2VXYA

The structure of ftsz from bacillus subtilis at 1.7a resolution
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
306
structure length
306
Chain Sequence
LASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATGFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords CELL DIVISION PROTEIN FTSZ
publication title An Inhibitor of Ftsz with Potent and Selective Anti-Staphylococcal Activity.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 111
structure length 306
sequence length 306
ec nomenclature
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 2vxyA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 2vxyA01
5IJ0A 4TV8A 3RYFB 5JH7B 5LA6A 2VAWA 4EI8A 5LP6A 5CA0A 3E22A 5M7EA 1JFFA 4O2AA 1W5FA 4X1IB 4B45A 2RHLA 4O4HB 5JQGB 3RB8A 5CB4A 3WGKA 2BTQA 5IJ0B 4TV8B 5KMGA 3WGNA 5EZYA 1RQ7A 2RHJA 4U3JB 4ZI7A 5LP6B 2R751 2RHOA 3JATA 5CA0B 4O4LB 1W59A 3JALA 5LOVA 5EIBD 4YJ2A 1JFFB 4I55B 5CA1B 3JASA 4O2AB 5JVDB 5J2UA 4YJ3B 5J2TA 5IJ9A 3HKEA 5KX5B 4EI9A 5CB4B 2BTQB 2Q1XA 5JCOC 4KWEA 5KMGB 3HKCA 5ITZA 4LNUA 5EZYB 4I4TA 5JCOA 4ZI7B 3VPAA 3C8LA 4X1KA 5C8YB 3JATB 3M8KA 3CB2A 4O2BA 5BMVB 3JALB 4U39A 5LOVB 4YJ2B 2VAPA 5FNVA 3JASB 5J2UB 4F6RA 5J2TB 4ZHQA 3N2KA 3VO8A 3HKEB 5IJ9B 5LA6B 4I50A 2GVIA 2R6R1 4IIJA 4EI7A 3HKDA 4X1YA 5ITZB 4LNUB 2Q1YA 3RYIA 3E22B 4I4TB 4X1KB 3RYHA 4DRXA 3ZIDA 5IYZA 4XCQA 4O2BB 1OFUA 1W5EA 4TUYA 5GONA 1SA0A 4M8IA 3WGMA 5FNVB 3N2GA 5EYPA 4F6RB 2VXYA 3JAWA 3N2KB 4O4IA 3UT5A 5JVDA 1Z5WA 4IIJB 3JAKA 4B46A 5MN5A 3M89A 2BTOA 3ZBQA 3RYIB 4ZOLA 3WGLA 4DRXB 3RYHB 5LYJA 1W5BA 5IYZB 5LXTA 3VOAA 4EB6A 4DXDA 4TUYB 5GONB 1SA0B 4WBNA 3N2GB 4O4JA 4O4HA 5EYPB 5JQGA 3JAWB 3UT5B 4FFBA 3HKCB 1W5AA 3R4VA 4IHJA 2XKBA 1TUBA 3VOBA 3JAKB 1Z5VA 4HNAA 1RLUA 4U3JA 1W581 3RYCA 4ZOLB 1TVKA 4TV9A 3JARA 3HKBA 4X20A 1RQ2A 4O4LA 5LYJB 5LXTB 1FFXA 5EIBC 4EB6B 4I55A 4ZHQB 5CA1A 5MN6A 3VO9A 4YJ3A 4I50B 4WBNB 4E6EA 4O4JB 5KX5A 5JH7A 3RYFA 3HKDB 5MN4A 4X1YB 4FFBB 4IHJB 1TUBB 2RHHA 4HNAB 3RYCB 1TVKB 5C8YA 4TV9B 3JARB 3HKBB 4X20B 4X1IA 5BMVA 1FFXB 3WGJA 2XKAA 3ZBPA 1FSZA 4O4IB 3V3TA 2VAMA 5LP6C
chains in the Genus database with same CATH superfamily
4X71A 4KI0A 3V6LA 5LP6A 2KYRA 3GUHA 3WSWA 2G5TA 1GSHA 2X5OA 3O8NA 1O95D 2XTZA 2ZSHA 4ZOBA 3U3KA 4AROA 1C8BA 2XTMA 4DCTA 4EHFA 2VT6A 4X3LA 1Y80A 2FQQA 2VF4X 4F86A 1VJGA 5C5DA 3ER9A 2PGLA 4OI4A 4O4HB 5D85A 3OD1A 2GM4A 5K3FA 3QVUA 4DAOA 3LXMA 1KBOA 4KH0A 1DEOA 1UKEA 1ZDMA 2OGZA 1JEYB 1FP1D 2E55A 5EB0A 1P7VA 3HHPA 4JMPA 1DE0A 1XMOB 1V6SA 3LT2A 3ENKA 4UUPA 3P10A 1V0JA 5AUOB 4QJ3A 4RTKA 3PQ7A 3G6KA 3NHPA 2YJTD 3SR4A 5IT0A 1ISSA 3AEQA 3QM1A 4ON9A 1L5MA 2AYYA 3DFIA 1LD3A 5COBA 3GLHA 4KWEA 1QH1B 2LNDA 1QBGA 3CLTD 4EA7A 1YS1X 2O3QA 2XYQA 3J7TA 4N7RA 2YRXA 4FWBA 4NECA 5BVGB 5AUQA 3WK7A 3GGOA 4RC9A 3SHQA 1FRVA 1AKQA 1KR5A 4FUTA 4MO9A 3H4IA 3G2IA 4QGFA 2BGWA 3OY7A 5MGBA 5CYPA 1LLUA 2W11A 1L0BA 2JI6A 2WT9A 3RV4A 5IXJA 3IBTA 5CDYA 5ECDA 2C2MA 1VQ8F 2OTJF 4AWAA 3RWMB 1V47A 3E22B 3KKZA 4CDGA 2HF7A 3BWEA 4DHWA 3U9SA 1B4DA 3HFRA 3OJFA 4F2HA 4ZYVA 5LSAA 3MTGA 2GKGA 3RS9A 4QASA 4YJDA 1M9NA 2C61A 4UVIA 1AUVA 3ZV5A 5C8VA 4X97A 4M21A 1D1SA 2RHMA 1S01A 1O77A 1EJ2A 1RZUA 1U2GC 4D9CA 3P96A 4DMHA 1BRTA 2EFJA 3A3PA 1SHTX 1X1DA 1Z0IA 5JD3A 4G65A 1WW2A 3S1AA 4E88A 2BM0A 2YY7A 4Q4HB 2R0QC 5ETJA 1XCGB 2W6QA 2YXBA 3H9EO 4KIWA 4P7KA 5BV1A 3UXHA 4GZ6A 5HP7A 2FEAA 1BHSA 3EEIA 1NTRA 3U26A 6YASA 4JWKA 2EGGA 2VBCA 4RDIA 2IELA 4UUNA 4EYQA 4OSOA 5IDVA 1QD9A 2IYQA 3DDCA 3Q0EA 1KJJA 4ZOEA 3S02A 1AV7A 3DMYA 3AUYA 3HBAA 5BUCA 3VR6H 3CWQA 4XFKA 1KYZA 1UM8A 2C7PA 2PSFA 3LWOC 1W49A 1OWMA 2YH2A 3C4QA 3QJ5A 5GQSA 4RGQA 1J5XA 1ARZA 4JUBA 3E5HA 4LY6A 2AX3A 1FY2A 3K1JA 1FW6A 4EGQA 4UQPA 4QELA 3S44A 1RYYA 4A15A 2XOKD 4ADSG 2H9IA 2V03A 3ETNA 3I6IA 1DKPA 3QV2A 2CFTA 3N2ZB 3NOOA 1YACA 1L5QA 4YNBA 5DVZA 3SF8B 4ZGWA 5KIAA 3NHMA 3TLCA 5F7JA 3GNQA 4O4JF 2WU3A 1T43A 1KMIY 1ZW6A 1M8FA 1XQVA 1WRBA 4NWIA 1H48A 3LWBA 3PUVA 1BU5A 1PNOA 4UTXA 2G36A 2B7LA 4KQ9A 5EGNA 5ESWA 5IC6A 1U8ZA 2VSNA 3EW7A 1S3FA 1NVUQ 2ZRLA 1NP3A 1NUHA 3K96A 1RC0A 1DXQA 1DX4A 2BMWA 5KHOC 4BGVA 4DLRA 5JSUA 4K1LA 4RZQA 1G5QA 2N46A 1RLTA 1MOZA 1YS2X 4RHUA 2CNOA 4AUKA 5JT1A 4OVKA 4RD1A 2ET6A 3HVRA 1V3QE 3H6KA 1NW5A 3AUAA 1TZ2A 2GZ3A 1U9CA 4MGIR 1OXBB 1XLUA 1JTEA 2ZBQA 4UTNA 1QE3A 3BULA 1WY7A 2O7VA 5JLJA 3HBLA 2WNSA 1MU0A 5E8RA 3PT9A 1Y6QA 4FYVA 1GUFA 3DC7A 3IKMB 3IP9A 2QMEA 3ROFA 1WULS 3RVOA 1ZOOA 3GBVA 4B7ZA 1KVTA 3ETDA 1B0ZA 1SRQA 1TZMA 3L7CA 4HGPA 4MVJM 2V7WA 1QV7A 4I6GA 1W85A 1Q7EA 1ODLA 3G6WA 2CXOA 1WS6A 4G1BA 3WE7A 3GGPA 1FW8A 4B76A 4DL9A 4P7JA 5DN6D 4OYHA 3KXKA 4YPOA 5AKXA 4J16A 3L6RA 4OQPA 2PX6A 2JGIA 2B5WA 3NVIB 3OLVA 3O31A 2PT6A 3IMKA 3PXBA 4F6RA 1DFIA 3OTIA 2YMMA 3I9LA 4ND3A 3D6HA 4WERA 4B8ZA 5A1TA 1QP4A 4YJGA 1W2WB 2CVHA 1AK2A 3Q1LA 3R3ZA 1OHHD 3JQPA 1X8KA 1ZWKA 1C30B 4XGIA 1E89A 5JI2E 1PQUA 2RGWA 4CGZA 4P38A 4RF2A 1UM9A 4ENSA 3DTVA 4TWAA 3VIUA 1EVQA 3D3EA 4DC1A 2WWTA 3KJZA 4LFCB 2E18A 4ONEA 3OPVA 4HNRA 2CDNA 4D8XA 1EH5A 4AICA 1PLKA 1YQQA 4GWLA 1ESDA 1AG9A 2NVUA 4GBMA 1H8ED 4I1IA 4MV4A 5JAMA 5ANRB 3UJPA 3BL6A 3AZOA 3DO6A 4OAPA 3IMPA 2G70A 1BDBA 3DQZA 3TOSA 7ABPA 4NLLA 3CINA 2C97A 4Z9FA 1U8EA 3V1UA 3KFLA 4BNZA 1WUJS 1MX3A 4EYKA 5A1JA 3U44B 4H7JA 5EZYF 1OZ0A 2PT9A 2QQGA 3ZO8A 1JSRA 1UMDB 4XTRA 5F1YA 4IYJA 3A1SA 1LSUA 4NENA 1ZMXA 2HFKA 2N48A 3CBQA 4NVRA 5TB5A 3V4PB 1UCFA 4PZLA 1NSTA 2PL3A 4JMLA 1J8QA 1HZZA 3AJ9A 5DN9A 1X6VA 1E9FA 1NW6A 2EAUA 1CUSA 3F2VA 5E1OA 3AO0B 5B57C 2I6TA 2YN2A 3EXIA 3IR7A 2Y9PB 4MEJA 4RM3A 1FLNA 4RMJA 2IV7A 3BGWA 1QK3A 1P3JA 1N5OX 1SUFA 1UINA 4KE7A 1DDGA 2QL6A 3ROXA 3WIOA 3IO3A 4GMDA 1D0SA 1Y5IA 3D64A 4QBGB 3RARA 1FK8A 2IVFA 5H1YA 1CIJA 2A7XA 3FPCA 1X1QA 3I04A 1UWCA 1E3LA 1QYRA 1DMSA 4NE9A 1Q91A 1QOQB 2C54A 3RAEC 2P9ZA 2FJ0A 2PZBA 3FTCA 4M0KA 1LNZA 2ID4A 3M1AA 4INOA 1SHKA 4TX1A 2FQ1A 3GIDA 2JL1A 3M6MD 1QG0A 4X7RA 1XC7A 4ZQBA 1XLTC 3ZE0B 4BIMA 3BHIA 4DWVA 1B1AA 4U9HS 4BBZA 4H31A 4DANA 1TAUA 2OGTA 4I1OA 3FOFC 2PLNA 3PFCA 2Y66A 3AHCA 3ESRA 4DN6A 3H7IA 1QHEA 2W2PA 2A0UA 4JC4A 3L0SA 3NAGA 1XK7A 4L02A 1TYCA 2C77A 2YZGA 3PQFA 4PQRA 1IVSA 4WKCA 4ZALA 2Y1GA 2W4IA 3UHJA 3N0RA 3I45A 1DMRA 4EZEA 1LDYA 3KLMX 5PNTA 1V7PC 3HDYA 5FBQB 1VBNA 1ZKMA 2AFHB 1Z5UA 1UPFA 5JS8A 3A04A 5ER9A 3GEHA 2VUSA 4N7BA 2QMUA 4PGHA 1GPMA 1K0FA 1Z2OX 2JS7A 4UEJA 2OXCA 1C8KA 5ICFA 3GLGA 3MLEA 5IJ9A 5BYJA 4N47A 4HWOA 2JJMA 1NN5A 1KO7A 1FZQA 4RWZA 2EG5A 2BGNA 2G08A 2OZKA 4XWOA 1WCXA 3KKQA 4MI1A 3RSSA 3MJCA 1BE6A 2FEWB 2Z1UA 3CLHA 1GILA 1Z7GA 1ZOPA 2H4FA 3RBVA 1KEWA 3L6CA 3P2MA 4Q1CA 1V8BA 4X6YA 2O2IA 3EXAA 1ECBA 2OHVA 1JR6A 1E59A 1JJ7A 3F5DA 3ZYCA 3TWOA 4LYHA 1SR8A 2EBWA 3HTXA 4RS4A 1K27A 4FSHA 3DVRX 3ZY5A 2E1PA 1ISGA 3IT3A 3FSGA 2G9IA 5ALWA 2J9YB 2CDCA 2UV8A 1RAFA 5DEIA 5MFPA 1RP7A 1SCIA 2Z5GA 3D3QA 3KJEA 1U28A 3L43A 3LLSA 2B36A 1X25A 2VPQA 4CN8A 3ER8A 1KP3A 3RF6A 3S81A 5JPDA 5FJ4C 1QANA 3LT0A 2VKQA 2C2XA 3COWA 4RACA 5JAIA 1Q0LA 2B98A 2JD2A 2JCGA 5I4KA 1ZS9A 1RC1A 4DR5B 2O8CB 5CM2Z 4F21A 3P4UA 1N8KA 2GARA 4GR5A 2D06A 4XD7A 5EQJB 1F8YA 1NV9A 1SMKA 1Y9AA 3PHIA 4QLAA 4EJSC 1HNXB 1D07A 1HDIA 2WNIA 2XUZA 1I6MA 2P62A 5IH7A 1TZCA 3VVMA 4CXMA 3DMNA 2OVFA 5E6SB 1EXMA 3WB0A 1BJKA 1ZRSA 2QYSA 3LRTA 2VNHA 2AN3A 3PRKE 1FE8A 2VGNA 4MUFA 3NGXA 3RVBA 3ZWNA 3AX6A 3T7RA 3I56F 1GG8A 2QUBA 3CUYA 1S4QA 2J6IA 3WHPA 5LXTB 4E07A 3A6KA 1XMPA 4KNWA 4XVRA 3VYVA 3RAPR 2C8JA 5LR6A 1JAIA 4Q4JA 1F0PA 2VK2A 4G0VA 4UBLA 3M6IA 2VTVA 3U0OA 3IUEA 3T9EA 4F06A 4RVGA 2FGKA 3VPHA 3EODA 2PX0A 4IKOA 3K0FB 2RHHA 2UAGA 4WOCA 1A7JA 3W9BA 2ZJ5A 2VH5R 1HI9A 3GZNA 4IWXA 5JFGA 3KUCA 4OV6B 2D4AA 2PRYA 4LVCA 4A82A 1B23P 3DDHA 3E8MA 1FIUA 1NVXQ 2IF0A 2VL7A 4A8TA 1Z8HA 2G07A 3WIBA 4E14A 3THXA 1ZN8A 4X92A 3ZIAA 2C9BA 2GD1O 4IH1A 1AKWA 1DWQA 1J8FA 4V0NA 3U81A 1BCSA 4B4WA 5C7IO 2GBLC 2NXNA 5I7SA 4JJ6A 2WTBA 1JWBB 2FMKA 4J1QA 1LB1B 3R7AA 1NQ5A 4CLHA 3K6KA 2XVAA 3JVHA 3OWOA 3G7SA 2GD0A 3BF7A 3KYCA 3MT0A 3DVLA 5FEUA 2ENUA 4I9GA 1ZWZA 3WV4A 1CEEA 4DKJA 4Z5XA 5DBOA 3KT6A 1D6SA 3B89A 5CX4A 2IHNA 1S8NA 2WSSD 4AM8A 4TV8B 4HAXA 4JR1A 2ZB8A 2C2OA 1T0HB 1CVIA 1C2TA 1DG1G 4P4LA 3WDKA 1H93A 2EARA 3IEUA 5GZ6A 4DILA 3EGIA 1XNJA 4MVJA 1B6SA 3R24A 1TC2A 3Q2OA 1K06A 2G0NA 3VR3D 2J3LA 1JFFB 2VCEA 4IUDS 5BSMA 3O73A 5B7NA 2O50A 1MOQA 4DCSA 3WNCA 1L3IA 5CVDA 4EABA 1PK7A 3HDHA 3OIFA 1IHDA 3T1NA 2JCSA 4N5NA 1E1RA 1HEUA 4R3NA 4RK4A 5AM0A 1YZLA 2BBTA 1T0KB 4ZOAA 1H22A 2JI9A 2OZVA 2R8ZA 3NDBB 2G0AA 3EBLA 4TMFA 4RBNA 3WWCA 5FOWA 1D7OA 1OYOA 1MUUA 1K8ZB 1A88A 3G6EF 2QEQA 1Y42X 1JYFA 3BMOA 3PYLA 3QKSA 4HDOB 2C82A 3GRUA 4YWJA 4XIYA 2KGWA 1A4RA 3KDAA 3HEMA 4ER6A 1QRSA 2N0SA 4EKIA 1MT0A 2C9YA 3RK4A 4WXPA 4BU1A 2G67A 5I7UA 1PJ2A 4WNIA 3ZEIA 1VGQA 2VYND 3FCAA 2BHRA 3VYRB 5EQTA 4CQMB 5FXMA 4I4TB 3NQ41 2GHQA 3PD0A 4FDLA 3SHOA 3ZGVA 3ZWVA 4BQOA 4LECA 3RYHA 4Q05A 4KU4A 3RAGA 1GN8A 1QR6A 4DR7B 4LF6B 2Y1CA 3BIOA 3L4BC 2FGJA 4MS3B 4YCAA 2XB9A 5HDBB 4AG5A 1C41A 3GNSA 1DCMA 3GF4A 2PCLA 1UKAA 1BGXT 1XMIA 2P6UA 4KR9A 3EC1A 2ZSAA 4RY8A 4HI0E 1JI3A 4JIGA 2Y1FA 1RXVA 1Z07A 3U1BA 2UZ1A 1FB5A 4INJA 1S1CA 4YCCA 1QO9A 5H16A 3UY4A 5AVRA 2RGYA 1EGMB 1L1FA 1EX6A 3Q2KA 3CURA 5DXJA 3DB2A 2ZVDA 1S8AA 4ZMRA 1DIBA 4UM7A 2KSQA 4JBHA 5BW4A 2ST1A 2C5BA 2OHOA 2P9TA 4TTVA 2Z1TA 2P6YA 2BEVA 3OTOB 1R74A 4GYWA 1MEOA 2ZUCA 3G0OA 5DX0A 1LGYA 3BIXA 4RDHA 3SLGA 5BT9A 2HHLA 4G26A 1HBJA 3JAMM 5FADA 1FX0A 4D4HA 1U0SY 2VP0A 3E27A 1I3LA 4RA9B 2WVAA 2E4VA 3LJKA 2H1WA 2O2ZA 4HAYA 3DE5X 2J59A 2HQBA 3OJOA 3K6RA 4I66A 5FPKA 5EE3A 5LP1A 1Z39A 5A2QA 3ZJTA 1P4JA 4FBMA 1ZNQO 4KAFA 2I3AA 2UYJA 5DI3A 3WXMA 3ZHCA 1TFRA 1N0UA 1RFLA 4EX7A 2X9GA 1TQHA 2XKKA 4IQFA 3OLXA 5B55A 2ZIEA 3K70B 3N70A 1YZVA 2PE5A 4RM2A 2B1JA 3KOWA 5I8ZA 4B32A 1J22A 4OGLA 1A0OA 5I7VA 5DT9A 1P9OA 1JKXA 3EA5A 1U90A 2AFHE 3J7AR 1SUDA 4NZ9A 4PHTA 2X5XA 2F3QA 1DG9A 3JRWA 3MJEA 1F5SA 1JXOA 2B8NA 2DWPA 2O3JA 3B85A 1ADFA 1Y8QB 2H8KA 5FUBA 1IPHA 4RUKA 5GONF 3KR1A 4HEA6 3WTCA 2GFIA 2WYHA 4V0SA 3NNDA 1KMHA 2CCGA 1H3EA 1P3Y1 1V3VA 3LPDA 1YJNF 2JGMA 4Q6WA 4EG0A 2A9JA 1GPBA 1AHPA 4G63A 1XT6A 2H0RA 3FETA 5ED4A 4LF9B 1FX1A 3IEVA 1T9HA 4CG0A 3B13B 4R4JA 2ZR7A 5EHGA 1KEVA 5EIBD 2NU6B 2OD9A 2Q3EA 4F11A 1W3EX 4QJIA 4ZV7A 2AH5A 4FLMA 1OXVA 2QXTA 4XM2A 4JYCA 4I46A 4RQUA 4KRXA 1GIAA 3OKPA 2Q1XA 3E84A 5FOVA 5JJBA 1DKRA 2INGX 1EDOA 4UMVA 2XD4A 1PJLA 3UH0A 2O0HA 2GO7A 1R2QA 4MDEA 4EOGA 1D5CA 2O3SA 5FP0A 3VX3A 3GRPA 3PUIA 2DPMA 1SAYA 3L6EA 1BEEA 1YVUA 9LDBA 2BBSA 2MTBA 2B99A 3WDSA 1SPBS 3OCYA 4IW3B 4AT1A 1T6YA 1ENOA 1RKQA 3IX7A 3NH6A 3R0ZA 1WM1A 1RBQA 4NMLA 4Z9AA 4ZMSA 2HHHB 4J0DA 1X7PA 5EP3A 2H1CA 1ZUD1 2Z1FA 1I0IA 1JG2A 4BRWA 4MYHA 4PGMA 1YI1A 3HYTA 1YL5A 2GN2A 4AZVA 2PBLA 1VQ7F 2O8DA 5LNK6 4JUAA 3WGMA 3LIIA 4WZBB 3OX3A 3ZEAA 5ICMA 4N3NA 1YB1A 1PWXA 1NBMA 1XE3A 1GKLA 2YYEA 1A9RA 3KNZA 4F3KA 1A9SA 1RPZA 4CEJB 4Q3LA 1TLFA 1XKQA 3EFOA 4YMSA 3VSEA 1QHXA 1VE5A 4C7VA 1I1NA 4EY7A 2WWRA 3MWYW 5JSYA 2NPFA 2WF5A 2QYOA 5AO9A 1FTNA 2X0KA 3O9MA 5IABA 4DEVA 2IE8A 4KO1S 4PLWA 1UWVA 1BG6A 4ARCA 4KE9A 3RVMA 1SA0B 1V9SA 2FDRA 5EYPB 4N3AA 1ZW1A 5KNCH 1CE8B 5JQGA 4AKEA 2VP9A 2XUDA 3H5WA 3FKJA 4G8JA 3DHWC 2Q5QA 2QN1A 3O91A 5ALJA 4AF6A 2W8BC 5CMLA 2H7XA 4G1FA 3LUDA 2O8NA 1D0IA 3EDRA 1PIWA 4RDCA 5TPZA 1H5QA 3CMMA 5H68A 3TUIC 3OE4A 3E1KA 4NZMA 3F5MA 3ZDQA 2H1IA 3AL2A 4R1NA 4YLEA 2OM6A 4KMRA 4NICA 4FBGA 2CEKA 1OXSC 3QQPA 3U7RA 4NJMA 2O06A 3I3OA 1R5BA 2JIZD 3KO8A 4HQ6A 3ETHA 3AB7A 2IIVA 3FDZA 3CB4A 3KVYA 3GGDA 2CCJA 4IDAA 1WQ4A 2KLBA 1QQ6A 3DTYA 4RCZA 4TQGA 3DCNA 1V8DA 5FNVF 4DV3B 4OXIA 1RWBA 3P2KA 2GFQA 1J2TA 5FWYB 1K9MH 4UDXX 1U7UA 1XYYA 4B6FA 2X23A 3DL2A 2CHFA 3G89A 1DOAA 3HFGA 4JGBA 2FR8C 3E03A 1RYFA 2PD6A 2X40A 1ZL2A 3HV2A 3UB3A 2NSJA 3WYFA 4YLYA 1BDJA 5KTYA 1NR7A 3KTAA 2QTVA 4CBVA 4LISA 2BFWA 1BOFA 4YJKA 2CMFA 3JVIA 4G8DA 1GZUA 1T5TA 1X9IA 2VZ8A 5U9CA 5BPHA 3PICA 3L4JA 2REOA 3VPBA 2OQ2A 2PEYA 4V3BA 2Q2WA 2BELA 4IZOA 3ZLBA 4A0FA 1YQNA 1KZYC 2GYYA 2A1TR 2H08A 1DP4A 2K5UA 3AH8A 3P20A 2V7VA 5T5QA 4HRAA 1SWWA 2WJJA 4EMSA 3R6TA 3Q41A 2OKCA 5IANA 1YDGA 1J9EA 4M0LA 3RTDA 1KJNA 1ZWLA 4WL0A 3KXPA 1MA0A 4EG5A 2AN5A 1LPPA 5FPTA 4Y0VA 2W5UA 1XUOA 4JLBA 1ZH6A 5LMNB 4C1BA 4ZQFA 4OH7A 2V58A 3EVGA 3ON5A 4P5DA 9ATCA 4KSBA 2ZUFA 4FC6A 1H47A 2YZMA 4EZIA 3X1DA 2JDIA 4COKA 1QVVA 4DDHA 1OBHA 1ZIXA 1FJ2A 2G82A 2HIAA 2O2SA 1VHQA 2WP8J 1WF6A 4RPIA 1GDHA 4F72A 3RJ5A 1JFRA 3ITDA 2B8EA 2QZJA 1ADBA 2JH9A 4E4RA 5E7JA 4DNPA 1WDLA 3JVVA 4JY7A 2UYKA 4MH0R 2D1TA 3EPJA 5J2UB 3QMWA 4IIBA 4KPUB 1VHDA 3NOVA 5J43A 4R8MA 1ZD8A 2PZMA 1N7GA 4XDZA 3Q10A 5AKJA 1KOLA 1M6EX 1TGVA 4KLAA 4OLBA 4OJMX 1MNQA 3FXAA 3H7AA 4JL6A 4YK7A 2QE6A 3OFNA 5BN5A 1WQ3A 1Z2NX 2UVPB 4WTOA 2P6MA 3L7AA 3Q7PA 1JU4A 2JGAA 3GRCA 4NZPA 5KYXA 3R75A 5C1IA 3GDGA 1UBTS 4BKOA 3HDQA 2WYIA 3R3SA 2EDCA 3KD2A 2O52A 3IXQA 4RVSA 5IKMA 1SC1A 3GJ4A 5JSFA 2D4HA 5KJ6A 3F9RA 4X5OA 4QBIA 1MAHA 5TJ9A 3OCJA 4ZKEA 1TM4E 1V8OA 1QX4A 2C4HA 1JFLA 2DHDA 4J0FA 4K46A 1G2OA 1VQOF 1E77A 1H65A 1R0ZA 3CJRA 3LQQA 3SLKA 2NNWB 3IVXA 2VSYA 2ECKA 2NYUA 2JLSA 4UOEA 1W7AA 3JAMA 3IP7A 3CISA 1R0BA 3H16A 4BMCA 3IPLA 4QTYA 3TRFA 2PMPA 2H1FA 4IQ0A 3JARA 5EWRA 2QJTA 3FPGA 4IVQA 3TLYA 1QCYA 4GE3A 2YIDA 4PO3X 3RIGA 5AK6A 1TTQB 1VSVA 3HA5A 4J9VA 1NGSA 2HSJA 4YT8A 1FS4A 3FM9A 5F35A 4MINA 5B3AA 5F5LA 5JYBA 2HQSA 3NATA 1UBRS 4UHDA 3D2LA 3D0QA 3V1LA 4L76A 3QIVA 4FFSA 4FZJA 3MEQA 1DXOA 4LOAA 5TQVA 1DADA 3HUDA 4ZJUA 4B3BA 5LQAA 4ARBA 4R71A 2JEOA 4PVDA 2NUPA 2QENA 4PYLA 3HB0A 1GVHA 2CLSA 2WG2A 3IEIA 4YASA 1LC0A 5J23A 1N4DA 4Q3NA 2ALEA 4JFRA 4G09A 4EITA 1NOIA 1OX4A 2FSSA 3ABZA 3QEMA 4HS4A 3ZXSA 3D8UA 2XZOA 1J1ZA 1OD6A 4H60A 4QUBA 2IKQA 4V0ME 4Z0TA 1SEVA 2NOAA 2RK4A 4A23A 2QD2A 3I37X 4F2PA 4JJFA 1TF5A 4WFIA 3CSDA 2ZJ6A 4FHCA 4HYTA 2DSTA 4LXXA 3LVFO 5G3ZA 1IJBA 2CGEA 2ZYTX 5IJ0B 3PS9A 2P6PA 3M34A 3RRMA 2CVFA 4GC5A 1U3FA 1H85A 3EXFB 4MV9A 3MCTA 1TYEB 4XGNA 1KPHA 4YRPA 1W55A 3N86A 2BMAA 2ZJZA 3E7WA 2QY9A 3RJZA 3A2MA 5G1PA 1W29A 5DYIA 1M75A 2NZ8A 3PC4A 2JFQA 2VHVA 3T9BA 1VQ5F 2UYGA 3CZCA 2IIQA 2QQ5A 4LMBA 1CB0A 2JD0A 2ECPA 2ZODA 2ZRPA 3LPCA 2WSBA 4ZICA 3ZKWA 1SEPA 3SGLA 5CFZA 1PEYA 1FQKA 1M2VB 1T5SA 1V7QA 2R7AA 2WI8A 3ESBA 4J49A 3ZBTA 1FF9A 1O3YA 2WWHA 1JILA 4IHAA 4WZBE 3B1KA 4HXYA 3B1WA 1GAQA 3MCAB 4RDXA 4ICIA 2JGDB 3Q3JB 3F6CA 5FKJA 1DXYA 4EPYA 1NBHA 3MPUA 1Y3BE 3GOHA 3HKEB 1X87A 3LC0A 2BP7B 3MJRA 5DM0A 3SF0A 1FMFA 4OK6A 1DKNA 1R00A 5KYVA 1W36C 3D7NA 1SZJG 5AVTA 3HEBA 5KOYA 1CRLA 1MX5A 5JTUA 3BH7A 3GQBA 3AVPA 4Q82A 1J1UA 4G0NA 1NI5A 2R97A 4NV1A 1XDUA 1TK3A 4EB8A 1O6GA 1O94A 1KYVA 3PPXA 4AN4A 1GKYA 1P1KA 2F90A 3PT5A 4FWIB 3GLIB 4M8IA 2ZXFA 4D80A 3OUTA 4PYNA 2VRWA 4AVYA 2VXYA 1F6WA 3BZBA 1UJ5A 1QU3A 3MWLA 5D5PA 3DT8A 1UFVA 3TBFA 4ZFNA 2H48A 4B3XA 4ZIRA 1KYTA 3IAFA 4PGAA 5K6RA 3Q11A 4XARA 1GXSB 3SQWA 1O08A 5AYVA 5TQ2B 5KYWB 2CD7A 3QI2A 1PG0A 3UJ3X 3BWMA 3C1OA 4HEQA 1Y98A 1NFFA 4I9UA 4BB9A 5KVCA 3M5WA 4F97A 3JQ8A 5THXA 4N76A 3A7EA 3GNLA 4MW2A 3R9XB 1UZNA 1UBOS 4AJ4A 2FPSA 3L6UA 4L1KA 4Q7QA 4IHJA 1ETUA 3TLGB 4L9AA 2GZAA 3GZTB 2ZJ2A 2BMVA 3JYHA 5JAHA 2BN4A 4NFYA 4NH0A 5A4DA 3D4NA 3ROMA 1EU1A 3ZZMA 2BM1A 4IINA 3VKVA 2ODQA 1I80A 3P9RA 4CKBB 3N8HA 2GM5A 1NMYA 3P9KA 3CZ9A 3NWPA 4F0JA 2EKDA 5AJXA 1XEXB 1JX6A 3UQYS 3H4TA 2CNNA 1PZNA 2G4LA 1GITA 1SC4A 2VPWA 3NHLA 3OTGA 1K92A 4QVGA 1P62B 2QIPA 5HCNA 3FHCB 2WEKA 1IM8A 1O9GA 5JO0A 2LZ0A 3V4DA 1FTQA 3EVFA 3EWSA 1FFXB 4MIOA 1WXHA 1JA0A 4Y1FA 4L16A 4KGXA 1RMQA 3T3GA 4EGSA 1XMQB 5HRAA 3I83A 4Y1EA 3UHOA 2G88A 1GSIA 3ZLUA 2GLUA 3H17A 1BN6A 3N9IA 2FR1A 1YZTA 4EA8A 3N6VA 2MYTA 2PWPA 3EISA 4LVUA 4IOKA 1UQUA 3KE9A 4RD2A 4YACA 3WKDA 5LUBA 1QH8B 4RSGA 2WJ6A 4H0NA 5EKUA 4FD2A 2YRFA 2XCSB 2PHNA 1TEHA 1JAHA 4D7AA 2YFHA 7MDHA 5DLPA 1MX1A 4A2CA 3QA9A 4EHIA 1E3EA 1QP8A 1ZM2A 2PEZA 4Z4HA 1Y6RA 3T1TA 2Y1DA 5A2QM 2DC1A 4JLOA 4KN5A 2QE7D 2D13A 3AP2A 3P1JA 3S7TA 5IX8A 1FUYB 4X64B 2ADMA 2JGNA 3GT3A 3LL4A 4QPDA 1AZSC 2IU3A 4RD6A 5B3KA 1XTIA 3GCWA 4Y6GB 4P0PB 1R4MB 3WSTA 1IPEA 2WWWA 1IVNA 3LVBA 2QLJA 3PWSA 5FRDA 4QGSA 3KQLA 1EJBA 2FCAA 2OV3A 4RXMA 2CLCX 2XUIA 1OU0A 1RRFA 4DYDA 1KEKA 1IBSA 3NORA 1L7NA 1BHJA 3UT6A 4BWGA 5JSQA 4FX5A 3LPMA 3JVUA 2QB5A 4M88A 1E9VA 5E3JA 3OZXA 3T61A 3TL6A 2CUNA 3TMAA 3UT0A 1K75A 2ZIUB 1PGOA 1S2GA 1E2EA 3K53A 1E99A 1D03A 4R2LA 2G4CA 4ZZ1A 1FSPA 1H2YA 2CNKA 2ZWIA 4ND4A 4Q24A 2GM9A 1PN3A 4BXOB 3SZOA 2F9FA 3VMMA 2IODA 1WXQA 4P31A 4ZPJA 4G2NA 2QAGB 2QL7A 4MJLA 1NYRA 4B75A 4C76A 1AMNA 1XZEA 5BWMA 1KHHA 2OTMA 1H0SA 1T36B 1Y5RA 4RA6B 3WRVA 4BP8A 2DFKB 2PZLA 4CMGA 3WFJA 4OBXA 3TNJA 3GPCA 2QT0A 1LPMA 1OGYA 2C9ZA 3ZGOA 2Z4SA 2VZ0A 3UT5A 5DHUA 1UJ2A 4YALA 3N3BC 5B1EA 3P9ZA 4CZ2A 1G8FA 3COPA 4AY2A 4DJEC 1C1XB 3RA5A 2SECE 5G1OA 3LH5A 3RKSA 2GD6A 5DBIA 3UBTA 4ZAGA 2NU7A 5AI0A 4G0OA 4KZKA 4RLQA 1QIEA 4B81A 4NXMB 3DF7A 1WCIA 2C07A 4GOLD 1NXQA 4DXDA 3F98A 2HU5A 4WK6A 2YWRA 3L7OA 4JEIA 3ZGZA 1Q2UA 2D1RA 2VOJA 1JDJA 1GYQA 1GTJ1 1Y7LA 3JQQA 1I6LA 3HSSA 2RHWA 3LO8A 4MPTA 1F2TA 2P30A 2WFLA 3IVGA 2XGOA 4I5GA 4R6WA 4TS3A 4DSOA 4FFLA 1JQJC 5DOZA 5GVRA 3OC0A 3NBYC 4Q21A 4EKGA 3R09A 1CUEA 4GM0A 3G79A 2IE0A 2Y0PA 1D2RA 3E2IA 1PT5A 2Y2UA 4MUXA 1MTZA 1UPCA 2GHRA 2W2KB 4DLLA 3K1AA 4S1OA 3KTDA 3MJTA 2IUEA 5A4JA 1L4NA 2VTBA 4RFSA 3C0KA 2IEYA 5FUMA 2ETVA 2CNWD 4MMYB 4PYRA 3DKPA 3LW8A 3O9VA 1A3CA 3M1IA 4QDOA 4NBRA 3RASA 2LBWA 1FFSA 1WETA 1VKOA 1DBVO 2Y0EA 3CH7A 4HEJA 3ZHSA 1Q2XA 2PRKA 1N6IA 4M98A 4ZJPA 2YNMD 3CA8A 1JKJA 1ZQ9A 3HI4A 3K0KA 4NCAA 3GLHE 1PTJA 3ORQA 1EFVB 1JG1A 3CCEF 2G25A 4FQ5A 4RHXA 5D5QA 2IU0A 5LQUA 5BSTA 2HR1A 4F3YA 1GLVA 5CCBA 4Y6PA 4CMCA 1XMVA 1UI9A 1CS4C 2JAPA 4CFYA 3LT4A 5DYWA 1TPZA 5BRAA 2JK0A 3CUUA 2I71A 1YZGA 3OLQA 5IC5A 1KE2A 1ZICA 3SMQA 1GKKA 2NO0A 3FPHA 3MB8A 3IIEA 2TMGA 3KKOA 3K2XA 4IIXA 4LBYA 2IAFA 2EP8A 2GVZC 3GG9A 3JWGA 1KAMA 2AF3C 1T3ZA 4V24A 3LDHA 4HAOA 5CNJA 1RI4A 2O57A 1FC0A 3B9BA 5LXTF 4CM8B 2C1XA 4MVJH 3BMCB 4WOPA 5DGDA 2IDMA 3KKLA 5CA0B 2EG9A 5HY1A 3B52X 2AD1A 2P4HX 2GPSA 4DPMA 4PZZA 4I55B 1IAQA 1L7BA 2HO4A 5BV2P 5JDIC 3AKYA 2F3SA 2GESA 1PK9A 2XUJA 3EVNA 4UUOA 5DI9A 4WADA 3S70A 1ESNA 4RO0A 4YV2A 3HTNA 2G7MC 5A5EA 3JQAD 1B8OA 2I6UA 5ITZA 1QGZA 1FDRA 3P2YA 2IL1A 5DV9A 4II7A 1LBQA 4WBSA 3GLIE 5AXAA 2P6OA 3WLLA 1MO5A 3EG9B 4YJ3F 1V96A 1L7VC 1UBGA 1U7XA 3PKIA 5H59A 2IIPA 3K0TA 3FI0A 3QKUA 3V7UA 2V4MA 2ZS9A 2X4DA 4CMAA 1SXJD 2V4UA 4GECA 2XCTB 3GAZA 4XQ9A 4LMAA 3F6PA 4UASA 1A8QA 4DIFA 2CBGA 3DA8A 3GFBA 3IVRA 3KBOA 1RRKA 1J7KA 2ODBA 2CDBA 2J5RA 2JCBA 4NBKA 3PZBA 4ZT5A 3ZX5A 4BT5A 1NQOA 5IYZA 2O2DA 1XTTA 3PC8C 1ZD5A 3QA3E 4JBWA 4LC0A 4TV8F 1PT8A 3FVRA 4OTZA 1E9RA 4GLLA 1KI6B 1VIYA 3CX7A 3K0CC 2EYQA 4QDTA 4AAYA 4D8WA 1IDN1 5I7FA 3FD5A 1XDGA 2BFDA 1XK6A 3QUWA 2OK7A 2BR3A 4EKYA 2LBTA 1KF0A 2F62A 1W46A 3L0YA 4RHFA 5T4HA 4WEOA 1I9GA 2IZ5A 5KPJA 1LCIA 1ZLXA 1N5MA 5ALOA 4B83A 2CY0A 1U9JA 2BPOA 1Q5PA 1EK5A 4NPAA 2YHBA 4KBYA 4YRNA 4WKBA 5JSZB 4G85A 2GPTA 3CTPA 2DQZA 4Z1MA 2FLKA 4E33A 4AECA 1XB2A 2AUTA 1SBYA 3EHDA 2PBRA 4GLJA 2LPMA 4QAJA 2IH5A 1F9AA 3VR1A 3TFWA 2W48A 1W25A 3MUEA 4M8KA 1W8DA 3DZIA 5BORA 4ER0A 2YV4A 4WCVA 1E8NA 1YR9A 1Z6TA 1E62A 4W9NA 4JBGA 2GZMA 1IPAA 1KERA 4LUCA 1GEGA 3SU8A 1QZUA 3SDSA 1BHQ1 1MPXA 4I4TF 5KX5A 1AF7A 1GTVA 2QRUA 1C9NA 4C81A 3KWLA 4X1YB 3LTEA 1U9YA 1OIWA 2V1XA 2YMPA 3GLRA 2ZJ7A 3P9CA 4JQOA 1TO2E 5EERA 1RPNA 4ED9A 2ZTVA 5FPPA 3R0VA 3FCEA 3VR6D 1QVGF 1WMDA 3CZ4A 1KSGA 4PNEA 1Q3HA 4IIYA 5B64A 1SHLA 2WFAA 3L40A 1W40A 3THYA 5EY5B 3EMDA 4R41A 4HFNA 1UFOA 4R1QA 4BN0A 1L4LA 2QBYA 1K4KA 2NIPA 2HF8A 4E4TA 2I3BA 3LVQE 4XYBA 2IYWA 4QXMA 1E1CA 4KMMA 1K7SN 4RQAA 2IPMA 1I4EB 2LTAA 4MITA 4Q66C 3RBZA 4JBYA 2DWUA 3EEFA 5BW5A 2IJGX 1DIAA 1EWTA 4MR8B 3ZZ0A 3K05A 5LM3A 2G1PA 1I30A 4QTTB 3IL2A 1QIHA 3P7MA 2OPBA 1VMEA 4GI3A 4HUQA 4MQBA 5FFFA 3RB8A 2C1EA 3WR5A 4GIBA 2ZSJA 4U8HA 4K9NA 2W71A 5H82A 2VQDA 3U4IA 5JCXA 3U48A 1E3TA 2XCUA 4DQKA 1A1SA 1CY0A 4NS1A 4YC7A 2DFDA 4YMLA 1MMFB 5DULA 3RAJA 3I64A 2FPPA 1X3SA 3CW9A 3E2MA 4YQFA 3TPFA 2AJBA 1P2SA 3G13A 1L3CA 1ECJA 1HA3A 1QIKA 5CIQA 1P33A 2JIDA 3PJEA 3TO5A 2VH2A 2XEXA 1HTBA 2VXBA 5H70A 3SC3A 2CHVA 2VZ9A 4GL2A 1SXPA 1IN1A 4D3DA 3CXCF 3DZCA 4KK3A 5FTJA 1VBFA 2OFFA 5CA1F 3K14A 5IVHA 1RNLA 1LQUA 3V8RA 4HC4A 1H8HD 1PVDA 3MBKA 3DWFA 2YWGA 4OHVA 4Q37A 1IXZA 1H9BA 1TW2A 4IV8A 2ODWA 3D3KA 2RJNA 4MWEA 5KNLA 4DC9A 3X2FA 4BX2A 5LA6B 4IIVA 2EZTA 1DARA 4N5LA 3LNCA 1U5BB 4QYXA 2WMOB 1K7FB 1CUCA 5SY6A 4FYWA 3R23A 1IOLA 1U9ZA 2J45A 2H3HA 2MSLA 4BEBA 4KQEA 5ALZA 1FCJA 4DRXA 1YRQA 2GJ4A 2AA3A 3J80M 2GN9A 2QTRA 3HP1A 2NVOA 1LRLA 1TUEA 4MV1A 4RPKA 3GZ4A 1G9XA 4YP0A 2AZDA 1WMEA 2RH9B 1C7FA 3KU4A 3IR5A 3PVZA 3TSWA 3ZS9A 1F20A 5CFOA 3GMTA 2EERA 2VP3A 2D5CA 3NTUA 4UCQA 3W6UA 2AI2A 5A4AA 3G8DA 3WGIA 2IZZA 4GRAA 3CCCA 5DIZA 3TLAA 4OKNA 3PF8A 4KODA 4URHA 5I7HA 1PXWA 1OBVA 1EM6A 1DC6A 1A97A 1O1YA 1J39A 3B78A 3JW8A 5ELLA 5CP8A 1L7OA 2XWQA 4ZD6A 4DV0B 4XGRA 3S2IA 2YV1A 4HZGA 3TE6A 3LMEA 3BG5A 4R40B 3QX8A 3PR3A 3HNOA 1LC3A 1U8FO 3P97A 4G0ZA 3SG0A 2HRRA 4W7IA 1G7CA 3WLQA 4BNKA 3N2EA 1NG9A 4UBKA 3RIYA 4MQUA 2R00A 5AJTA 1ORVA 3MCWA 4QZVA 3UJ9A 1G6Q1 3CEJA 4FGKA 1D2MA 4OL9A 1PX2A 5EWJB 4ARZB 4ZCRA 3RYFA 4NBSA 2I76A 2J09A 3PFKA 4L8GA 4PLPA 3IUYA 3ZOZA 2Q0SA 3MJ4A 3UXEA 1P2BA 1TUBB 3QKTA 3NB0A 3OCUA 1AS2A 1Z26A 3PA6A 3HADA 2OB2A 5JATA 3CNQS 2C3OA 4WHMA 5CAEB 1XNRB 1J8MF 1H1TA 4FMDF 3GLGE 4X20B 4MCHA 4BP1A 2EKPA 2XKAA 1G20B 1MAWA 3GROA 3KKEA 3LX5A 2NUTB 3HVUA 2PVPA 4JB2A 1KARA 1X7WB 2X2FA 1UMBA 1JDPA 2O8EA 3OQVA 5GY7A 2LXNA 2FWAA 2PV0A 3KYIB 4MVXA 3DDNA 3RF7A 4Y2JA 2ZCJA 4TYNA 3CF2A 5JVDF 1EUYA 1Q50A 1YB7A 2AXQA 1CDZA 2C98A 2WNHA 3KAKA 5HBRA 5AVXA 5IXSA 1JSCA 3VH4A 4FGUA 3Q8WA 4RTLA 5ALVA 4B8YA 4A10A 5M5BA 1AKEA 2PFSA 3K9BA 4XWAA 3WB2A 1D09A 1K6IA 1PI3A 3AXTA 3OE7D 2C84A 4RTRA 3M6AA 3I9FA 1L5FA 4Y7DA 4MDYA 1N2IA 1WABA 2K4MA 4W5HA 3QEOA 4OLFA 1HDOA 5DM4A 3ML1A 2AK2A 1ZEMA 2VZLA 3L6OO 3C1AA 4X7BA 3WLEA 3SQLA 5F1OA 2FQWA 3USCS 1PR3A 4LV6A 2BGKA 1I5OA 3T9DA 4MV0A 3WB9A 4BP3A 3PFBA 4WOKA 5JXHA 1FFBA 3CJQA 1FL9A 2DJIA 2F1RA 2BFBA 4M9UA 1I4LD 1ESEA 1Z6YA 5A5DA 1L5HA 2DQ4A 2FCRA 2NO4A 1ZKDA 1GN9A 2IUSA 3FR7A 3M5CA 3W5BA 4KN9S 2O3UA 2X4IA 5CX1A 3VHXB 1J21A 4L8WB 3KZOA 4HX9A 5GVSA 1J1IA 1JHYA 1DUVG 1VP3A 4R1SA 4D4MA 4BY9E 3CHYA 4KREA 1OYWA 2W42A 1GDTA 3NOQA 2XMCA 3U7FB 1CR6A 2WK1A 2P2DA 2GETA 2OK8A 2G8LA 3LO5A 4BTEA 4EHBA 2WM3A 1RS0A 2OKGA 4GE0A 4CF3A 2B9EA 4NZZA 3D00A 5GINC 2C2ZA 4PX5A 3D31A 3KYDB 5NLLA 5EJ7A 3IQIX 4B46A 2OHJA 4K40A 3UH1A 4DB2A 3ZQUA 3A26A 3WHKA 2GJ8A 2Z1NA 3WWEA 3W5UA 4BAZA 1WR8A 4WLNA 4HAUA 4C22A 1LTQA 3DAFA 5KWJA 1GCAA 4N40A 2Q29A 3BQMB 4RGBA 4XYGA 3RVSA 3C2QA 2ZSUA 4XVUA 1KQOA 2PMCA 4GKJB 4UM9D 5BV7A 3UHFA 1P19A 3W1EA 3GN2A 5ECYA 3GHZA 2PMDA 3KWJA 2XMDA 4PFQA 3B1JA 3AM1A 3Q3HA 4I8DA 3RRFA 4XLTA 1X7YA 3Q9SA 1VG9B 1DKQA 3TD4A 2WVHA 3OU7A 3U39A 2BEWB 5JH7A 3QELA 5MGNA 4Q9HA 1NR1A 1QGED 3NBZC 1M2WA 2GNOA 3TECE 2TSYB 1PR4A 1QPGA 3V2GA 1CYEA 4JBLA 5ADWA 4LXQA 2LDXA 3SX2A 3G2PA 2PUJA 4WNYA 3PYXA 1O95C 3AOEC 2IYTA 1IB6A 4JFAA 2OBBA 1IOVA 3ZY2A 3H9GA 1NN1A 1I2DA 1GZVA 1QYWA 3IPYA 3U6KA 3S5UA 1VE6A 1EXNA 1QU9A 3DM5A 2EATA 4YBRA 3SJAA 4LS3A 4MYUA 1NVEA 4DLAA 3TF5A 3L8YA 1XA4A 4M8SA 3FD6A 3G23A 2SKDA 4FUQA 1ST2A 4G5YA 2NO9A 3F3MA 4V0OA 4ND2A 1TQ8A 2AYXA 4LZZA 4MROA 1QR2A 3RM3A 3KOXA 4P8RA 4BLWA 2GGSA 3WQSB 1XVAA 3PI7A 4AJ1A 5TSDA 3KEQA 3LFHA 1NDQA 3GTZA 2BTQA 3RA6A 2W6IA 1KPIA 4IJQA 3PNLA 3CLTC 2G7ZA 5BQ5A 1IEXA 1B0PA 4HN9A 4Z3KA 5D86A 1Z7WA 1BD3A 4FHZA 1A7AA 3NC4A 3FZQA 1U3UA 3GEMA 2G9QA 4FFDA 4IG4A 1VL1A 1JQBA 3C43A 3IC5A 4OHRA 2R1UA 4Q3EA 4GW3A 4UXJA 3Q6NA 4TMWA 1T6BY 4S35A 3HYCA 4GDFA 4X8LA 3BM5A 1PJTA 3E18A 3OTQA 4TMXA 2ZF8A 1BXKA 3ZX4A 3MFQA 4EMBA 3T5PA 4QOHA 3VDRA 4YXWD 5FBRB 2V45A 1LDGA 3FYDA 2FSVA 1FNMA 2O5EA 3PK0A 4AX8A 5JU6A 1IHYA 2C88A 1PJCA 3PKZA 1NY5A 5LU9A 1Q1BA 2XZLA 3FSRA 3M3DA 3U6BA 1IUNA 4XR9A 3HRKA 3U16A 2XLBA 1S0UA 4JLVA 2HA7A 2QV0A 1YT5A 2X8JB 3FMFA 3MERA 4G8BA 4HNVA 3J80A 5I3CA 4TSFA 1MXFA 5C8YF 3VC7A 4XWKA 3ZDYB 1UBHS 1CUJA 3M33A 5FUXA 3IBGA 2NUAB 1PHPA 1LF5A 1TM5E 3MG9A 1X19A 5JXIA 1LK7A 2AG1A 4CLEA 1MDFA 1ZK0A 3LC1O 4N5DA 2JAWA 1SGWA 3MQ2A 5T3YA 5TEVA 4WLFA 5TGZA 3NUZA 1DKOA 1DC3A 2ZOVA 2QM7A 2NACA 3SHTA 4WPGA 1HORA 4R1UA 3JQAB 1ZONA 1F8GA 2EBFX 4H1WA 3SY8A 1MV5A 1PZFA 1T5IA 2GB4A 5GJCA 4ENVA 3DMPA 1M1XB 2CXTA 1WU8A 3KPYA 1ZU4A 4H7EA 3VAAA 1CD5A 3BHNA 1F0KA 4FCCA 4JVOA 3OO1A 2P2YA 1SXJB 3AP3A 4RQBA 1EXWA 1Q77A 3B5IA 4KQJA 3VR4H 3T4UA 3U4CA 4PWZA 3VOBA 1DEAA 1I36A 3TB4A 1XGKA 1I4OA 3WTBA 3DEAA 1G20E 3LBIA 3I32A 4D3YA 4ACAA 3TLEA 5BNIA 3QNUA 3QBTA 4TV9A 1N2JA 1S8OA 3C7CB 1U3TA 1ZCFA 3CVOA 3FYSA 3Q98A 4GQBA 3K30A 1ILWA 4BNUA 1R10A 3IUPA 4NDNE 2DQKA 2GZRA 3IH5A 3OZGA 2R44A 1RXWA 2SBTA 4MHSA 4PC2A 2HRYA 5MN4A 1U81A 3VJMA 2ZS8A 2NLOA 2QNRA 5F73A 4H7FA 1NXWA 1GTG1 2GLXA 4LI0A 2W9XA 1DKMA 3NANA 1Y82A 4I6EA 4YMIA 3TSOA 4D9MA 2YR0A 4JJIA 2RG7A 4DV4B 1YMUA 3AKDA 2Q5OA 1ZMRA 1AXRA 4IDBA 4AMGA 3S55A 4GBGA 4X3MA 1GNRA 1UK7A 2IGBA 3LRPA 2Q5FA 3W3AA 2ZR0A 4RYLA 4EGFA 2JLZA 2ZI9A 4XVCA 4RVOA 4UZFA 3AI3A 4MEBA 2WF7A 4AJKA 1AIPA 2HPVA 1FA9A 1SO8A 1GKUB 1Y8RB 2DG2A 2XTAA 4ZHYB 1VJRA 1XRNA 2L69A 2XADA 4JX9A 1MVLA 3VNUA 4HEHA 4XJVA 1D5WA 5EUBA 4H9GA 1TLTA 1VPEA 3PITA 4H3HB 1MORA 3B3AA 3K5HA 3DEKA 3QVLA 4LKRA 4D92A 4M83A 2IBSA 1EYZA 4FW9A 4N8DA 5L3RA 1XTJA 2O48X 5EA2A 2IVZA 1BA2A 2BD0A 4LV8B 1Q0HA 3K8ZA 2GTPA 4AYTA 3UK6A 1XQYA 4C0XA 1QGDA 5LFAA 3BFVA 3WGUA 3NVMB 4BVLA 1Y3CE 2FDCA 4GM1A 3JPYA 1TQ2A 3GGGA 4Q7KA 3TIXB 1UDWA 5KYGA 4O4LB 1BKSB 4XUEA 2QRQA 1FYVA 4JSTA 4LTNA 4YN3A 2VTKA 1TKCA 5IH3A 2EFGA 3UF0A 3IIJA 4WINA 1NBME 5DW3A 3TOCA 2D0PB 5CXSA 4G89A 3MOSA 4JROA 1L4MA 1WDMA 2H16A 3GLVA 3ZW8A 4KP7A 4C07A 4GPD1 2NZUG 4MQEB 3TQSA 1JR3D 1M34B 2JJQA 2RGNC 3B7WA 3C6KA 4CKCB 1N3LA 4XWWA 1U0HC 1I9CA 2I6DA 3FSJX 4C4SA 2ZVJA 1HE8B 2FYTA 4UBMA 2BGIA 4Z7QB 3O83A 3SI7A 4Q9NA 4KO2S 4XUCA 4DM7A 1Z6XA 1PZEA 3PUWA 3L18A 2DRIA 5HZMA 4UVGA 3THOA 4NIMA 4V0LA 1G3IA 4XIJA 2GBPA 3FKSA 2V6JA 3E1SA 3MMXA 3NUGA 4TMTA 3R5SA 1SQSA 5JG7A 1SBNE 4B31A 3ZHVA 5F4ZA 5JC1A 1E2UA 2NT3A 4RPLA 4EBBA 1U8UA 1CJVC 2YXPX 1PVVA 3GAFA 3DW1X 1MD9A 3LY5A 4Z8XA 1A2BA 4OLAA 1Y6GA 3ELCA 2E5FA 2XJ9A 1P0CA 1NXXA 3KPJA 3X43A 2WKPA 3C4JA 3COYA 3TJRA 1G59A 3C6BA 3FPKA 4QIHA 1RI2A 3LHIA 4KQGA 3K20A 4DT1A 3KKPA 5K3BA 4IGFA 5CLLA 1GZ3A 4G1MB 2IYEA 1IXKA 1A4UA 2E5WA 4GYYA 4OQZA 2RB5A 1WZ2A 3SE7A 3ESJA 1R4AA 1TJPB 2H85A 3WSVA 5JARA 3F7TA 1RFGE 2DHEA 2BFEA 3ZHTA 2DUNA 4WVLA 3ZJ4A 5EVCA 1V1RA 3AF2A 4BQPA 1EAYA 3ZP7A 1S8FA 5D3MB 1IY9A 4OX9Y 3BYQA 2JI4A 2PVSA 3ZJYA 5CBPB 3LQ4A 5JAUA 1XYGA 4GQIA 5IMBA 2IIBA 3OOEA 5EMNA 1KIFA 3NTOA 2QRGA 4X6LA 4LV5B 5G53C 3NHRA 4LVOA 4BUJA 3FIJA 1JEOA 2VPYA 4LIPD 4PVCA 1ZA1A 4X90A 1GZ6A 3RT7A 3DE7X 3SMVA 1YJWF 2R84A 3DOEA 4U2DA 5KTMA 5DB4A 4L6AA 2CLFB 3TRHA 3KLOA 4OHMA 1GNLA 1LBSA 1ODFA 5CLIA 2GEVA 3QKRB 4BVJA 3A06A 3I1IA 4D9JA 1JFVA 1NZJA 1PNTA 2J5XA 3G49A 3TFQA 1NLZA 3KKMA 2RHDA 3OTWA 1VA5A 4C6TB 2RGUA 3PDJA 3C9TA 5BSKA 4E2WA 4YJFB 3ZY6A 3DS8A 1O58A 2IFTA 4MWTA 3UMBA 1RZRD 3VHRA 3H86A 3SKVA 4MJ3A 4D3FA 3PJRA 4HX5A 1NBIA 5ULLA 1MN6A 4R2WA 3ZHXA 4GI1A 4B8WA 1UDAA 3BK2A 4YRMA 4XZ3A 3SZ3A 5AXBA 4D99A 2FJUA 3O8OA 3Q3EA 1W5SA 4C3ZA 4IUCS 4XJTA 1JJBA 1T35A 1P6XA 1VLZA 2X7XA 5HCUA 2DR2A 2JFPA 4NMWA 1DAHA 4NU0A 3PCXA 1N77A 1DIHA 2CLIB 1F17A 1VQMF 1YUBA 2CJWA 3ND5A 3ZDBA 1XMSA 4M53A 1P5RA 4BGEA 5G0WA 3BFPA 4M0MA 1EVLA 1Y33E 2H4WA 2Q6VA 3HJAA 2RKBA 1ISJA 3L04A 2RHGB 2VG8A 4MB6A 1PKEA 3CWCA 4OHFA 2P40A 3I5MA 4ZVSA 1K8XB 1V11A 1W0KA 4DJ5X 3F74A 3TRJA 5KYYB 2X77A 4L5YA 4X9XA 3PQ6A 1JAYA 5G41A 4B43A 1NY6A 3GPDG 3Q1KA 2F1HA 5JZVA 4DSNA 2Z56A 3SJBA 3NG1A 2PR2A 2VT3A 2BEJA 3UXMA 3ZGXA 1NQVA 4GPIB 3U09A 5TEWA 2HK8A 4ZHQA 1RVV1 1HMYA 2BBWA 2P8JA 3AI1A 4HDSB 5K0EA 3LHDA 4YAWA 4EELA 3O8BA 2IWHA 2CL0X 1PDVA 1G18A 1PD1A 1VL0A 4P0TA 4YCJA 4Z0PA 3WGVA 2R7MA 1BQ3A 5EMHA 1NN0A 1UMCA 1Y1LA 2CXPA 4UNNA 1E3DA 2D3WA 4DWOA 5AVUA 3KT3A 2VBFA 3S27A 4UDYX 1CZLA 1E4EA 3ECSA 4BASA 4EAQA 5LD2C 2ZCVA 4MHOA 4INZA 3PNQA 2D8AA 5AK0A 4JJAA 4ATNA 2CL5A 5CBKA 5CA0F 2I6XA 3OF3A 1XTKA 3HWWA 3TXYA 2ZTMA 4NI5A 3WBFA 5DCVA 3K5IA 1X80B 4JASB 1HDEA 5DO9A 5FL3A 3MCUA 3GU3A 3K12A 3GR6A 3X1YA 2XTNA 3UICA 5BOVA 3AR2A 1Q1AA 1V3UA 1CVRA 1P29A 1R6TA 2HV8A 2BGJA 2Y67A 3F47A 5ALEA 1KDTA 3GVPA 4DLBA 4XX0A 3ZPXA 5F9MA 2MWMA 1NI4B 1PAUA 1BX0A 4Y2HA 4KMSA 2NSYA 5F9HA 4LY9A 3W05A 5KDOA 1KR2A 1VXOA 1SBTA 2OCDA 4UQLA 4DGQA 3PLNA 2HDNB 3HC7A 4JI6B 2Z3ZA 2XOEA 3GZJA 1V8FA 4LA4A 2VZEA 1EFKA 4H16A 2IYYA 2ZAYA 2V6BA 4Q4AA 1RYDA 3RT1A 4CR6A 2PJUA 2DFPA 4B0PA 3DEJA 4TVSA 1DFHA 2BF7A 2FWBA 4CKEA 4E15A 1QTRA 3R7LA 2GEKA 1HE4A 4RCYA 2WZDA 2J9FA 1ESMA 1D8AA 3I8SA 4NCXA 5ALGA 5F3DA 2X41A 3DFMA 3VPCA 4AUEA 1MHTA 4L8FA 2XUKA 5IBCA 2A5YB 2Y9MB 1GRVA 3QU7A 4MA0A 4P3KA 3ZXIA 2FFRA 4XUDA 5DTJA 2A0XA 1L6IA 4N3BA 1Q6YA 4LI3X 5LKRA 1LF0A 3AHIA 3ROKA 5TS2A 5K3EA 3C41J 4Y9UA 1JFTA 2H1OA 2R66A 3I12A 5K2MA 3GJQA 3L8CA 4UM9B 5J9FA 4GSLA 3QW2A 4MRAA 4EUFA 3WXBA 3QHQA 2AG6A 1ICEA 1O5OA 4ISCA 4ETMA 1R6UA 1X9HA 1FP4B 3ASYA 4FB4A 5JNUA 4YCNA 1CY1A 2G5PA 3E5RA 3BAFA 3QKWA 3CZAA 5H83A 2BO1A 3EGEA 4FILA 3ED5A 1G41A 2OD2A 1AVTA 1IHOA 3LUPA 1Z4KA 2PU5A 3BMXA 3LBAA 2Q4BA 2PL1A 3ICWA 3PXEA 3NEAA 3VA7A 2IYPA 1U40A 5FAKA 1B93A 5ALLA 5AKGA 4B6JA 1N6RA 3NGMA 2Y0BA 4BQEA 5A9SA 1YVDA 3ABQB 1DVRA 4YJ2A 1DT9A 1LSOA 4QGBA 4ZREA 3AXSA 5COAA 3E9MA 4CM4B 1B15A 4R05A 3EVCA 4TROA 5JCOC 3MWFA 4GUAA 4HY3A 3C97A 1U3DA 4HJXA 1JDVA 2B33A 1ND5A 4X60A 4FEGA 4DBZA 1UFRA 1KI8A 2X9QA 1GTMA 4B47A 2O7NA 3KEMA 4QUAA 1VQ9F 2GK4A 3CW2A 5I9TA 1EESA 4HB2A 3T7SA 3A0UA 3SQMA 4PW0A 3HAXD 1F2VA 2EDAA 2HS4A 3Q6MA 2RGEA 1VYTA 3DOFA 3WL7A 1WXEA 3R7SA 2W22A 3L9WA 1Z73A 1JW9B 4OQMA 2B94A 2QX4A 1ZM3A 4ZMBA 3ZE7A 3HEAA 2YJZA 3GO4A 4IIJA 2MSEB 5JAOA 3HKDA 2QUJA 3D6TB 5KINB 1OXTA 2XI4A 3C24A 2ZSDA 4H1UA 3GI1A 1B6RA 2B4TO 4NCNA 3MGGA 4IZHA 4DDWA 2AMVA 3PC2A 3FRHA 4ZQHA 1Q7TA 2XSZA 4FXOA 2HA4A 3N2GA 2CXSA 1XRGA 5FQOA 1XZQA 1IZ7A 3LPNA 5ALQA 2PGNA 1NMXA 1QAHA 2CVPA 2CDAA 1S89A 1ENYA 1Y5NA 2XTJA 3IILA 3STUA 3U62A 4BYGA 1K7EB 5TGTA 1YFLA 4MHTA 2SCUA 5C52B 1BJTA 1NDHA 3R41A 2AJTA 1QO0A 4ZZ0A 3H9BA 4ESEA 2P9CA 3N28A 4W9MC 2QN7A 2B30A 1W5BA 2H1VA 4HBGA 3QLUC 4TWJA 4P5PA 3RTAA 4P81A 1JT9A 1NXSA 3NKLA 4M1YA 4X7MA 5CPFA 3FIUA 1COZA 3HCEA 2AQ8A 1EWRA 1QCDA 2HWYA 5D51S 3NHKA 5JCJA 1Q7GA 4OM7A 3ZI0A 1E7YA 1SPXA 1YAJA 521PA 1ZUIA 1PJBA 2YOFA 1ZK1A 2C20A 4REMA 4RF4A 1T3LA 1NVDA 4GFDA 4YIHA 3CS3A 3BFJA 1W88B 3OIUA 3D6FA 1D1TA 4HG2A 5LYJB 2H1RA 3MIZA 4FDAA 1AURA 4YRDA 4G1VA 3A32A 1J0EA 3IXMA 4FGWA 3BB4A 2LCFA 1Z9BA 2I54A 2PBZA 3QOYA 3H04A 1CDOA 1NNI1 2ZRFA 4CV0A 3OPMA 2HK6A 4WH0A 3VH1A 1FRNA 1K6EA 1Y1SA 2BONA 4XD2A 2C4TA 3DH0A 1E60A 1UEXC 4OMFG 3Q2IA 2PWBA 1KFEB 1CRQA 1ULBA 3VJLA 3GVXA 3P8ZA 4D0RA 1CY7A 4WLVA 3F46A 2IYRA 2ZSKA 2I99A 1HOTA 2ICAA 1RYZA 4ROSA 4ZVPA 4F04A 3E81A 3I5YA 1ZGBA 3PSAA 1ACMA 1VE3A 2HLNA 5AP9A 4YRGA 4Z7JA 1N2BA 2G9ZA 1THMA 2QAGC 2P0YA 1IFXA 4BO2A 5AKHA 1CV2A 2WYUA 3B8HA 3GRVA 1K9SA 1V5GA 1ZVKA 1PL6A 2DFTA 2NO5A 3EBOA 3GLUA 4I14A 3SIPA 1DSSG 1NUPA 4HDNB 4LGYA 3DZ8A 1C9JA 1RQNA 1XZFA 3ZDFA 3NVKI 2Z58A 4II2A 4M86A 4ZQGA 1IQUA 1JSXA 4YGXB 3A4VA 3S5JA 1C1YA 2C8VA 5ELXA 3I9V1 4H35A 2UUPA 4DCOA 2ILTA 2H8CA 2H6LA 1X94A 4KUHA 3ASZA 1TF2A 1CF9A 1YQGA 3GFGA 3N8DA 3QOXA 3DNPA 4XQEA 2GYWA 4ZC8A 4OH1A 1IB0A 1A8SA 2LR0A 5GGYA 5LQMA 2B34A 2WIBA 4DR3B 1NNSA 2K2QB 1Y6ZA 4E5DA 2AZ4A 3PUXA 1LKZA 1SCJA 1KO1A 1JLSA 4WCFA 3R9IA 4DMMA 1U9IC 3DYBA 4AG6A 3TCXB 2UZ4A 2VH1A 5LN1A 1XLTA 3SCZA 1L7PA 4V0RA 4IM7A 1GL9B 3L7LA 2I6GA 2OHGA 3D4PA 3OM1A 4KV9A 5BMVB 1CNMA 4HB3A 4HUJA 3A4TA 3CMAF 1FFAA 3KUXA 4GEGA 2R65A 4E6PA 5L53A 4P35A 2A5JA 1X7ZA 4ERHA 1Z75A 3CCJF 2ZT5A 1Z0ZA 1JPVA 3L3BA 3K9CA 4GP6A 3TINA 3TLJA 4EI7A 4D2IA 4LE0A 1GLNA 2ISQA 3ENWA 4URWR 5DM70 2XBMA 2WSMA 4G0UA 1LEHA 4WQMA 5ESDA 4I9HA 3V00A 1U02A 2XNSA 4CIDA 1U1CA 2ZVZA 1NJ5A 3ZU6A 5HIKA 2QVYX 5GANK 4C2BA 1M74A 3K9HA 1DDIA 4TT3A 2QLLA 3EF3A 5HIJA 2D2XA 4EUHA 3AIKA 3FSGD 4M7RA 2UXBB 3U80A 5A7FA 5IU6A 3DBHB 4Q03A 5F21A 1F2DA 2J5QA 2JKZA 3IDOA 1GGVA 2XH8A 4CMIB 2YFYA 4BE4A 1NMZA 4PCVA 3O4RA 4XOUA 1HSZA 1TB4A 2KB0A 3MGCA 2IYOA 2FPKA 4LHSA 2WP0A 2XB4A 1PCXA 4QULA 1NXTA 4ZVLA 2ZM5A 3A6LA 2P9JA 1ONBA 3QVWA 3DJYA 4MGKR 5FR2A 4B80A 1AGPA 5EFOA 4RL4A 5G4KA 1UOQA 2GJ9A 3N58A 3HO1A 3GLFA 4JB0A 4TRMA 4DPLA 3KCQA 4XD7D 2GCGA 1VIVA 4HH4A 2XZDA 2YZKA 5JMOA 2NZVG 5IVDA 1WHSA 7MHTA 2RG1A 2OZEA 2IQ5A 1NVBA 4F56A 4QXAA 2D7CA 3Q7RA 5HWSA 4QC2A 3A9TA 5JXWA 2YHIA 1PBTA 3BCSA 3EFBA 1NP6A 3Q12A 4J4TA 1Z8NA 2Q5JA 2VUIB 1GNVA 1OFUX 4C14A 2PX4A 2GMWA 4AMVA 2JD1A 2WHYA 2G09A 3K32A 3LQYA 3LWNA 3OM9A 4H6VA 1ZOSA 4IDCA 4BMNA 1J8VA 1AB5A 2WQZA 4F9EA 1G5FA 4A0HA 4IOJA 1LW6E 2XMRA 1GZ4A 1KYYA 3M6UA 1ODJA 2Q8NA 4RFVA 3CT4A 4TWZA 4I1PA 1SG6A 4Q9DA 2R8OA 4ZU1X 3ESYA 1FYFA 1GOTA 2XXBA 4LWPA 4EJSA 4R31A 1T24A 1DC7A 4MQFA 2J30A 1RHJA 2OO5A 2ZVYA 2YXNA 4HD8A 2EGHA 3WL5A 3ZXUB 5C37A 2VAWA 1U5CA 4IJVA 2OCXA 4L5JA 1K8QA 1PLJA 3QI7A 3L0BA 1PRYA 3QPAA 4MZXA 4W6QA 5KYUA 4ZYLA 3L4KA 1AK9A 2QGZA 3BKXA 3FOAA 1Y37A 4NRDA 3T3MB 2HRUA 1MB9A 2P2LA 2ZWOA 2RGCA 3ZIAD 4KAJA 3ODPA 2A92A 2Y05A 2P3LA 4EEKA 3WGKA 4PLZA 5CFPA 4ZT2A 2FZLA 4A0QA 3OPYA 4JN6B 2QM8A 4L5IA 3HABA 2E1RA 1RKBA 2QX8A 2EC5A 3BS4A 2XWSA 1NUQA 3A31A 3C5CA 3RC2A 1E6EA 5F2KA 1V9CA 3D7SA 3RFCA 4DYVA 2ZWVA 1JHPA 1G2QA 4HQLA 1GO0A 2QTBA 5CLFA 2WHQA 1ORTA 3GA0A 4O8CA 2ERXA 2Q2OA 1VLVA 4EI9A 2ZJYA 4ZEWA 4DG8A 4HLQB 1OLXB 2OFXA 3KKNA 4FK8A 4NU5A 3UG7A 1ITZA 4MVJD 2GBLA 4WLUA 3U7GA 1T6NA 4QFMA 1QOPB 2JGJA 1PQWA 4FBLA 3SDBA 4F85A 4UU8A 1W4LA 1YCHA 3LZCA 2NAFA 4RV9A 2PO5A 4ZO8A 2BGRA 1KDYA 3WLJA 1GO1A 2AIZP 2AG8A 4MVJG 4MDFA 4ZDJA 4QRHA 4MS1B 3PX7A 1T3SA 1E1RD 4YQEA 3VDQA 5FL7D 2WJWA 3U1VA 1OUMA 4EG6A 4ZOCA 1C3EA 1M0WA 2W83A 3G0CA 1T9GS 5LBTA 4LFAB 2ZUUA 3KJGA 4JI5B 2J0UA 4OUDA 5B3LA 2KG4A 4PLYA 2QTFA 2GEJA 2Z5FA 4XCQA 1JEJA 1XJQA 1K68A 4MUGA 3AFNA 4TLAA 5FX2A 4HH3C 5E3HA 2QQ0A 2RC5A 3EF0A 4K2HA 3FNHA 3U4QB 5EIAA 1II9A 2A59A 1HTWA 2BDUA 2FUEA 1H0KA 4LVNA 4X84A 1SBZA 2PCJA 3IP5A 4G5OA 5IVKA 1NDUA 2EZ4A 4ESOA 3E23A 1WBJB 4J0HA 2I2AA 4FGLA 4N5HX 5UKDA 2EJTA 3TLBA 1UJBA 2QI2A 1K8YB 4G36A 4MUAA 3X3HA 3EIOA 4IEFB 2E6KA 3G2NA 1KEZA 4HRVA 2Q46A 4UVDA 3B6NA 5ALMA 3BTUA 3D1VA 4JA0A 1IUOA 2IPLA 2Q8QA 2QPLA 3LX6A 3R5TA 4M0PA 2CBXA 5HOEA 1M6WA 4J2TA 3UAOA 1VPTA 1SCUA 3PUZA 3WK6A 2HGSA 3EVEA 4OYYA 1D4FA 1NT4A 3B20A 3DFKA 1UXHA 5KOHA 1YBMA 2H2WA 3AL0C 3GP5A 4RD0A 4YRFA 4PZUA 4NCHA 3CN9A 3C7DB 3DW3X 1I2BA 9GPBA 2YC2C 2IUFA 6GPBA 3L4BA 3LP8A 4DXHA 4QLBA 1CR2A 5JJKA 3TSCA 2JJ2A 4ZVOA 4TZ0A 2QW8A 3IOBA 2WW8A 3DQQA 4FIDA 3P5SA 1EKXA 4FYHA 1E6KA 3D8RA 4IDEA 1OFGA 1IWOA 4G5XA 4MVCA 1OI2A 1JHAA 3RYCB 1RW4A 2ZBFA 5KWVA 3EVBA 4BQQA 1EBBA 4LGVA 3U0BA 3W3AH 3ND7A 4ZYUA 1OFVA 3H65A 3NS7A 5G40A 3WLHA 4AW9A 2WWIA 3ZE8A 3AW9A 2OA0A 4CLRA 1X86B 1FXSA 2ZIVB 3IEPA 4PPGA 2QVBA 3ZY4A 5KUTA 3MRSA 3ZNPA 1EWYA 2YOHA 3RC8A 2RAUA 2WB4A 2P9GA 2AFIB 2JH3A 2PUWA 3V7YA 3VVLA 1SD2A 3LYLA 1XD8A 1CY4A 3FCOA 2AQKA 3WO1A 1ESZA 2QUZA 3DOIA 3G8BA 1MO6A 1UP7A 2PA0A 1D2AA 1XL1A 4CIVA 4QOGA 3UJ6A 2C9OA 1J23A 4BN4A 4UTOA 1OH7A 3JR7A 3IIKA 2I9KA 1GPKA 4ZC1A 3TAHA 2EQBA 3TAXA 5J4VA 2DXIA 5EZYA 1DQPA 1K9VF 3NBXX 3HACA 2AWNA 5FORA 4LE2A 4K9KA 1YR1A 3SHVA 2FEOA 3DDSA 4O02B 5J4HA 1E5XA 3PNSA 4OYRA 1MB4A 1YU6A 3AQ4A 2QNBA 4YEDA 3E15A 4ALKA 1HDZA 2D2EA 1P7CA 4KITB 3EG5A 3DHEA 2YYYA 1XN1A 3CIOA 3QYFA 1XZDA 4JL8A 3NOXA 3R6GA 5JMTA 1PJSA 1K97A 3R3YA 3KSBC 2H2GA 5L9AA 2BLLA 2EJCA 3F90A 1DI0A 2NV2B 5BWOA 3DR3A 2OECA 3CUTA 4GYKA 4KR6A 2QRVB 4H7PA 2DBVO 4M4SA 1RAHA 2GSDA 1O4WA 2QR5A 3KJNA 2FSUA 3QU2A 4PS1A 4YBZA 5EXSA 3C45A 2NZJA 2J5BA 3FNEA 3GW8A 3K0AB 4L51A 5BN4B 4RE5A 2C59A 4BMZA 4TLDA 4ETNA 4Q19A 2OOKA 5ALKA 1YF3A 2BH9A 1XFAA 2W93A 4U02A 5D7NA 3MNFA 3ANXA 4H59A 4PTLA 1XXHB 2JARA 2JFWA 4KC0A 1YJ8A 5A4IS 3LRXA 5KSPA 3LQ1A 3BRWA 5KYNA 3Q5DA 4MOWA 2QTTA 1Z8DA 5HZGA 3ROEA 1ISHA 4AK9A 1CHNA 3KG2A 1RM5A 2Y0DA 2ZK7A 1Z82A 2I2FA 3LUCA 4HWRA 3SYLA 4ZKDA 6REQA 3C9RA 1YIAA 3AVQA 4HDKA 4RHAA 4IQ8A 2ZPAA 5C31A 1EHIA 1Z28A 4HP8A 3IB6A 4KQ2A 2CHGA 3BSYA 4BZXA 3LOQA 2C78A 3UBMA 2R5NA 1Z0AA 3DTNA 4OMUA 2YVUA 2DYYA 2CFOA 4WXEA 4F84A 1ODEA 3F7MA 4OI0A 2NO6A 2CL7X 2HQRA 5K8VA 5ALDA 3QFHA 4WK0B 1JXAA 3L7IA 1J0XO 4ME6A 1EP3B 3QWFA 5CYFA 4RTOA 3AEUA 4B4KA 2QP3A 1N3IA 2VJPA 2G9UA 4OAQA 5AQEA 3WLTA 4C4RA 4HSEA 4Q48A 1W19A 2AZTA 4GP7A 3KOYA 5L6LB 4C7MA 2E37A 1SXIA 1V3TA 3D7MA 1TVCA 1CFJA 4KQXA 5AK3A 3HKBA 3ONVA 1ORIA 3H1PA 1VECA 5IN5A 2VF2A 4ML3A 1HKHA 3DZHA 2DR3A 1GV0A 4BUCA 1Z17A 4ZV4A 1CZOA 1GUAA 1XNHA 2DFVA 3GDOA 3R7WA 2F4VB 3T5BA 4KR3A 1VDMA 5DRTA 3EPLA 1VFPA 4YGYA 3TW8A 2H1HA 1NOJA 2AOTA 1VP9A 4MKXA 4BT4A 2G72A 2VDPB 4QSHA 4PX9A 3ELBA 3OFVA 3FF1A 1R0WA 3MC1A 3GLTA 4URYR 4GICA 2IEIA 2H0AA 2YL2A 3KAJA 2WD7A 1GQYA 1Z25A 4NAUA 2X1LA 3A4IA 1OAAA 2I65A 5CLQA 4DFDA 1WF3A 5DOVA 3T5TA 2X1HA 5FEMA 2Z1DA 3A4LA 2D5IA 3RW9A 4IFBA 3HVHA 4TLMB 3VNAA 1IN5A 4C2TA 2W6OA 2C29D 4L4SA 3U3RA 1Q7RA 1D0VA 2PL5A 1EFPA 5DIFA 2H18A 1CQXA 3FTFA 5JFOA 3TTTA 3M5PA 4IJ5A 5IMSA 4N1AA 3BTOA 3VZRA 4LYYA 1SZDA 2WUVA 4AP6A 4I1UA 4HZUB 2GVNA 1EE2A 2WDZA 4GHWA 4L78A 1AUOA 2BM9A 4O1IA 1WPRA 4CTKA 3NHSA 1UJ4A 4AQDA 3JALA 1SVMA 4BCCA 4E5MA 4W8OA 1JQ5A 1WU7A 3HPRA 3MWEA 4KYTA 4FR0A 4CIAA 2QZ4A 5JZOA 5HYVA 1OB2A 2FSIA 1PBNA 5AK5A 5E6UB 3V6MA 1B0UA 1CJBA 4YAUA 1XV2A 1LY1A 1OLUA 4H7HA 4MW9A 2VUUA 4MAFA 1MKYA 1VSTA 3HZHA 3X1JA 2VRCA 2KI5A 3LD9A 3LF2A 2D1SA 2AMYA 4UARA 4UJ3A 2JDID 4OBWA 3VUEA 3G85A 1NW8A 2ZYGA 4HR7A 4KYVA 4PZPA 3T7AA 3H9QA 4FIZA 4Z1OA 1G19A 3CUKA 4ZRNA 5IAEA 1HQKA 1ZU5A 2UZHA 2HV9A 2P41A 4P3NA 2GFHA 1ESCA 1MEEA 4CQLB 4E7OA 5LDGA 2IPXA 1QHHA 3TRIA 5KJFA 5C51B 4GOXA 1XFDA 3IPAA 4OCZA 4NZNA 1UP6A 2W2QA 2E7ZA 2ZQZA 3TBHA 4BMVA 1E6LA 2WLTA 4NUTA 2GKSA 1WEKA 3ZHUA 2J31A 2Q5HA 1ODIA 4M1ZA 4PAGA 5ALIA 4S05A 1Z2EA 1EDBA 2L19A 3OFND 3NU1A 4UTRA 3FCSB 5GM2A 1QLHA 3DLTA 4RVHA 3UA3A 4AY5A 1W1UA 4J90A 4RMGA 3KEOA 2RH8A 4D3SA 2G71A 4RAQA 1BFDA 3RTCA 1L1QA 3DBRA 1U31A 2PH7A 1OTHA 2DHQA 1SURA 4JBXA 4AY4A 4ZVTA 1UPAA 1B43A 4KQFA 3TW4A 4BAGA 2DWCA 1ZIDA 3PE3A 3FJ1A 1L8OA 3LYAA 1RACA 1M2HA 2JFYA 4LJYA 5DWDA 3VVBA 421PA 3S0WA 4QJBA 1L4HA 1TRHA 4IJWA 2Q3JA 1W2BF 3WAKA 5JCZA 2YNMC 2XA9A 2QR2A 1JQEA 2ZI4A 4N49A 3FPSA 2AFIE 1NJFA 5JAQA 2XXAB 4OHOA 5K0TA 1ULTA 3O9ZA 1MVOA 1NYTA 4ZQEA 3ZZ1A 3PVCA 4FM9A 1NV8A 1IL0A 2A3RA 5HUJA 2Q50A 3V4LA 4X63A 2GHTA 4UU1A 3H9JA 2B2NA 5B1SA 1JL3A 1EFHA 3QITA 3PRJA 3I55F 1MC4A 2ORVA 2QU7A 2P3OA 3QYAA 2WMYA 4P7BA 1NFQA 5BNZA 3A1TA 2WHEA 1G9SA 4HVAA 1R3UA 1OZFA 1IN8A 1QP7A 3TNDA 1N2CA 2ZYDA 5JE8A 4HS9A 4PR3A 2O0KA 1FQJA 1FYDA 4R84A 4G23A 2IHUA 5CUQA 1DJMA 3UCEA 3OPXA 5AT1A 2F17A 1R7RA 2V59A 3FBAA 1DQYA 1G4UR 1C7JA 1X2EA 3F8TA 3W7VA 2Z8XA 3W2TA 2H29A 1K8AH 2EZ8A 3BFKA 3QUCA 1WTAA 2YOGA 3KTOA 3DAPA 4JQCA 3QBJA 4WSOA 4Q9KA 1IIBA 2WT8A 2I4LA 2F6RA 3EGCA 3OIGA 4RLFA 3KR2A 5DU2A 3H8SA 1XQ9A 1GARA 3UKJA 5C80A 4LOLA 1FTGA 1GU1A 1BFUA 4FT2A 2V7QD 1FVXA 1L9XA 1BE8A 1OWOA 2C95A 2IU6A 2QMZA 5CCXA 1SN7A 1FJHA 1YRHA 3ISJA 1OSNA 3FUUA 3MBOA 2WWXA 1GA4A 3C87A 2CVLA 4LJ8A 1XXHE 2IZ1A 4C89A 1JYEA 1SXJC 3GRAA 2OCLA 5CB4B 1RVDA 4LRSB 4PSUA 1MJ5A 3CR7A 3OC6A 1CZNA 3UGQA 1C0EA 3G2HA 1DWUA 2OFOA 2EBHX 3M4JA 5DCYA 4K86A 4FONA 5DZSA 1Q95A 3S2YA 4CL2A 1KVSA 1QBKC 4KEAA 4FZRA 4N9QA 4RSMA 5CU7A 2JIOA 5EP2A 3RLIA 3VNRA 1D04A 1XROA 4BLOA 1W6UA 2Z0MA 5C1PA 2FB9A 1OI4A 4MUBA 2ZQ5A 3M6WA 4BDSA 4WXHA 3LXRA 3I9OA 5BNFA 3ACCA 4IYRA 2Q9CA 4ERXA 5B7PA 3W5DA 3PFHA 4LJSA 3P0ZA 4RJTA 1I2ZA 3M6FA 3QLVC 4F6CA 3QXJA 3VKFA 1WMFA 3DSRA 1TJ4A 3ZCRA 5JV5A 3W9SA 4QVIA 2YKGA 1I4DD 3DONA 4U63A 5GONA 5G4UC 3S6JA 5IEJA 5BWCA 4JCOA 3A70A 2O8EB 3TTWA 3RWBA 1Z2CA 4PF1A 1TCAA 4NYMR 1PR0A 3NP7A 4NG4A 1GA6A 1V5WA 2O3RA 3M2PA 1XAJA 5DX1A 1ID8A 1Z0DA 3PYMA 3KQVA 2FFQA 5BWBA 2Q3FA 2LKCA 1V8PA 2ZREA 2Q7XA 3LS2A 1RRMA 4REQA 2XNJA 4D8UA 4U5QA 4BGUA 3I5AA 1YQWA 1P1BA 1KS9A 2FUG1 4UBJA 3QHDA 4BCBA 5ARCA 1U0NA 2B2CA 3OQJA 3IMFA 1T2CA 1UL1X 5CVCA 1E66A 1PDWA 1E0SA 1OT3A 3OONA 1YI8A 4QBKA 3FVQA 5BUQA 4F38A 1IM2A 1MB2A 3G17A 3WK9A 4C04A 2ECFA 3S28A 3DAYA 3HLKA 5HZKA 1RBYA 4MRMA 5LQKA 2PLRA 3ZWPA 5AW7A 4I4LA 1F7VA 1T3GA 4HPWA 1F5NA 1G1MA 2BGLA 2GEFA 4KQIA 2O05A 3VR4D 2WM8A 1T0IA 3HCWA 2ZXEA 4ZYWA 4Q15A 4IEEA 2IHTA 1GX1A 3KJQA 5IDXA 5I47A 5IAAA 1LJLA 2IHJA 2PSDA 5IASA 5I9IA 4L9RA 1GTZA 2PMBA 1GRQA 4CTOA 1QHYA 4BKUA 3O03A 3C1TA 1TM3E 3DFFA 4L3VA 4YRTA 1O97D 2A9PA 3GEDA 4QECA 4Y98A 3S99A 1U65A 3TD2A 1OAOC 1EUDB 1J7HA 3EPKA 1PLLA 2BKEA 3VXKA 5TQ0B 4EKEA 1FS6A 1ORWA 1OWLA 3NTQA 5L3SA 5BR4A 2TYSB 1Z38A 3KOUA 5CYGA 5GWXA 2TMKA 1WP9A 5EC8A 2VJMA 1H0HA 2Y1LA 2KS6A 4TL7A 3OQIB 5CURA 4EDFA 4AX4A 1WUYA 3DOHA 1PP4A 4PHFA 4RPHA 3HB9A 1TK2A 3ESXA 2J3IA 4RQOA 3G0GA 4FWTA 2Z2JA 4FOSA 5KPDA 1IRXA 2PX5A 5E38A 3A37A 4B7AA 4YONB 5J5CA 3LP5A 5IM4F 3VU9A 3THWA 2H4HA 3SYTA 1ONNA 2BEVB 3RTBA 3L8MA 1KC1A 4DA6A 5LYJF 1RLIA 3AESB 3QEJA 2OMEA 1IV3A 2XHEA 3I9JA 3MK31 4JYMA 1U99A 3JATA 1RHQA 4D9IA 1HK7A 3U3OA 4EH1A</