 3I6IA 4OGGA 5T4BA 4BRSA 4JBHA 4IDNA 3O4RA 5ALXA 4DZTA 1ISPA 2RGUA 5L3SB 2VTKA 4S0ZA 3QWFA 2NWQA 3WK4A 4UOEA 3GRZA 4W99A 4R7ZA 3HYLA 5KYUB 1VB3A 3U56A 1PZFA 1BMTA 2UAGA 5A3RA 5EXDA 5CW2A 1N6HA 1Y7HA 3W6UA 1E9BA 3CB2A 4WNIA 2P6UA 1WUTA 2UUAB 3CNNA 2JIRA 2ZUBA 1R37A 4HAIA 4I6JA 1T8YA 1HYEA 1ULBA 3BB4A 4HDRB 4PYLA 2Z3WA 1P31A 4Q3LA 1E3QA 4G86A 5GOTA 3HVKA 1J9EA 1S3IA 2B0JA 4HP8A 4L76A 4F97A 1Z45A 4HD8A 4I6GA 3EEOA 1IBLB 2QBYB 1YZNA 3VPAA 3HAXD 1T9GR 3M34A 1SEVA 1K92A 1SCDA 3RPEA 1ZXXA 3MRVA 3BQ9A 1JEQB 4ZZ0A 2JAQA 3EWNA 4D4JA 1L5WA 3ELYA 2MSDB 2P4HX 3UWOA 1OI3A 4R2MA 1SXJC 1U5BB 2R6FA 3EQ9A 4LE0A 3GLGA 3FZEA 4YWJA 4CMBA 4W9NA 5ENVA 2I66A 2XVZA 5EAIA 5HM8A 1U2QA 3H7IA 3CX7A 4YJ3F 4AJEA 1ESEA 2R00C 5COQA 5ELMA 5L45A 1WAMA 1I94B 1H6CA 4OGWA 4MVWA 5SYMA 3C9UA 1AUXA 2IYZA 3Q1LA 2FRDC 2YWCA 1FDIA 3T3GA 4IKPA 2ZWAA 3SS9X 1ENOA 1O1YA 4RKEA 2R8EA 5JY1A 5CVJA 1JBQA 3PX2A 4DQKA 2QRVA 3PQ4A 5JISA 2BKXA 3ORHA 2HQBA 3O0DA 5A3QA 3HP4A 5K7SA 5A1TA 1D2NA 4DG8A 2G09A 3ND8A 3CXCF 3RTCA 1BOOA 2IPNA 1DQZA 1T2FA 3JYOA 2MR5A 5LNK1 2H3HA 1M73E 3AU9A 4QULA 4BLOA 2JL1A 3JWJA 4U02A 5EIFA 3F2VA 3TNYA 2FWNA 4Z3KA 2AJDA 2BVNA 2JIBA 3WP0A 1BE6A 1IXRC 1CJMA 3O8DA 5CB4F 3ZCXA 821PA 5EQFA 3IHTA 2P35A 1A8UA 1Q57A 3UA4A 2FPKA 1GZDA 2XVXA 4KXUA 4DA6A 1EFAA 4JCCA 4PAQA 1JU3A 3L7DA 1SK8A 1TEVA 1GDDA 2C4UA 2W2NA 3G02A 4O2AA 1UOPA 3U1BA 1VLQA 4L85A 3CRRA 3CT6A 4O33A 4Z2YA 2FRVA 2P4EA 3VOBA 2HS3A 4J29A 4PLWA 5AMXA 3BIXA 4YMGA 3SJCA 2BL4A 2QJRA 4A2WA 1K6JA 1TLFA 2QTCA 4D3FA 3CCBA 1VG1A 4JI2B 4OGFA 2JATA 1R1MA 5E4JA 4C9BA 1SC6A 1AUPA 5B4UA 2YDYA 2ADOA 2RARA 1VCMA 2CNNA 3I4LA 3L7KA 4FOTA 3PDWA 5F21A 5JO0A 4UOQA 3L46A 2CXQA 3C6XA 3HLTA 1GUDA 1ZJWA 2BBWA 1A4RA 3A6FA 4JU9A 3NXKA 3U7EB 4BCBA 3NPMA 2PWYA 3SZMA 2VHWA 3E82A 4Q4JB 4Z7QB 4EKNB 3REQA 4O5OA 2A5DA 2HA2A 1N0VC 1EIWA 1RLMA 1PG2A 1RR6A 2FPIB 3ESAA 3LRXA 2H1WA 4XIYA 2JGFA 2OO7A 1RNLA 2VH5R 3SM3A 1ZKMA 3U44A 3QE9Y 3CSUA 3PUVA 1OX4A 2PLFA 2YOHA 4RD6A 1Z6TA 3B78A 3TB4A 2GJ8A 4PIVA 5SZJA 2IXAA 2PZAA 2YL2A 2O3UA 3KLBA 1PNOA 2JGRA 3AB7A 2H52A 4R8KA 4XPZA 1BDMA 5EIAA 5BSVA 1ABEA 1NBMD 3M33A 2E85A 2VQ3A 5A5DA 2O4CA 1JFFA 4UDOA 5T6BA 2CT8A 4UVGA 4H1UA 5AHWA 3WKCA 4J43A 1BWPA 3WGMA 1KP9A 4BVGA 2IUSA 2VBIA 4E46A 1JHOA 2H2HA 3DHWC 3FTFA 4Q9IA 5EG5A 1U80A 4GH5A 3TPZA 1A8SA 4FFSA 1HT3A 3ITNA 4QOFA 1GTJ1 3G0CA 1RXCA 5JAZA 4GQBA 1XEXB 2GF9A 1Z3IX 2ZRIA 1T36B 3BH0A 3VDXA 3J80A 5KO2A 2ZF8A 3M9LA 3RSHA 4BASA 2B8JA 2CNWD 4DR5B 4MKRA 3REFA 4JROA 1YUNA 2PMWB 4TV8B 4MVYA 3G8AA 3NWEA 5TX7A 1XDBA 1YB5A 4DS3A 2B2NA 4BNMA 5DW3A 1N34B 1J33A 1UKAA 2W6JA 4GXQA 5FBVB 2KW5A 4BN5A 2V0NA 2WWHA 4X0EA 3SJUA 3M6MD 2V6BA 4AYXA 4D4MA 3FKQA 5HM6A 1PSZA 3ZXUB 3P9QA 1EVZA 1LBQA 3GJZA 4HWTA 2XNKA 4BQOA 3HBMA 1NXVA 4PG5A 4L5AA 4DILA 5IVHA 1CD5A 2AXQA 5ITWA 2OD2A 2NUTB 3LLMA 5LDHA 3CE6A 1T10A 4ENSA 3LMEA 2DHDA 4HDAA 3GA0A 3IQGX 1VZ3A 2A59A 2CL0X 3H16A 3MWEB 3NTOA 4GP6A 1L7BA 2CLDX 5F1PA 5TPZD 1KEPA 4CZ2A 2BFEB 1FA9A 3DZIA 4IBOA 1FNKA 2BFAA 2JIMA 4IP0A 1IULA 3T7AA 1QF6A 2NO0A 4I50A 4QEZA 1LSUA 3OPVA 4NZMA 5IJ0A 3WSWA 4GWLA 4J7UA 4MVJG 4P3XA 4O63O 1GGVA 3LWVC 1P73A 1VQKF 2W6QA 4LGMA 4X6XA 5CT4A 4CV1A 4XJXA 2DUUA 2ACKA 4CU2A 4Q0MA 1AQUA 2Z1EA 1UBOS 1V48A 2RAUA 4FLMA 4N7BA 1EB8A 4YV7A 4DF3A 4NJMA 2AIFA 1QZXA 1NI4B 1YZFA 2BFDA 3GRRA 1FQKA 1W1IA 1M6HA 1Y7LA 2HV8A 3EVTA 1ZA1A 3PQ7A 4JJFA 1D1TA 4NK5A 4OSPA 2HQSC 3KX2A 4BMDA 4C03A 4TKLA 5FNVA 3TD5A 1P81A 1ES9A 2IEIA 1JDBB 1DTSA 1T5TA 3GZNB 3G8YA 4MW5A 1WS6A 3BERA 2VWHA 3T3DA 3NEPX 1GN8A 3ASYA 4EF5A 4R4JA 4F2WA 1RS0A 3RUDA 1N3LA 1XK7A 2DCUA 3R3HA 3CZAA 3HA5A 3VUFA 2HK9A 5AO9A 4U9HS 5LBIA 3SZ3A 3TXYA 3ZVKA 4PZZA 1VJRA 1GZUA 4MVXA 2G08A 4WXHA 1TK2A 1UDRA 2PBZA 3W2HA 3MC1A 4PWTA 4CV2A 4EY6A 2YH2A 3TJZA 1ISMA 5C8XA 3EZNA 2DEUA 3UK1A 4W6ZA 2BCEA 2R60A 3EDQA 1R10A 2KYRA 1YIDA 5EIOA 5KDDA 1VE5A 3VMFA 1B76A 3P4XA 1U7OA 2QLLA 1CR0A 1NR1A 4G01B 2W6OA 5IUKC 3NHPA 2QUBA 1L4MA 5IJAA 1DKMA 2FMXA 2Z95A 1Y9AA 4S0XA 5ALDA 2RHGB 2QU8A 2QN8A 2W0MA 5BWOA 4X3CA 5FV4A 2ST1A 2FY8A 4OU5A 4W5WA 1NUSA 3K1TA 3R0XA 1OB5A 2F3QA 4OHMA 2OB2A 3H5OA 3THYB 4OAQA 5DNEA 1P4JA 3GU3A 3OPNA 3S2YA 1O4VA 1C8LA 4LUCA 1R5OA 4S12A 1U65A 4M1TA 4PBRA 3O90A 3ZWOA 5CXSA 2QNBA 3S2EA 2RKWA 3TVTA 2Q99A 3UQYS 4NZZA 5AVVA 5AHKA 2GS9A 2N42A 4RETA 3FJYA 5ALMA 2VH1A 5G0TA 1MAWA 1HE1C 4Z3OA 5EQTA 2OECA 1T5IA 2X2PA 3PXAA 4BMVA 1GTL1 2Q8NA 4UBJA 4GX2A 2J30A 3OTOB 4FFDA 2OV1A 4FDTA 5T8KA 1UC5B 1CQIA 2JJ1A 1SVNA 3EY9A 4Q4LA 1XWFA 3NFYA 5ER6A 2OAP1 5L51A 2FMTA 1QVZA 4EHBA 2VBGA 2HT1A 2VNIA 2DYYA 3GPBA 3A2LA 1JHQA 3VZQA 3UMMA 3F6RA 1GUFA 5JDIC 1P5FA 5DH9A 3PEYA 4MH0R 4JUCA 3VAAA 5DYNA 2C94A 2YWFA 2Z6AA 2YY7A 1TXGA 4C4YA 1CEEA 2XX3A 4JT4A 3DEFA 1O03A 1XQ9A 3ZV3A 2VGNA 4NDNE 4GWKA