3SIUA

Structure of a hprp31-15.5k-u4atac 5' stem loop complex, monomeric form
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
ADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the dual U4 and U4atac snRNA-binding specificity of spliceosomal protein hPrp31.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing/rna
molecule keywords NHP2-like protein 1
total genus 39
structure length 125
sequence length 125
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3siuA00
3FFMA 1W2BF 1Q81H 1Q86H 3CCLF 1VQ6F 1M1KH 2QI2A 3CC4F 3E20B 1XBIA 1DT9A 3V7EA 4BY9D 2LBWA 1VQ9F 2HVYD 3N4YA 1PXWA 1VQ5F 3G71F 3CCEF 3I55F 3PLAC 1W3EX 5G4UC 3PAFA 2JNBA 4X3MA 2KTVA 1ZWZA 1YJWF 2VGMA 1YJ9F 4X3LA 1CK2A 1Q7YH 1YIJF 3CXCF 1X7OA 1QVFF 3SIUA 1K8AH 5GANK 3NMUC 3IR9A 3NK6A 1YI2F 2I6DA 1QVGF 3LWRC 4C4WC 1H7MA 5GIPC 3J7AR 3CMAF 3ON1A 2QA4F 1VQ7F 1RA4A 1CN7A 1YITF 2FC3A 3J80M 1NJIH 2KTUA 3CCRF 2WALA 3V7QA 1YHQF 1KD1H 1E7KA 2VGNA 1K9MH 5FJ4C 1NMUB 3G6EF 1VQ8F 2OTLF 1VQNF 3HJWC 4LCKA 1W40A 3CG6A 2QEXF 3CC7F 3OBYA 1VQKF 3LFOA 2ALEA 3LWQC 3WXMB 1K73H 1N8RH 3VI6A 3JCMM 1IPAA 5DCVA 2AIFA 1VQLF 4BW0B 1X52A 3I56F 3LWVC 3AGKA 5EO3A 3LWOC 3CD6F 1X7PA 3NVIB 3O85A 3CCJF 1RLGA 3OW2F 1VQOF 1YJNF 2KG4A 5G4VC 3HAXD 1M90H 3G4SF 2BO1A 3J81M 5FLXM 1KQSF 2OZBA 3CMEF 4TZZA 1W42A 3LWPC 3E1YA 3RA5A 3VMFB 3JAMM 3SIVA 1VQMF 1S72F 3N4ZA 5A2QM 1VQPF 1VQ4F 2OTJF 1W41A 2OHWA 5EWRA 3MCAB 3NK7A 3CCQF 3CCVF 5GINC 3CCMF 3GYQA 1JJ2F 4NUTA 3CCSF 5GIOC 3CCUF 1GO1A 1SDSA 5IT9M 3NVKE 3CPWF 3OBWA 2CZWA 1GO0A 3CC2F 3CPQA 2LBXA 5GAPK 1KC8H 1T0KB 1GZ0A 3RA6A 1Q82H
chains in the Genus database with same CATH superfamily
1IV1A 3RYCA 5CA0B 4G4XA 5HY0A 1Q81H 5EB1B 1Q86H 2ZOVA 1TVKA 3CC4F 3HKDA 1XBIA 3MCQA 5AVMA 3TD3A 5JCOA 2UYNA 3V7EA 1PF5A 3C8LA 1PXWA 2Z01A 1H48A 5EIBC 5J2TA 5GONA 2H8EA 3PAFA 5J2TB 2HP3A 4X1IA 2VGMA 4YJ2B 4C8GA 1YJ9F 4DRXB 1CK2A 2RB9A 3KIZA 1YIJF 3CXCF 3ZOPA 3F0DA 3TD4A 3DDNA 4ZHQA 4O4IB 4G4YA 1RQ2A 4IHJB 2OTMA 3GHZA 1IV4A 3DC2A 4O4JB 1H7MA 2DYYA 2NMUA 4IIJB 3LWRC 5KX5A 1YITF 3J80M 3LMEA 5LXTB 2WALA 4FFBA 2VGNA 1U3PA 1Z5VA 3WPWA 3HJWC 2RHOA 4HNAB 3JAKA 5CA0A 5IJ0A 2ZVYA 4B5CA 3F6MA 1VQKF 1UFYA 5EYPA 3VI6A 3JCMM 4O4HB 1IPAA 4X1YB 2ZF8A 5CA1B 1FFXB 2GLZA 2AMTA 3I56F 3LWVC 2LCAA 4IHJA 2MQEA 5LYJB 3NVIB 3LWOC 4PWTA 1H47A 3CCJF 3OW2F 5G4VC 3F0FA 3VYUC 4F6RA 2G9IA 1M90H 3J81M 2OZBA 3D00A 3JALA 3E1YA 3JAKB 5IJ0B 1VQMF 3I3FA 3N4ZA 3UT5A 1U3LA 1VQPF 3TD5A 3S06A 2EWCA 2H6LA 4TUYB 5JH7A 2OHWA 2HP0B 5EZYA 3EORA 3ERNA 3MBMA 2DT4A 1FFXA 5JVDA 3JAWB 4O4HA 2I6RA 1GO1A 2Z1TA 1GX1A 3OBWA 3CC2F 2BTUA 3F0EA 3WGNA 1UI9A 4NWOB 5HY1A 4EI8A 1W2BF 3JASB 4C8IA 3HKEA 1M1KH 4B46A 2W8BC 5HY4A 1OAPA 1IV3A 3HKEB 5LXTA 3JALB 4U39A 4BY9D 2HS0A 5IJ9B 3RYCB 1VQ5F 3VYSC 1W5FA 5LOVA 3CCEF 5JQGB 1SZQA 1TUBB 3I55F 3PLAC 5G4UC 5J2UB 4X3MA 3KJKA 2KTVA 4RHAA 4EB6A 1YJWF 1W5EA 4O2AB 1JFFB 3S0HA 4YJ3A 1Q7YH 3SIUA 1VHAA 1QVFF 1K8AH 4TUYA 5GANK 3NMUC 4YJ3B 3IR9A 4ZOLA 1W581 3JAWA 4X1KA 1QU9A 3N2KB 5BMVB 1QVGF 5HY2A 4DRXA 2GZLA 2UYPA 3K2XA 5BMVA 3JATA 3IKFA 1T0AA 5MN5A 4BT6A 3CCRF 1NJIH 1SA0A 4E6EA 1K9MH 3VYTC 4BT5A 5FJ4C 2OTLF 3S0WA 4BVRA 4TV8A 3RYHA 3R0PA 2QEXF 3ZO8A 3CC7F 3VOBA 3KE1A 3T80A 3OBYA 4X20B 3P0ZA 3QUWA 1K73H 2IG8A 3S02A 2K1SA 4KWEA 2UYKA 5KMGA 3CB2A 3WGJA 1JFFA 1QAHA 3M1XA 1X52A 2V9YA 3D01A 4BVQA 1XRGA 3AGKA 3B6NA 5LA6A 2CHTA 3HWUA 3V3TA 1FNKA 2CVLA 5EO3A 2H8CA 1VQOF 1YJNF 4X1KB 1CLIA 4U3JB 4LNUA 1JY8A 2VAMA 4ZHYB 4ZI7B 3CMEF 1W42A 3U0OA 3SIVA 1Q8RA 4M8IA 1DBFA 3QTYA 3KJJA 1X25A 3FBAA 5EIBD 4F6RB 2OTJF 1J7HA 5LOVB 5EWRA 3RYHB 5FNVA 3CCQF 3JARB 4X20A 1U43A 1JN1A 5GINC 5J2UA 1W59A 3HKDB 3OONA 3HKCA 1SDSA 2YXZA 3IEQA 3K14A 4O4LA 3LYBA 2HS3A 3CYQA 5GONB 4O4LB 1GZ0A 3N2KA 5IYZB 5LA6B 3I7TA 2B33A 4YJ2A 4ZHQB 3CCLF 5C8YA 2QI2A 4BVTA 5C8YB 1SA0B 4TV9B 5HXUA 2LBWA 1VQ9F 2HVYD 3N4YA 4U3JA 3RYIB 3ZP7A 4O4JA 2RHHA 5HP8A 2L26A 4ZI7A 1W3EX 3RYIA 2JNBA 3WGKA 5KX5B 3WJPA 4X3LA 5LP6C 3N2GA 2BTQB 2RHLA 4B45A 2KGWA 3M84A 1YI2F 3V4DA 1ONIA 4ZHVA 3UT5B 2CW4A 1VK3A 5JH7B 2VAPA 4C4WC 5EAZA 5GIPC 3J7AR 1CN7A 2QA4F 5IYZA 3E22B 3L7QA 3V7QA 4R40B 1YHQF 3ELCA 2CSLA 2YYEA 5ITZA 5LP6A 3G6EF 1VQ8F 3IMPA 4LCKA 2PMPA 3HTNA 4I4TA 1ODEA 2Q1XA 1COMA 4O4IA 4NQ3A 3LWQC 1N8RH 3WXMB 4ZK7A 1FSZA 1Z5WA 1JD1A 3D54A 3HKBA 4IIJA 4TV8B 2PHNA 1VQLF 4BW0B 2BTOA 3WGMA 3C9TA 3IEWA 4ZHWA 5JQGA 3N2GB 2RHJA 3MQWA 2VAWA 4HNAA 2HRYA 3Q8HA 3HKCB 2P6YA 2R6R1 1RLGA 4BT3A 3LDTA 3FD6A 2KG4A 5HXZA 3HAXD 1RLUA 3KHNA 3P4EA 3G4SF 5JCOC 2BO1A 3WJQA 4G4VA 5FLXM 3ZP4A 4X1YA 5CA1A 3VMFB 4I4TB 4C82A 1S72F 1QD9A 5LYJA 1W5AA 4C8EA 5HP7A 1RQ7A 2ZAUA 1XHOA 2IQQA 3MCAB 1YQNA 3NK7A 2QTPA 1KNKA 3VO8A 5B8FA 4BT7A 2AIZP 3GTZA 2LBTA 4B62A 3RE3A 1JJ2F 4NUTA 5EB0A 3M4SA 3CCSF 5IT9M 3NVKE 5FNVB 3CPWF 3JARA 1GO0A 4G4ZA 3CPQA 2LBXA 4O2BA 4ERHA 1KC8H 1T0KB 1IV2A 5KMGB 2HP0A 5EZYB 3K0TA 3MDOA 3IKEA 2Z1FA 2HS4A 3FFMA 3C9UA 4G88A 1VQ6F 1VH8A 3E20B 1DT9A 1XV2A 4WBNB 2Z1EA 4DXDA 1VQVA 4ZOLB 3S03A 2UZHA 3G71F 3WJRA 1ZWZA 3JASA 4TV9A 2CHSA 3BYQA 4I50B 2VXYA 4XCQA 3S0YA 1X7OA 3FD5A 2GVIA 2ZVZA 3NK6A 4EI7A 4C81A 2I6DA 4FFBB 5MN6A 1TUBA 1NQ3A 3ON1A 3CMAF 5HWEA 1RA4A 1VQ7F 1KNJA 2FC3A 2KTUA 3RYFB 1R1MA 2UYNB 2Z1UA 2Q1YA 1KD1H 1E7KA 5CB4B 2IAFA 1NMUB 5EYPB 4O2AA 1VQNF 2N48A 5CB4A 4RQOA 4WBNA 1W40A 4I55A 3CG6A 5JVDB 4I55B 3ESJA 3LFOA 2ALEA 3JATB 5ITZB 5LP6B 4LNUB 1W57A 3C9SA 2CWJA 1U40A 1W55A 5DCVA 3QHDA 1W5BA 2AIFA 3VCZA 2HRUA 2FGYA 5IJ9A 3WGLA 3CD6F 2F9ZC 1X7PA 3O85A 1YGYA 4O2BB 1TVKB 2HQSC 4EB6B 4EI9A 4BT4A 3VOAA 1KQSF 3JVHA 4TZZA 3LWPC 3RA5A 3RYFA 3JAMM 4X1IB 2UYJA 5A2QM 1VQ4F 3CYPB 3E22A 1W41A 4BT2A 3CCVF 3F0GA 3C9RA 2R751 3P10A 3CCMF 4I50A 2ZODA 3GYQA 3VIUA 3CCUF 3VTIC 5GIOC 4G4WA 2CZWA 3FPIA 2HX0A 3K12A 3WPXA 5GAPK 1OFUA 5MN4A 1FNJA 3HKBB 3RA6A 4BVSA 1Q82H
chains in the Genus database with same CATH topology
4EI8A 3FFMA 5HY0A 1W2BF 1Q81H 1Q86H 3CCLF 1VQ6F 1M1KH 2QI2A 3CC4F 3E20B 1XBIA 5HY4A 4BVTA 1DT9A 3V7EA 4BY9D 5HXUA 2LBWA 1VQ9F 2HVYD 3N4YA 1PXWA 1VQ5F 3G71F 3CCEF 3I55F 3PLAC 1W3EX 5G4UC 3PAFA 2JNBA 4X3MA 2KTVA 1ZWZA 1YJWF 2VGMA 1YJ9F 4X3LA 1CK2A 4XCQA 1Q7YH 1YIJF 3CXCF 1X7OA 1QVFF 3SIUA 1K8AH 5GANK 3NMUC 3IR9A 3NK6A 1YI2F 4EI7A 2I6DA 1QVGF 5HY2A 3LWRC 4C4WC 1H7MA 5GIPC 3J7AR 3CMAF 3ON1A 2QA4F 5HWEA 1RA4A 1VQ7F 1YITF 1CN7A 2FC3A 3J80M 1NJIH 2KTUA 3CCRF 2WALA 3V7QA 1YHQF 1KD1H 1E7KA 2VGNA 1K9MH 5FJ4C 1NMUB 3G6EF 1VQ8F 2OTLF 1VQNF 3HJWC 4LCKA 4BVRA 1W40A 3CG6A 2QEXF 3CC7F 3OBYA 1VQKF 3LFOA 4NQ3A 2ALEA 3LWQC 3WXMB 1K73H 1N8RH 3VI6A 3JCMM 1IPAA 5DCVA 2AIFA 2GLZA 4BW0B 1VQLF 1X52A 3I56F 4BVQA 3LWVC 3AGKA 3V3TA 2FGYA 5EO3A 3LWOC 2F9ZC 1X7PA 3CD6F 3NVIB 3O85A 3CCJF 1RLGA 3OW2F 1VQOF 1YJNF 2KG4A 5HXZA 5G4VC 3HAXD 1M90H 3G4SF 2BO1A 3J81M 4EI9A 5FLXM 1KQSF 3D00A 2OZBA 3CMEF 4TZZA 1W42A 3LWPC 3E1YA 3RA5A 3VMFB 3JAMM 3SIVA 1VQMF 1S72F 3N4ZA 5A2QM 1VQPF 1VQ4F 2OTJF 1W41A 2OHWA 5EWRA 3MCAB 3NK7A 3CCQF 3CCVF 5GINC 3CCMF 3GYQA 1JJ2F 4NUTA 3CCSF 5GIOC 3CCUF 1GO1A 1SDSA 5IT9M 3NVKE 3CPWF 3OBWA 2CZWA 1GO0A 3CC2F 3CPQA 2LBXA 5GAPK 1KC8H 1T0KB 5HY1A 1GZ0A 3RA6A 4BVSA 1Q82H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FFM A;  1W2B F;  1Q81 H;  1Q86 H;  3CCL F;  1VQ6 F;  1M1K H;  2QI2 A;  3CC4 F;  3E20 B;  1XBI A;  1DT9 A;  3V7E A;  4BY9 D;  2LBW A;  1VQ9 F;  2HVY D;  3N4Y A;  1PXW A;  1VQ5 F;  3G71 F;  3CCE F;  3I55 F;  3PLA C;  1W3E X;  5G4U C;  3PAF A;  2JNB A;  4X3M A;  2KTV A;  1ZWZ A;  1YJW F;  2VGM A;  1YJ9 F;  4X3L A;  1CK2 A;  1Q7Y H;  1YIJ F;  3CXC F;  1X7O A;  1QVF F;  3SIU A;  1K8A H;  5GAN K;  3NMU C;  3IR9 A;  3NK6 A;  1YI2 F;  2I6D A;  1QVG F;  3LWR C;  4C4W C;  1H7M A;  5GIP C;  3J7A R;  3CMA F;  3ON1 A;  2QA4 F;  1VQ7 F;  1RA4 A;  1CN7 A;  1YIT F;  2FC3 A;  3J80 M;  1NJI H;  2KTU A;  3CCR F;  2WAL A;  3V7Q A;  1YHQ F;  1KD1 H;  1E7K A;  2VGN A;  1K9M H;  5FJ4 C;  1NMU B;  3G6E F;  1VQ8 F;  2OTL F;  1VQN F;  3HJW C;  4LCK A;  1W40 A;  3CG6 A;  2QEX F;  3CC7 F;  3OBY A;  1VQK F;  3LFO A;  2ALE A;  3LWQ C;  3WXM B;  1K73 H;  1N8R H;  3VI6 A;  3JCM M;  1IPA A;  5DCV A;  2AIF A;  1VQL F;  4BW0 B;  1X52 A;  3I56 F;  3LWV C;  3AGK A;  5EO3 A;  3LWO C;  3CD6 F;  1X7P A;  3NVI B;  3O85 A;  3CCJ F;  1RLG A;  3OW2 F;  1VQO F;  1YJN F;  2KG4 A;  5G4V C;  3HAX D;  1M90 H;  3G4S F;  2BO1 A;  3J81 M;  5FLX M;  1KQS F;  2OZB A;  3CME F;  4TZZ A;  1W42 A;  3LWP C;  3E1Y A;  3RA5 A;  3VMF B;  3JAM M;  3SIV A;  1VQM F;  1S72 F;  3N4Z A;  5A2Q M;  1VQP F;  1VQ4 F;  2OTJ F;  1W41 A;  2OHW A;  5EWR A;  3MCA B;  3NK7 A;  3CCQ F;  3CCV F;  5GIN C;  3CCM F;  3GYQ A;  1JJ2 F;  4NUT A;  3CCS F;  5GIO C;  3CCU F;  1GO1 A;  1SDS A;  5IT9 M;  3NVK E;  3CPW F;  3OBW A;  2CZW A;  1GO0 A;  3CC2 F;  3CPQ A;  2LBX A;  5GAP K;  1KC8 H;  1T0K B;  1GZ0 A;  3RA6 A;  1Q82 H; 
#chains in the Genus database with same CATH topology
 1IV1 A;  3RYC A;  5CA0 B;  4G4X A;  5HY0 A;  1Q81 H;  5EB1 B;  1Q86 H;  2ZOV A;  1TVK A;  3CC4 F;  3HKD A;  1XBI A;  3MCQ A;  5AVM A;  3TD3 A;  5JCO A;  2UYN A;  3V7E A;  1PF5 A;  3C8L A;  1PXW A;  2Z01 A;  1H48 A;  5EIB C;  5J2T A;  5GON A;  2H8E A;  3PAF A;  5J2T B;  2HP3 A;  4X1I A;  2VGM A;  4YJ2 B;  4C8G A;  1YJ9 F;  4DRX B;  1CK2 A;  2RB9 A;  3KIZ A;  1YIJ F;  3CXC F;  3ZOP A;  3F0D A;  3TD4 A;  3DDN A;  4ZHQ A;  4O4I B;  4G4Y A;  1RQ2 A;  4IHJ B;  2OTM A;  3GHZ A;  1IV4 A;  3DC2 A;  4O4J B;  1H7M A;  2DYY A;  2NMU A;  4IIJ B;  3LWR C;  5KX5 A;  1YIT F;  3J80 M;  3LME A;  5LXT B;  2WAL A;  4FFB A;  2VGN A;  1U3P A;  1Z5V A;  3WPW A;  3HJW C;  2RHO A;  4HNA B;  3JAK A;  5CA0 A;  5IJ0 A;  2ZVY A;  4B5C A;  3F6M A;  1VQK F;  1UFY A;  5EYP A;  3VI6 A;  3JCM M;  4O4H B;  1IPA A;  4X1Y B;  2ZF8 A;  5CA1 B;  1FFX B;  2GLZ A;  2AMT A;  3I56 F;  3LWV C;  2LCA A;  4IHJ A;  2MQE A;  5LYJ B;  3NVI B;  3LWO C;  4PWT A;  1H47 A;  3CCJ F;  3OW2 F;  5G4V C;  3F0F A;  3VYU C;  4F6R A;  2G9I A;  1M90 H;  3J81 M;  2OZB A;  3D00 A;  3JAL A;  3E1Y A;  3JAK B;  5IJ0 B;  1VQM F;  3I3F A;  3N4Z A;  3UT5 A;  1U3L A;  1VQP F;  3TD5 A;  3S06 A;  2EWC A;  2H6L A;  4TUY B;  5JH7 A;  2OHW A;  2HP0 B;  5EZY A;  3EOR A;  3ERN A;  3MBM A;  2DT4 A;  1FFX A;  5JVD A;  3JAW B;  4O4H A;  2I6R A;  1GO1 A;  2Z1T A;  1GX1 A;  3OBW A;  3CC2 F;  2BTU A;  3F0E A;  3WGN A;  1UI9 A;  4NWO B;  5HY1 A;  4EI8 A;  1W2B F;  3JAS B;  4C8I A;  3HKE A;  1M1K H;  4B46 A;  2W8B C;  5HY4 A;  1OAP A;  1IV3 A;  3HKE B;  5LXT A;  3JAL B;  4U39 A;  4BY9 D;  2HS0 A;  5IJ9 B;  3RYC B;  1VQ5 F;  3VYS C;  1W5F A;  5LOV A;  3CCE F;  5JQG B;  1SZQ A;  1TUB B;  3I55 F;  3PLA C;  5G4U C;  5J2U B;  4X3M A;  3KJK A;  2KTV A;  4RHA A;  4EB6 A;  1YJW F;  1W5E A;  4O2A B;  1JFF B;  3S0H A;  4YJ3 A;  1Q7Y H;  3SIU A;  1VHA A;  1QVF F;  1K8A H;  4TUY A;  5GAN K;  3NMU C;  4YJ3 B;  3IR9 A;  4ZOL A;  1W58 1;  3JAW A;  4X1K A;  1QU9 A;  3N2K B;  5BMV B;  1QVG F;  5HY2 A;  4DRX A;  2GZL A;  2UYP A;  3K2X A;  5BMV A;  3JAT A;  3IKF A;  1T0A A;  5MN5 A;  4BT6 A;  3CCR F;  1NJI H;  1SA0 A;  4E6E A;  1K9M H;  3VYT C;  4BT5 A;  5FJ4 C;  2OTL F;  3S0W A;  4BVR A;  4TV8 A;  3RYH A;  3R0P A;  2QEX F;  3ZO8 A;  3CC7 F;  3VOB A;  3KE1 A;  3T80 A;  3OBY A;  4X20 B;  3P0Z A;  3QUW A;  1K73 H;  2IG8 A;  3S02 A;  2K1S A;  4KWE A;  2UYK A;  5KMG A;  3CB2 A;  3WGJ A;  1JFF A;  1QAH A;  3M1X A;  1X52 A;  2V9Y A;  3D01 A;  4BVQ A;  1XRG A;  3AGK A;  3B6N A;  5LA6 A;  2CHT A;  3HWU A;  3V3T A;  1FNK A;  2CVL A;  5EO3 A;  2H8C A;  1VQO F;  1YJN F;  4X1K B;  1CLI A;  4U3J B;  4LNU A;  1JY8 A;  2VAM A;  4ZHY B;  4ZI7 B;  3CME F;  1W42 A;  3U0O A;  3SIV A;  1Q8R A;  4M8I A;  1DBF A;  3QTY A;  3KJJ A;  1X25 A;  3FBA A;  5EIB D;  4F6R B;  2OTJ F;  1J7H A;  5LOV B;  5EWR A;  3RYH B;  5FNV A;  3CCQ F;  3JAR B;  4X20 A;  1U43 A;  1JN1 A;  5GIN C;  5J2U A;  1W59 A;  3HKD B;  3OON A;  3HKC A;  1SDS A;  2YXZ A;  3IEQ A;  3K14 A;  4O4L A;  3LYB A;  2HS3 A;  3CYQ A;  5GON B;  4O4L B;  1GZ0 A;  3N2K A;  5IYZ B;  5LA6 B;  3I7T A;  2B33 A;  4YJ2 A;  4ZHQ B;  3CCL F;  5C8Y A;  2QI2 A;  4BVT A;  5C8Y B;  1SA0 B;  4TV9 B;  5HXU A;  2LBW A;  1VQ9 F;  2HVY D;  3N4Y A;  4U3J A;  3RYI B;  3ZP7 A;  4O4J A;  2RHH A;  5HP8 A;  2L26 A;  4ZI7 A;  1W3E X;  3RYI A;  2JNB A;  3WGK A;  5KX5 B;  3WJP A;  4X3L A;  5LP6 C;  3N2G A;  2BTQ B;  2RHL A;  4B45 A;  2KGW A;  3M84 A;  1YI2 F;  3V4D A;  1ONI A;  4ZHV A;  3UT5 B;  2CW4 A;  1VK3 A;  5JH7 B;  2VAP A;  4C4W C;  5EAZ A;  5GIP C;  3J7A R;  1CN7 A;  2QA4 F;  5IYZ A;  3E22 B;  3L7Q A;  3V7Q A;  4R40 B;  1YHQ F;  3ELC A;  2CSL A;  2YYE A;  5ITZ A;  5LP6 A;  3G6E F;  1VQ8 F;  3IMP A;  4LCK A;  2PMP A;  3HTN A;  4I4T A;  1ODE A;  2Q1X A;  1COM A;  4O4I A;  4NQ3 A;  3LWQ C;  1N8R H;  3WXM B;  4ZK7 A;  1FSZ A;  1Z5W A;  1JD1 A;  3D54 A;  3HKB A;  4IIJ A;  4TV8 B;  2PHN A;  1VQL F;  4BW0 B;  2BTO A;  3WGM A;  3C9T A;  3IEW A;  4ZHW A;  5JQG A;  3N2G B;  2RHJ A;  3MQW A;  2VAW A;  4HNA A;  2HRY A;  3Q8H A;  3HKC B;  2P6Y A;  2R6R 1;  1RLG A;  4BT3 A;  3LDT A;  3FD6 A;  2KG4 A;  5HXZ A;  3HAX D;  1RLU A;  3KHN A;  3P4E A;  3G4S F;  5JCO C;  2BO1 A;  3WJQ A;  4G4V A;  5FLX M;  3ZP4 A;  4X1Y A;  5CA1 A;  3VMF B;  4I4T B;  4C82 A;  1S72 F;  1QD9 A;  5LYJ A;  1W5A A;  4C8E A;  5HP7 A;  1RQ7 A;  2ZAU A;  1XHO A;  2IQQ A;  3MCA B;  1YQN A;  3NK7 A;  2QTP A;  1KNK A;  3VO8 A;  5B8F A;  4BT7 A;  2AIZ P;  3GTZ A;  2LBT A;  4B62 A;  3RE3 A;  1JJ2 F;  4NUT A;  5EB0 A;  3M4S A;  3CCS F;  5IT9 M;  3NVK E;  5FNV B;  3CPW F;  3JAR A;  1GO0 A;  4G4Z A;  3CPQ A;  2LBX A;  4O2B A;  4ERH A;  1KC8 H;  1T0K B;  1IV2 A;  5KMG B;  2HP0 A;  5EZY B;  3K0T A;  3MDO A;  3IKE A;  2Z1F A;  2HS4 A;  3FFM A;  3C9U A;  4G88 A;  1VQ6 F;  1VH8 A;  3E20 B;  1DT9 A;  1XV2 A;  4WBN B;  2Z1E A;  4DXD A;  1VQV A;  4ZOL B;  3S03 A;  2UZH A;  3G71 F;  3WJR A;  1ZWZ A;  3JAS A;  4TV9 A;  2CHS A;  3BYQ A;  4I50 B;  2VXY A;  4XCQ A;  3S0Y A;  1X7O A;  3FD5 A;  2GVI A;  2ZVZ A;  3NK6 A;  4EI7 A;  4C81 A;  2I6D A;  4FFB B;  5MN6 A;  1TUB A;  1NQ3 A;  3ON1 A;  3CMA F;  5HWE A;  1RA4 A;  1VQ7 F;  1KNJ A;  2FC3 A;  2KTU A;  3RYF B;  1R1M A;  2UYN B;  2Z1U A;  2Q1Y A;  1KD1 H;  1E7K A;  5CB4 B;  2IAF A;  1NMU B;  5EYP B;  4O2A A;  1VQN F;  2N48 A;  5CB4 A;  4RQO A;  4WBN A;  1W40 A;  4I55 A;  3CG6 A;  5JVD B;  4I55 B;  3ESJ A;  3LFO A;  2ALE A;  3JAT B;  5ITZ B;  5LP6 B;  4LNU B;  1W57 A;  3C9S A;  2CWJ A;  1U40 A;  1W55 A;  5DCV A;  3QHD A;  1W5B A;  2AIF A;  3VCZ A;  2HRU A;  2FGY A;  5IJ9 A;  3WGL A;  3CD6 F;  2F9Z C;  1X7P A;  3O85 A;  1YGY A;  4O2B B;  1TVK B;  2HQS C;  4EB6 B;  4EI9 A;  4BT4 A;  3VOA A;  1KQS F;  3JVH A;  4TZZ A;  3LWP C;  3RA5 A;  3RYF A;  3JAM M;  4X1I B;  2UYJ A;  5A2Q M;  1VQ4 F;  3CYP B;  3E22 A;  1W41 A;  4BT2 A;  3CCV F;  3F0G A;  3C9R A;  2R75 1;  3P10 A;  3CCM F;  4I50 A;  2ZOD A;  3GYQ A;  3VIU A;  3CCU F;  3VTI C;  5GIO C;  4G4W A;  2CZW A;  3FPI A;  2HX0 A;  3K12 A;  3WPX A;  5GAP K;  1OFU A;  5MN4 A;  1FNJ A;  3HKB B;  3RA6 A;  4BVS A;  1Q82 H; 
#chains in the Genus database with same CATH homology
 4EI8 A;  3FFM A;  5HY0 A;  1W2B F;  1Q81 H;  1Q86 H;  3CCL F;  1VQ6 F;  1M1K H;  2QI2 A;  3CC4 F;  3E20 B;  1XBI A;  5HY4 A;  4BVT A;  1DT9 A;  3V7E A;  4BY9 D;  5HXU A;  2LBW A;  1VQ9 F;  2HVY D;  3N4Y A;  1PXW A;  1VQ5 F;  3G71 F;  3CCE F;  3I55 F;  3PLA C;  1W3E X;  5G4U C;  3PAF A;  2JNB A;  4X3M A;  2KTV A;  1ZWZ A;  1YJW F;  2VGM A;  1YJ9 F;  4X3L A;  1CK2 A;  4XCQ A;  1Q7Y H;  1YIJ F;  3CXC F;  1X7O A;  1QVF F;  3SIU A;  1K8A H;  5GAN K;  3NMU C;  3IR9 A;  3NK6 A;  1YI2 F;  4EI7 A;  2I6D A;  1QVG F;  5HY2 A;  3LWR C;  4C4W C;  1H7M A;  5GIP C;  3J7A R;  3CMA F;  3ON1 A;  2QA4 F;  5HWE A;  1RA4 A;  1VQ7 F;  1YIT F;  1CN7 A;  2FC3 A;  3J80 M;  1NJI H;  2KTU A;  3CCR F;  2WAL A;  3V7Q A;  1YHQ F;  1KD1 H;  1E7K A;  2VGN A;  1K9M H;  5FJ4 C;  1NMU B;  3G6E F;  1VQ8 F;  2OTL F;  1VQN F;  3HJW C;  4LCK A;  4BVR A;  1W40 A;  3CG6 A;  2QEX F;  3CC7 F;  3OBY A;  1VQK F;  3LFO A;  4NQ3 A;  2ALE A;  3LWQ C;  3WXM B;  1K73 H;  1N8R H;  3VI6 A;  3JCM M;  1IPA A;  5DCV A;  2AIF A;  2GLZ A;  4BW0 B;  1VQL F;  1X52 A;  3I56 F;  4BVQ A;  3LWV C;  3AGK A;  3V3T A;  2FGY A;  5EO3 A;  3LWO C;  2F9Z C;  1X7P A;  3CD6 F;  3NVI B;  3O85 A;  3CCJ F;  1RLG A;  3OW2 F;  1VQO F;  1YJN F;  2KG4 A;  5HXZ A;  5G4V C;  3HAX D;  1M90 H;  3G4S F;  2BO1 A;  3J81 M;  4EI9 A;  5FLX M;  1KQS F;  3D00 A;  2OZB A;  3CME F;  4TZZ A;  1W42 A;  3LWP C;  3E1Y A;  3RA5 A;  3VMF B;  3JAM M;  3SIV A;  1VQM F;  1S72 F;  3N4Z A;  5A2Q M;  1VQP F;  1VQ4 F;  2OTJ F;  1W41 A;  2OHW A;  5EWR A;  3MCA B;  3NK7 A;  3CCQ F;  3CCV F;  5GIN C;  3CCM F;  3GYQ A;  1JJ2 F;  4NUT A;  3CCS F;  5GIO C;  3CCU F;  1GO1 A;  1SDS A;  5IT9 M;  3NVK E;  3CPW F;  3OBW A;  2CZW A;  1GO0 A;  3CC2 F;  3CPQ A;  2LBX A;  5GAP K;  1KC8 H;  1T0K B;  5HY1 A;  1GZ0 A;  3RA6 A;  4BVS A;  1Q82 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...