3SIUA

Structure of a hprp31-15.5k-u4atac 5' stem loop complex, monomeric form
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
ADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NHP2-like protein 1
publication title Structural basis for the dual U4 and U4atac snRNA-binding specificity of spliceosomal protein hPrp31.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing/rna
total genus 39
structure length 125
sequence length 125
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3siuA00
3CMEF 1K73H 1H7MA 3VI6A 3HAXD 2VGMA 2HVYD 1T0KB 4BW0B 3NK6A 1Q81H 3SIVA 1KQSF 4NUTA 3LWOC 1YITF 2VGNA 3CCSF 5FLXM 5GIPC 3CG6A 3OW2F 3HJWC 5G4VC 1Q82H 5G4UC 3LWRC 1YJNF 2CZWA 3NVIB 2OZBA 1GO1A 2WALA 3IR9A 3J80M 4C4WC 3VMFB 4TZZA 3N4ZA 3WXMB 1GZ0A 1YI2F 3NVKE 3CCEF 1PXWA 3OBYA 3CCUF 1VQMF 3CC2F 3JCMM 1NMUB 3E1YA 2BO1A 3E20B 3CCLF 1W42A 3CPWF 1X7OA 3CCJF 3LWVC 3G71F 1CN7A 3AGKA 2I6DA 3RA6A 1XBIA 3O85A 1VQKF 1W40A 1GO0A 4LCKA 1QVGF 5GAPK 1VQLF 2OTJF 1RLGA 5EO3A 3CCRF 1JJ2F 3GYQA 5GINC 3CCQF 3G4SF 3PLAC 3LWQC 2KTVA 4X3MA 3JAMM 5GANK 2KTUA 3V7QA 1K8AH 2AIFA 1RA4A 3CPQA 3PAFA 2ALEA 1DT9A 1Q86H 3J7AR 3I55F 1VQOF 5FJ4C 1M1KH 3SIUA 2LBWA 3I56F 3LFOA 1VQNF 1VQ6F 3RA5A 1VQ8F 1QVFF 3CMAF 1VQ7F 3CC4F 1VQ5F 3CXCF 2QA4F 3NMUC 1YHQF 2JNBA 1KD1H 3LWPC 3V7EA 3OBWA 5A2QM 1SDSA 5EWRA 1W2BF 3CCMF 2QEXF 1Q7YH 1K9MH 1ZWZA 1N8RH 1YJ9F 3ON1A 1X7PA 3N4YA 1X52A 1VQPF 1YJWF 1VQ4F 2QI2A 3CD6F 5GIOC 3MCAB 3J81M 1NJIH 1W41A 2KG4A 1CK2A 1E7KA 1M90H 1VQ9F 2LBXA 3CC7F 1W3EX 5DCVA 5IT9M 3NK7A 3G6EF 1YIJF 1KC8H 1IPAA 2OHWA 1S72F 4BY9D 3FFMA 2FC3A 3CCVF 2OTLF 4X3LA
chains in the Genus database with same CATH superfamily
3MDOA 5MN6A 2GLZA 1K73H 1H7MA 3HAXD 2HX0A 5FNVA 4EB6A 1T0KB 3WGKA 4G4YA 1W57A 3SIVA 2N48A 2Z1UA 3LWOC 2IG8A 2IQQA 4I4TA 2CSLA 5IYZA 1ODEA 2OTMA 4B62A 3WPXA 3OW2F 4HNAA 5EB0A 2G9IA 2OZBA 5LYJA 4BT4A 5HWEA 5FNVB 3WPWA 4EB6B 1CLIA 1GO1A 5IYZB 1RQ2A 3L7QA 1W5AA 3V4DA 3VOAA 4X20A 4HNAB 3CCEF 2RHOA 3RYHA 2VAWA 1PXWA 1VQMF 3V3TA 5LYJB 4C8IA 5BMVA 2I6RA 2YYEA 1VHAA 3O85A 4X20B 1VQKF 3RYHB 5HY4A 2YXZA 4DXDA 4TUYA 5HP8A 5EO3A 3QTYA 4BVSA 1YGYA 3ERNA 4R40B 5GANK 2KTUA 5BMVB 3V7QA 3FBAA 3CPQA 2VAPA 3K14A 3PAFA 3ZP7A 3CYPB 3F0EA 3M4SA 1DT9A 3QUWA 3HKEA 2GZLA 1SA0B 3S0WA 2GVIA 1SZQA 3U0OA 3LFOA 4LNUA 1DBFA 4O2AA 1QVFF 2Q1XA 5B8FA 2HS3A 2QA4F 3OONA 4C81A 2QTPA 2ZVYA 4YJ2A 3HKEB 4B45A 2NMUA 1H47A 1SDSA 2R751 5EWRA 1W2BF 3KJJA 1VQVA 3HKBB 5KMGB 1K9MH 4G4XA 3Q8HA 4LNUB 3RYCA 4O2AB 2RHLA 1RLUA 1X7PA 3UT5A 3WJRA 3R0PA 1COMA 1JN1A 4IHJA 3TD4A 1Q8RA 3S02A 4YJ2B 1NQ3A 1E7KA 1VQ9F 5IT9M 3G6EF 3BYQA 1Z5VA 3RYCB 1S72F 1YQNA 3UT5B 3CCVF 2UYNA 4IHJB 3CMEF 4DRXA 2VGMA 4BW0B 1FNKA 3I3FA 3VYTC 1KQSF 3IKEA 4C8GA 4O4LA 1H48A 5JCOC 2H8EA 5LA6A 5GIPC 1U3PA 3CG6A 5G4VC 5JCOA 5G4UC 2CHTA 1W55A 4DRXB 3F0DA 3I7TA 3WJPA 2WALA 3M84A 4B5CA 3T80A 5EYPA 3VMFB 4TZZA 4O4LB 4BT5A 5J2TA 2AIZP 5LA6B 1GZ0A 1YI2F 4BVQA 4I50A 3CC2F 1TVKA 3FD5A 3KHNA 4ZHVA 3E1YA 1OFUA 2BO1A 4BVTA 4ZHQA 3N2KA 3G71F 5J2TB 5IJ0A 4G4VA 2CWJA 2IAFA 1TVKB 1RLGA 2VXYA 1JJ2F 4I4TB 3G4SF 4ZHQB 3N2KB 3M1XA 5JQGA 3F6MA 4ZHWA 5IJ0B 2BTOA 4RHAA 3HWUA 2Z01A 3JASA 4X1IA 1Q86H 4BT3A 3K2XA 5C8YA 2ZAUA 1IV1A 1W59A 3SIUA 1FNJA 5JQGB 1UI9A 3CC4F 3P0ZA 1XHOA 1W5BA 5HXZA 3JASB 4X1IB 1IV3A 5GONA 1W581 5A2QM 5C8YB 2F9ZC 3CYQA 4G4WA 3HTNA 3HKCA 3CCMF 1Q7YH 5CA1A 3C9SA 3WGNA 3KE1A 1X52A 2V9YA 3GTZA 4RQOA 4TUYB 2Z1EA 2CVLA 5HY0A 3VO8A 5CA0A 5GONB 1IV4A 4BVRA 2LBXA 3CC7F 3NK7A 3HKCB 3JATA 3WJQA 3P4EA 1IPAA 5CA1B 4X1KA 3WGMA 5KX5A 4BY9D 5FJ4C 3VI6A 5CA0B 1KNJA 3NK6A 4BT2A 3D54A 4I55A 1OAPA 4NUTA 1QAHA 3C8LA 3JATB 1YITF 5KX5B 2FGYA 1W5EA 2VGNA 4O4IA 5FLXM 3HJWC 2H8CA 4M8IA 1Q82H 3B6NA 3LWRC 3TD5A 2CZWA 3E22A 3NVIB 4I55B 2W8BC 4YJ3A 2ZODA 4F6RA 1JY8A 3IR9A 3IEQA 4C4WC 3GHZA 2VAMA 3VYSC 4BT7A 4C8EA 3WXMB 2HP3A 3OBYA 1VH8A 3E22B 4BT6A 2ZOVA 1NMUB 3E20B 3CCLF 4FFBA 4YJ3B 1W42A 1Z5WA 4F6RB 4ERHA 3CCJF 3LWVC 3ESJA 1CN7A 3JAKA 2ZF8A 2Z1FA 2UYNB 1XBIA 2ZVZA 4EI8A 4ZOLA 3TD3A 1W40A 2Z1TA 1GO0A 4LCKA 1QVGF 2PMPA 2CW4A 2HS4A 1TUBA 2RHJA 1VQLF 2OTJF 4TV9A 3CCRF 3GYQA 4FFBB 3MCQA 5AVMA 2KTVA 4X3MA 3JAMM 1FSZA 3JAKB 1K8AH 2AIFA 5LOVA 1QU9A 4ZOLB 4O4HA 4G4ZA 2ALEA 3D01A 3C9UA 1TUBB 3S0HA 3VOBA 4TV9B 3J7AR 4O2BA 3S03A 1VQOF 1RQ7A 5EYPB 1QD9A 4PWTA 1M1KH 2LBWA 5EIBC 5CB4A 1VQ6F 1KNKA 1VQ8F 3DC2A 3RE3A 4I50B 1VQ7F 5LOVB 3S06A 3NMUC 3F0GA 3WGJA 1GX1A 3DDNA 4NQ3A 4XCQA 4O4JA 3VCZA 3IKFA 1KD1H 2RHHA 3K12A 2B33A 3V7EA 3LYBA 3OBWA 4O2BB 1J7HA 3P10A 1T0AA 2BTQB 5LXTA 1IV2A 1ZWZA 5CB4B 1N8RH 4E6EA 3HKDA 5HY2A 2LCAA 3F0FA 3K0TA 1JD1A 5GIOC 3MCAB 1U43A 2UYJA 5EB1B 3J81M 2UZHA 3EORA 2HRUA 4O4JB 4WBNA 5HXUA 2DYYA 1CK2A 2KG4A 3JARA 1R1MA 5ITZA 1VK3A 3LMEA 4IIJA 5DCVA 1W3EX 3JAWA 5LXTB 5MN5A 3HKDB 2AMTA 4X1YA 5EZYA 2HQSC 2FC3A 3FFMA 4U3JA 3ZP4A 4WBNB 5ITZB 3JARB 2HVYD 1Q81H 4IIJB 3S0YA 3JAWB 5JH7A 1X25A 4EI7A 2HP0A 2CHSA 1XV2A 3CCSF 4X1YB 5EZYB 5HP7A 4U3JB 5JVDA 3JALA 5EIBD 3LDTA 1YJNF 3ELCA 2PHNA 2L26A 4B46A 1SA0A 5JH7B 3J80M 2HP0B 1U40A 2R6R1 5IJ9A 3ZO8A 3MBMA 3N4ZA 1XRGA 3NVKE 3RYIA 3IEWA 5JVDB 3JVHA 1ONIA 3JALB 2EWCA 5MN4A 3CCUF 2MQEA 3KJKA 4ZHYB 3C9RA 3JCMM 3CPWF 1X7OA 3VIUA 1W5FA 4X1KB 5LP6C 3WGLA 3HKBA 5KMGA 5IJ9B 3AGKA 2I6DA 3RA6A 5LP6A 4G88A 3RYIB 1UFYA 3RYFA 2LBTA 5GAPK 3KIZA 2H6LA 5HY1A 3D00A 2K1SA 5GINC 3CCQF 3PLAC 3LWQC 1FFXA 2HRYA 3IMPA 4O4IB 4ZI7A 1PF5A 3FPIA 5J2UA 3C9TA 5LP6B 1RA4A 1JFFA 3RYFB 2RB9A 2KGWA 3I55F 4EI9A 3I56F 1VQNF 1FFXB 3RA5A 4ZI7B 3CMAF 5J2UB 1VQ5F 3CXCF 1JFFB 4TV8A 1YHQF 3N2GA 2JNBA 3LWPC 2Q1YA 2UYKA 2QEXF 4C82A 1YJ9F 3ON1A 2HS0A 5EAZA 1U3LA 3FD6A 3N4YA 2P6YA 3VTIC 2UYPA 4NWOB 1VQPF 4U39A 1YJWF 1VQ4F 4TV8B 2QI2A 3CD6F 3N2GB 3ZOPA 1NJIH 1W41A 4KWEA 2DT4A 2BTUA 1M90H 3VYUC 3MQWA 1YIJF 1KC8H 4ZK7A 2OHWA 4O4HB 3QHDA 3CB2A 2OTLF 4X3LA
chains in the Genus database with same CATH topology
3CMEF 2GLZA 1K73H 1H7MA 3VI6A 3HAXD 2VGMA 2HVYD 1T0KB 4BW0B 3NK6A 1Q81H 3SIVA 1KQSF 4NUTA 3LWOC 4EI7A 1YITF 2FGYA 2VGNA 3CCSF 5FLXM 5GIPC 3CG6A 3OW2F 3HJWC 5G4VC 1Q82H 5G4UC 3LWRC 1YJNF 2CZWA 3NVIB 2OZBA 5HWEA 1GO1A 2WALA 3IR9A 3J80M 4C4WC 3VMFB 4TZZA 3N4ZA 3WXMB 1GZ0A 1YI2F 3NVKE 3CCEF 4BVQA 1PXWA 3OBYA 3CCUF 1VQMF 3V3TA 3CC2F 3JCMM 1NMUB 3E1YA 2BO1A 3E20B 4BVTA 3CCLF 1W42A 3CPWF 1X7OA 3CCJF 3LWVC 3G71F 1CN7A 3AGKA 2I6DA 3RA6A 1XBIA 3O85A 4EI8A 1VQKF 1W40A 1GO0A 4LCKA 5HY4A 1QVGF 5GAPK 1VQLF 5HY1A 2OTJF 1RLGA 3D00A 5EO3A 3CCRF 1JJ2F 3GYQA 5GINC 3CCQF 4BVSA 3G4SF 3PLAC 3LWQC 2KTVA 4X3MA 3JAMM 5GANK 2KTUA 3V7QA 1K8AH 2AIFA 1RA4A 3CPQA 3PAFA 2ALEA 1DT9A 1Q86H 3J7AR 3I55F 1VQOF 5FJ4C 1M1KH 4EI9A 2LBWA 3I56F 3LFOA 1VQNF 1VQ6F 3RA5A 1VQ8F 3SIUA 1QVFF 3CMAF 1VQ7F 3CC4F 1VQ5F 3CXCF 2QA4F 3NMUC 1YHQF 2JNBA 4NQ3A 4XCQA 5HXZA 1KD1H 3LWPC 3V7EA 3OBWA 5A2QM 1SDSA 2F9ZC 5EWRA 1W2BF 3CCMF 2QEXF 1Q7YH 1K9MH 1ZWZA 1N8RH 1YJ9F 3ON1A 1X7PA 3N4YA 5HY2A 1X52A 1VQPF 1YJWF 1VQ4F 2QI2A 3CD6F 5GIOC 3MCAB 3J81M 5HXUA 5HY0A 1NJIH 1W41A 2KG4A 1CK2A 4BVRA 1E7KA 1M90H 1VQ9F 2LBXA 3CC7F 1W3EX 5DCVA 5IT9M 3NK7A 3G6EF 1YIJF 1KC8H 1IPAA 2OHWA 1S72F 4BY9D 3FFMA 2FC3A 3CCVF 2OTLF 4X3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME F;  1K73 H;  1H7M A;  3VI6 A;  3HAX D;  2VGM A;  2HVY D;  1T0K B;  4BW0 B;  3NK6 A;  1Q81 H;  3SIV A;  1KQS F;  4NUT A;  3LWO C;  1YIT F;  2VGN A;  3CCS F;  5FLX M;  5GIP C;  3CG6 A;  3OW2 F;  3HJW C;  5G4V C;  1Q82 H;  5G4U C;  3LWR C;  1YJN F;  2CZW A;  3NVI B;  2OZB A;  1GO1 A;  2WAL A;  3IR9 A;  3J80 M;  4C4W C;  3VMF B;  4TZZ A;  3N4Z A;  3WXM B;  1GZ0 A;  1YI2 F;  3NVK E;  3CCE F;  1PXW A;  3OBY A;  3CCU F;  1VQM F;  3CC2 F;  3JCM M;  1NMU B;  3E1Y A;  2BO1 A;  3E20 B;  3CCL F;  1W42 A;  3CPW F;  1X7O A;  3CCJ F;  3LWV C;  3G71 F;  1CN7 A;  3AGK A;  2I6D A;  3RA6 A;  1XBI A;  3O85 A;  1VQK F;  1W40 A;  1GO0 A;  4LCK A;  1QVG F;  5GAP K;  1VQL F;  2OTJ F;  1RLG A;  5EO3 A;  3CCR F;  1JJ2 F;  3GYQ A;  5GIN C;  3CCQ F;  3G4S F;  3PLA C;  3LWQ C;  2KTV A;  4X3M A;  3JAM M;  5GAN K;  2KTU A;  3V7Q A;  1K8A H;  2AIF A;  1RA4 A;  3CPQ A;  3PAF A;  2ALE A;  1DT9 A;  1Q86 H;  3J7A R;  3I55 F;  1VQO F;  5FJ4 C;  1M1K H;  3SIU A;  2LBW A;  3I56 F;  3LFO A;  1VQN F;  1VQ6 F;  3RA5 A;  1VQ8 F;  1QVF F;  3CMA F;  1VQ7 F;  3CC4 F;  1VQ5 F;  3CXC F;  2QA4 F;  3NMU C;  1YHQ F;  2JNB A;  1KD1 H;  3LWP C;  3V7E A;  3OBW A;  5A2Q M;  1SDS A;  5EWR A;  1W2B F;  3CCM F;  2QEX F;  1Q7Y H;  1K9M H;  1ZWZ A;  1N8R H;  1YJ9 F;  3ON1 A;  1X7P A;  3N4Y A;  1X52 A;  1VQP F;  1YJW F;  1VQ4 F;  2QI2 A;  3CD6 F;  5GIO C;  3MCA B;  3J81 M;  1NJI H;  1W41 A;  2KG4 A;  1CK2 A;  1E7K A;  1M90 H;  1VQ9 F;  2LBX A;  3CC7 F;  1W3E X;  5DCV A;  5IT9 M;  3NK7 A;  3G6E F;  1YIJ F;  1KC8 H;  1IPA A;  2OHW A;  1S72 F;  4BY9 D;  3FFM A;  2FC3 A;  3CCV F;  2OTL F;  4X3L A; 
#chains in the Genus database with same CATH topology
 3MDO A;  5MN6 A;  2GLZ A;  1K73 H;  1H7M A;  3HAX D;  2HX0 A;  5FNV A;  4EB6 A;  1T0K B;  3WGK A;  4G4Y A;  1W57 A;  3SIV A;  2N48 A;  2Z1U A;  3LWO C;  2IG8 A;  2IQQ A;  4I4T A;  2CSL A;  5IYZ A;  1ODE A;  2OTM A;  4B62 A;  3WPX A;  3OW2 F;  4HNA A;  5EB0 A;  2G9I A;  2OZB A;  5LYJ A;  4BT4 A;  5HWE A;  5FNV B;  3WPW A;  4EB6 B;  1CLI A;  1GO1 A;  5IYZ B;  1RQ2 A;  3L7Q A;  1W5A A;  3V4D A;  3VOA A;  4X20 A;  4HNA B;  3CCE F;  2RHO A;  3RYH A;  2VAW A;  1PXW A;  1VQM F;  3V3T A;  5LYJ B;  4C8I A;  5BMV A;  2I6R A;  2YYE A;  1VHA A;  3O85 A;  4X20 B;  1VQK F;  3RYH B;  5HY4 A;  2YXZ A;  4DXD A;  4TUY A;  5HP8 A;  5EO3 A;  3QTY A;  4BVS A;  1YGY A;  3ERN A;  4R40 B;  5GAN K;  2KTU A;  5BMV B;  3V7Q A;  3FBA A;  3CPQ A;  2VAP A;  3K14 A;  3PAF A;  3ZP7 A;  3CYP B;  3F0E A;  3M4S A;  1DT9 A;  3QUW A;  3HKE A;  2GZL A;  1SA0 B;  3S0W A;  2GVI A;  1SZQ A;  3U0O A;  3LFO A;  4LNU A;  1DBF A;  4O2A A;  1QVF F;  2Q1X A;  5B8F A;  2HS3 A;  2QA4 F;  3OON A;  4C81 A;  2QTP A;  2ZVY A;  4YJ2 A;  3HKE B;  4B45 A;  2NMU A;  1H47 A;  1SDS A;  2R75 1;  5EWR A;  1W2B F;  3KJJ A;  1VQV A;  3HKB B;  5KMG B;  1K9M H;  4G4X A;  3Q8H A;  4LNU B;  3RYC A;  4O2A B;  2RHL A;  1RLU A;  1X7P A;  3UT5 A;  3WJR A;  3R0P A;  1COM A;  1JN1 A;  4IHJ A;  3TD4 A;  1Q8R A;  3S02 A;  4YJ2 B;  1NQ3 A;  1E7K A;  1VQ9 F;  5IT9 M;  3G6E F;  3BYQ A;  1Z5V A;  3RYC B;  1S72 F;  1YQN A;  3UT5 B;  3CCV F;  2UYN A;  4IHJ B;  3CME F;  4DRX A;  2VGM A;  4BW0 B;  1FNK A;  3I3F A;  3VYT C;  1KQS F;  3IKE A;  4C8G A;  4O4L A;  1H48 A;  5JCO C;  2H8E A;  5LA6 A;  5GIP C;  1U3P A;  3CG6 A;  5G4V C;  5JCO A;  5G4U C;  2CHT A;  1W55 A;  4DRX B;  3F0D A;  3I7T A;  3WJP A;  2WAL A;  3M84 A;  4B5C A;  3T80 A;  5EYP A;  3VMF B;  4TZZ A;  4O4L B;  4BT5 A;  5J2T A;  2AIZ P;  5LA6 B;  1GZ0 A;  1YI2 F;  4BVQ A;  4I50 A;  3CC2 F;  1TVK A;  3FD5 A;  3KHN A;  4ZHV A;  3E1Y A;  1OFU A;  2BO1 A;  4BVT A;  4ZHQ A;  3N2K A;  3G71 F;  5J2T B;  5IJ0 A;  4G4V A;  2CWJ A;  2IAF A;  1TVK B;  1RLG A;  2VXY A;  1JJ2 F;  4I4T B;  3G4S F;  4ZHQ B;  3N2K B;  3M1X A;  5JQG A;  3F6M A;  4ZHW A;  5IJ0 B;  2BTO A;  4RHA A;  3HWU A;  2Z01 A;  3JAS A;  4X1I A;  1Q86 H;  4BT3 A;  3K2X A;  5C8Y A;  2ZAU A;  1IV1 A;  1W59 A;  3SIU A;  1FNJ A;  5JQG B;  1UI9 A;  3CC4 F;  3P0Z A;  1XHO A;  1W5B A;  5HXZ A;  3JAS B;  4X1I B;  1IV3 A;  5GON A;  1W58 1;  5A2Q M;  5C8Y B;  2F9Z C;  3CYQ A;  4G4W A;  3HTN A;  3HKC A;  3CCM F;  1Q7Y H;  5CA1 A;  3C9S A;  3WGN A;  3KE1 A;  1X52 A;  2V9Y A;  3GTZ A;  4RQO A;  4TUY B;  2Z1E A;  2CVL A;  5HY0 A;  3VO8 A;  5CA0 A;  5GON B;  1IV4 A;  4BVR A;  2LBX A;  3CC7 F;  3NK7 A;  3HKC B;  3JAT A;  3WJQ A;  3P4E A;  1IPA A;  5CA1 B;  4X1K A;  3WGM A;  5KX5 A;  4BY9 D;  5FJ4 C;  3VI6 A;  5CA0 B;  1KNJ A;  3NK6 A;  4BT2 A;  3D54 A;  4I55 A;  1OAP A;  4NUT A;  1QAH A;  3C8L A;  3JAT B;  1YIT F;  5KX5 B;  2FGY A;  1W5E A;  2VGN A;  4O4I A;  5FLX M;  3HJW C;  2H8C A;  4M8I A;  1Q82 H;  3B6N A;  3LWR C;  3TD5 A;  2CZW A;  3E22 A;  3NVI B;  4I55 B;  2W8B C;  4YJ3 A;  2ZOD A;  4F6R A;  1JY8 A;  3IR9 A;  3IEQ A;  4C4W C;  3GHZ A;  2VAM A;  3VYS C;  4BT7 A;  4C8E A;  3WXM B;  2HP3 A;  3OBY A;  1VH8 A;  3E22 B;  4BT6 A;  2ZOV A;  1NMU B;  3E20 B;  3CCL F;  4FFB A;  4YJ3 B;  1W42 A;  1Z5W A;  4F6R B;  4ERH A;  3CCJ F;  3LWV C;  3ESJ A;  1CN7 A;  3JAK A;  2ZF8 A;  2Z1F A;  2UYN B;  1XBI A;  2ZVZ A;  4EI8 A;  4ZOL A;  3TD3 A;  1W40 A;  2Z1T A;  1GO0 A;  4LCK A;  1QVG F;  2PMP A;  2CW4 A;  2HS4 A;  1TUB A;  2RHJ A;  1VQL F;  2OTJ F;  4TV9 A;  3CCR F;  3GYQ A;  4FFB B;  3MCQ A;  5AVM A;  2KTV A;  4X3M A;  3JAM M;  1FSZ A;  3JAK B;  1K8A H;  2AIF A;  5LOV A;  1QU9 A;  4ZOL B;  4O4H A;  4G4Z A;  2ALE A;  3D01 A;  3C9U A;  1TUB B;  3S0H A;  3VOB A;  4TV9 B;  3J7A R;  4O2B A;  3S03 A;  1VQO F;  1RQ7 A;  5EYP B;  1QD9 A;  4PWT A;  1M1K H;  2LBW A;  5EIB C;  5CB4 A;  1VQ6 F;  1KNK A;  1VQ8 F;  3DC2 A;  3RE3 A;  4I50 B;  1VQ7 F;  5LOV B;  3S06 A;  3NMU C;  3F0G A;  3WGJ A;  1GX1 A;  3DDN A;  4NQ3 A;  4XCQ A;  4O4J A;  3VCZ A;  3IKF A;  1KD1 H;  2RHH A;  3K12 A;  2B33 A;  3V7E A;  3LYB A;  3OBW A;  4O2B B;  1J7H A;  3P10 A;  1T0A A;  2BTQ B;  5LXT A;  1IV2 A;  1ZWZ A;  5CB4 B;  1N8R H;  4E6E A;  3HKD A;  5HY2 A;  2LCA A;  3F0F A;  3K0T A;  1JD1 A;  5GIO C;  3MCA B;  1U43 A;  2UYJ A;  5EB1 B;  3J81 M;  2UZH A;  3EOR A;  2HRU A;  4O4J B;  4WBN A;  5HXU A;  2DYY A;  1CK2 A;  2KG4 A;  3JAR A;  1R1M A;  5ITZ A;  1VK3 A;  3LME A;  4IIJ A;  5DCV A;  1W3E X;  3JAW A;  5LXT B;  5MN5 A;  3HKD B;  2AMT A;  4X1Y A;  5EZY A;  2HQS C;  2FC3 A;  3FFM A;  4U3J A;  3ZP4 A;  4WBN B;  5ITZ B;  3JAR B;  2HVY D;  1Q81 H;  4IIJ B;  3S0Y A;  3JAW B;  5JH7 A;  1X25 A;  4EI7 A;  2HP0 A;  2CHS A;  1XV2 A;  3CCS F;  4X1Y B;  5EZY B;  5HP7 A;  4U3J B;  5JVD A;  3JAL A;  5EIB D;  3LDT A;  1YJN F;  3ELC A;  2PHN A;  2L26 A;  4B46 A;  1SA0 A;  5JH7 B;  3J80 M;  2HP0 B;  1U40 A;  2R6R 1;  5IJ9 A;  3ZO8 A;  3MBM A;  3N4Z A;  1XRG A;  3NVK E;  3RYI A;  3IEW A;  5JVD B;  3JVH A;  1ONI A;  3JAL B;  2EWC A;  5MN4 A;  3CCU F;  2MQE A;  3KJK A;  4ZHY B;  3C9R A;  3JCM M;  3CPW F;  1X7O A;  3VIU A;  1W5F A;  4X1K B;  5LP6 C;  3WGL A;  3HKB A;  5KMG A;  5IJ9 B;  3AGK A;  2I6D A;  3RA6 A;  5LP6 A;  4G88 A;  3RYI B;  1UFY A;  3RYF A;  2LBT A;  5GAP K;  3KIZ A;  2H6L A;  5HY1 A;  3D00 A;  2K1S A;  5GIN C;  3CCQ F;  3PLA C;  3LWQ C;  1FFX A;  2HRY A;  3IMP A;  4O4I B;  4ZI7 A;  1PF5 A;  3FPI A;  5J2U A;  3C9T A;  5LP6 B;  1RA4 A;  1JFF A;  3RYF B;  2RB9 A;  2KGW A;  3I55 F;  4EI9 A;  3I56 F;  1VQN F;  1FFX B;  3RA5 A;  4ZI7 B;  3CMA F;  5J2U B;  1VQ5 F;  3CXC F;  1JFF B;  4TV8 A;  1YHQ F;  3N2G A;  2JNB A;  3LWP C;  2Q1Y A;  2UYK A;  2QEX F;  4C82 A;  1YJ9 F;  3ON1 A;  2HS0 A;  5EAZ A;  1U3L A;  3FD6 A;  3N4Y A;  2P6Y A;  3VTI C;  2UYP A;  4NWO B;  1VQP F;  4U39 A;  1YJW F;  1VQ4 F;  4TV8 B;  2QI2 A;  3CD6 F;  3N2G B;  3ZOP A;  1NJI H;  1W41 A;  4KWE A;  2DT4 A;  2BTU A;  1M90 H;  3VYU C;  3MQW A;  1YIJ F;  1KC8 H;  4ZK7 A;  2OHW A;  4O4H B;  3QHD A;  3CB2 A;  2OTL F;  4X3L A; 
#chains in the Genus database with same CATH homology
 3CME F;  2GLZ A;  1K73 H;  1H7M A;  3VI6 A;  3HAX D;  2VGM A;  2HVY D;  1T0K B;  4BW0 B;  3NK6 A;  1Q81 H;  3SIV A;  1KQS F;  4NUT A;  3LWO C;  4EI7 A;  1YIT F;  2FGY A;  2VGN A;  3CCS F;  5FLX M;  5GIP C;  3CG6 A;  3OW2 F;  3HJW C;  5G4V C;  1Q82 H;  5G4U C;  3LWR C;  1YJN F;  2CZW A;  3NVI B;  2OZB A;  5HWE A;  1GO1 A;  2WAL A;  3IR9 A;  3J80 M;  4C4W C;  3VMF B;  4TZZ A;  3N4Z A;  3WXM B;  1GZ0 A;  1YI2 F;  3NVK E;  3CCE F;  4BVQ A;  1PXW A;  3OBY A;  3CCU F;  1VQM F;  3V3T A;  3CC2 F;  3JCM M;  1NMU B;  3E1Y A;  2BO1 A;  3E20 B;  4BVT A;  3CCL F;  1W42 A;  3CPW F;  1X7O A;  3CCJ F;  3LWV C;  3G71 F;  1CN7 A;  3AGK A;  2I6D A;  3RA6 A;  1XBI A;  3O85 A;  4EI8 A;  1VQK F;  1W40 A;  1GO0 A;  4LCK A;  5HY4 A;  1QVG F;  5GAP K;  1VQL F;  5HY1 A;  2OTJ F;  1RLG A;  3D00 A;  5EO3 A;  3CCR F;  1JJ2 F;  3GYQ A;  5GIN C;  3CCQ F;  4BVS A;  3G4S F;  3PLA C;  3LWQ C;  2KTV A;  4X3M A;  3JAM M;  5GAN K;  2KTU A;  3V7Q A;  1K8A H;  2AIF A;  1RA4 A;  3CPQ A;  3PAF A;  2ALE A;  1DT9 A;  1Q86 H;  3J7A R;  3I55 F;  1VQO F;  5FJ4 C;  1M1K H;  4EI9 A;  2LBW A;  3I56 F;  3LFO A;  1VQN F;  1VQ6 F;  3RA5 A;  1VQ8 F;  3SIU A;  1QVF F;  3CMA F;  1VQ7 F;  3CC4 F;  1VQ5 F;  3CXC F;  2QA4 F;  3NMU C;  1YHQ F;  2JNB A;  4NQ3 A;  4XCQ A;  5HXZ A;  1KD1 H;  3LWP C;  3V7E A;  3OBW A;  5A2Q M;  1SDS A;  2F9Z C;  5EWR A;  1W2B F;  3CCM F;  2QEX F;  1Q7Y H;  1K9M H;  1ZWZ A;  1N8R H;  1YJ9 F;  3ON1 A;  1X7P A;  3N4Y A;  5HY2 A;  1X52 A;  1VQP F;  1YJW F;  1VQ4 F;  2QI2 A;  3CD6 F;  5GIO C;  3MCA B;  3J81 M;  5HXU A;  5HY0 A;  1NJI H;  1W41 A;  2KG4 A;  1CK2 A;  4BVR A;  1E7K A;  1M90 H;  1VQ9 F;  2LBX A;  3CC7 F;  1W3E X;  5DCV A;  5IT9 M;  3NK7 A;  3G6E F;  1YIJ F;  1KC8 H;  1IPA A;  2OHW A;  1S72 F;  4BY9 D;  3FFM A;  2FC3 A;  3CCV F;  2OTL F;  4X3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...