3SIUA

Structure of a hprp31-15.5k-u4atac 5' stem loop complex, monomeric form
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
ADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing/rna
molecule keywords NHP2-like protein 1
publication title Structural basis for the dual U4 and U4atac snRNA-binding specificity of spliceosomal protein hPrp31.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 125
sequence length 125
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3siuA00
1YJNF 3LWOC 3ON1A 3JAMM 1Q7YH 3AGKA 2WALA 1Q82H 1VQ8F 1VQLF 1X7PA 5GINC 1H7MA 2VGNA 2OTLF 4X3LA 1M1KH 1NMUB 2OTJF 4X3MA 1Q86H 1KQSF 3RA6A 4C4WC 3CC7F 1GZ0A 3J80M 3LWPC 1VQ6F 1CK2A 3OBWA 1RA4A 3E1YA 4NUTA 1VQ7F 4TZZA 3CXCF 3J7AR 3V7EA 1GO1A 5EO3A 1K9MH 3CG6A 5GIPC 3NK7A 3JCMM 5GAPK 2KTVA 3CPQA 3N4ZA 3CCEF 3CCJF 1S72F 5DCVA 3MCAB 3LFOA 3V7QA 5A2QM 1NJIH 1E7KA 2QA4F 1CN7A 3CMAF 1IPAA 3NK6A 1PXWA 1N8RH 1VQPF 4LCKA 3GYQA 3G4SF 1VQ4F 1QVFF 1YITF 1W3EX 2HVYD 1RLGA 1X52A 5G4UC 1YJWF 1Q81H 1KC8H 3CC2F 3CCUF 3O85A 2JNBA 2LBWA 3CCVF 3CCQF 2CZWA 3HAXD 4BW0B 1VQMF 3NVIB 3RA5A 3LWQC 2QEXF 1VQOF 3CC4F 3CCMF 3NMUC 3LWVC 5IT9M 3VMFB 3J81M 2QI2A 1W41A 5GANK 1VQ5F 2AIFA 3CCRF 2VGMA 3LWRC 3G6EF 3CD6F 3IR9A 3G71F 5G4VC 3PLAC 5EWRA 1VQNF 1T0KB 3N4YA 2KG4A 4BY9D 5FJ4C 1VQKF 3CCSF 3I55F 3CCLF 1W42A 1K8AH 1SDSA 2I6DA 2KTUA 5GIOC 3OW2F 1YJ9F 1YI2F 1KD1H 3NVKE 1GO0A 1YHQF 1XBIA 3E20B 1JJ2F 3SIUA 1ZWZA 3PAFA 3VI6A 1YIJF 2OZBA 3SIVA 1X7OA 1W40A 3CMEF 2LBXA 3I56F 3OBYA 2FC3A 2OHWA 5FLXM 1VQ9F 1DT9A 3WXMB 3FFMA 1K73H 3HJWC 1M90H 1QVGF 2BO1A 3CPWF 2ALEA 1W2BF
chains in the Genus database with same CATH superfamily
4ZOLA 3LWOC 3RYFB 5HP7A 5MN5A 1VQ8F 3B6NA 3N2KA 1X7PA 3C9SA 4IIJA 1W5EA 5GINC 3ZP7A 3RYIA 3E22B 4O2AB 1TUBA 3ERNA 3CYQA 2OTJF 2ZOVA 1XV2A 2Z1EA 3HKDB 3LDTA 2RHLA 3JATB 1GZ0A 4X20A 3LWPC 3WGNA 3HKEB 1CK2A 3OBWA 4LNUA 4HNAA 5JH7A 1GO1A 2N48A 4U3JB 3S0YA 2DT4A 2HP0B 5GIPC 4FFBB 2KTVA 3N4ZA 3CCEF 3FBAA 3MQWA 3S03A 5A2QM 1NJIH 2CW4A 1H47A 4O4IA 3CMAF 5EAZA 5C8YB 1VQPF 4ZOLB 1QVFF 3N2GA 1X52A 1YJWF 2IG8A 4WBNA 1Z5WA 1KC8H 3N2KB 3GHZA 2MQEA 4IIJB 5FNVA 3WGJA 3RYIB 5BMVA 4DRXA 3O85A 4BT2A 2ZAUA 5MN6A 2R751 4BT6A 3LWQC 2QEXF 4X20B 4LNUB 3NMUC 3F0GA 3LWVC 1JD1A 1QAHA 4HNAB 5JH7B 1W41A 5IT9M 4TV8A 2AIFA 2CHTA 2VGMA 3CCRF 2NMUA 1W55A 2I6RA 2EWCA 3IR9A 5G4VC 3G71F 4ZHVA 3VYSC 4I55A 3WJPA 4BT5A 1YGYA 5GONA 1W5FA 3RYCA 1VQKF 1JFFA 2BTQB 3Q8HA 2RHOA 3K0TA 1X25A 1W42A 3KJKA 2VAWA 5EB1B 2HQSC 1ODEA 3KE1A 2QTPA 4RHAA 4ZK7A 3N2GB 1YHQF 4X1KA 1XBIA 3E20B 4WBNB 3K12A 4E6EA 1X7OA 4YJ2A 3TD4A 5BMVB 4DRXB 2ZF8A 3L7QA 1K73H 1Q8RA 1M90H 1QVGF 3MCQA 4O2AA 3CPWF 2ALEA 2Q1YA 3QTYA 4YJ3A 4G4VA 4C8IA 2HS0A 4ZHWA 3AGKA 4TUYA 3QHDA 1H48A 5GONB 1Q86H 2DYYA 3M84A 4U3JA 1JFFB 2HP0A 2CWJA 4FFBA 3VYUC 2AIZP 1OAPA 4C4WC 3S02A 4U39A 1RA4A 3IEWA 2RB9A 3E1YA 4B5CA 2Z1TA 4BVTA 4X1KB 5EO3A 2PMPA 1K9MH 3D01A 4YJ2B 5LA6A 1OFUA 3T80A 3CG6A 3JCMM 4KWEA 3CCJF 5HWEA 3MCAB 2LCAA 4TV9A 2ZVZA 1E7KA 2QA4F 4NQ3A 2H8CA 3FD5A 1U3LA 4LCKA 3I3FA 3JAKA 5JCOC 4X1YA 2H8EA 4YJ3B 1YITF 2VAMA 5G4UC 2HX0A 4R40B 4TUYB 1U43A 4I50B 4BVSA 1Q81H 1W5BA 2Z1UA 2LBWA 3CCVF 1FNKA 3JALB 2CZWA 3WGKA 2HRUA 3RA5A 1QU9A 3OONA 5JCOA 1VH8A 5CB4B 3CC4F 1IV2A 3F6MA 2ZODA 3UT5A 3TD5A 2P6YA 2QI2A 3S0HA 3HKCB 3S0WA 1KNKA 4O2BA 3P4EA 4EB6A 5LA6B 4ERHA 4BY9D 1W59A 3V4DA 4TV9B 3CCLF 2W8BC 4BT7A 3S06A 3JAKB 3DDNA 3NVKE 5HY4A 4X1YB 5JVDA 5LYJA 3D00A 1SZQA 5IJ9A 3PAFA 1RQ2A 1W40A 5HP8A 2LBXA 1COMA 5B8FA 5FLXM 3CB2A 1VQVA 3HJWC 3ELCA 4G4WA 2VAPA 3HTNA 3F0DA 5CA1A 3JASA 5ITZB 3KJJA 2UYJA 1YJNF 4BT4A 5KX5A 3UT5B 3GTZA 2H6LA 2GLZA 2UYKA 3VO8A 2WALA 1Q82H 4O2BB 4EB6B 1H7MA 3C9UA 3CYPB 4O4JA 3M4SA 1KNJA 2OTLF 2Z01A 5LP6C 1KQSF 3RYHA 3CC7F 3JVHA 5IYZB 4BVQA 4NUTA 2G9IA 5JVDB 4TZZA 3WJRA 3CXCF 3VIUA 2V9YA 5LYJB 3K2XA 5IJ9B 2AMTA 2IAFA 4PWTA 5GAPK 1W57A 2L26A 3CPQA 5LP6A 5DCVA 4ZI7A 4I50A 3LFOA 1FSZA 1CN7A 5KMGB 5CA1B 1IPAA 3JALA 3JASB 4NWOB 1PXWA 1N8RH 2Q1XA 3P0ZA 1VQ4F 3RE3A 5KX5B 4O4HB 3R0PA 3C9TA 5CB4A 3LYBA 5EIBD 3VYTC 2CHSA 2R6R1 3CCUF 4O4JB 1J7HA 3HKCA 2KGWA 1NQ3A 2JNBA 3CCQF 5AVMA 4BW0B 3NVIB 1T0AA 1PF5A 3I7TA 3RYHB 3KHNA 1JY8A 3WGMA 3WJQA 3C8LA 1VQOF 3CCMF 5GANK 2RHHA 3ESJA 5J2TA 3LWRC 3G6EF 1SA0B 2ZVYA 2BTOA 1W581 4O4LB 4BVRA 3MBMA 3N4YA 5LP6B 4ZI7B 2HS3A 1IV3A 1CLIA 5HXZA 3C9RA 3CCSF 3I55F 2Z1FA 3VOAA 4B45A 1XHOA 1U3PA 1Z5VA 3IEQA 2VXYA 4I4TA 1YI2F 4F6RA 1GO0A 3ZOPA 3SIUA 1U40A 5ITZA 5EZYA 4C82A 3VI6A 3SIVA 2OZBA 4C81A 3HWUA 3HKBA 3IKEA 3JAWA 3VTIC 3OBYA 1IV1A 2FC3A 2OHWA 1DT9A 3WXMB 1UI9A 3V3TA 5HY1A 2IQQA 3JARA 1JN1A 4XCQA 1R1MA 5LOVB 1XRGA 1W2BF 1DBFA 3ON1A 5EYPA 3MDOA 5J2TB 2YYEA 5IYZA 3JAMM 1RLUA 1Q7YH 3TD3A 1VQLF 3ZP4A 5EB0A 1TVKB 2OTMA 1RQ7A 2VGNA 1FFXB 5CA0B 3F0EA 4X3LA 1M1KH 1NMUB 4B62A 4X3MA 2PHNA 3IMPA 3WGLA 3RA6A 1ONIA 1VK3A 5JQGA 3J80M 1VQ6F 2HP3A 2YXZA 3IKFA 2UYNA 3VOBA 1VQ7F 4RQOA 2LBTA 4I4TB 5EIBC 2CSLA 4F6RB 5KMGA 5IJ0A 3J7AR 3V7EA 1TUBB 5EZYB 3BYQA 2GVIA 4O4HA 1QD9A 3HKBB 3JAWB 3ZO8A 3NK7A 4G4ZA 1FNJA 1S72F 3V7QA 2K1SA 4M8IA 3JARB 4X1IA 3WPXA 3NK6A 3GYQA 1W5AA 3G4SF 5LXTA 3D54A 4G88A 1W3EX 2HVYD 5EYPB 4IHJA 1RLGA 3CC2F 3K14A 5J2UA 3KIZA 1VHAA 1UFYA 4ZHQA 1SA0A 2CVLA 3DC2A 4O4IB 3QUWA 3VCZA 3HAXD 3WPWA 1VQMF 4O4LA 5JQGB 2FGYA 2UYNB 3RYFA 3J81M 3VMFB 1VQ5F 5FNVB 3FD6A 5IJ0B 3CD6F 4B46A 2B33A 4DXDA 5MN4A 3PLAC 5EWRA 3E22A 3M1XA 4ZHYB 4G4YA 4C8GA 5HY2A 1VQNF 1T0KB 2KG4A 5FJ4C 3U0OA 5HXUA 5HY0A 4G4XA 2HS4A 2UZHA 3HKDA 3JATA 4TV8B 1K8AH 2HRYA 3EORA 4X1IB 1SDSA 2I6DA 3FPIA 3HKEA 3F0FA 2KTUA 5GIOC 5LXTB 3OW2F 1YJ9F 1KD1H 4I55B 4IHJB 1JJ2F 4C8EA 5LOVA 4EI8A 3P10A 1ZWZA 2GZLA 2UYPA 1IV4A 1YIJF 2F9ZC 3RYCB 3CMEF 5J2UB 3I56F 1YQNA 4EI9A 4ZHQB 1VQ9F 4EI7A 3FFMA 1TVKA 2BTUA 3LMEA 1GX1A 4BT3A 5CA0A 1FFXA 2BO1A 2RHJA 5C8YA
chains in the Genus database with same CATH topology
1YJNF 3LWOC 3ON1A 2GLZA 3JAMM 1Q7YH 3AGKA 2WALA 1Q82H 1VQ8F 1VQLF 1X7PA 5GINC 1H7MA 2VGNA 2OTLF 4X3LA 1M1KH 1NMUB 2OTJF 4X3MA 1Q86H 1KQSF 3RA6A 4C4WC 3CC7F 1GZ0A 3J80M 3LWPC 1VQ6F 1CK2A 3OBWA 1RA4A 4BVQA 3E1YA 4NUTA 1VQ7F 4TZZA 3CXCF 4BVTA 3J7AR 3V7EA 1GO1A 5EO3A 1K9MH 3CG6A 5GIPC 3NK7A 3JCMM 5GAPK 2KTVA 3CPQA 3N4ZA 3CCEF 3CCJF 1S72F 5DCVA 5HWEA 3MCAB 3LFOA 3V7QA 5A2QM 1NJIH 1E7KA 2QA4F 1CN7A 4NQ3A 3CMAF 1IPAA 3NK6A 1PXWA 1N8RH 1VQPF 4LCKA 3GYQA 3G4SF 1VQ4F 1QVFF 1YITF 1W3EX 2HVYD 1RLGA 1X52A 5G4UC 1YJWF 1Q81H 4BVSA 1KC8H 3CC2F 3CCUF 3O85A 2JNBA 2LBWA 3CCVF 3CCQF 2CZWA 3HAXD 4BW0B 1VQMF 3NVIB 3RA5A 3LWQC 2QEXF 1VQOF 3CC4F 2FGYA 3CCMF 3NMUC 3LWVC 5IT9M 3VMFB 3J81M 1W41A 2QI2A 5GANK 1VQ5F 2AIFA 3CCRF 2VGMA 3LWRC 3G6EF 3CD6F 3IR9A 3G71F 5G4VC 3PLAC 4BVRA 5EWRA 1VQNF 5HY2A 1T0KB 3N4YA 2KG4A 4BY9D 5FJ4C 5HXUA 1VQKF 5HXZA 5HY0A 3CCSF 3I55F 3CCLF 1W42A 1K8AH 1SDSA 2I6DA 2KTUA 5HY4A 5GIOC 3OW2F 1YJ9F 1YI2F 1KD1H 3NVKE 1GO0A 1YHQF 3D00A 1XBIA 3E20B 1JJ2F 3SIUA 4EI8A 1ZWZA 3PAFA 3VI6A 1YIJF 2OZBA 3SIVA 2F9ZC 1X7OA 1W40A 3CMEF 2LBXA 3I56F 3OBYA 2FC3A 2OHWA 4EI9A 5FLXM 1VQ9F 1DT9A 3WXMB 3FFMA 3V3TA 4EI7A 1K73H 3HJWC 5HY1A 1M90H 1QVGF 2BO1A 3CPWF 4XCQA 2ALEA 1W2BF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN F;  3LWO C;  3ON1 A;  3JAM M;  1Q7Y H;  3AGK A;  2WAL A;  1Q82 H;  1VQ8 F;  1VQL F;  1X7P A;  5GIN C;  1H7M A;  2VGN A;  2OTL F;  4X3L A;  1M1K H;  1NMU B;  2OTJ F;  4X3M A;  1Q86 H;  1KQS F;  3RA6 A;  4C4W C;  3CC7 F;  1GZ0 A;  3J80 M;  3LWP C;  1VQ6 F;  1CK2 A;  3OBW A;  1RA4 A;  3E1Y A;  4NUT A;  1VQ7 F;  4TZZ A;  3CXC F;  3J7A R;  3V7E A;  1GO1 A;  5EO3 A;  1K9M H;  3CG6 A;  5GIP C;  3NK7 A;  3JCM M;  5GAP K;  2KTV A;  3CPQ A;  3N4Z A;  3CCE F;  3CCJ F;  1S72 F;  5DCV A;  3MCA B;  3LFO A;  3V7Q A;  5A2Q M;  1NJI H;  1E7K A;  2QA4 F;  1CN7 A;  3CMA F;  1IPA A;  3NK6 A;  1PXW A;  1N8R H;  1VQP F;  4LCK A;  3GYQ A;  3G4S F;  1VQ4 F;  1QVF F;  1YIT F;  1W3E X;  2HVY D;  1RLG A;  1X52 A;  5G4U C;  1YJW F;  1Q81 H;  1KC8 H;  3CC2 F;  3CCU F;  3O85 A;  2JNB A;  2LBW A;  3CCV F;  3CCQ F;  2CZW A;  3HAX D;  4BW0 B;  1VQM F;  3NVI B;  3RA5 A;  3LWQ C;  2QEX F;  1VQO F;  3CC4 F;  3CCM F;  3NMU C;  3LWV C;  5IT9 M;  3VMF B;  3J81 M;  2QI2 A;  1W41 A;  5GAN K;  1VQ5 F;  2AIF A;  3CCR F;  2VGM A;  3LWR C;  3G6E F;  3CD6 F;  3IR9 A;  3G71 F;  5G4V C;  3PLA C;  5EWR A;  1VQN F;  1T0K B;  3N4Y A;  2KG4 A;  4BY9 D;  5FJ4 C;  1VQK F;  3CCS F;  3I55 F;  3CCL F;  1W42 A;  1K8A H;  1SDS A;  2I6D A;  2KTU A;  5GIO C;  3OW2 F;  1YJ9 F;  1YI2 F;  1KD1 H;  3NVK E;  1GO0 A;  1YHQ F;  1XBI A;  3E20 B;  1JJ2 F;  3SIU A;  1ZWZ A;  3PAF A;  3VI6 A;  1YIJ F;  2OZB A;  3SIV A;  1X7O A;  1W40 A;  3CME F;  2LBX A;  3I56 F;  3OBY A;  2FC3 A;  2OHW A;  5FLX M;  1VQ9 F;  1DT9 A;  3WXM B;  3FFM A;  1K73 H;  3HJW C;  1M90 H;  1QVG F;  2BO1 A;  3CPW F;  2ALE A;  1W2B F; 
#chains in the Genus database with same CATH topology
 4ZOL A;  3LWO C;  3RYF B;  5HP7 A;  5MN5 A;  1VQ8 F;  3B6N A;  3N2K A;  1X7P A;  3C9S A;  4IIJ A;  1W5E A;  5GIN C;  3ZP7 A;  3RYI A;  3E22 B;  4O2A B;  1TUB A;  3ERN A;  3CYQ A;  2OTJ F;  2ZOV A;  1XV2 A;  2Z1E A;  3HKD B;  3LDT A;  2RHL A;  3JAT B;  1GZ0 A;  4X20 A;  3LWP C;  3WGN A;  3HKE B;  1CK2 A;  3OBW A;  4LNU A;  4HNA A;  5JH7 A;  1GO1 A;  2N48 A;  4U3J B;  3S0Y A;  2DT4 A;  2HP0 B;  5GIP C;  4FFB B;  2KTV A;  3N4Z A;  3CCE F;  3FBA A;  3MQW A;  3S03 A;  5A2Q M;  1NJI H;  2CW4 A;  1H47 A;  4O4I A;  3CMA F;  5EAZ A;  5C8Y B;  1VQP F;  4ZOL B;  1QVF F;  3N2G A;  1X52 A;  1YJW F;  2IG8 A;  4WBN A;  1Z5W A;  1KC8 H;  3N2K B;  3GHZ A;  2MQE A;  4IIJ B;  5FNV A;  3WGJ A;  3RYI B;  5BMV A;  4DRX A;  3O85 A;  4BT2 A;  2ZAU A;  5MN6 A;  2R75 1;  4BT6 A;  3LWQ C;  2QEX F;  4X20 B;  4LNU B;  3NMU C;  3F0G A;  3LWV C;  1JD1 A;  1QAH A;  4HNA B;  5JH7 B;  1W41 A;  5IT9 M;  4TV8 A;  2AIF A;  2CHT A;  2VGM A;  3CCR F;  2NMU A;  1W55 A;  2I6R A;  2EWC A;  3IR9 A;  5G4V C;  3G71 F;  4ZHV A;  3VYS C;  4I55 A;  3WJP A;  4BT5 A;  1YGY A;  5GON A;  1W5F A;  3RYC A;  1VQK F;  1JFF A;  2BTQ B;  3Q8H A;  2RHO A;  3K0T A;  1X25 A;  1W42 A;  3KJK A;  2VAW A;  5EB1 B;  2HQS C;  1ODE A;  3KE1 A;  2QTP A;  4RHA A;  4ZK7 A;  3N2G B;  1YHQ F;  4X1K A;  1XBI A;  3E20 B;  4WBN B;  3K12 A;  4E6E A;  1X7O A;  4YJ2 A;  3TD4 A;  5BMV B;  4DRX B;  2ZF8 A;  3L7Q A;  1K73 H;  1Q8R A;  1M90 H;  1QVG F;  3MCQ A;  4O2A A;  3CPW F;  2ALE A;  2Q1Y A;  3QTY A;  4YJ3 A;  4G4V A;  4C8I A;  2HS0 A;  4ZHW A;  3AGK A;  4TUY A;  3QHD A;  1H48 A;  5GON B;  1Q86 H;  2DYY A;  3M84 A;  4U3J A;  1JFF B;  2HP0 A;  2CWJ A;  4FFB A;  3VYU C;  2AIZ P;  1OAP A;  4C4W C;  3S02 A;  4U39 A;  1RA4 A;  3IEW A;  2RB9 A;  3E1Y A;  4B5C A;  2Z1T A;  4BVT A;  4X1K B;  5EO3 A;  2PMP A;  1K9M H;  3D01 A;  4YJ2 B;  5LA6 A;  1OFU A;  3T80 A;  3CG6 A;  3JCM M;  4KWE A;  3CCJ F;  5HWE A;  3MCA B;  2LCA A;  4TV9 A;  2ZVZ A;  1E7K A;  2QA4 F;  4NQ3 A;  2H8C A;  3FD5 A;  1U3L A;  4LCK A;  3I3F A;  3JAK A;  5JCO C;  4X1Y A;  2H8E A;  4YJ3 B;  1YIT F;  2VAM A;  5G4U C;  2HX0 A;  4R40 B;  4TUY B;  1U43 A;  4I50 B;  4BVS A;  1Q81 H;  1W5B A;  2Z1U A;  2LBW A;  3CCV F;  1FNK A;  3JAL B;  2CZW A;  3WGK A;  2HRU A;  3RA5 A;  1QU9 A;  3OON A;  5JCO A;  1VH8 A;  5CB4 B;  3CC4 F;  1IV2 A;  3F6M A;  2ZOD A;  3UT5 A;  3TD5 A;  2P6Y A;  2QI2 A;  3S0H A;  3HKC B;  3S0W A;  1KNK A;  4O2B A;  3P4E A;  4EB6 A;  5LA6 B;  4ERH A;  4BY9 D;  1W59 A;  3V4D A;  4TV9 B;  3CCL F;  2W8B C;  4BT7 A;  3S06 A;  3JAK B;  3DDN A;  3NVK E;  5HY4 A;  4X1Y B;  5JVD A;  5LYJ A;  3D00 A;  1SZQ A;  5IJ9 A;  3PAF A;  1RQ2 A;  1W40 A;  5HP8 A;  2LBX A;  1COM A;  5B8F A;  5FLX M;  3CB2 A;  1VQV A;  3HJW C;  3ELC A;  4G4W A;  2VAP A;  3HTN A;  3F0D A;  5CA1 A;  3JAS A;  5ITZ B;  3KJJ A;  2UYJ A;  1YJN F;  4BT4 A;  5KX5 A;  3UT5 B;  3GTZ A;  2H6L A;  2GLZ A;  2UYK A;  3VO8 A;  2WAL A;  1Q82 H;  4O2B B;  4EB6 B;  1H7M A;  3C9U A;  3CYP B;  4O4J A;  3M4S A;  1KNJ A;  2OTL F;  2Z01 A;  5LP6 C;  1KQS F;  3RYH A;  3CC7 F;  3JVH A;  5IYZ B;  4BVQ A;  4NUT A;  2G9I A;  5JVD B;  4TZZ A;  3WJR A;  3CXC F;  3VIU A;  2V9Y A;  5LYJ B;  3K2X A;  5IJ9 B;  2AMT A;  2IAF A;  4PWT A;  5GAP K;  1W57 A;  2L26 A;  3CPQ A;  5LP6 A;  5DCV A;  4ZI7 A;  4I50 A;  3LFO A;  1FSZ A;  1CN7 A;  5KMG B;  5CA1 B;  1IPA A;  3JAL A;  3JAS B;  4NWO B;  1PXW A;  1N8R H;  2Q1X A;  3P0Z A;  1VQ4 F;  3RE3 A;  5KX5 B;  4O4H B;  3R0P A;  3C9T A;  5CB4 A;  3LYB A;  5EIB D;  3VYT C;  2CHS A;  2R6R 1;  3CCU F;  4O4J B;  1J7H A;  3HKC A;  2KGW A;  1NQ3 A;  2JNB A;  3CCQ F;  5AVM A;  4BW0 B;  3NVI B;  1T0A A;  1PF5 A;  3I7T A;  3RYH B;  3KHN A;  1JY8 A;  3WGM A;  3WJQ A;  3C8L A;  1VQO F;  3CCM F;  5GAN K;  2RHH A;  3ESJ A;  5J2T A;  3LWR C;  3G6E F;  1SA0 B;  2ZVY A;  2BTO A;  1W58 1;  4O4L B;  4BVR A;  3MBM A;  3N4Y A;  5LP6 B;  4ZI7 B;  2HS3 A;  1IV3 A;  1CLI A;  5HXZ A;  3C9R A;  3CCS F;  3I55 F;  2Z1F A;  3VOA A;  4B45 A;  1XHO A;  1U3P A;  1Z5V A;  3IEQ A;  2VXY A;  4I4T A;  1YI2 F;  4F6R A;  1GO0 A;  3ZOP A;  3SIU A;  1U40 A;  5ITZ A;  5EZY A;  4C82 A;  3VI6 A;  3SIV A;  2OZB A;  4C81 A;  3HWU A;  3HKB A;  3IKE A;  3JAW A;  3VTI C;  3OBY A;  1IV1 A;  2FC3 A;  2OHW A;  1DT9 A;  3WXM B;  1UI9 A;  3V3T A;  5HY1 A;  2IQQ A;  3JAR A;  1JN1 A;  4XCQ A;  1R1M A;  5LOV B;  1XRG A;  1W2B F;  1DBF A;  3ON1 A;  5EYP A;  3MDO A;  5J2T B;  2YYE A;  5IYZ A;  3JAM M;  1RLU A;  1Q7Y H;  3TD3 A;  1VQL F;  3ZP4 A;  5EB0 A;  1TVK B;  2OTM A;  1RQ7 A;  2VGN A;  1FFX B;  5CA0 B;  3F0E A;  4X3L A;  1M1K H;  1NMU B;  4B62 A;  4X3M A;  2PHN A;  3IMP A;  3WGL A;  3RA6 A;  1ONI A;  1VK3 A;  5JQG A;  3J80 M;  1VQ6 F;  2HP3 A;  2YXZ A;  3IKF A;  2UYN A;  3VOB A;  1VQ7 F;  4RQO A;  2LBT A;  4I4T B;  5EIB C;  2CSL A;  4F6R B;  5KMG A;  5IJ0 A;  3J7A R;  3V7E A;  1TUB B;  5EZY B;  3BYQ A;  2GVI A;  4O4H A;  1QD9 A;  3HKB B;  3JAW B;  3ZO8 A;  3NK7 A;  4G4Z A;  1FNJ A;  1S72 F;  3V7Q A;  2K1S A;  4M8I A;  3JAR B;  4X1I A;  3WPX A;  3NK6 A;  3GYQ A;  1W5A A;  3G4S F;  5LXT A;  3D54 A;  4G88 A;  1W3E X;  2HVY D;  5EYP B;  4IHJ A;  1RLG A;  3CC2 F;  3K14 A;  5J2U A;  3KIZ A;  1VHA A;  1UFY A;  4ZHQ A;  1SA0 A;  2CVL A;  3DC2 A;  4O4I B;  3QUW A;  3VCZ A;  3HAX D;  3WPW A;  1VQM F;  4O4L A;  5JQG B;  2FGY A;  2UYN B;  3RYF A;  3J81 M;  3VMF B;  1VQ5 F;  5FNV B;  3FD6 A;  5IJ0 B;  3CD6 F;  4B46 A;  2B33 A;  4DXD A;  5MN4 A;  3PLA C;  5EWR A;  3E22 A;  3M1X A;  4ZHY B;  4G4Y A;  4C8G A;  5HY2 A;  1VQN F;  1T0K B;  2KG4 A;  5FJ4 C;  3U0O A;  5HXU A;  5HY0 A;  4G4X A;  2HS4 A;  2UZH A;  3HKD A;  3JAT A;  4TV8 B;  1K8A H;  2HRY A;  3EOR A;  4X1I B;  1SDS A;  2I6D A;  3FPI A;  3HKE A;  3F0F A;  2KTU A;  5GIO C;  5LXT B;  3OW2 F;  1YJ9 F;  1KD1 H;  4I55 B;  4IHJ B;  1JJ2 F;  4C8E A;  5LOV A;  4EI8 A;  3P10 A;  1ZWZ A;  2GZL A;  2UYP A;  1IV4 A;  1YIJ F;  2F9Z C;  3RYC B;  3CME F;  5J2U B;  3I56 F;  1YQN A;  4EI9 A;  4ZHQ B;  1VQ9 F;  4EI7 A;  3FFM A;  1TVK A;  2BTU A;  3LME A;  1GX1 A;  4BT3 A;  5CA0 A;  1FFX A;  2BO1 A;  2RHJ A;  5C8Y A; 
#chains in the Genus database with same CATH homology
 1YJN F;  3LWO C;  3ON1 A;  2GLZ A;  3JAM M;  1Q7Y H;  3AGK A;  2WAL A;  1Q82 H;  1VQ8 F;  1VQL F;  1X7P A;  5GIN C;  1H7M A;  2VGN A;  2OTL F;  4X3L A;  1M1K H;  1NMU B;  2OTJ F;  4X3M A;  1Q86 H;  1KQS F;  3RA6 A;  4C4W C;  3CC7 F;  1GZ0 A;  3J80 M;  3LWP C;  1VQ6 F;  1CK2 A;  3OBW A;  1RA4 A;  4BVQ A;  3E1Y A;  4NUT A;  1VQ7 F;  4TZZ A;  3CXC F;  4BVT A;  3J7A R;  3V7E A;  1GO1 A;  5EO3 A;  1K9M H;  3CG6 A;  5GIP C;  3NK7 A;  3JCM M;  5GAP K;  2KTV A;  3CPQ A;  3N4Z A;  3CCE F;  3CCJ F;  1S72 F;  5DCV A;  5HWE A;  3MCA B;  3LFO A;  3V7Q A;  5A2Q M;  1NJI H;  1E7K A;  2QA4 F;  1CN7 A;  4NQ3 A;  3CMA F;  1IPA A;  3NK6 A;  1PXW A;  1N8R H;  1VQP F;  4LCK A;  3GYQ A;  3G4S F;  1VQ4 F;  1QVF F;  1YIT F;  1W3E X;  2HVY D;  1RLG A;  1X52 A;  5G4U C;  1YJW F;  1Q81 H;  4BVS A;  1KC8 H;  3CC2 F;  3CCU F;  3O85 A;  2JNB A;  2LBW A;  3CCV F;  3CCQ F;  2CZW A;  3HAX D;  4BW0 B;  1VQM F;  3NVI B;  3RA5 A;  3LWQ C;  2QEX F;  1VQO F;  3CC4 F;  2FGY A;  3CCM F;  3NMU C;  3LWV C;  5IT9 M;  3VMF B;  3J81 M;  1W41 A;  2QI2 A;  5GAN K;  1VQ5 F;  2AIF A;  3CCR F;  2VGM A;  3LWR C;  3G6E F;  3CD6 F;  3IR9 A;  3G71 F;  5G4V C;  3PLA C;  4BVR A;  5EWR A;  1VQN F;  5HY2 A;  1T0K B;  3N4Y A;  2KG4 A;  4BY9 D;  5FJ4 C;  5HXU A;  1VQK F;  5HXZ A;  5HY0 A;  3CCS F;  3I55 F;  3CCL F;  1W42 A;  1K8A H;  1SDS A;  2I6D A;  2KTU A;  5HY4 A;  5GIO C;  3OW2 F;  1YJ9 F;  1YI2 F;  1KD1 H;  3NVK E;  1GO0 A;  1YHQ F;  3D00 A;  1XBI A;  3E20 B;  1JJ2 F;  3SIU A;  4EI8 A;  1ZWZ A;  3PAF A;  3VI6 A;  1YIJ F;  2OZB A;  3SIV A;  2F9Z C;  1X7O A;  1W40 A;  3CME F;  2LBX A;  3I56 F;  3OBY A;  2FC3 A;  2OHW A;  4EI9 A;  5FLX M;  1VQ9 F;  1DT9 A;  3WXM B;  3FFM A;  3V3T A;  4EI7 A;  1K73 H;  3HJW C;  5HY1 A;  1M90 H;  1QVG F;  2BO1 A;  3CPW F;  4XCQ A;  2ALE A;  1W2B F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...