2VGNA

Structure of yeast dom34 : a protein related to translation termination factor erf1 and involved in no-go decay.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
382
structure length
360
Chain Sequence
MKVISLKKDSFNKGGAVITLLPEDKEDLFTVYQIVDKDDELIFKKKFDLVKLKIKVISEDFDMKDEYLKYKGVTVTDESGASNVDIPVGKYLSFTLDYVYPFTIIKQNFNKFMQKLLNEACNIEYKSDTAAVVLQEGIAHVCLVTSSSTILKQKIEYDVLKFDEKTEKFYKAIYSAMKKDLNFDKLKTIILCSPGFYAKILMDKIFQYAEEEHNKKILDNKGMFFIAHCSTGYLQGINEVLKNPLYASKLQDTKYSKEIMVMDEFLLHLNKDDDKAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLTGIACILKYPLPDLDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Yeast Dom34: A Protein Related to Translation Termination Factor Erf1 and Involved in No-Go Decay.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
molecule keywords DOM34
total genus 90
structure length 360
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03463 eRF1_1 eRF1 domain 1
A PF03464 eRF1_2 eRF1 domain 2
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.870 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vgnA01
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2vgnA02
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2vgnA03
1YJWF 2VGNA 1Q81H 3HJWC 1W40A 4C4WC 1PXWA 5GIOC 4X3LA 3CCEF 1W3EX 3V7QA 1S72F 5FLXM 2HSTA 2OZBA 3HAXD 1YI2F 1W41A 3JCMM 3ON1A 1X52A 1SDSA 3GYQA 1W2BF 3CPQA 1VQKF 3CC7F 3CD6F 3O85A 2WALA 1KD1H 1DT9A 3LFOA 2FC3A 3CCRF 5EWRA 4X3MA 3CC4F 3CG6A 1K9MH 3CPWF 2AIFA 2KG4A 1VQOF 3CCUF 5GINC 2KTVA 3PAFA 1RLGA 3SIUA 5A2QM 1RA4A 5IT9M 2KTUA 2JNBA 3CCMF 2QEXF 1GO1A 1CK2A 1KC8H 1QVFF 3IR9A 3RA5A 3I55F 1YITF 1VQ7F 1NJIH 2BO1A 2OTLF 5GANK 2HVYD 1X7PA 3PLAC 5FJ4C 3OBYA 3WXMB 1VQMF 4LCKA 1CN7A 3J81M 5G4VC 3N4ZA 3CCJF 3OBWA 5GIPC 1VQ9F 3RA6A 1N8RH 4NUTA 2QI2A 1NMUB 3CCSF 3NVKE 5GAPK 3V7EA 1QVGF 1H7MA 3J80M 3LWRC 1Q7YH 1M1KH 1VQLF 1W42A 4BW0B 1YIJF 3MCAB 3SIVA 3NK7A 3CXCF 3CCLF 3LWOC 1M90H 2OTJF 1K8AH 3LWQC 4TZZA 3LWVC 3G71F 3G4SF 3OW2F 1VQ4F 2LBWA 1XBIA 1YJNF 1VQ5F 3NMUC 1Q82H 1VQPF 5DCVA 3AGKA 1VQ6F 3VMFB 1GZ0A 3E20B 1IPAA 1X7OA 3VI6A 2LBXA 2OHWA 3J7AR 3NVIB 1E7KA 3I56F 3JAMM 3G6EF 3CCVF 3N4YA 5G4UC 3NK6A 1T0KB 3CMAF 1YJ9F 3E1YA 1YHQF 2I6DA 4AF1A 3LWPC 1KQSF 3FFMA 3CC2F 1JJ2F 1Q86H 1VQNF 1K73H 1GO0A 2VGMA 1VQ8F 2ALEA 5EO3A 3CCQF 2QA4F 2CZWA 3CMEF 4BY9D 1ZWZA
chains in the Genus database with same CATH superfamily
1PD1A 4FL6A 5IT9O 3TAFA 4AHUA 3VEVA 1NBEB 4DOWA 3JB9G 4DR5K 1Q7YC 2DMOA 1K9MR 3ASMA 3U3YA 2QM1A 1W3EX 2F9ZC 4RTYA 4X1KB 3QHSA 2XKOC 1FX7A 1JRIA 2EQKA 3OB9A 4LN2A 3AHUA 1NLVA 4ZNXA 3EE8A 1RAGB 1BIUA 4E89A 2BZ8A 2HBLA 4LFBK 3ZP7A 5LOVB 2QGGA 2DO3A 3DOKA 3O6WA 2QXLA 3I55Q 2QKBA 5C0MA 4OMMA 4NLBA 3VQBA 4OP0A 1YJ9T 2K3XA 2PUOB 2K5FA 4MLEA 4BR4A 4DSLA 3M1FA 4LH4A 4CJ5A 3I0RA 3HFNA 3ZOPA 4C92F 1Q9YA 1K9MH 1M1KU 3DLEA 3Q7CA 1X01A 4HVJA 2PYLA 2NMUA 2DFFA 1QQMA 3NTHA 4ZK7A 1Y96A 4PJOC 1LAVA 1QCFA 3HKBA 2LCSA 4DFPA 4J8FA 1D1AA 4AG1C 2YSQA 1NGAA 2OPRA 2HS0A 4JLHA 3N2GB 3CFPA 3V4IA 4IUUA 1RT6A 1VQ8N 2CGHA 4JRKA 3RYHB 3E01A 3JAKB 2BE7D 4X1YA 3PLAC 3OBYA 4PL6A 1K8KB 4ILHA 4C8GA 1VQMA 4FT4A 4WQ5C 3V7CA 3VQEA 3HRSA 4G4XA 1OX8A 5FU6C 1YJ9Q 3CETA 3LPUA 1SHFA 4K43A 1IKXA 4PL8A 3CYQA 4FJMA 4YJ2A 1BIZA 2CYZB 2EYZA 3HYFA 3ATUA 1BI0A 3ZO8A 2E20A 3VS0A 3EE9A 3VYGA 4KB0A 3BYQA 1S9GA 3CFRA 4OGEA 1VQ7Q 1D4XA 4M7DG 4GW6A 3DDNA 5AQSA 3V7EA 4BREA 2BTQB 2Y90A 4IIOA 3OTOK 1QAHA 1VQKN 4O5FA 3H0FA 2AP1A 1NPPA 2G9IA 3LWRC 2KT8A 1VQLA 1Q18A 1M2VB 3IUCA 2F1LA 2OAWA 1NOZA 2PU9B 1NM1A 3OW2S 2RPIA 3VERA 3WPXA 3CCLF 2IDOA 4CBUA 1M90H 4JI7K 5KI6A 3HKBB 4FIBA 2W10A 1GFDA 1KTQA 3OW2F 1KQ1A 4CC3A 3KLEA 3K5NA 3M0UA 4F7UA 2ZWHA 3G10A 2RHLA 4IJNA 1Q82H 1IO6A 1VRUA 2MQEA 4AFZC 3AVBA 3MXIA 4FCYA 4F2SA 1WA7A 3E20B 2IG0A 4XEIA 2X3XD 3TTFA 1WQWA 1Y71A 4JD2B 3VS1A 1LCUA 4ORZA 1KC8O 3IMXA 4C8QG 4ID1A 3D01A 3QBYA 1NBWA 4JEPA 1NQ3A 1TXQA 1NEGA 3D7SB 4CF1A 3LM9A 2P1JA 3E1YA 4CJ4A 1M1KO 2HHWA 3CC4T 4IKFA 1S1WA 1MU2A 4Z4CA 5IHKA 4DR1K 2NRZA 4LNUA 2HNDA 1VQOF 4AM7A 2L3RA 3MP1A 2OTJQ 3LWPC 4AF1A 1KQSA 3MHXA 3OYNA 2FSNA 1TOVA 5MN4A 3C95A 2FSKA 4LXCA 3CFOA 3UPUA 3TSUA 3QESA 3SUPA 4JYAK 1NK6A 2Q0UA 4IOAL 1M27C 3E66A 3CC7Q 1I3AA 4V19S 5EO3A 4DSFA 2QA4F 4BY9D 3MDOA 3AAPA 3I55T 1YXQA 2EIFA 4DR3K 1J6ZA 1IBLK 5CR4A 4FYDA 2CVLA 3N5BB 1CZAN 5ADXA 3VTIC 2GQVA 5AYFA 2KROA 1S72Q 2XD0A 3JCMX 1Z05A 2YNIA 1ZX6A 2CUDA 4BRMA 3KJVA 1VQVA 2ZJRL 3SPYA 3S02A 1YI2A 4AHSA 2C06A 3KE1A 1C1BA 3B8AX 4OLAA 3JARB 1Y96B 3KKSA 3VYUC 4CEAA 4BI3A 3CQTA 2H3EB 1YI2Q 5LL6Z 4LNPA 1JD1A 3M8QA 2OZSA 4X1KA 1ONIA 4Z4IA 3CC4F 1KQSM 5AQOA 2EFIA 3KK1A 4HCCA 1QKWA 3CPWF 1HYOA 3K9JA 3L4IA 2A5XA 3PSIA 1GCQA 2HHHK 2KTVA 2Q3SA 4BR5A 3GL1A 2QW9A 3QWXX 5AZJA 3QNNA 2XY7A 4LSLA 4M75B 1AZEA 3Q1JA 2DA9A 3KBGA 2QEXF 3CCMF 1IV1A 2A28A 3V8LA 2J05A 1FNKA 4M3ZA 3H6ZA 1OYXA 4OVLA 1D9FA 1QWEA 2EJ9A 3LWHA 3QKJA 1E4FT 4Z8AA 4CGIA 3SWNA 2D6FA 5FJ4C 3R3LA 4EDUA 4NL2A 5LYJB 2VG6A 3WXMB 4JJBA 4EMKB 3OYLA 2W6KA 5CYQA 3INZA 4Q5WA 3DXKB 3TTCA 4BQLA 3VOAA 2W42A 4HUFA 2NRHA 2I2LA 2JOYA 1IG8A 5CK9A 1I39A 2FF3B 1X9SA 4N76A 3CCJF 2OPPA 5LMNK 3M56A 2KQWA 3MO8A 3VQQA 4O4LB 2DVEA 2BE9B 4CEEA 4EIAA 1KJWA 1T6CA 4ID5A 4J9BA 3UKUB 2CUBA 4PY5A 2M16A 4GY2B 3IG1A 3M1XA 2AIZP 2CP7A 2O2OA 1JL1A 4RKUE 2PVDB 3CCST 1BI1A 1JY8A 3AVGA 2JMCA 3DXMA 1TVKB 1HYZA 2FBTA 3O4QA 2HDAA 2HSEB 2NUPA 2P9IB 2W6LA 3BY7A 1YVUA 4E7SA 1ITGA 3S06A 1YI2N 1P92A 1YCYA 1OKJA 5AQWA 3OJUA 3CXCF 2OA8A 1SG5A 4ERHA 3ME9A 4II1A 4HUGA 2OTJF 4MO5A 2ENMA 1RDCA 4OB1B 1V4SA 1VQ9Q 2E1HA 2X78A 1YJNN 2X6NA 2UUAK 1W2BP 4FLXA 3F70A 2F9TA 4DFMA 4FM1A 3CC4Q 2X6SA 3AA4A 4BR0A 2RJDA 3M8RA 5FPDA 4J2AA 2DM1A 3N4PA 2NUTB 2HF4A 2M1HA 4KH5A 5J2UB 2JVVA 4M78B 2DL5A 2OPSA 3U9ZA 5HBMA 3BY5A 2P9UA 1IHVA 1N6QA 2FPFA 3I56A 4XU2A 3AVCA 3D2EB 3G6EF 2HZYA 3N4YA 2E5QA 3PVLA 3LPTA 3HSCA 3VTIA 1IV0A 5EY4A 1YJ9F 4F04B 3FPIA 3WJPA 4R55A 4PWTA 4B3TK 1M9SA 2EYYA 4EZ9A 4HVWA 4JKDA 4BRFA 1UEBA 2YRCA 4KGXB 3MDQA 4IXCA 1X75C 1RACB 4E7HA 1M1KR 3DLLL 2AZVA 1HQEA 1TUCA 1IGUA 4WBNA 2VXEA 4PJMA 4OPKA 3THYA 4C8LA 4QT7A 4YY3K 4JI1K 1ZBXA 4DFJA 2JS2A 3AO2A 5AQRA 1FFXB 5JMVA 1SSFA 2VGMA 3MP6A 3V1RA 4OVAA 4XTYA 2WACA 4RG8A 1U3PA 2FVUA 1WNLA 1D5AA 1HPMA 3TSZA 3OYKA 3EHQA 5C24A 3K0SA 2DZ9A 2C0IA 4WF2A 4CK3A 5MLCQ 1Q81H 3GNFB 4B08A 5A0GA 5HXZA 5KRTA 1WJQA 4CFCA 4CE9A 1T6DA 2IS3A 5TKYA 5JCOC 1YT3A 4N47A 5CQYA 1KQSF 3EEQA 1BK2A 2D0BA 3ISNC 1VQON 4LFCK 2RKIA 1RLUA 2ZAUA 4X65K 4YDUC 4MMLA 3WXIA 1W41A 3REAB 5JH7B 3ON1A 4CJPA 2HL3A 5BRDA 5I9EB 4UC4A 4E7IA 5HWEA 1YITQ 4JKFA 2AZSA 5A2QE 4BDZA 4GV6A 3LDNA 4DHYA 3CC2Q 1R0CB 2HBMA 1KAYA 1NGJA 3SPZA 3F73A 2CSIA 4F4KA 2KVQG 1Q82U 5LL6S 5AT1B 2DXCA 3CCMT 1HQUA 1RFQA 3K5OA 3S3OA 4O4HA 3QO3A 4W5NA 3I8BA 4DTSA 3FRNA 3E9PA 1FMWA 3QZ9B 3C65A 5AQGA 2HKNA 5JS2A 3BP8A 2X35A 3U23A 3L2VA 4JJDA 2FO0A 3ZT4A 4KREA 3QBWA 2FEIA 4G4VA 4RTVA 2UYTA 4JJNK 5F2RA 3F0EA 2L3QA 1SRLA 1X7PA 3MXJA 2I0NA 4L3QA 1T0JA 4CIFA 3T69A 4KHNA 3FIFA 4C8NA 1ZBHA 5KGWA 1XNRK 3N4ZA 4BR9A 4DTMA 5GAOl 2YHYA 5EXWA 3T1HK 4FYYB 4DQSA 4JV5K 4H8KA 1HLUA 1RAEB 1KFDA 5AQLA 5IYZB 2QI2A 4CZJA 3QB0A 2E6NA 2X74A 4X9CA 2HHTA 4DF8A 4J2EA 2VWKA 4M7DE 2MPXC 4D8DA 3J7YP 2ZPFB 1VQ6Q 3PX6A 2LNVA 4FW1A 2YNHA 5FPEA 3SAHA 4QS8A 1K73C 2MWPA 3WVEB 4R5PA 3ITHA 3CXCP 2ZQBA 3BF1A 4O44A 1M2OA 3BDUA 4OMNA 3F0DA 5FLXE 4AFSC 1K73R 4BY6B 4K41A 1K8AH 3VS4A 3O3HA 5MN5A 1Q95G 1T3SA 3G4SA 3ERNA 5GMKe 3ELCA 3MN9A 5CA0B 4F7UF 3KFVA 1OU9A 1UUEA 1KG1A 3TAQA 4FPAA 3AGKA 1BCMA 3CC7T 1JXOA 1S22A 2A41A 3A0IX 4B1UB 3HPOA 3RA5A 1M3CA 1MNEA 2X3WD 4E0DA 4ZOLA 3AO5A 2D0OA 5CB4B 4I4TA 3KJJA 1E7KA 1B9FA 1JLAA 3ZSRA 1XHZA 1G15A 2L2PA 1PSEA 1LVKA 1RAIB 1W6XA 5IAYA 2Q31A 2WONA 2G8FA 3GNGA 2A3LA 3WXLA 3N2KA 4M3XA 4HTLA 2HMPA 4K11A 1HX1A 2PFUA 5BMVB 1YP5A 2L89A 2E3IA 3EGXB 3JCMg 1YJ9N 5CIUA 4C0ZA 3QWYA 4C8QD 3LAMA 4FLZA 2H8EA 2CSLA 3S0WA 4C0DC 1VQNT 1SRMA 3FZHA 2M9UA 5B8HA 2FGYA 2BKDN 4M77C 1ZUUA 1ZBFA 1RLPC 1SV5A 4B46A 1GO0A 3PUFA 4FYWB 2FC0A 5GAOq 5C0YA 1VQ8A 4DV6K 2QA4A 3ZETA 2RHOA 2ROLA 4DEXA 2BUDA 3MEVA 4CJFA 2RHIA 4ZHRA 4BE1A 3J7AP 2DY4A 5JVDB 4GNIA 5BPLA 4C92G 3OMGA 1RBUA 3TI0A 1U3OA 2K1SA 2X51A 2XICA 5BRFA 5GADP 2LSNA 2LP5A 1VSDA 3DMJA 3THXB 4PJOG 4L5GA 2R58A 3WXKA 3PO4A 2HSTA 3KWIA 1EIFA 4XH1A 2OTJN 3TSWA 5A2QO 1YI2F 3HAXD 4GLMA 4M77E 2V26A 1AWWA 4B9QA 4CJVA 4IO9L 3MQWA 3JXUA 3MECA 2EAYA 4CD1A 4O4JA 1REVA 1D0YA 4J9FA 3EG0A 3F0FA 1XC3A 2P9SA 2QYZA 2GBQA 2RPNA 4CFBA 5TKWA 2JTMA 1R0BG 4I6MB 2G6FX 3CPWA 1JFFB 1WZOA 3G6ET 1VQ4Q 3LW5E 3C0CA 2LQNA 5FNVB 1N9RA 1KD1O 5IT9M 5GONA 1MMDA 3QHDA 3OYYA 1RQ7A 3W0LA 1HKCA 4B3SK 3OY9A 1VYUA 3NHNA 4FK4A 1OH7A 4EMKC 1W2BM 2P9LB 3HO1A 1W5FA 4PLIA 4OMQA 3RBBB 4CC7A 3LDLA 4DLEA 2D1XA 1U5SA 2DD4A 2X4WA 5CCAA 1C0UA 2EQJA 2QWNA 5AQMA 1YJNT 4CW7B 2DFUA 5M1QA 3HPGA 1LWFA 5HP7A 2QGFB 1D3BB 4DTPA 1RCHA 2F2VA 2ABLA 1S1VA 3T7ZA 1VHAA 4M78G 1TVRA 3CCJA 4CBWA 2XHBA 2DTIA 1G5VA 4PA1A 3WNEA 3EZWA 3C94A 5CE3A 4DBHA 4WQ4C 4CHZA 2RQUA 1T44A 3WNHA 2JLEA 3CCSF 3NVKE 3U0OA 4BDYA 4QVZA 4IURA 3TVTA 3M4GA 1K73U 2DETA 3CMEQ 3ZSYA 5J2UA 1QZ6A 1NJWA 3C7NA 1KAZA 3DM2A 3H46O 4JAXA 1YIJN 3J80M 3HZ6A 2CZ0B 1YUWA 3H0HA 3V7SA 1EETA 1HRHA 4FLWA 2HS4A 2LJ0A 4IJAA 4YOYA 2E3HA 4Y92A 3ZBDA 2OTJA 3HTVA 2KAFA 3G71A 4HVVA 4B9VA 1U43A 2DF6A 1U8RA 3AO4A 3C6TA 3O1BA 3FLGA 2PAVA 4PFPA 3OYDA 1VQ5A 3TTDA 5CYMA 1HNVA 2DL4A 1GLAG 4O0JA 5DM6L 5DCVA 1G3WA 1UA0A 1U1SA 1UOCA 2EWSA 1QVGM 3UA6A 2QA4N 1Q81R 2QEXT 1SF9A 1QVFS 3L3UA 1IB8A 3A5MC 4E7JA 4OLBA 2RHHA 3PIPA 3ZFJA 3RKWA 3OYHA 4A59A 1ASWA 1A5XA 4M77F 1W9HA 2YUOA 5A0LA 1XTDA 1XHOA 5IJ9A 2EGAA 4C8QB 4GMJB 3TAMA 2LJ1A 3H8ZA 2RO0A 4PFZA 2VASA 4DTXA 2E88A 4JKHA 1YAGA 2IIRA 1TL1A 4RW7A 1DKGD 1NJZA 1YJ9A 1BKBA 1O13A 5LOVA 1VQ9N 1COMA 1GOCA 1BO5O 4YJ3A 3FLCO 2LNHB 4LD9K 2HHVA 1FKOA 3CCUQ 5B8FA 3HP6A 3NF6A 3HKSA 4AMCA 2IVPA 2J7IA 2VQEK 3MXMA 1T03A 2K5IA 2ZPBB 3SV4A 1J7HA 3SQ1A 1WXTA 2ZM6K 1LPLA 4ILJA 3T1YK 2DNUA 3MEUA 2M0OA 2L26A 3CBOA 3PMIA 1MV0B 1QVGS 3CCQA 4IOXA 2RF0A 2V7ZA 3FGUA 1VQ7N 4C8OA 3PLAA 1KD1R 5BPMA 4FJXA 3TARA 4A4GA 1WXBA 4YOUA 2VGNA 3WVDB 2CGJA 3PGGA 3HK2A 4ZN1A 4LF4K 4DCHA 3QIPA 3HJFA 2EGEA 1LNXA 1XMOK 3G6EQ 2O4XB 4OGCA 3R9PA 2D0PA 3UE5A 3CMEN 1PG5B 5GAN8 4RWTA 1K9AA 5M1PA 2HP0B 4G4ZA 4M7DA 3CCUT 2HOEA 2O8EB 4WBNB 3GYQA 3JSMA 5I42A 1W2BF 5KCHA 5LJ3j 4IFEA 1VQKF 5JQGB 1FWZA 3CD6F 1KD1H 3RMDA 1WYXA 3V7RA 3GE1A 3MX2A 1YWPA 2CDTA 1T0AA 1WSIA 5KX5B 2UXDK 2GEMA 1KC8C 4KH6A 3WQUA 2NUZA 1J5EK 1KNJA 2VCPA 4M7AC 4X64K 3DRSA 1YJWN 1Z5VA 3V4DA 4B1XB 4UY8O 2E12A 5GINC 3ENBA 4M7AG 4I9LA 1YN8A 3VEYA 5C2DA 3I56N 3GF5A 5EOYA 4FJJA 4J9GA 2NZTA 5EG2A 2YYEA 3H6EA 3FFKB 2O4GA 1NGEA 3K5LA 1CK2A 2GV9A 3MEAA 1OOTA 1UGVA 3HL8A 5FW9A 3M8PA 2HVHA 3LYBA 1YITA 4N41A 5AR0A 4IUTA 2X4YA 1WXUA 1C6VX 3DWLA 3IEWA 3O9RA 1EWQA 3VA0A 5EIBC 3A8OB 5EC7A 3SB2A 2V51B 3JS6A 1MNDA 3FD5A 3HKDB 3WJRA 2P9NA 5JVDA 2X4XA 1K73O 3ASKA 2FHDA 4GV3A 3ZETB 1CZ9A 1GXIE 4XTXA 4A4EA 4WTOB 2KG4A 1LAWA 1UTIA 3OBWA 1RILA 4OX9K 2QG9B 4I50B 3RYIB 4BVSA 3OYBA 4KKOA 4CHPA 4OKKA 1NJXA 2DFEA 3V9ZA 3CC7N 3NE6A 2J06A 1PRMC 3CCVT 5JS1A 2BTUA 4N0AA 1RGIA 3O8MA 3JVHA 1QVGA 2HKQB 4JJCA 4BY6C 3KWGA 1FXXA 5DY9A 1UJ0A 3JYTA 2QWOA 3M84A 4DTRA 1FSZA 3JB9F 2KYBA 2MIOA 4JLIA 5L23A 2QTDA 3K14A 1EO1A 1AHJB 3LP2A 4X1IB 1J54A 3G4SF 1TUYA 3O4NA 4JRQA 2HBKA 4CEOA 2YRVA 2P51A 1GBQA 4FLTA 4LUEA 3GDQA 4C5IA 2IPOB 2KZMA 2GF7A 3EO3A 2Z01A 3OVNA 3V1OA 1MMGA 3RVCA 3TAEA 3VQ6A 1W5EA 3JCMb 4BI8B 3VGKA 1PRLC 3DC2A 3DLHA 4BI4A 5GAOn 4XH5A 1BI4A 3ZSVA 3SI6A 3GOIA 4FYVB 1U06A 2QWPA 2KGTA 1LJOA 1BU1A 1Q7YR 2WSEE 1K9MC 1IBKK 2BDPA 2ATCB 4DQRA 2CZ1B 2HQEA 3VF4A 8ATCB 1RDUA 3HSTB 2RD1A 4IO8A 5BN8A 4KI6A 3UA7A 3I3FA 1E3MA 3SBGA 4JLGA 4C82A 2YJFA 3E9LA 2CWJA 1JLQA 4PKGA 2Z1EA 1ZHIA 5LJ5f 1YI2T 5HLFA 2GLZA 1EFNA 1ESVA 2GZLA 4BVTA 1VIFA 2E6MA 2O8EA 3NPFA 1BI2A 2Z1IA 3TCJA 3AO3A 5HOOA 4JRIA 3E9FA 1F21A 1S9EA 2EBPA 3NF9A 4CZKA 2CZWA 4DRXA 3P8DA 3EAEA 3ZT3A 4E1JA 3FEOA 5HCKA 4QQGA 1NJIR 5GANj 4V2SA 5HY4A 4JKEA 1IKVA 5AQIA 3G6EN 3HSBA 4RCCA 5C25A 4Y1CA 2AIRB 1VSJA 3P39A 2D8JA 1ZSGA 3SUNA 1TUDA 3CCJT 3ZX2A 1CKBA 1VYVA 1ATRA 4ZI7B 2K4YA 1X43A 3G1JA 1QP2A 2DXBA 1RNHA 3SQ2A 2A08A 1G3YA 2VC8A 3S3NA 3AV9A 1VQ8Q 3EFSA 5KPZA 3BDPA 3TD5A 2E6ZA 2RN8A 5HP1A 2PY5A 5GANg 4XH4A 2AMTA 2FC3A 1VQNQ 3HKCB 3SD4A 3A8HB 1YHQT 4B1WB 1BUPA 1NK0A 4JI8K 2IOCA 3OQ5A 2P5GA 2ZJQL 3CG6A 5JQGA 2IAFA 2OCEA 2EYQA 1UFFA 3DKMA 3L2QA 4KHSA 5HY6A 4AQYK 1JO8A 1W5AA 3HKCA 2GWJA 2HRYA 5C6SA 2KTUA 1M1FA 4C0FA 2ZF5O 3D54A 3FZKA 2RI2A 3VRZA 1QD9A 2JM9A 2Q97A 1NKEA 4OKEA 5JLFA 3AGRA 4BRQA 4PUOA 3IR9A 2GX9A 2DX1A 3RMQA 4QCLA 1OULA 4JHDB 3M9QA 4CZMA 1VQ7F 2RE2A 1W0HA 4DS4A 1UGPB 1IREB 1U1TA 5GAMg 3VQCA 3R6NA 4LH5A 4XTVA 5IXBA 3OYEA 3MK6A 4J9CA 3CMAN 2BZYA 1M2VA 1YNZA 3CCJN 3RTVA 4X62K 4FJNA 1RAAB 4HA8A 2V1RA 2YHBA 5F1XA 3OSVA 4C8QF 3CJCA 4FJ7A 2R6R1 4F7UG 1TK0A 1TUBB 1VQ9F 1FFXA 1KC8R 1GLCG 4FWSA 1ACMB 2DL8A 3CCET 4M41A 1DEJA 3LAKA 4CD3A 4XTUA 2VAMA 2AHJB 3NMUA 2HP3A 1HNZK 2B86A 3KHNA 4C8EA 1RT1A 2PVGB 1VQ9T 3HTNA 5SZTA 3CCMN 3MCAB 5BRHA 1TL3A 4DV5K 3RNJA 1ASVA 1X25A 5IJ0A 4KFBA 1PCXA 4I2QA 4WFBL 4Z4GA 4EMGA 3ZEUB 3G71F 4BRPA 1S1UA 2F2WA 4M78D 1EXQA 4H4OA 1R8OB 5KYWB 3JB9D 2R751 5D6WA 1RTDA 3HKEA 1NMDA 3R8EA 4CHOA 2HHUA 3CC4N 5LA6A 4IHJB 3B6NA 2UXBK 1SAZA 1J9AA 3A8MB 1VSEA 1YITN 3QO9A 1KVBA 3E1SA 5FWBA 2AJQA 3JB9I 1LWEA 1NKBA 3SMPA 1IPAA 1VQ6F 2LX9A 3JALB 4BGAA 1WHKA 1WUAA 1IBMK 2COYA 1TUBA 2F8SA 1W97L 1WDXA 2N48A 1RT4A 4M77A 1M5Q1 3JCMV 4J2BA 2W8BC 3QFPA 4CF8A 3MN7A 3OS5A 3CCVF 3VOVA 3FZMA 3CQXA 2R57A 4BD3A 4F17A 5GAOm 2YJEA 1VQ5Q 4ZGEB 3NBPA 3A8YA 4NXMK 4CESA 1BI4B 2V8JA 2KY9A 3OSSC 1IH7A 4JK9A 4EB6B 4FYXB 2YNFA 1PNJA 3CCQQ 1KFZA 1QCOA 2QTXA 1TYQB 3VENA 3ZT1A 1QCNA 2HAXA 1KVAA 2KMTA 4XU1A 2Z1GA 4FOIA 3X26B 3IMPA 4J8OA 4RMOA 3CCLT 1UGQB 4FVMA 4PL7A 3M0TA 4O4LA 1V76A 2O9SA 2QXFA 1SS6A 3NDKA 3HP9A 5LP6A 4BWJA 2QQ9A 3D0PA 5KX5A 2LCCA 3CCQF 2KEAA 4ISEA 1QKXA 4HCBA 3HFOA 3CB2A 3S6WA 4CEZA 3UKRA 1I07A 5KPTA 3CBPA 3KLHA 1Q7YU 2BE2A 4M78E 3P5JA 4CHQA 1GLDG 3HVRA 4CERA 2O8CA 4YORA 1QS4A 1M8MA 2CGKA 4AILC 2CW4A 2KT1A 3SUOA 2H3GX 2NLXA 3LH5A 1QSYA 2O8BA 1FKPA 5BREA 2CH4A 1RAHB 4UQGA 1NEBA 4OMOA 2Q0RA 1W2BA 4E7KA 3CPQA 3LYIA 4BG8A 1G99A 5AFUA 4NLCA 3ULDA 2OYQA 3LFOA 2VQFK 2CP5A 4C8QE 5CR2A 3CD6T 3HI0A 4L8RB 4CC2A 2ZPHB 5IN1A 2IG8A 4U3JA 4ZHQB 5FRNA 1W4SA 4FT2A 4C92A 2D4WA 3C6AA 4ANJA 2JNBA 3RYFA 4BC2A 1UGRB 3L2ZA 4DV7K 3VKIA 3VS5A 4DQQA 3CCLN 4B9UA 1KLNA 4DUYK 1VQMN 4CHYA 1Q82C 1I5OB 4EP4A 4U39A 3UKRB 4WFAL 2RK2A 3OA9A 3TPQA 1IKYA 1HK9A 2HQXA 3MPUB 3L42A 1B34A 5GJWB 5AZIA 4FO0A 1NK7A 4B9LA 1VQ6N 2HHSA 1ATSA 2KBTA 1KIKA 3DRPA 4OPHA 2V8KA 3QERA 2O8FA 2E2QA 1H641 2RB6A 3AO1A 2HHXA 2LBTA 4ZHYB 5GAN3 1PM3A 3I7TA 3PNWC 1RADB 5LJ3d 4E47A 3DYAA 4B8CA 2DLPA 1FMVA 3KLIA 3O9TA 5KMGB 3QEXA 5IJ0B 5CZ2A 1VQPN 5CKEA 4HWIA 4FJIA 1Z9QA 1Q86U 1UHCA 1VIEA 1WSFA 5GMKm 3CF5L 4CZHA 2OI3A 1OAPA 2YWWA 4X66K 4M75E 1KD1U 2XDBA 2LTOA 2VG5A 3EKUA 4DV1K 1W581 4B9WA 2NRXA 4B9XA 3VYSC 3VCZA 4A2BA 1S1NA 3P8HA 3X25B 1LWCA 3EG9B 2QWMA 2G8IA 3VS2A 1VQLF 5IXFA 3JASB 4FXDA 3L4QA 1QP3A 2HNZA 1M8VA 1O75A 2VG7A 3CCLA 3ZX3A 1KAXA 5CO7A 4M42A 3HHTB 1MDUB 2BTOA 2O9VA 3OW2A 4BY9C 3MEDA 2MOXA 3UT1A 1VQPT 4G4WA 4FLVA 1VSMA 4EI7A 1KLMA 3Q7BA 2LQWA 3VF2A 3P8BB 3PIOA 2ESWA 3A5ZB 2FB7A 1Q8IA 4M78F 3CMAT 4EAHD 1HSQA 1Y0MA 1CZBA 4D6WA 4KTWA 4RTFD 5EU7A 1C0GA 1D3BA 3M54A 4R56A 3UDCA 3F9MA 2UUBK 1WBBA 3CYPB 2KI7A 4F16A 5HL7L 3ESJA 3VEZA 1SA0A 2DD5A 3A8GB 1ZSZB 3BDLA 1KQ2A 1BG3A 1S5JA 4JZ3A 4OB3B 3BGRA 3JAMM 5G4UC 4O5VA 3SFMA 3VUBA 1R77A 2KRSA 2P9NB 4BRKA 3CPWP 1N8RC 1X1PA 4WF9L 1YHQA 4A62A 3RR6A 4M7XA 4K42A 2O4XA 4FWRA 5C2FA 2RHJA 3C9UA 1U04A 3GP8A 4ZGDB 5GIOA 1VQKT 2LC4A 5HY1A 4LY7A 2DEQA 2F7TA 4F8RA 2RJFA 3E9GA 4BR7A 5J1EA 4EPCA 4EI8A 1Z9ZA 1JJ2A 4HT8A 4KTQA 4NS5A 2XU8A 4BUGA 4NCGA 4CFAA 2JJ9A 3R6MA 5FU6B 4BRIA 4ELUA 1OPLA 5LJ3h 1E6HA 5HKCA 3UB5A 4B8AB 4CGJA 3NGYA 2KXDA 3SJJA 2E64A 3PMTA 1YITT 1LV5A 3QBXA 4Z88A 2VWBA 4BRNA 2R7YA 4XQ3A 5AFUH 3QNOA 3WUHA 1DTQA 3EYZA 1J53A 5EIBD 3PIPL 4LD6A 5LJ3g 2KTQA 1L3SA 2GFUA 3U3GA 5FLXM 4ZTJA 1B7TA 2KYMA 2K79A 4DR4K 1ZBJA 1VQKQ 4K25A 3O9UA 2ZJPL 4BVPA 3JCMd 1DLOA 2XY5A 2KQ2A 5GAOr 4E6RA 3CM6A 4CBXA 2YUQA 3SAGA 1Z6RA 3EFRA 4BC5A 3RERA 4IG0A 2HF3A 1Y97A 3T1AA 3RWUA 3FJPA 2R5AA 3ALYA 4BC3A 3CC2N 1T3VA 2DILA 2FZGB 2IVWA 3G4SQ 4CRIA 5LJ5e 2DXTA 3CCUA 5AQVA 2WTUA 4I6MA 3I5SA 3C6HA 1K8AC 4DUZK 1RLGA 4F6RB 1W1FA 5CKBA 4TV8A 1UJYA 2DPNA 2DRMA 2LQ8A 3H3OB 1RDWX 2UYJA 4DU3A 4F3TA 3WPWA 1C0FA 2P9LA 1KSWA 3ER0A 3F2KA 1W7AA 1TUGB 1IO2A 1WPYA 1U2VB 1AOJA 3AAQA 4OPAA 4LDVA 3KLFA 2DTUA 4OMPA 3PV8A 1NJIH 3K0TA 5CHIA 4EP5A 5AQXA 4CHNA 3SYZA 3VF6A 2YUNA 1JLCA 4C92C 5BR8K 4WQ5A 3J8AA 1R0AA 2COZA 1UWBA 2Q1NA 3QEIA 4NYNA 2HQHA 4W5TA 1X2QA 4H0TB 2Y1IA 3J81M 3P4IA 3NVMA 2GTDA 3A98A 2ZVZA 3EGUA 1HKGA 1HPZA 3IKMA 3QSUA 3O1WA 4PJOD 1XNIA 3PSFA 4Y28E 4YNQA 4JI0K 1W59A 2FXUA 1S72T 3SAFA 3KKRA 3V8JA 3LWLA 3JB9J 1YTUA 1TTHB 1NMUB 3VETA 1WHMA 3TU4K 4BT5A 4HCKA 3VV0A 1NYGA 1WLJA 1OU8A 4FPBA 4AH9A 2O8DA 2RHYA 4A54A 5KCOA 1LOTB 4CI6A 1NGFA 4PJLA 2GWKA 2Z1TA 1KHCA 1AWXA 3HBTA 1MMAA 3MWPA 1A5VA 4CK2A 2O4IA 1JCGA 4E7ZA 2ZE2A 4GV9A 3EH1A 4PFOA 1TGOA 1BGXT 4MQ3A 3HPWA 3H1VX 3B6PA 1NKCA 3SEMA 1Q86R 3PE0A 1YJNF 3CHWA 4RTXA 4MZPA 4M3TA 2FRWA 5ELZA 3CXCM 2E4HA 3MN6A 1X9WA 1MA9B 3EZ5A 3KD1E 3I56Q 4EZ6A 1VQ6A 4NXNK 1ZBLA 3PIOL 1T3LA 5KQDA 4FZYA 3EFOA 3HVTA 3JAWB 4O2BA 2RJEA 2P9IA 2QWLA 3I56F 2C0TA 5IH2A 4MMKA 1S72N 2AKLA 2O8DB 4FWKA 2ED0A 5J26A 3F9KA 3IFRA 5GINA 4M77G 1QQOA 4CJ3A 1YHQN 5LJVA 1OH6A 1V1CA 4OB2B 4IG3A 1S1TA 3MN5A 1IG9A 3JATB 3I33A 1XC9A 2Z1HA 1K8AO 3SWNC 2UUCK 3CD6N 3N2KB 1SUQA 3QDFA 4RW4A 3DB4A 5D6YA 4IWVA 2A36A 5AQHA 3THKA 4G1QA 4DS5A 1VQLN 2RB9A 3Q8HA 5GONB 1ZBSA 1TU0B 1FYNA 4QKUA 4JKGA 3JATA 3VO8A 3H3NO 4I4TB 4DKWA 3CMEF 2XG8D 3ZT2A 2QAZA 1OH8A 1VAZA 5J2NA 2VAWA 3M55A 2A0FB 4CJTA 1NK8A 4EI9A 1NJIO 2KNBB 3HJWC 2QEXN 4DV4K 4CJRA 1PXWA 4DOVA 2Z0WA 4BRAA 2DJZA 2COWA 1K8AU 2VXFA 3WXJA 1XJWB 1OH5A 5CA0A 4ICLA 4FK0A 4M4ZA 1KCFA 2VB6A 4C5GA 5AQNA 3W3DA 1L3UA 4RUGA 3O5ZA 4TV8B 3LGFA 3WGMA 1BB9A 4GKKK 3PTAA 1TUUA 4J6YA 4BRDA 4IUPA 5GAMe 3C8LA 5IHNA 4GBQA 3MWTA 5C42A 3QUWA 3V81A 2E1ZA 3TD3A 3AA3A 3BZKA 1NK4A 4ELTA 3LZIA 4M75D 3E22A 4X3MA 5D6XA 3WGLA 3H08A 1XMQK 1SZQA 3P83D 4IFVA 5KPRA 3GPLA 5KYYB 4NO7A 4FOEA 2PQWA 3LDOA 4O2AA 5IJ9B 5HP8A 4E2FB 3M0SA 1TV6A 5IT9E 5CQXA 1KXPA 2OPQA 3A2FA 3ATVA 3O9SA 4A57A 1GBRA 2A42A 1RBVA 4IHJA 1W55A 2IC3A 2ASPA 4DSIA 4M78C 1M1KC 1GO1A 2LMJA 2L5QA 1KQSS 4CJWA 1M4ZA 3M0QA 3NAEA 4GLKA 1ABOA 4L59A 3NH2A 4OPJA 3C9RA 1QE1A 2DVJA 2K6DA 5DM7R 2OAUA 3CCVQ 2I7PA 3P1GA 1W5BA 2KHOA 4ELVA 1JXMA 4OJRA 4RTWA 5T7BA 2A3ZA 3JCMJ 3D2FA 4FJHA 4KHUA 2VV5A 3QYGB 2E6LA 4YOXA 4EMHA 2D0AA 4IBNA 4J7IA 5CZ1A 4CEFA 1E6GA 4GKJK 2GQIA 2QA4T 3SBTA 4X20B 3JASA 4M77D 2QEXQ 5GAMf 1K0XA 2VXYA 1ABQA 5LJ5j 2X9HA 1ZA1B 1GX1A 3QMLA 2FBVA 4FFBB 1IKWA 4C81A 5MN6A 2K5LA 4CK1A 5AQZA 1VQ4F 3AY9A 1B07A 1KC8U 5GAGP 3UKUA 3RDVA 3NMUC 3D7EO 4DTUA 5CKFA 4YTLA 1GLFO 2BANA 3I35A 4H0XB 3DLLA 4O2AB 5M1KA 4M78A 3CCVN 5AJ3K 1H3ZA 5GAN2 2VYPA 1VQMQ 2YKMA 1SKWA 2R5MA 1X7OA 1LCKA 3O80A 5FDLA 2AK5A 2OTLQ 1JCEA 3HM8A 3QXEB 4CVNE 1AD5A 5KYUA 3DLKA 2XY6A 1KD1C 3P4EA 4H03B 4BRCA 4JUVA 1M1GA 2EYXA 4B6MA 3RYFB 1RL2A 1Q86C 3LDTA 1BIAA 4X20A 4CZEA 2JS0A 4BE0A 5C10A 3CJ1A 3V8KA 4QAGA 2DYIA 4JS4A 1RUWA 2B6AA 1DBFA 2HNIA 2J6KA 1YITF 1X6OA 3NF7A 1J5OA 1FJGK 1HKBA 4M45A 2K3BA 3FFMA 5AZIB 2XI9A 4QS9A 5KRSA 1JJ2F 1VQLQ 2HVIA 1VQNF 1VQMT 3GHZA 4Z4HA 3K59A 5HXUA 3OMCA 1V4TA 1VQ8F 2HBJA 2I5JA 1N27A 2AKKA 3HRTA 5M1FA 3WNGA 2HMIA 3AT1B 4PJNA 1JLEA 3GBTA 4NB4A 3J81E 1HNWK 4BT4A 2A1SA 1ZXOA 1S1XA 3E9OA 2H3JA 4BT3A 2LVMA 1MUZA 4Z4FA 1VQ8T 4FJLA 5GMKh 1ZUYA 3LL3A 3SHWA 5FNVA 2JMAA 3OA6A 2P9PA 3WT0A 4DSKA 1TVKA 1OPKA 2OZBA 1LOJA 2ED1A 3F6MA 1NJIU 2RM4A 4CJLA 4F3OA 1Z5WA 4EHTA 3P31A 2LZ6B 4LUDA 4AFUC 4R40B 2ZZDA 3D2EA 2QQSA 1AWOA 2YHWA 4OKJA 2G3RA 1DT9A 3ZT0A 5GAN5 3CCRF 2F9WA 3V9SA 4CEQA 3MCPA 3H9NA 3QFUA 3H0IA 1YCSB 2P0PA 5D3GA 4TVRA 3GOXA 3CCUF 1YJWQ 4JI3K 2ITMA 1HJDA 3VESA 2W41A 1MHNA 4CJKA 1JB0E 1VQOT 3OW2P 1KC8H 4O55A 3LDQA 4M63C 1U49A 1W57A 3K9KA 3LP0A 5M1OA 3TU5A 1M90C 4EMKA 2JN0A 1NMNA 1YF5L 4M7AA 5FPMA 3S9HA 3QG1A 2QK0A 4BE2A 2VAPA 3JCMc 2OTJT 4DQIA 5C15A 1Q8RA 1CLIA 3ULEA 3DOLA 1NNEA 1GRIA 3EGXA 2P84A 1SSHA 5GIPC 4O8KA 2ZGZA 4WE1A 3VQ4A 5GAEP 1UFYA 3R1XA 1NLPC 4FWLA 2YDLA 4Z94A 1JJ2P 3CCSA 1B34B 4MZMA 4M7DC 2NRTA 5AQUA 3RYIA 4ZHWA 5LY3A 4J9DA 3HM9A 5I21A 3VGLA 2E70A 2KSSA 5ITZB 5KE2A 1XI1A 2UYNA 1WQ7A 5I11A 1W42A 1YIJA 4BRGA 1QMCA 5I2MA 2F5TX 3DLGA 2D8HA 2LDMA 4RW8A 4O0IA 1NG9A 3NK7A 4C23A 3KTQA 2RMOA 4J6XA 4J5YA 5AQKA 1NJYA 1NE8A 3QJ6A 5D7UA 3CPWS 2YHXA 1JCFA 3ENOA 1YJNA 4Q5VA 2CKKA 1VQ5F 4X9DA 4HNAB 1D1CA 1OEBA 1K6YA 1NZ9A 5E41A 2DJQA 1TKZA 2PYJA 1SL2A 4F6RA 4LF8K 4LD0A 5KYWA 2GVIA 3HKEB 1UECA 2IVNA 1FMKA 2XIDA 4CF0A 4HCZA 1N5YA 3H41A 2YI1A 1T0HA 5AQQA 4PLLA 3IKFA 1VA7A 2KDSA 5J2TA 1Q81C 1B9DA 3HRGA 5GAMh 4R0KA 3NVIB 2VWFA 3TREA 4BC4A 2HEQA 4M3UA 2ASOA 4DQPA 3O8VA 5EZYA 5EYPB 4B9NA 3JAME 1PKSA 1MWKA 3VGMA 4AT1B 4DB3A 2OJ2A 4HTUA 2Y4XA 3EHRA 3CMET 3MCQA 4M7AD 1JN1A 3CCUN 4DU4A 2KE9A 2GFAA 2I7NA 1TS9A 1X6GA 1VK3A 3KJKA 1RBRA 4CJQA 4H5VA 1QTMA 4M75A 1BISA 2A40A 2MCNA 1GCPA 3MEGA 4BWMA 3VN5A 1BBZA 2LQKA 3MMVA 4X1YB 1XV2A 2V7YA 1EZZB 3M58A 1C6VA 3ZSZA 4FJ8A 3OYGA 4EHUA 3A8LB 1ZLMA 2IIMA 2MF2A 4ATOA 3ZEHA 1B92A 3WNFA 1D0XA 2JW4A 2FLOA 4C92D 3OHRA 3U6FA 3I56T 4K8ZA 3V7QA 3JAMO 4DRXB 1BL3A 3VEXA 2O8CB 3BEXA 1NGDA 4E3SA 1H1VA 2VYTA 2DYYA 1N9SA 4C0GA 4M7DF 4Y0WA 1D0ZA 4B9SA 4N4IA 4RW6A 3M3ZA 3JCMM 1X52A 4PKIA 2RJCA 3IEQA 3T9NA 3TSQA 3QYHB 4FZZA 3CC7A 1Y57A 2PHNA 4ZI7A 3JCMh 1M3AA 2WALA 4BVOA 2MYSA 1PKTA 1VQNN 4M3WA 4BRHA 3KLGA 4BT6A 1SQKA 5J2TB 4NCAA 2YX6A 3S41A 1OV3A 3VS3A 2GELA 1ZQ1A 3FE1A 1BI3A 4YOTA 4JI6K 3SK3A 5I3UA 2CP0A 1ODEA 3NGZA 4KHQA 1IV4A 3SIUA 4KHWA 3TQ7P 3FZFA 2QA4Q 1EQYA 1JLBA 1P90A 1N33K 2DAQA 2ETJA 4W5RA 3A1PA 1Q9XA 2VUBA 3EY1A 1FK9A 2ZPEB 7AT1B 2KZZA 1KSPA 4NQ3A 1U48A 3EGDB 3J7AF 4E19A 1TK8A 3ID8A 1GLJO 4A61A 4U67L 1HJRA 2DBKA 5GAMd 2FPEA 4B3RK 4QVCA 4KB1A 3SQ0A 4BDPA 5GANK 2K3YA 4LF7K 1N34K 2E1YA 1VQMF 3DB3A 4KO0A 5HK3A 4LF6K 1M3BA 1CN7A 4FW2A 2QASA 3EG1A 1NGHA 3O3FA 1VQPQ 5J2MA 3TANA 4DLGA 2JTEA 4MDWA 4PWDA 1Z26A 1SA0B 2QTVA 1K8AR 1E7OA 4J7FA 1JL2A 1K9MU 5H1SQ 2RH2A 2RQWA 5DK5A 4AHRA 3RYCB 1N8RH 2PZ1A 1VQ4N 4B5CA 4WQ4A 4QOZB 1OVYA 2OX7A 2DTOA 4ZGJB 1JKHA 1WGSA 4KULA 3VJPA 2YUPA 1S6PA 3WEEA 4A4KA 4BB7A 1QSLA 2VKNA 4FJGA 4FSSA 1GLBG 2EKHA 1DTTA 1UAXA 1T7PA 3RYHA 3R6OA 3QIIA 4JPBW 5KTQA 4CGHA 1QVFM 2RF2A 2HQSC 4FM2A 3I9QA 5CKHA 4J9IA 1RT2A 2PVOB 2PBDA 1FW6A 1PF5A 1QU9A 2NWMA 1DGKN 3BFMA 2HNYA 2K2VA 3M6GA 1XBIA 3VTHA 2GGRA 3QINA 4TSXA 2JGUA 4WYBA 2RA2A 2BGGA 5E26A 4DBQA 1PC0A 4M75G 2RI3A 3CCQN 1VQ4T 3K12A 3UT5B 3OYMA 1EKEA 3LWMA 1GZ0A 2RI5A 2B8AA 2LRQA 1QWFA 3J7AR 1VK0A 1X3NA 4MDBA 1YIJT 4IEIA 3L6QA 4DR7K 3RYCA 3MJXA 3CJ7A 3M8SA 5EB0A 4IZ9A 3URGA 2P4TA 3G0ZA 3DRRA 1OZ3A 3D00A 3CMAA 1NWKA 4M8IA 2YXZA 5LJ5d 4E1MA 3KD5E 3OJSA 4TUYA 3EG9A 4KBMB 1GCQC 4M77B 2CSQA 1SL0A 4KRTA 1NK5A 3VEWA 2Y4YA 1BA1A 1MV3A 3JARA 2BZXA 1BDGA 1JXEA 4CEBA 1BU6O 4M7YA 4H5NA 1UDLA 2KRMA 4CJSA 3I8DA 4X1VA 1VQNA 1GL5A 4RCBA 3NHGA 3RMAA 2PZSA 3AVAA 1BA0A 2J6OA 2JM8A 3HKDA 1JLFA 2X4JA 4IOCL 3LGLA 3ENHA 4A2AA 1ZC6A 2ASMA 3VQDA 3TABA 1WBDA 4FWPA 1JEGA 2EWCA 2V8IA 3PX4A 5AQJA 3VIUA 2L3SA 3T3FA 2YHAA 1HYSA 4DXDA 1VQ5N 3OYIA 3CCEF 1MMNA 1Y7XA 5AZJB 1KVCA 3UWNA 3KIZA 4CECA 1F1BB 4WCEL 1XHXA 1ILYA 2RK1A 2H6LA 2A37A 2XY8A 4JNEA 3SMSA 1HXDA 4PNOA 3NFAA 5LMUK 1NM7A 1WJRA 4HXJA 2BTFA 2XK0A 1SDSA 3L2UA 4JZ4A 2G8WA 1Q82O 1I4K1 4TV9A 1WOQA 1AWJA 1JJ2M 1KHIA 4H5TA 3CCRA 4TUYB 2JWKA 3O4WA 5KYUB 3OYFA 1VSKA 3U4LA 4KHPK 4JK8A 4IIMA 5HRPA 2ZD1A 4RTZA 2V9YA 2AIFA 2E2OA 3C9SA 1Y07A 4N5SA 2DTHA 2RHUA 2HX0A 4QVDA 1WJSA 4XTWA 1N8RR 4B9TA 4C5EA 4CGDA 1VQLT 1U40A 2EQUA 1NGBA 2QEXA 1U45A 3GG4A 4NYFA 5GAMj 4O8UA 3JRZA 5HRRA 1QVFF 3E2UA 3IRXA 4EB6A 2KLAA 1VQ7A 2G8KA 2E8AA 4FJ5A 2WSCE 2OTLF 4RTUA 2LJ3A 3THWB 4DBRA 4FSXA 4M7AF 4H0PA 2P9KA 1QVGP 2WUSA 1WSGA 3ZSXA 4FK2A 4CCHA 3DLBA 1QW1A 5LJ5h 2QKKA 3NH0A 1DJ7B 4FWNA 1TSFA 3P10A 3CCJQ 4M7DB 4AHCA 2P0KA 4RQOA 3OW2M 2CT4A 4C8QA 1JBMA 2EX3A 2ITGA 2UYPA 4OMFB 2B5JA 5LJ5g 4IDKA 1WX6A 1WFWA 5FU7C 3JCMe 3AVJA 3EKSA 2E4LA 4CZIA 3HPHA 2OTLN 2KGWA 3VOBA 4DEYA 1YJWT 5GAPK 3IQLA 3CCRN 2HCKA 2HHQA 3ULRB 4FFBA 2ZCFB 1H47A 2MAMA 4WCIA 1TKXA 3OS0A 1QHAA 2MMPA 3HRUA 4Q0BA 1WSEA 5KYXA 2JT4A 2H8HA 3E19A 3LWVC 3BE3A 3NGPA 2DK3A 1VQOQ 4G88A 2DYBA 2RN2A 1G8XA 1G2BA 2E2NA 3JAKA 1RDAA 4FLYA 5HROA 3CMAQ 4CF9A 2RHKA 5KQ8A 3SV3A 2ZGYA 2M51A 3MKDA 3V6DA 3J80O 3RMBA 2JUFA 3CJBA 2DPPB 3ZLJA 4ILGB 4L6V5 1S6QA 5KYYA 1X69A 1XRGA 1RI9A 1WHGA 4QQ6A 3CG7A 2F69A 4JK7A 3ZEUA 2NLUA 2OZMA 3EGDA 3GLXA 1HYVA 1WSJA 2D5RA 1X9JA 3CCVA 4XCQA 3VQ8A 3ZX0A 3SQ4A 2HBPA 3VRYA 3X20B 3CCMQ 3CCEQ 4KAZA 4DQ8A 4DG1A 5KGXA 2DT4A 5L8RE 3CCRT 4W5QA 4YDUA 3TAGA 3M59A 3QLHA 2AT1B 3BF3A 4FL9A 4JHDA 1Q82R 4I55B 1JJ2S 5GMKj 5FLXO 3S0HA 3O9QA 2O31A 5JCOA 3PT9A 1X9MA 3CC2F 2HD0A 1K8KA 1R59O 3FC3A 4C8KA 3KUFA 3ZCMA 2NUBA 2L3PA 2YHTA 5LXTB 3IKEA 5JLHA 3AARA 3K58A 4CFDA 4XU0A 4PKHA 1ZWZA 3LX7A 1BHLA 3M5AA 2F96A 2NRRA 4JKGB 4NL3A 4DTJA 2RQRA 1YJWA 1TK5A 2F2XA 3KXTA 1W40A 3RRGA 4NCBA 3WGKA 2G8HA 2L8DA 1IXDA 2F4VK 1E4GT 3LLRA 1P8ZA 3HOSA 5GAN4 1MWMA 3CCRQ 4DWIA 3NMZC 2LCAA 3DLMA 1QQJA 3QDRB 2HL5C 1SKRA 3HOTA 3K5MA 1X27A 1VQ6T 3TAPA 5FWCA 1TAUA 1ARKA 3VUZA 4PKCC 3CC7F 4M7DD 3GBQA 3O85A 1QVPA 2HB5A 4M7AB 4GVMA 3C6UA 4I50A 1N32K 3CXCS 3LALA 2PTKA 3JV3A 3MEEA 4BG9A 1HR0K 4JKCA 5IHIA 2PMPA 2FL7A 2F5KA 4RCHA 2A7YA 2C0OA 3ZYYX 2PNIA 2G8UA 1Z25A 1QVFP 3J81O 3PAFA 2YLCA 3E22B 1RA4A 3D45A 2XMFA 4RTTA 2D0NA 1WHLA 3UATA 5JICA 1Y64A 3HXMA 4X1IA 1K9MO 1D09B 3RRHA 4JKBA 4EFHA 5AVMA 1NGGA 3A5NC 1BOTO 3I55F 1OVQA 3P0ZA 3K57A 4DTOA 3V9UA 4KHYA 2HVYD 4MLHA 3H1QA 4Z89A 1RT5A 3ULEB 1XUPO 4LSNA 4IUQA 5M1NA 2FBXA 1GLEG 5DLQE 3HWUA 3QUIA 4CC4B 4FWQA 2WC9A 5BPNA 3FD6A 3BZCA 1NPRA 4HNAA 1BQMA 2ZGWA 3VS6A 5KH6A 5ITZA 4A63B 3RA6A 1NK9A 1NGCA 2D9TA 1YFNA 5JVGL 4KRFA 2LT4A 1EWRA 3C12A 1TH7A 1U4BA 4IIJB 2E10A 3QZ5B 3X28B 3L1AA 2NRVA 3AVMA 4JN4A 5CY4A 4HT9A 2QK9A 1K4US 4H0VB 1ZBIA 4DR6K 1L3VA 4N4HA 1KRPA 4IIJA 3VS7A 4CZGA 4W5OA 3LZJA 4BW0B 1VOMA 4RG2A 3C7NB 1SL1A 5FRMA 5ECAA 2DKGA 4I7FA 1OFUA 1SKSA 2O88A 4BVRA 5CB4A 4JDSA 4FZXC 3O3GA 3LWOC 2E5LK 2I6RA 4KH0B 1YHQQ 1VSFA 1GOBA 2OTLT 4LDYA 1WIEA 1VQPF 5C12A 2E5KA 3C4SA 1M90O 3DLRA 2Z1JA 3V3TA 5A0DA 4H0YB 2B33A 5IWAK 1UHFA 3UF4A 4ESRA 2J4RA 1EP4A 2LBXA 2P9PB 2G8VA 1HD3A 1KK7A 1N8RO 1IV3A 2B4JA 4XK8E 1J3TA 4O4IB 1OQKA 4JKAA 3TD4A 1D9DA 3HTRA 3EL2A 4NWOB 2ZPGB 1IHWA 4C8IA 1T0KB 4O4HB 5DLOA 2OTMA 1HJOA 1CSKA 4M3RA 3CMAF 1IRXA 3CPFA 1YHQF 4F14A 1C1CA 4DV2K 3THVA 2RHZA 1I8FA 2I6DA 4IEEA 2HBWA 3MEWA 2E41A 4WFNL 2MK5A 3I5RA 4LE9A 1OZ2A 2YXYA 4H5RA 3ZP4A 2EYWA 2FF6A 1A5WA 1ZA2B 1VSIA 1K73H 4EIKA 3P38A 2XRIA 2XDPA 2BUPA 1WHJA 2P9SB 5K14A 1U6ZA 1NJIC 5HY2A 2YCHA 3EFOB 1BCOA 3LP3A 2FYKA 2P0QA 2EJGA 4D8KA 4GVEA 4X3LA 3CYMA 3PY8A 1PWTA 3CCEA 2DE0X 3R0PA 1S72A 2WSFE 4BGBA 4YJ3B 4LDXA 2QQRA 4KBOA 2UYKA 1QZ5A 1VSLA 3CI5A 2CS7A 3F5TA 1IJJA 4IFYA 4ISFA 3MP8A 3WQTA 4DV0K 1ZYQA 3QDKA 1N36K 2DL7A 1SEMA 2EJFA 2MI6A 3OYCA 5BN9A 2HP0A 4JI5K 1HUXA 3AVHA 3CQYA 3QETA 1T05A 2Q1YA 3C0BA 1WLPB 2K2MA 4LFAK 5CA1B 4H0OA 4J83A 4PHTX 4BT7A 1G3TA 4IDHA 5M9OA 3FB9A 4YOWA 1YTAA 4DSJA 1ASUA 1VQOA 4C8QC 4ME7A 1VUBA 3RSEA 3ZSOA 1U47A 3EORA 1XQSC 1C0MA 3KIOA 1M30A 2KRNA 2W0ZA 1QSSA 2K9GA 4I9QA 2GUPA 3QJYA 1SHGA 4FLUA 4BVQA 5LJWA 1QVFA 4KWEA 2WFBA 1YGYA 3ZSWA 2BO1A 2OTLA 1H8KA 4AHVA 1RTHA 1LW2A 3CM5A 5LJ3f 2EW3A 1JQQA 4U7BA 3NH1A 3WGNA 2CZ6B 1VHXA 4CGGA 4FM0A 4LCKA 5LXTA 3M4SA 2ZAEA 5AQPA 3VQ9A 3VQAA 2NYSA 2KW4A 3FDRA 4LF5K 1L5UA 3PVQA 3RMCA 5FU7B 4KUIA 3T80A 1IZ6A 4BQZA 2ZODA 3LWIA 1WB9A 3DAWA 4B9MA 2Y1JA 3AVIA 3VYTC 1UGSB 1N6AA 3ID6A 4E7LA 2IGIA 3G71Q 3PO5A 1D8YA 4XU3A 4AHTA 3G71N 1RQ2A 3GTZA 4ELYC 3DXMB 5FPNA 3JCMQ 4XAXB 3VQ5A 3D2FB 3V9WA 1GOAA 2YLBA 2E65A 2FPDA 5CAIA 2AA4A 1IV2A 5DM7L 4N4GA 4FJ9A 1WAJA 5FROA 3NGIA 4OF1A 2GCXA 1CXQA 1X3MA 1AZGB 2QQBA 1NU0A 1OX9A 4B1ZA 5I22A 1KNKA 2ZOVA 2LBWA 2XHCA 3N4QA 5HY0A 2W40A 5LYJA 4PJOA 2A1RA 2Q36A 3NVKA 2MWOA 3CIPA 2H8CA 2L0AA 4M3YA 4K0KK 2PUKB 5BR9A 2HMAA 3VI6A 2CP3A 4PQUA 1NGIA 3AA2A 3AVFA 3CCSQ 2OANA 5KYNA 4FVUA 1NYFA 5BMVA 3CJAA 3K2PA 2Q1XA 2QDLA 2SRCA 3M57A 5GANe 4M7AE 4C1NK 2F8TA 3RE3A 3IDHA 2KFNA 3AVNA 1I81A 4GY5A 1O1WA 4RHAA 4Y91A 3WJQA 2HRUA 1O9SA 1UE9A 3CERA 2UYNB 3KZBA 4O4IA 4DFKA 4B45A 4B62A 2EQMA 2EGCA 1H48A 3SZ2A 3AA5X 5CKDA 3DJCA 4CEDA 3S3MA 3RIRA 1ATNA 1CXUA 2IAJA 4CJ7A 4DV3K 1Q7YO 1L3TA 4LC9B 1OI1A 3TSPA 2VWJA 1I5LA 3CC2A 1K76A 1W70A 4C92B 2Z1UA 4I55A 2ZVYA 1Q86H 1ZSZA 4N56A 2P4RA 4P5NA 2GTOA 1X6BA 3RSEB 1JXBA 2P9KB 3U8XA 1AEYA 3CMEA 1HMVA 3RR8A 5LP6B 1TG0A 1JFFA 1YJWF 4C4WC 4A5BA 4VUBA 2FZCB 2XO7A 3MBMA 5CA1A 4CJUA 3KVGA 3QEPA 2O8BB 4KH1B 4MDAA 1QLYA 4C5HA 2KFZA 3EH2A 4FWOA 3QTYA 4O4JB 3B6OA 3JCMf 3CD6Q 3O08A 1TKTA 4YFUA 4O6JA 2DXUA 3META 3MX5A 2LT1A 5SWMA 4YHHK 3ZL7C 3RR7A 1VQKA 5IYZA 3CD6A 3J80E 1BQNA 1ZBUA 3AVKA 3CPEA 2K7AA 1W2BS 4DA4A 5EWRA 3REBB 1VQ7T 3A5LC 4HUEA 3HT3A 1B3QA 4BT2A 3SLCA 4J9HA 1UI9A 4AFQC 2CP2A 1C1AA 5GANf 4C1NI 1QQCA 3WGJA 2D0QB 4ZHQA 3U9DA 4YOVA 2Z1FA 3L3VA 3C9TA 3CCEN 5A2QM 1MGQA 4AG2C 4ELZC 3RMSA 1BIBA 3FJ5A 3LANA 4DSEA 4N0AC 4KGZB 4PJOB 3I55A 1RDDA 3THXA 3JAWA 5KE3A 4O2BB 4KUDK 2FZKB 1VQ5T 1SPKA 4FSVA 4FWMA 5GAN7 4B1YB 3KK2A 1NOYA 3RUXA 5ADXH 4Z02A 1GLLO 3JALA 1X2KA 3TWHA 3CC2T 1KFSA 3FFIA 3L0QA 3VA3A 4KI4A 5J39A 4Z4EA 1I1JA 4H5WA 4KH4A 3VQPA 3SWNB 1AT1B 4ZOLB 4HVUA 2YV0X 2DZCA 1WHHA 3G4SN 1RBSA 3CPWM 3O5BA 2UU9K 1FNJA 5J3BA 5GANd 4ZTFA 2KKZA 2Q2RA 3UIQA 3LMEA 4QQDA 1XQHA 4H4MA 4U3JB 1YIJQ 4JS5A 1C0TA 1VSHA 1QVGF 1BWFO 1TYQA 3D6RA 1SKUB 3BW1A 4O4GA 3ZSQA 1H7MA 1Q7YH 3CEYA 3L8BA 5JVHL 1D1BA 2DL3A 1RDBA 4JD2A 1Q86O 2DIGA 2WBNA 2FG0A 3BUZB 8AT1B 4LDWA 2BTTA 1RTIA 4CGFA 3S0YA 2EKOA 3LWQC 1VQ4A 3QIOA 2CP6A 1PSFA 5AQYA 3KK3A 3NCIA 2JTFA 4HKEA 2NNWA 3SCXA 2D0CA 3G25A 3S03A 2GTJA 2M0YA 2FBYA 3M0PA 5GMKl 1VQPA 2GUIA 3G4ST 3CBMA 4XIUA 4F7UE 1K0SA 3VMFB 3KK7A 1SZ2A 1ZSZC 2YRDA 1RBTA 3A5OC 3CCSN 3EG2A 2QQAA 5LA6B 1Q81U 1PD0A 3M5RA 3RKYA 1WI7A 2ZF8A 3NTKA 3JCMW 2D1KA 2NRWA 4I2PA 3NK6A 1ZUKA 2JZ2A 4A4HA 4ISGA 3WEEB 5JH7A 1YBYA 1RT7A 1CLQA 3LM2A 2CT3A 4Z0UA 5E84A 5GAOp 2EQIA 2GBZA 3NFCA 3CCQT 4CZLA 4DR2K 4F7UB 4KTZA 3NTIA 2IVOA 4G4YA 4QW2A 5EX5A 2CZ7B 4A4FA 3OS2A 2EVRA 1RI0A 4LDUA 1I94K 1XOVA 1M90R 1WAFA 3LDSA 5F0XA 3VPZA 3CJ9A 3JB9H 2K57A 4MZTA 1XWLA 3SJHA 4DBFA 3L7QA 1U2VA 4BROA 2CHSA 2HSPA 4DF4A 4KPYA 4OB0B 4KGVB 5GAN6 2QWRA 5GIOC 3QPHA 1IGQA 2QDYB 1S72F 1K1ZA 2O01E 3PFSA 2CH6A 3PX0A 4DQ2A 4PK4A 2BH1A 1HNIA 1YWOA 5GANh 4ZN3A 3K2XA 5CVIA 2ZPIB 3VEOA 1S3XA 3J7ZO 5KMGA 4F2RA 3LP1A 3V1QA 1RAFB 2LX7A 2YNGA 4KV8A 4BR2A 3CQ8A 2P9UB 2HS3A 1CKAA 4NOYA 2UZHA 2JXBA 2SEMA 1M90U 3CC4A 1N5ZA 4G9ZA 5C8YA 4BACA 2VVKA 1NG2A 4MFBA 2DIQA 4E6EA 2GNCA 3G71T 3JCMP 3M0RA 2KK4A 1TAQA 2JWLA 2FSJA 4B1VA 1N8RU 5GIPA 2UXCK 4R79A 2FRYA 5AQFA 4PJOE 2ROTA 1BYMA 3M4YA 2DFHA 5EYPA 5EZYB 3OS1A 4CIGA 3THWA 4NUTA 2ATQA 2LCLA 2ECZA 4KT0E 4A53A 3JSCA 3L2WA 3CCMA 5EVZA 4LF9K 2CHTA 3F0GA 2V1QA 5EB1B 1H3HA 5KYXB 3LH0A 3X24B 1WSHA 1G3SA 3H45C 4M75C 2IQQA 1UB4A 1I0CA 2RQTA 3SUQA 1JLGA 2KXCA 3OYAA 4CIEA 2DBMA 2NUPB 2BIVA 2YKNA 3NF8A 4DTNA 1TKDA 5J2PA 1RLQC 2YT6A 2A6AA 3MAQA 3SNNA 4FJKA 1VRTA 4BRLA 5I2SA 4IUVA 2CGLA 2P5OA 2EHGA 4J2DA 1XNQK 2CH5A 4YJ2B 5G4VC 4XTZA 1VYTA 4K8XA 4AM6A 1PHTA 1NLOC 3FR0A 4JI2K 1HNXK 4J9EA 3EG3A 1H92A 4CZFA 4C0DB 1YJNQ 2XDDA 1VQ9A 1QHTA 4MO4A 4HHTA 3OYJA 3FZLA 4TV9B 1T8EA 3THYB 1WNSA 2J6FA 1V29B 2NUTA 3V9XA 3N2GA 5HRNA 3CCLQ 1KQSP 2DRKA 4E1NA 1YVNA 1YQNA 4Y1DA 1G83A 4B3MK 3RKXA 3G7ZA 3DI6A 1WN7A 4FU6A 3LDPA 1M1KH 3T19A 5HRSA 4A5AA 1YIJF 3FBAA 1GFCA 3SIVA 1RT3A 1TWBA 6AT1B 3CXCA 2CREA 2EWNA 3QICA 3TR8A 3L2RA 4FM4B 4TZZA 3VU3C 5GAHP 2V52B 3AVLA 3VYHB 2CH4W 4C92E 1LW0A 2E2PA 1A0NB 3VQ7A 4CJEA 5LJ3e 4PJOF 1Q81O 4B3OA 4J6WA 4MDXA 1AVZC 4OO1J 2JNGA 5EAZA 1RTJA 3I55N 2RHXA 4O5BA 1RABB 3RESA 2WOMA 1UG1A 3I0SA 4X34A 2OHWA 3UT5A 1U3LA 3KHYA 5GMKi 5J2QA 3GIBA 1VH8A 5GJVB 1JU5C 2EPDA 4LNUB 3G6EA 1QQNA 9ATCB 3DXKA 4CF2A 5HK0A 3IS9A 4RW9A 1R1MA 4OMLA 2DERA 1UA1A 2QTPA 5C8YB 3OONA 4CI0C 5AQTA 3QEWA 2DEUA 4F9OA 4JI4K 3IAYA 4DU1A 2HW3A 3SDZA 4QS7A 4ZHVA 4C8MA 3TEEA 3EN9A 4JRPA 1EX4A 4M75F 2KR3A 2RNAA 5LP6C 4PJJA 2QWQA 2O8FB 2ALEA 2M02A 3QEVA 2P6YA 2RQVA 4DMNA 3M53A 5DMRA
chains in the Genus database with same CATH topology
4FL6A 3VEVA 4DOWA 3JB9G 1Q7YC 2QM1A 1W3EX 2F9ZC 3QHSA 2XKOC 1FX7A 1JRIA 2EQKA 3OB9A 1NLVA 3AHUA 3EE8A 2HBLA 2DO3A 3O6WA 2QXLA 5C0MA 4NLBA 4OP0A 1YJ9T 2K3XA 2PUOB 2K5FA 4MLEA 4BR4A 3M1FA 1K9MH 3HFNA 4C92F 1M1KU 3Q7CA 1X01A 1QQMA 3NTHA 1Y96A 4PJOC 4J8FA 1NGAA 4IUUA 1VQ8N 2CGHA 4JRKA 3PLAC 3OBYA 4PL6A 1K8KB 4ILHA 1VQMA 4FT4A 4WQ5C 3V7CA 3HRSA 5FU6C 3CETA 4K43A 4PL8A 2CYZB 3ATUA 1BI0A 2E20A 3EE9A 3VYGA 4OGEA 1D4XA 4M7DG 5AQSA 3V7EA 4BREA 2Y90A 1VQKN 4O5FA 2AP1A 1NPPA 3LWRC 1VQLA 1Q18A 3IUCA 3VERA 2PU9B 1NM1A 3OW2S 3CCLF 1M90H 4CBUA 4FIBA 3OW2F 1KQ1A 4F7UA 2ZWHA 1Q82H 4IJNA 3E20B 2IG0A 4XEIA 3TTFA 1WQWA 1Y71A 4JD2B 1LCUA 1KC8O 3IMXA 4C8QG 3QBYA 1NBWA 4JEPA 3LM9A 3E1YA 1M1KO 3CC4T 4IKFA 2NRZA 4AM7A 2L3RA 3MP1A 3LWPC 4AF1A 1KQSA 3MHXA 3OYNA 2FSNA 3C95A 2FSKA 3UPUA 3TSUA 2Q0UA 4IOAL 3E66A 5EO3A 2QA4F 4BY9D 3AAPA 3I55T 1YXQA 2EIFA 1J6ZA 5CR4A 3N5BB 1CZAN 5ADXA 2GQVA 5AYFA 2XD0A 1Z05A 3JCMX 4BRMA 2ZJRL 1YI2A 2C06A 3B8AX 1Y96B 4BI3A 3CC4F 1KQSM 5AQOA 2EFIA 4HCCA 3CPWF 3K9JA 3L4IA 2A5XA 2KTVA 4BR5A 3GL1A 2QW9A 5AZJA 4M75B 3Q1JA 3KBGA 3CCMF 2QEXF 3V8LA 3H6ZA 1OYXA 2EJ9A 3LWHA 3QKJA 1E4FT 3SWNA 2D6FA 3R3LA 4EDUA 4NL2A 3WXMB 4EMKB 3OYLA 3TTCA 3INZA 4Q5WA 3DXKB 4BQLA 2NRHA 2I2LA 2JOYA 1IG8A 5CK9A 2FF3B 3CCJF 3M56A 2KQWA 3MO8A 2DVEA 4EIAA 1T6CA 3UKUB 2M16A 4GY2B 4RKUE 2PVDB 3CCST 1BI1A 3DXMA 2P9IB 3BY7A 1YI2N 1P92A 1YCYA 1OKJA 5AQWA 3CXCF 2OTJF 3ME9A 4II1A 4MO5A 4OB1B 1V4SA 2E1HA 1YJNN 3F70A 2F9TA 4BR0A 2RJDA 5FPDA 3N4PA 2HF4A 2M1HA 4KH5A 2JVVA 4M78B 3U9ZA 2P9UA 3I56A 4XU2A 3D2EB 3G6EF 3N4YA 2E5QA 3HSCA 3VTIA 5EY4A 1YJ9F 4R55A 1M9SA 4JKDA 4BRFA 1UEBA 3MDQA 4IXCA 3DLLL 1X75C 4E7HA 2VXEA 1ZBXA 5AQRA 5JMVA 1SSFA 2VGMA 3MP6A 4OVAA 4XTYA 2WACA 4RG8A 2FVUA 1WNLA 1HPMA 3OYKA 2DZ9A 4WF2A 5MLCQ 1Q81H 3GNFB 5HXZA 5A0GA 1WJQA 1T6DA 5TKYA 5CQYA 1VQON 4YDUC 4MMLA 3WXIA 1W41A 3ON1A 5BRDA 5I9EB 4UC4A 4E7IA 5HWEA 4JKFA 5A2QE 4BDZA 4GV6A 3LDNA 4DHYA 2HBMA 1KAYA 1NGJA 2KVQG 1Q82U 5LL6S 3CCMT 2DXCA 1RFQA 3S3OA 3QO3A 3I8BA 3FRNA 3E9PA 3C65A 3QZ9B 5AQGA 3BP8A 2X35A 3L2VA 3QBWA 2UYTA 4JJNK 5F2RA 1X7PA 4L3QA 3T69A 3FIFA 3N4ZA 4BR9A 5GAOl 2YHYA 5EXWA 1HLUA 5AQLA 2QI2A 4CZJA 3QB0A 2E6NA 4X9CA 4M7DE 2ZPFB 2LNVA 3SAHA 5FPEA 4QS8A 1K73C 2MWPA 3WVEB 3BF1A 3BDUA 5FLXE 4BY6B 4K41A 1K8AH 3G4SA 5GMKe 3MN9A 4F7UF 1KG1A 4FPAA 3AGKA 3CC7T 1S22A 2A41A 3A0IX 4B1UB 2D0OA 1E7KA 1PSEA 2Q31A 5IAYA 3GNGA 2A3LA 3WXLA 4HTLA 2HMPA 1HX1A 2PFUA 2L89A 3JCMg 1YJ9N 5CIUA 4C0ZA 4C8QD 1KQSF 4C0DC 1VQNT 3FZHA 2FGYA 2M9UA 5B8HA 2BKDN 4M77C 1GO0A 5GAOq 5C0YA 1VQ8A 2QA4A 3ZETA 2BUDA 3MEVA 2RHIA 4BE1A 4GNIA 5BPLA 4C92G 3OMGA 2XICA 5BRFA 5GADP 4PJOG 4L5GA 2R58A 3WXKA 2HSTA 3KWIA 1EIFA 4XH1A 2OTJN 3HAXD 1YI2F 4M77E 4B9QA 4IO9L 3JXUA 2EAYA 4CD1A 1XC3A 2P9SA 5TKWA 2JTMA 4I6MB 3CPWA 3G6ET 3LW5E 1N9RA 1KD1O 5IT9M 3OYYA 3W0LA 1HKCA 3OY9A 3RA5A 4EMKC 1W2BM 2P9LB 4PLIA 3LDLA 2DD4A 2X4WA 5CCAA 2QWNA 5AQMA 2EQJA 1YJNT 5M1QA 1D3BB 3T7ZA 4M78G 3CCJA 4CBWA 2DTIA 1G5VA 3EZWA 3C94A 5CE3A 4WQ4C 1T44A 3CCSF 3NVKE 4BDYA 4QVZA 4IURA 1K73U 3M4GA 1QZ6A 3C7NA 1KAZA 3H46O 4JAXA 1YIJN 3J80M 3HZ6A 2CZ0B 1YUWA 3V7SA 4IJAA 4YOYA 3ZBDA 2OTJA 3HTVA 2KAFA 3G71A 1U8RA 3O1BA 3FLGA 2PAVA 1VQ5A 3OYDA 3TTDA 1GLAG 5DM6L 5DCVA 1G3WA 1U1SA 2EWSA 1QVGM 2QA4N 2QEXT 1QVFS 3A5MC 4E7JA 3PIPA 3ZFJA 3RKWA 3OYHA 4A59A 4M77F 5A0LA 1XTDA 4C8QB 3H8ZA 2RO0A 2E88A 4JKHA 1YAGA 2IIRA 1DKGD 1YJ9A 1BKBA 1O13A 1VQ9N 1BO5O 3FLCO 4LD9K 3HKSA 2IVPA 2K5IA 2ZPBB 4ILJA 3MEUA 2M0OA 3CBOA 3PMIA 4IOXA 1QVGS 3CCQA 1VQ7N 3FGUA 2V7ZA 3PLAA 5BPMA 4A4GA 4YOUA 2VGNA 3WVDB 2CGJA 3PGGA 4ZN1A 4DCHA 1LNXA 2O4XB 4OGCA 3R9PA 2D0PA 3UE5A 3CMEN 5GAN8 4RWTA 5M1PA 4M7DA 3CCUT 2HOEA 3GYQA 1W2BF 5KCHA 5LJ3j 4IFEA 1VQKF 3CD6F 1FWZA 1KD1H 3V7RA 3GE1A 3MX2A 2GEMA 1KC8C 4KH6A 3WQUA 2VCPA 4M7AC 1YJWN 4B1XB 4UY8O 2E12A 5GINC 3ENBA 4M7AG 5C2DA 3VEYA 3I56N 3GF5A 5EOYA 2NZTA 5EG2A 3H6EA 3FFKB 1NGEA 1CK2A 3MEAA 3HL8A 1YITA 5AR0A 4IUTA 2X4YA 3DWLA 3O9RA 3A8OB 2V51B 3SB2A 3JS6A 2P9NA 2X4XA 1K73O 3ASKA 2FHDA 4GV3A 3ZETB 1GXIE 4XTXA 4A4EA 3OBWA 4BVSA 3OYBA 3CC7N 3CCVT 4N0AA 1RGIA 3O8MA 1QVGA 4BY6C 3KWGA 1FXXA 5DY9A 2QWOA 3JB9F 2QTDA 4JLIA 1EO1A 1AHJB 3G4SF 1TUYA 4JRQA 2HBKA 2YRVA 3GDQA 4C5IA 2GF7A 3EO3A 3RVCA 3JCMb 4BI8B 3VGKA 4BI4A 5GAOn 4XH5A 3GOIA 2QWPA 1LJOA 1K9MC 2WSEE 2CZ1B 2HQEA 3VF4A 1RDUA 2RD1A 4IO8A 5BN8A 3SBGA 4JLGA 2YJFA 3E9LA 4PKGA 1ZHIA 5LJ5f 1YI2T 2GLZA 1ESVA 4BVTA 1VIFA 1BI2A 3TCJA 5HOOA 4JRIA 3E9FA 2CZWA 4CZKA 3P8DA 3EAEA 4E1JA 3FEOA 4QQGA 5GANj 4V2SA 5HY4A 4JKEA 3G6EN 5AQIA 3HSBA 4RCCA 3P39A 3CCJT 3ZX2A 1ATRA 2K4YA 1QP2A 2DXBA 1G3YA 2VC8A 3S3NA 5KPZA 3EFSA 2E6ZA 5GANg 4XH4A 2FC3A 3SD4A 3A8HB 1YHQT 4B1WB 1BUPA 3OQ5A 2ZJQL 3CG6A 2EYQA 3DKMA 3L2QA 5HY6A 2GWJA 5C6SA 2KTUA 1M1FA 4C0FA 2ZF5O 3FZKA 2RI2A 2Q97A 5JLFA 3AGRA 4BRQA 3IR9A 2GX9A 3RMQA 4JHDB 3M9QA 4CZMA 1VQ7F 2RE2A 1UGPB 1IREB 1U1TA 5GAMg 4XTVA 3OYEA 3MK6A 3CMAN 3CCJN 4HA8A 5F1XA 3OSVA 4C8QF 3CJCA 4F7UG 1VQ9F 1GLCG 4FWSA 3CCET 1DEJA 4CD3A 4XTUA 2AHJB 3NMUA 2PVGB 1VQ9T 3CCMN 3MCAB 5BRHA 4WFBL 4EMGA 3ZEUB 3G71F 4BRPA 4M78D 1R8OB 3JB9D 5D6WA 1NMDA 3R8EA 3CC4N 1SAZA 3A8MB 1YITN 1VQ6F 3E1SA 3JB9I 1IPAA 3SMPA 2LX9A 4BGAA 1WUAA 1W97L 4M77A 1M5Q1 3JCMV 3QFPA 3MN7A 3OS5A 3CCVF 3VOVA 3FZMA 3CQXA 2R57A 4BD3A 5GAOm 2YJEA 4ZGEB 3A8YA 2V8JA 2KY9A 3OSSC 4JK9A 1TYQB 3VENA 2QTXA 2HAXA 2KMTA 4XU1A 4FOIA 3X26B 4J8OA 4RMOA 3CCLT 1UGQB 4PL7A 2QXFA 1SS6A 3HP9A 2QQ9A 3CCQF 2LCCA 4ISEA 4HCBA 3HFOA 3S6WA 3UKRA 5KPTA 3CBPA 1Q7YU 4M78E 1GLDG 4YORA 2CGKA 2H3GX 2NLXA 5BREA 2Q0RA 1W2BA 4E7KA 3CPQA 3LYIA 4BG8A 1G99A 5AFUA 4NLCA 3LFOA 4C8QE 5CR2A 3CD6T 3HI0A 2ZPHB 5IN1A 5FRNA 1W4SA 4FT2A 4C92A 2D4WA 3C6AA 4BC2A 1UGRB 3L2ZA 3VKIA 3CCLN 1VQMN 1Q82C 3UKRB 4WFAL 2RK2A 3OA9A 3TPQA 1HK9A 2HQXA 5AZIA 3L42A 1B34A 4FO0A 1VQ6N 1YITF 1ATSA 4OPHA 2V8KA 2E2QA 1H641 2RB6A 5GAN3 3PNWC 5LJ3d 4E47A 3O9TA 1VQPN 5CKEA 4HWIA 1Q86U 1VIEA 5GMKm 3CF5L 4CZHA 4M75E 1KD1U 2XDBA 2LTOA 3EKUA 4B9WA 2NRXA 4B9XA 4A2BA 3P8HA 3X25B 2QWMA 1VQLF 3L4QA 1QP3A 1M8VA 1O75A 3CCLA 3ZX3A 1KAXA 5CO7A 3HHTB 1MDUB 3OW2A 4BY9C 3UT1A 1VQPT 4EI7A 3Q7BA 3VF2A 3P8BB 3PIOA 4EAHD 3A5ZB 2FB7A 4M78F 3CMAT 4D6WA 4RTFD 1C0GA 1D3BA 3M54A 4R56A 3UDCA 3F9MA 5HL7L 3VEZA 2DD5A 3A8GB 3BDLA 1KQ2A 1BG3A 4OB3B 3JAMM 5G4UC 4O5VA 3SFMA 3VUBA 2P9NB 4BRKA 1N8RC 4WF9L 1YHQA 4A62A 4M7XA 4K42A 2O4XA 4FWRA 5C2FA 3GP8A 4ZGDB 5GIOA 1VQKT 2LC4A 5HY1A 2DEQA 2F7TA 2RJFA 3E9GA 4BR7A 4EPCA 4EI8A 1JJ2A 4HT8A 4NS5A 2XU8A 4BUGA 3R6MA 5FU6B 4BRIA 5LJ3h 5HKCA 4BVRA 3UB5A 2E64A 3PMTA 1YITT 3QBXA 2VWBA 4BRNA 4XQ3A 5AFUH 3WUHA 3PIPL 4LD6A 5LJ3g 2GFUA 5FLXM 4ZTJA 4K25A 3O9UA 2ZJPL 4BVPA 3JCMd 5GAOr 4CBXA 3SAGA 1Z6RA 3EFRA 4BC5A 3RERA 2HF3A 3FJPA 2R5AA 3CC2N 4BC3A 1T3VA 2IVWA 4CRIA 5LJ5e 2DXTA 3CCUA 5AQVA 1VQOF 4I6MA 3C6HA 1K8AC 1RLGA 5CKBA 2DPNA 2LQ8A 3H3OB 1RDWX 1C0FA 2P9LA 3ER0A 3F2KA 1WPYA 1U2VB 3AAQA 4OPAA 4LDVA 1NJIH 5CHIA 5AQXA 3VF6A 4C92C 4WQ5A 3J8AA 2Q1NA 4H0TB 3J81M 3P4IA 3NVMA 2GTDA 1HKGA 3IKMA 3O1WA 3QSUA 4PJOD 1XNIA 4Y28E 2FXUA 1S72T 3SAFA 3V8JA 3JB9J 1NMUB 3VETA 3TU4K 3VV0A 4FPBA 2RHYA 4A54A 5KCOA 1LOTB 4CI6A 1NGFA 2GWKA 1KHCA 3HBTA 3MWPA 1JCGA 4GV9A 3HPWA 3H1VX 1YJNF 3CHWA 4MZPA 5ELZA 3CXCM 3MN6A 1MA9B 1VQ6A 3PIOL 5KQDA 2RJEA 2P9IA 2QWLA 3I56F 4MMKA 1S72N 4FWKA 5J26A 3IFRA 5GINA 1YHQN 4M77G 1QQOA 5LJVA 4OB2B 3MN5A 3I33A 1K8AO 3SWNC 3CD6N 3DB4A 5D6YA 4IWVA 5AQHA 1VQLN 1ZBSA 4JKGA 3H3NO 4DKWA 3CMEF 2XG8D 1VAZA 3M55A 4EI9A 1NJIO 3HJWC 2QEXN 1PXWA 4DOVA 4BRAA 2DJZA 1K8AU 2VXFA 3WXJA 5AQNA 4C5GA 3W3DA 3LGFA 3PTAA 1TUUA 4J6YA 4BRDA 4IUPA 5GAMe 3MWTA 2E1ZA 4M75D 4X3MA 5D6XA 5KPRA 3GPLA 4NO7A 4FOEA 2PQWA 3LDOA 3O9SA 5IT9E 5CQXA 1KXPA 4A57A 3ATVA 2A42A 2ASPA 4M78C 1M1KC 1GO1A 2L5QA 1KQSS 1M4ZA 4GLKA 4L59A 5DM7R 2OAUA 2I7PA 2KHOA 2A3ZA 3JCMJ 3D2FA 2VV5A 3QYGB 4YOXA 4EMHA 4J7IA 2QA4T 3SBTA 4M77D 5GAMf 5LJ5j 3QMLA 2K5LA 5AQZA 1VQ4F 3AY9A 1KC8U 5GAGP 3UKUA 3NMUC 3D7EO 5CKFA 4YTLA 1GLFO 4H0XB 3DLLA 5M1KA 4M78A 3CCVN 1H3ZA 5GAN2 2VYPA 2R5MA 1X7OA 3O80A 1JCEA 3HM8A 3QXEB 1KD1C 4H03B 4BRCA 4JUVA 1M1GA 1RL2A 1Q86C 1BIAA 4CZEA 4BE0A 5C10A 3CJ1A 3V8KA 4JS4A 2HNIA 1X6OA 1HKBA 3FFMA 5AZIB 2XI9A 4QS9A 1JJ2F 1VQNF 1VQMT 5HXUA 3OMCA 1V4TA 1VQ8F 2HBJA 1N27A 3HRTA 5M1FA 4NB4A 3GBTA 3J81E 1ZXOA 3E9OA 2H3JA 2LVMA 1VQ8T 5GMKh 3LL3A 3OA6A 2OZBA 2P9PA 3WT0A 1LOJA 1NJIU 2RM4A 4EHTA 3P31A 2ZZDA 3D2EA 2QQSA 2YHWA 2G3RA 1DT9A 5GAN5 3CCRF 2F9WA 3MCPA 3QFUA 2P0PA 4TVRA 3GOXA 3CCUF 2ITMA 3VESA 2W41A 1MHNA 1JB0E 1VQOT 1KC8H 3LDQA 4M63C 3K9KA 5M1OA 3TU5A 1M90C 4EMKA 2JN0A 1YF5L 4M7AA 5FPMA 3QG1A 4BE2A 3JCMc 2OTJT 5C15A 3ULEA 5GIPC 4O8KA 2ZGZA 5GAEP 3R1XA 4FWLA 4Z94A 4M7DC 3CCSA 1B34B 4MZMA 2NRTA 5AQUA 5LY3A 5I21A 3VGLA 2E70A 2KSSA 5KE2A 1WQ7A 1W42A 1YIJA 4BRGA 5I2MA 2F5TX 2LDMA 3NK7A 4C23A 4J6XA 4J5YA 5AQKA 1NE8A 3QJ6A 3CPWS 2YHXA 1JCFA