3SIUA

Structure of a hprp31-15.5k-u4atac 5' stem loop complex, monomeric form
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
ADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NHP2-like protein 1
publication title Structural basis for the dual U4 and U4atac snRNA-binding specificity of spliceosomal protein hPrp31.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing/rna
total genus 39
structure length 125
sequence length 125
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3siuA00
1GO1A 1Q82H 1YI2F 5FJ4C 5EWRA 2FC3A 3G71F 1YHQF 1VQ5F 3NVKE 1PXWA 3ON1A 3CCJF 1VQLF 3FFMA 1ZWZA 3CCEF 3E1YA 3LWVC 4NUTA 3I56F 3CC2F 3SIVA 1S72F 3GYQA 3HAXD 3O85A 3RA6A 1YITF 3CG6A 1VQMF 5GIPC 3CCQF 2JNBA 3V7EA 2HVYD 1JJ2F 1VQNF 1VQ9F 1CK2A 3NK7A 3N4ZA 3CXCF 2KTVA 1RA4A 1T0KB 2OHWA 1NJIH 1KQSF 1X7PA 1H7MA 1W3EX 3G4SF 1Q81H 4BW0B 3I55F 4LCKA 1VQ6F 5IT9M 3NVIB 3E20B 5DCVA 1M1KH 2LBWA 1X7OA 5GINC 1DT9A 3OBWA 2I6DA 3CCUF 1YJWF 1K73H 4X3MA 5G4VC 3CCSF 3CCLF 3N4YA 1VQOF 4BY9D 1K8AH 2AIFA 1VQKF 3OW2F 3CC7F 5A2QM 2OTLF 1KC8H 5GANK 1SDSA 2OTJF 1IPAA 1Q7YH 1K9MH 1KD1H 1VQ7F 3CCRF 1VQ4F 1XBIA 2QI2A 1M90H 5EO3A 1QVGF 1W40A 3VI6A 1Q86H 3NMUC 2KG4A 1YJ9F 1RLGA 3JCMM 1W2BF 4X3LA 3CCVF 3CCMF 2OZBA 1VQ8F 3CPWF 1YIJF 3LWPC 1QVFF 3NK6A 2LBXA 2QA4F 2WALA 3CD6F 2VGMA 3CC4F 3LWOC 5G4UC 2KTUA 1VQPF 2CZWA 3PAFA 5GAPK 3LWRC 4C4WC 3MCAB 1X52A 3J81M 3G6EF 1GO0A 3J7AR 3J80M 1GZ0A 1N8RH 3OBYA 3LFOA 5FLXM 2BO1A 3LWQC 1YJNF 2ALEA 1CN7A 3CMAF 3CPQA 3HJWC 1W42A 3VMFB 3JAMM 3CMEF 1E7KA 3WXMB 3PLAC 3V7QA 3IR9A 3RA5A 1NMUB 2QEXF 3SIUA 5GIOC 4TZZA 1W41A 2VGNA 3AGKA
chains in the Genus database with same CATH superfamily
1YI2F 1OAPA 2H8EA 5HP7A 3WJQA 3TD4A 4I50A 1VQLF 3FFMA 3LWVC 2MQEA 4B45A 3SIVA 1W5FA 5C8YA 5EZYB 2PMPA 3E22B 2Z1EA 3KE1A 5J2TA 4O4JA 2VXYA 2JNBA 3V7EA 1FSZA 3FPIA 3KJJA 2UYNB 3N4ZA 4IHJB 4BT5A 2KTVA 1RA4A 2VAWA 2UZHA 1H7MA 1W3EX 4C8EA 2N48A 3NVIB 4FFBB 3E20B 5DCVA 1M1KH 1X7OA 4TV8B 2IQQA 3HKBB 1DT9A 5LOVA 1YJWF 4TV9B 4X3MA 5JQGB 5G4VC 3CCLF 5GONA 1VQOF 2AIFA 3WGNA 3P10A 1W5AA 5LYJB 5GANK 2OTJF 1QD9A 1K9MH 4ZHQB 3VI6A 1KNKA 1YGYA 1Z5VA 1W581 3NMUC 1IV3A 5EYPB 2Z1FA 5HY4A 3JCMM 3QUWA 4X3LA 3HKEB 2Q1YA 3RYHB 3S02A 5IJ0B 1VQ8F 1YIJF 3LWPC 4BT3A 2BTQB 4G4XA 3P4EA 4I50B 3CYPB 2VGMA 2LCAA 4G4VA 3C9RA 1JFFB 2KTUA 5C8YB 1VQPF 5J2TB 1W59A 2HX0A 3F0DA 3J7AR 1U43A 1Q8RA 3OBYA 5FLXM 5EZYA 2BO1A 1Z5WA 3IKFA 1YJNF 1CN7A 3E22A 3S06A 2HS0A 4EI7A 3VMFB 3K12A 5HWEA 3LYBA 5HXUA 4C8GA 4RQOA 5GIOC 3CB2A 2UYNA 4IHJA 4I4TA 5HXZA 2RB9A 1W41A 2H8CA 5B8FA 1GO1A 1RQ7A 5EB0A 4FFBA 3VO8A 3MCQA 3VTIC 4B5CA 1Q82H 1XHOA 5FJ4C 3WPXA 4TV8A 3R0PA 3HKBA 3JAWB 1QU9A 4O4LB 2IAFA 4TV9A 1VQVA 3CCJF 3HTNA 1SA0A 2IG8A 3ZP7A 2DT4A 3IKEA 3HKCB 4NUTA 3VOBA 2BTUA 5LYJA 3JARB 3TD5A 3C9SA 3HAXD 3RA6A 1YITF 4ZHQA 3GTZA 4DXDA 5GIPC 1VQMF 5EIBC 2HP0B 4U39A 5LXTB 5EYPA 3N2KB 2W8BC 3HKEA 3RYHA 4B46A 2OTMA 2RHLA 1W5EA 5IJ0A 1IV1A 1X7PA 1IV2A 4BW0B 3WPWA 5HY1A 5IT9M 5IJ9B 1H47A 3OONA 3KIZA 4LNUA 3JVHA 4ZK7A 4O2BB 5EIBD 3LMEA 3LDTA 2CWJA 5GINC 2I6DA 1K73H 1IV4A 3BYQA 1JFFA 4PWTA 2Z1UA 1VQKF 4BVSA 4O4IB 1R1MA 2QTPA 2B33A 1SDSA 1IPAA 1U40A 2LBTA 4O2AB 3WGMA 4F6RB 4O4HB 3CCRF 4XCQA 4HNAB 5LP6B 1W40A 1Q86H 4I4TB 3M1XA 2KG4A 3D54A 5EB1B 1RLGA 1JY8A 3JAKB 3KHNA 1W2BF 2EWCA 3Q8HA 2HS3A 5LP6C 5BMVA 2OZBA 3CPWF 3ZOPA 2L26A 3F6MA 2QA4F 3WGJA 2CVLA 4C81A 1SA0B 4EI8A 3VIUA 2DYYA 2P6YA 3JAWA 4O4LA 2HQSC 5JVDB 2VAPA 3HKCA 3VCZA 3WJRA 3G6EF 2ZODA 1GO0A 1FFXB 3JARA 4ZI7A 2PHNA 2ALEA 3CMAF 1UFYA 3HJWC 2YXZA 3WXMB 2HP0A 3S0HA 5LXTA 5HY2A 3IR9A 3M84A 1NMUB 2GZLA 3N2KA 4LNUB 3RYCB 1H48A 3K2XA 3VYTC 1FNJA 4TZZA 2V9YA 5IJ9A 1OFUA 5FNVB 3S0WA 1KNJA 4TUYB 5EWRA 3UT5A 1QAHA 4O2BA 3ZP4A 3G71F 3MBMA 1VQ5F 3NVKE 1PXWA 1U3PA 4ZHWA 5AVMA 1ZWZA 4O4IA 3I56F 3CC2F 5JCOA 3GYQA 4O2AA 3O85A 4BT7A 4F6RA 4O4HA 5IYZB 3CG6A 3GHZA 4HNAA 5LP6A 2R6R1 5J2UA 3IEWA 3CCQF 2F9ZC 2HVYD 4G4YA 5BMVB 3TD3A 2G9IA 1VQ9F 2CHTA 2K1SA 3JAKA 3NK7A 5MN4A 2RHHA 2OHWA 4ZHYB 3F0FA 3F0EA 1W55A 5MN5A 3G4SF 4LCKA 1ODEA 3I55F 1VQ6F 5CB4B 5HP8A 3C8LA 2HRUA 3OBWA 3CCSF 1W5BA 4ZI7B 5JVDA 3WGLA 1K8AH 2CW4A 2FGYA 3OW2F 5KMGB 3CC7F 4G88A 3IMPA 5A2QM 3JATB 5LA6A 2OTLF 1W57A 3U0OA 1FFXA 1KD1H 1FNKA 1CLIA 1XBIA 1XV2A 1UI9A 5EO3A 2UYKA 5CA0B 1M90H 3ERNA 3FD5A 3ESJA 4X1IB 4C8IA 3P0ZA 1GX1A 4R40B 4E6EA 1YJ9F 3HKDB 1JN1A 3CCVF 4BT4A 1RQ2A 3MDOA 4I55A 3VYSC 3RYCA 3UT5B 1ONIA 1TUBB 4NWOB 4YJ3B 2UYPA 3WJPA 1QVFF 2R751 3NK6A 2LBXA 3S03A 4U3JA 5EAZA 5FNVA 4DRXB 5CA1A 5KX5B 4TUYA 3CYQA 3CC4F 4WBNB 3FD6A 5G4UC 2Z01A 2BTOA 3PAFA 3RYFB 2ZOVA 4C4WC 5J2UB 3MCAB 3I3FA 1U3LA 3JALA 3K0TA 4B62A 3J80M 1N8RH 5JCOC 3LWQC 5IYZA 3CPQA 1W42A 4X20B 4X1YB 3VYUC 5ITZB 3CMEF 3C9TA 2ZAUA 1TVKB 4YJ2B 3D00A 2GLZA 4KWEA 2HRYA 3IEQA 2YYEA 3I7TA 3V3TA 2QEXF 1XRGA 2ZVYA 3F0GA 1J7HA 3AGKA 4NQ3A 2AMTA 5CB4A 3DDNA 2FC3A 1VK3A 1VH8A 4X1KB 2UYJA 5LA6B 1YHQF 3RYIA 1X25A 3ON1A 3N2GB 4ERHA 3S0YA 1T0AA 1YQNA 3CCEF 3E1YA 5KMGA 3EORA 5JH7A 3JASA 3JATA 3MQWA 1S72F 4IIJA 3WGKA 3HWUA 4EB6B 5CA0A 2HP3A 4I55B 3C9UA 3DC2A 1DBFA 2RHOA 2I6RA 4X1IA 1JJ2F 4ZOLA 1VQNF 1CK2A 3QTYA 3HKDA 3V4DA 1PF5A 3ZO8A 4U3JB 3CXCF 4BVQA 4BT6A 5CA1B 1SZQA 1NJIH 1T0KB 4YJ3A 1TUBA 4BVRA 4ZHVA 1KQSF 1Q81H 3VOAA 2VAMA 2LBWA 4DRXA 5KX5A 3JALB 3D01A 4WBNA 3CCUF 3N4YA 4BY9D 4RHAA 2ZF8A 3KJKA 3RYFA 3RE3A 3QHDA 4C82A 1KC8H 1Q7YH 1VQ7F 1VQ4F 2QI2A 1QVGF 4O4JB 2H6LA 4X20A 4X1YA 3M4SA 5ITZA 3B6NA 3FBAA 1TVKA 4YJ2A 2CSLA 2HS4A 2Z1TA 3K14A 5HY0A 1VHAA 2ZVZA 4G4ZA 3T80A 2NMUA 5MN6A 3CCMF 2AIZP 2RHJA 3L7QA 2GVIA 3RYIB 2WALA 3CD6F 5JH7B 5LOVB 3JASB 3LWOC 4X1KA 4BT2A 5GONB 4IIJB 3N2GA 2KGWA 2CZWA 5GAPK 3LWRC 4M8IA 3J81M 1X52A 1COMA 4BVTA 1JD1A 1GZ0A 5JQGA 3LFOA 4EI9A 4ZOLB 1RLUA 4EB6A 3ELCA 3JAMM 1E7KA 2Q1XA 4G4WA 3PLAC 3V7QA 1NQ3A 3RA5A 3SIUA 2CHSA 2VGNA
chains in the Genus database with same CATH topology
1GO1A 1Q82H 1YI2F 5FJ4C 5EWRA 2FC3A 3G71F 1YHQF 1VQ5F 3NVKE 1PXWA 3ON1A 3CCJF 1VQLF 3FFMA 1ZWZA 3CCEF 3E1YA 3LWVC 4NUTA 3I56F 3CC2F 3SIVA 1S72F 3GYQA 3HAXD 3O85A 3RA6A 1YITF 3CG6A 1VQMF 5GIPC 3CCQF 2F9ZC 2JNBA 3V7EA 2HVYD 1JJ2F 1VQNF 1VQ9F 1CK2A 3NK7A 3N4ZA 3CXCF 2KTVA 1RA4A 4BVQA 2OHWA 1T0KB 1NJIH 1KQSF 4BVRA 1X7PA 1H7MA 1W3EX 3G4SF 1Q81H 4BW0B 5HY1A 3I55F 1VQ6F 4LCKA 3NVIB 5IT9M 3E20B 5DCVA 1M1KH 2LBWA 1X7OA 5GINC 1DT9A 3OBWA 2I6DA 3CCUF 1YJWF 1K73H 4X3MA 5G4VC 3CCSF 3CCLF 3N4YA 1VQOF 4BY9D 1K8AH 2AIFA 1VQKF 2FGYA 4BVSA 3OW2F 3CC7F 5A2QM 2OTLF 1KC8H 5GANK 1SDSA 2OTJF 1IPAA 1Q7YH 1K9MH 1KD1H 1VQ7F 3CCRF 1VQ4F 1XBIA 2QI2A 1M90H 5EO3A 4XCQA 1QVGF 1W40A 3VI6A 1Q86H 3NMUC 2KG4A 5HY4A 1YJ9F 1RLGA 3JCMM 5HY0A 1W2BF 4X3LA 3CCVF 3CCMF 2OZBA 1VQ8F 3CPWF 1YIJF 3LWPC 1QVFF 3NK6A 2LBXA 2QA4F 2WALA 3CD6F 2VGMA 4EI8A 3CC4F 3LWOC 5G4UC 2KTUA 1VQPF 2CZWA 3PAFA 5GAPK 3LWRC 4C4WC 3MCAB 1X52A 3J81M 4BVTA 3G6EF 1GO0A 3J7AR 3J80M 1GZ0A 1N8RH 3OBYA 3LFOA 5FLXM 4EI9A 2BO1A 3LWQC 1YJNF 2ALEA 1CN7A 3CMAF 3CPQA 3HJWC 4EI7A 1W42A 3VMFB 3JAMM 3CMEF 5HWEA 1E7KA 3WXMB 3D00A 3PLAC 2GLZA 3V7QA 5HXUA 5HY2A 3IR9A 3RA5A 1NMUB 2QEXF 3V3TA 5GIOC 3SIUA 5HXZA 4TZZA 1W41A 2VGNA 3AGKA 4NQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GO1 A;  1Q82 H;  1YI2 F;  5FJ4 C;  5EWR A;  2FC3 A;  3G71 F;  1YHQ F;  1VQ5 F;  3NVK E;  1PXW A;  3ON1 A;  3CCJ F;  1VQL F;  3FFM A;  1ZWZ A;  3CCE F;  3E1Y A;  3LWV C;  4NUT A;  3I56 F;  3CC2 F;  3SIV A;  1S72 F;  3GYQ A;  3HAX D;  3O85 A;  3RA6 A;  1YIT F;  3CG6 A;  1VQM F;  5GIP C;  3CCQ F;  2JNB A;  3V7E A;  2HVY D;  1JJ2 F;  1VQN F;  1VQ9 F;  1CK2 A;  3NK7 A;  3N4Z A;  3CXC F;  2KTV A;  1RA4 A;  1T0K B;  2OHW A;  1NJI H;  1KQS F;  1X7P A;  1H7M A;  1W3E X;  3G4S F;  1Q81 H;  4BW0 B;  3I55 F;  4LCK A;  1VQ6 F;  5IT9 M;  3NVI B;  3E20 B;  5DCV A;  1M1K H;  2LBW A;  1X7O A;  5GIN C;  1DT9 A;  3OBW A;  2I6D A;  3CCU F;  1YJW F;  1K73 H;  4X3M A;  5G4V C;  3CCS F;  3CCL F;  3N4Y A;  1VQO F;  4BY9 D;  1K8A H;  2AIF A;  1VQK F;  3OW2 F;  3CC7 F;  5A2Q M;  2OTL F;  1KC8 H;  5GAN K;  1SDS A;  2OTJ F;  1IPA A;  1Q7Y H;  1K9M H;  1KD1 H;  1VQ7 F;  3CCR F;  1VQ4 F;  1XBI A;  2QI2 A;  1M90 H;  5EO3 A;  1QVG F;  1W40 A;  3VI6 A;  1Q86 H;  3NMU C;  2KG4 A;  1YJ9 F;  1RLG A;  3JCM M;  1W2B F;  4X3L A;  3CCV F;  3CCM F;  2OZB A;  1VQ8 F;  3CPW F;  1YIJ F;  3LWP C;  1QVF F;  3NK6 A;  2LBX A;  2QA4 F;  2WAL A;  3CD6 F;  2VGM A;  3CC4 F;  3LWO C;  5G4U C;  2KTU A;  1VQP F;  2CZW A;  3PAF A;  5GAP K;  3LWR C;  4C4W C;  3MCA B;  1X52 A;  3J81 M;  3G6E F;  1GO0 A;  3J7A R;  3J80 M;  1GZ0 A;  1N8R H;  3OBY A;  3LFO A;  5FLX M;  2BO1 A;  3LWQ C;  1YJN F;  2ALE A;  1CN7 A;  3CMA F;  3CPQ A;  3HJW C;  1W42 A;  3VMF B;  3JAM M;  3CME F;  1E7K A;  3WXM B;  3PLA C;  3V7Q A;  3IR9 A;  3RA5 A;  1NMU B;  2QEX F;  3SIU A;  5GIO C;  4TZZ A;  1W41 A;  2VGN A;  3AGK A; 
#chains in the Genus database with same CATH topology
 1YI2 F;  1OAP A;  2H8E A;  5HP7 A;  3WJQ A;  3TD4 A;  4I50 A;  1VQL F;  3FFM A;  3LWV C;  2MQE A;  4B45 A;  3SIV A;  1W5F A;  5C8Y A;  5EZY B;  2PMP A;  3E22 B;  2Z1E A;  3KE1 A;  5J2T A;  4O4J A;  2VXY A;  2JNB A;  3V7E A;  1FSZ A;  3FPI A;  3KJJ A;  2UYN B;  3N4Z A;  4IHJ B;  4BT5 A;  2KTV A;  1RA4 A;  2VAW A;  2UZH A;  1H7M A;  1W3E X;  4C8E A;  2N48 A;  3NVI B;  4FFB B;  3E20 B;  5DCV A;  1M1K H;  1X7O A;  4TV8 B;  2IQQ A;  3HKB B;  1DT9 A;  5LOV A;  1YJW F;  4TV9 B;  4X3M A;  5JQG B;  5G4V C;  3CCL F;  5GON A;  1VQO F;  2AIF A;  3WGN A;  3P10 A;  1W5A A;  5LYJ B;  5GAN K;  2OTJ F;  1QD9 A;  1K9M H;  4ZHQ B;  3VI6 A;  1KNK A;  1YGY A;  1Z5V A;  1W58 1;  3NMU C;  1IV3 A;  5EYP B;  2Z1F A;  5HY4 A;  3JCM M;  3QUW A;  4X3L A;  3HKE B;  2Q1Y A;  3RYH B;  3S02 A;  5IJ0 B;  1VQ8 F;  1YIJ F;  3LWP C;  4BT3 A;  2BTQ B;  4G4X A;  3P4E A;  4I50 B;  3CYP B;  2VGM A;  2LCA A;  4G4V A;  3C9R A;  1JFF B;  2KTU A;  5C8Y B;  1VQP F;  5J2T B;  1W59 A;  2HX0 A;  3F0D A;  3J7A R;  1U43 A;  1Q8R A;  3OBY A;  5FLX M;  5EZY A;  2BO1 A;  1Z5W A;  3IKF A;  1YJN F;  1CN7 A;  3E22 A;  3S06 A;  2HS0 A;  4EI7 A;  3VMF B;  3K12 A;  5HWE A;  3LYB A;  5HXU A;  4C8G A;  4RQO A;  5GIO C;  3CB2 A;  2UYN A;  4IHJ A;  4I4T A;  5HXZ A;  2RB9 A;  1W41 A;  2H8C A;  5B8F A;  1GO1 A;  1RQ7 A;  5EB0 A;  4FFB A;  3VO8 A;  3MCQ A;  3VTI C;  4B5C A;  1Q82 H;  1XHO A;  5FJ4 C;  3WPX A;  4TV8 A;  3R0P A;  3HKB A;  3JAW B;  1QU9 A;  4O4L B;  2IAF A;  4TV9 A;  1VQV A;  3CCJ F;  3HTN A;  1SA0 A;  2IG8 A;  3ZP7 A;  2DT4 A;  3IKE A;  3HKC B;  4NUT A;  3VOB A;  2BTU A;  5LYJ A;  3JAR B;  3TD5 A;  3C9S A;  3HAX D;  3RA6 A;  1YIT F;  4ZHQ A;  3GTZ A;  4DXD A;  5GIP C;  1VQM F;  5EIB C;  2HP0 B;  4U39 A;  5LXT B;  5EYP A;  3N2K B;  2W8B C;  3HKE A;  3RYH A;  4B46 A;  2OTM A;  2RHL A;  1W5E A;  5IJ0 A;  1IV1 A;  1X7P A;  1IV2 A;  4BW0 B;  3WPW A;  5HY1 A;  5IT9 M;  5IJ9 B;  1H47 A;  3OON A;  3KIZ A;  4LNU A;  3JVH A;  4ZK7 A;  4O2B B;  5EIB D;  3LME A;  3LDT A;  2CWJ A;  5GIN C;  2I6D A;  1K73 H;  1IV4 A;  3BYQ A;  1JFF A;  4PWT A;  2Z1U A;  1VQK F;  4BVS A;  4O4I B;  1R1M A;  2QTP A;  2B33 A;  1SDS A;  1IPA A;  1U40 A;  2LBT A;  4O2A B;  3WGM A;  4F6R B;  4O4H B;  3CCR F;  4XCQ A;  4HNA B;  5LP6 B;  1W40 A;  1Q86 H;  4I4T B;  3M1X A;  2KG4 A;  3D54 A;  5EB1 B;  1RLG A;  1JY8 A;  3JAK B;  3KHN A;  1W2B F;  2EWC A;  3Q8H A;  2HS3 A;  5LP6 C;  5BMV A;  2OZB A;  3CPW F;  3ZOP A;  2L26 A;  3F6M A;  2QA4 F;  3WGJ A;  2CVL A;  4C81 A;  1SA0 B;  4EI8 A;  3VIU A;  2DYY A;  2P6Y A;  3JAW A;  4O4L A;  2HQS C;  5JVD B;  2VAP A;  3HKC A;  3VCZ A;  3WJR A;  3G6E F;  2ZOD A;  1GO0 A;  1FFX B;  3JAR A;  4ZI7 A;  2PHN A;  2ALE A;  3CMA F;  1UFY A;  3HJW C;  2YXZ A;  3WXM B;  2HP0 A;  3S0H A;  5LXT A;  5HY2 A;  3IR9 A;  3M84 A;  1NMU B;  2GZL A;  3N2K A;  4LNU B;  3RYC B;  1H48 A;  3K2X A;  3VYT C;  1FNJ A;  4TZZ A;  2V9Y A;  5IJ9 A;  1OFU A;  5FNV B;  3S0W A;  1KNJ A;  4TUY B;  5EWR A;  3UT5 A;  1QAH A;  4O2B A;  3ZP4 A;  3G71 F;  3MBM A;  1VQ5 F;  3NVK E;  1PXW A;  1U3P A;  4ZHW A;  5AVM A;  1ZWZ A;  4O4I A;  3I56 F;  3CC2 F;  5JCO A;  3GYQ A;  4O2A A;  3O85 A;  4BT7 A;  4F6R A;  4O4H A;  5IYZ B;  3CG6 A;  3GHZ A;  4HNA A;  5LP6 A;  2R6R 1;  5J2U A;  3IEW A;  3CCQ F;  2F9Z C;  2HVY D;  4G4Y A;  5BMV B;  3TD3 A;  2G9I A;  1VQ9 F;  2CHT A;  2K1S A;  3JAK A;  3NK7 A;  5MN4 A;  2RHH A;  2OHW A;  4ZHY B;  3F0F A;  3F0E A;  1W55 A;  5MN5 A;  3G4S F;  4LCK A;  1ODE A;  3I55 F;  1VQ6 F;  5CB4 B;  5HP8 A;  3C8L A;  2HRU A;  3OBW A;  3CCS F;  1W5B A;  4ZI7 B;  5JVD A;  3WGL A;  1K8A H;  2CW4 A;  2FGY A;  3OW2 F;  5KMG B;  3CC7 F;  4G88 A;  3IMP A;  5A2Q M;  3JAT B;  5LA6 A;  2OTL F;  1W57 A;  3U0O A;  1FFX A;  1KD1 H;  1FNK A;  1CLI A;  1XBI A;  1XV2 A;  1UI9 A;  5EO3 A;  2UYK A;  5CA0 B;  1M90 H;  3ERN A;  3FD5 A;  3ESJ A;  4X1I B;  4C8I A;  3P0Z A;  1GX1 A;  4R40 B;  4E6E A;  1YJ9 F;  3HKD B;  1JN1 A;  3CCV F;  4BT4 A;  1RQ2 A;  3MDO A;  4I55 A;  3VYS C;  3RYC A;  3UT5 B;  1ONI A;  1TUB B;  4NWO B;  4YJ3 B;  2UYP A;  3WJP A;  1QVF F;  2R75 1;  3NK6 A;  2LBX A;  3S03 A;  4U3J A;  5EAZ A;  5FNV A;  4DRX B;  5CA1 A;  5KX5 B;  4TUY A;  3CYQ A;  3CC4 F;  4WBN B;  3FD6 A;  5G4U C;  2Z01 A;  2BTO A;  3PAF A;  3RYF B;  2ZOV A;  4C4W C;  5J2U B;  3MCA B;  3I3F A;  1U3L A;  3JAL A;  3K0T A;  4B62 A;  3J80 M;  1N8R H;  5JCO C;  3LWQ C;  5IYZ A;  3CPQ A;  1W42 A;  4X20 B;  4X1Y B;  3VYU C;  5ITZ B;  3CME F;  3C9T A;  2ZAU A;  1TVK B;  4YJ2 B;  3D00 A;  2GLZ A;  4KWE A;  2HRY A;  3IEQ A;  2YYE A;  3I7T A;  3V3T A;  2QEX F;  1XRG A;  2ZVY A;  3F0G A;  1J7H A;  3AGK A;  4NQ3 A;  2AMT A;  5CB4 A;  3DDN A;  2FC3 A;  1VK3 A;  1VH8 A;  4X1K B;  2UYJ A;  5LA6 B;  1YHQ F;  3RYI A;  1X25 A;  3ON1 A;  3N2G B;  4ERH A;  3S0Y A;  1T0A A;  1YQN A;  3CCE F;  3E1Y A;  5KMG A;  3EOR A;  5JH7 A;  3JAS A;  3JAT A;  3MQW A;  1S72 F;  4IIJ A;  3WGK A;  3HWU A;  4EB6 B;  5CA0 A;  2HP3 A;  4I55 B;  3C9U A;  3DC2 A;  1DBF A;  2RHO A;  2I6R A;  4X1I A;  1JJ2 F;  4ZOL A;  1VQN F;  1CK2 A;  3QTY A;  3HKD A;  3V4D A;  1PF5 A;  3ZO8 A;  4U3J B;  3CXC F;  4BVQ A;  4BT6 A;  5CA1 B;  1SZQ A;  1NJI H;  1T0K B;  4YJ3 A;  1TUB A;  4BVR A;  4ZHV A;  1KQS F;  1Q81 H;  3VOA A;  2VAM A;  2LBW A;  4DRX A;  5KX5 A;  3JAL B;  3D01 A;  4WBN A;  3CCU F;  3N4Y A;  4BY9 D;  4RHA A;  2ZF8 A;  3KJK A;  3RYF A;  3RE3 A;  3QHD A;  4C82 A;  1KC8 H;  1Q7Y H;  1VQ7 F;  1VQ4 F;  2QI2 A;  1QVG F;  4O4J B;  2H6L A;  4X20 A;  4X1Y A;  3M4S A;  5ITZ A;  3B6N A;  3FBA A;  1TVK A;  4YJ2 A;  2CSL A;  2HS4 A;  2Z1T A;  3K14 A;  5HY0 A;  1VHA A;  2ZVZ A;  4G4Z A;  3T80 A;  2NMU A;  5MN6 A;  3CCM F;  2AIZ P;  2RHJ A;  3L7Q A;  2GVI A;  3RYI B;  2WAL A;  3CD6 F;  5JH7 B;  5LOV B;  3JAS B;  3LWO C;  4X1K A;  4BT2 A;  5GON B;  4IIJ B;  3N2G A;  2KGW A;  2CZW A;  5GAP K;  3LWR C;  4M8I A;  3J81 M;  1X52 A;  1COM A;  4BVT A;  1JD1 A;  1GZ0 A;  5JQG A;  3LFO A;  4EI9 A;  4ZOL B;  1RLU A;  4EB6 A;  3ELC A;  3JAM M;  1E7K A;  2Q1X A;  4G4W A;  3PLA C;  3V7Q A;  1NQ3 A;  3RA5 A;  3SIU A;  2CHS A;  2VGN A; 
#chains in the Genus database with same CATH homology
 1GO1 A;  1Q82 H;  1YI2 F;  5FJ4 C;  5EWR A;  2FC3 A;  3G71 F;  1YHQ F;  1VQ5 F;  3NVK E;  1PXW A;  3ON1 A;  3CCJ F;  1VQL F;  3FFM A;  1ZWZ A;  3CCE F;  3E1Y A;  3LWV C;  4NUT A;  3I56 F;  3CC2 F;  3SIV A;  1S72 F;  3GYQ A;  3HAX D;  3O85 A;  3RA6 A;  1YIT F;  3CG6 A;  1VQM F;  5GIP C;  3CCQ F;  2F9Z C;  2JNB A;  3V7E A;  2HVY D;  1JJ2 F;  1VQN F;  1VQ9 F;  1CK2 A;  3NK7 A;  3N4Z A;  3CXC F;  2KTV A;  1RA4 A;  4BVQ A;  2OHW A;  1T0K B;  1NJI H;  1KQS F;  4BVR A;  1X7P A;  1H7M A;  1W3E X;  3G4S F;  1Q81 H;  4BW0 B;  5HY1 A;  3I55 F;  1VQ6 F;  4LCK A;  3NVI B;  5IT9 M;  3E20 B;  5DCV A;  1M1K H;  2LBW A;  1X7O A;  5GIN C;  1DT9 A;  3OBW A;  2I6D A;  3CCU F;  1YJW F;  1K73 H;  4X3M A;  5G4V C;  3CCS F;  3CCL F;  3N4Y A;  1VQO F;  4BY9 D;  1K8A H;  2AIF A;  1VQK F;  2FGY A;  4BVS A;  3OW2 F;  3CC7 F;  5A2Q M;  2OTL F;  1KC8 H;  5GAN K;  1SDS A;  2OTJ F;  1IPA A;  1Q7Y H;  1K9M H;  1KD1 H;  1VQ7 F;  3CCR F;  1VQ4 F;  1XBI A;  2QI2 A;  1M90 H;  5EO3 A;  4XCQ A;  1QVG F;  1W40 A;  3VI6 A;  1Q86 H;  3NMU C;  2KG4 A;  5HY4 A;  1YJ9 F;  1RLG A;  3JCM M;  5HY0 A;  1W2B F;  4X3L A;  3CCV F;  3CCM F;  2OZB A;  1VQ8 F;  3CPW F;  1YIJ F;  3LWP C;  1QVF F;  3NK6 A;  2LBX A;  2QA4 F;  2WAL A;  3CD6 F;  2VGM A;  4EI8 A;  3CC4 F;  3LWO C;  5G4U C;  2KTU A;  1VQP F;  2CZW A;  3PAF A;  5GAP K;  3LWR C;  4C4W C;  3MCA B;  1X52 A;  3J81 M;  4BVT A;  3G6E F;  1GO0 A;  3J7A R;  3J80 M;  1GZ0 A;  1N8R H;  3OBY A;  3LFO A;  5FLX M;  4EI9 A;  2BO1 A;  3LWQ C;  1YJN F;  2ALE A;  1CN7 A;  3CMA F;  3CPQ A;  3HJW C;  4EI7 A;  1W42 A;  3VMF B;  3JAM M;  3CME F;  5HWE A;  1E7K A;  3WXM B;  3D00 A;  3PLA C;  2GLZ A;  3V7Q A;  5HXU A;  5HY2 A;  3IR9 A;  3RA5 A;  1NMU B;  2QEX F;  3V3T A;  5GIO C;  3SIU A;  5HXZ A;  4TZZ A;  1W41 A;  2VGN A;  3AGK A;  4NQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...