2VGNA

Structure of yeast dom34 : a protein related to translation termination factor erf1 and involved in no-go decay.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
382
structure length
360
Chain Sequence
MKVISLKKDSFNKGGAVITLLPEDKEDLFTVYQIVDKDDELIFKKKFDLVKLKIKVISEDFDMKDEYLKYKGVTVTDESGASNVDIPVGKYLSFTLDYVYPFTIIKQNFNKFMQKLLNEACNIEYKSDTAAVVLQEGIAHVCLVTSSSTILKQKIEYDVLKFDEKTEKFYKAIYSAMKKDLNFDKLKTIILCSPGFYAKILMDKIFQYAEEEHNKKILDNKGMFFIAHCSTGYLQGINEVLKNPLYASKLQDTKYSKEIMVMDEFLLHLNKDDDKAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLTGIACILKYPLPDLDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords DOM34
publication title Structure of Yeast Dom34: A Protein Related to Translation Termination Factor Erf1 and Involved in No-Go Decay.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 90
structure length 360
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03463 eRF1_1 eRF1 domain 1
A PF03464 eRF1_2 eRF1 domain 2
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.870 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vgnA01
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2vgnA02
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2vgnA03
1SDSA 1YHQF 3OW2F 1GO0A 1YJ9F 5GAPK 3SIVA 3LWOC 3IR9A 4AF1A 3N4YA 5EWRA 3JCMM 3V7QA 3CMAF 1YIJF 1K8AH 3NK7A 1RLGA 5G4UC 1VQOF 5IT9M 3CCJF 1YJNF 3CMEF 2WALA 3I56F 2I6DA 1X7PA 3CPWF 3LWRC 3NMUC 1W41A 1CK2A 3N4ZA 1M90H 1YJWF 3HAXD 1K9MH 1W40A 1VQ6F 3WXMB 1X7OA 1VQKF 1T0KB 2JNBA 3SIUA 1KQSF 3PAFA 1YI2F 3NK6A 1S72F 3RA6A 1PXWA 1Q7YH 1K73H 4NUTA 3HJWC 1Q81H 3LWVC 3J81M 1N8RH 2VGNA 1RA4A 1VQ5F 3J80M 5GINC 1Q86H 3G6EF 2HVYD 2BO1A 3ON1A 2VGMA 3J7AR 3CCUF 1W3EX 3FFMA 4BW0B 5A2QM 1VQ7F 3CC2F 4TZZA 1QVGF 1VQPF 3CC4F 2QEXF 3CCSF 3I55F 2KTVA 1JJ2F 1Q82H 3CCEF 3RA5A 5GIOC 3CXCF 1CN7A 3CCRF 2FC3A 1YITF 1KC8H 1VQ8F 5GANK 3CC7F 3O85A 3CCLF 1W42A 3CCVF 1IPAA 1DT9A 3LFOA 5EO3A 1NJIH 3CPQA 2LBWA 1ZWZA 5DCVA 2LBXA 1VQ4F 3G71F 3OBWA 1VQNF 3OBYA 2HSTA 5FJ4C 4X3LA 3CCQF 2QI2A 2KTUA 2OHWA 3E1YA 3LWPC 4LCKA 5G4VC 3LWQC 4BY9D 3G4SF 3JAMM 1KD1H 3GYQA 5GIPC 1QVFF 3CG6A 1E7KA 1XBIA 3AGKA 2AIFA 2QA4F 1M1KH 1GO1A 3CCMF 3VMFB 1VQLF 1NMUB 1GZ0A 3V7EA 2OZBA 2ALEA 1H7MA 3MCAB 3NVKE 1VQMF 5FLXM 1VQ9F 3CD6F 3VI6A 2CZWA 4X3MA 4C4WC 2OTJF 2KG4A 3NVIB 2OTLF 1W2BF 1X52A 3PLAC 3E20B
chains in the Genus database with same CATH superfamily
3LPUA 3I8BA 4CJEA 1YHQF 3AVMA 2AHJB 2XHCA 3C9TA 3RYHB 1ZYQA 4JI2K 1HPMA 1WLPB 3V7QA 2HHSA 3M0QA 7AT1B 2VQEK 5G4UC 3D2EB 3AARA 1BI3A 5FLXE 2LC4A 4W5TA 3HP6A 3HK2A 1IGUA 1O1WA 4F8RA 2I6DA 3S0YA 1HX1A 3PFSA 3JCMX 2DEQA 3EH1A 1QZ6A 1QCNA 2X51A 2QG9B 2ITGA 4BVRA 2UUBK 1W9HA 2C0OA 4U3JA 2E10A 4BC2A 2O4IA 2DF6A 2ZJQL 1RTJA 3CCRT 2KRSA 4LFCK 1AWJA 3RDVA 1Q81O 1WIEA 1NK5A 4A61A 4HVJA 4LF7K 5EB1B 2HRYA 2YKNA 4BUGA 4I2PA 1V4SA 3WPWA 1WHGA 3CBOA 1TK5A 2G8KA 2IPOB 2JMAA 4ME7A 2I0NA 2J7IA 2XG8D 3PVLA 3A8OB 3CCSQ 4D8DA 3LDNA 5I11A 3NTKA 1B34A 2YLCA 1PKTA 4CJFA 2YJFA 1NMNA 4VUBA 3CPWM 4C8QF 4E0DA 4GKKK 4FFBB 1Q86U 5F2RA 3O4WA 2FF6A 1W3EX 3KLIA 5IH2A 3R6MA 4M3ZA 1MV0B 2X4WA 3CCQT 2GBQA 4TZZA 3CC2F 1E7OA 1NPPA 5CB4B 4AHSA 5FNVB 3H46O 4FWOA 5M1QA 4Z89A 1IO6A 3RR6A 2E70A 1QVGA 4HCCA 2RI2A 3VENA 4OO1J 3WGLA 5AQXA 1RBSA 3M5RA 1KC8O 1IXDA 1NJIC 1BI4B 2CGKA 2Y4YA 3EL2A 3GNFB 3ZSRA 1Q7YR 1NGGA 3CCLN 2D0AA 5HCKA 3O4NA 4DQ8A 5GAMe 3FD5A 1HNWK 2F2XA 4KH0B 1NLVA 3AVAA 1LOTB 3TU5A 1L3TA 5GAN3 4BDPA 2FG0A 2V26A 5IJ9B 1SKUB 4NLCA 1VQMT 3RYIB 1OZ3A 5TKWA 1NGEA 4M77B 1NYFA 3H6EA 3M9QA 1G83A 1AD5A 4M45A 4CHPA 2NRXA 4R40B 3J7ZO 4MDWA 5LP6B 3AVFA 1YIJQ 1NJWA 3LDQA 1SA0A 4QVCA 2ZF8A 5CA0A 3MQWA 3ID6A 4L5GA 3MP6A 1SV5A 3BDPA 5G4VC 1Z9QA 2I5JA 3FFKB 2V1RA 2W10A 4C5IA 5GAOr 1M1KC 3V81A 2VXFA 2K3XA 1SKSA 1Q8IA 4FYDA 4CIGA 2Z01A 3V8LA 3I55A 3OW2P 1YWOA 1PKSA 2WSEE 1K73R 2NNWA 2SRCA 4X62K 1ZHIA 4J2AA 4FZZA 5IJ0A 4RG2A 1LAWA 1OH6A 1TVKB 2KT1A 3MEUA 2QGGA 4FM4B 4AHTA 4YOYA 3QDFA 4JLIA 1M27C 1D1BA 5KQ8A 2EQMA 1NK8A 3DLHA 4W5NA 5JLFA 2R7YA 2FSNA 1EZZB 2VUBA 4EMKB 5KYXB 1KFSA 2KXCA 1GCPA 3HSCA 1MNEA 1FNKA 2HMAA 3SUOA 1K9MU 4X20A 1QSYA 2OTMA 3JALB 1P90A 1QVGS 2OA8A 3JB9F 3M55A 2ZVYA 5AQYA 3C7NB 3V8JA 1ZUUA 1WI7A 4YOVA 4CGFA 4LH5A 4M7AF 4HUEA 1ZBIA 2H3EB 3NF6A 5B8HA 3OW2F 2XK0A 3CJAA 1I8FA 2K2VA 2FL7A 3CM6A 4OKEA 1IV4A 3TAGA 2HW3A 3AVIA 3AHUA 5GONA 3VESA 1YIJF 5ITZB 3OYIA 4DTOA 1VQNT 4DQPA 4GY5A 3VS3A 4B5CA 1VQPT 1M2VA 1NGBA 2QWPA 2WALA 1YJWN 4EI7A 4DXDA 2B5JA 1G5VA 4CZLA 2ITMA 2I2LA 3PVQA 4DQQA 1SEMA 3F73A 3I0SA 1W41A 4PK4A 4O2BA 2VAWA 1UB4A 2EYQA 5GAMf 3P38A 2ZPFB 1K9MH 1VQ6F 4WCIA 3F0EA 3THWB 3KFVA 5MN5A 3EFOB 2ZPGB 2XU8A 4O4IB 3HRUA 4OMFB 2OPSA 4FWPA 4O8UA 2G3RA 5C12A 3JYTA 3THVA 4KB1A 4ZHYB 1K8AC 4WBNB 1ITGA 5JVDA 1S72F 3SQ2A 3UT5B 5BR8K 4FSVA 1AHJB 4ZOLA 2LTOA 3RMQA 3J81M 2FLOA 3JATB 1S1WA 4CGIA 4ZGEB 1N9SA 2RHXA 2D1KA 5GANj 4L8RB 1X6OA 2DXBA 4C0GA 4A4GA 5LL6Z 1L5UA 4ZTFA 5JQGA 2YNHA 1HRHA 3H8ZA 2KMTA 3CCRQ 2P9IA 1ACMB 4I6MA 1ZC6A 3ZT0A 4PJOE 1YXQA 3ZSVA 1KNKA 3JVHA 5LOVA 1S1VA 2QWOA 2D6FA 1QMCA 4LDVA 4B9SA 3N2GB 4DU4A 3CMEA 3S9HA 3NMUA 1BBZA 3QHDA 1R1MA 3O8VA 1X01A 1TUGB 1QZ5A 1VK0A 4Q5WA 1WAJA 4B9QA 1XHZA 4OVLA 3ERNA 2H8CA 4NO7A 2E6NA 4KPYA 2HQHA 1EWQA 3OYBA 2JS2A 3VYHB 2YRVA 4OMQA 1RTIA 1KQSA 2QA4T 5LJ5g 2QDLA 3OYNA 3CCMT 3MEDA 1MA9B 3CCQQ 5A2QE 2PNIA 3SAHA 4X66K 1WXUA 1CLQA 1XTDA 3WJPA 5KPZA 3QYHB 3VQQA 4M3WA 2KW4A 5AQLA 1X9MA 1DJ7B 1S1XA 5AQFA 2FSKA 2DL8A 2F2WA 3GPLA 4FJ7A 1J5EK 3NGYA 4B1XB 5J2TB 4DV4K 2KFZA 4Y92A 3HKCB 1OH5A 1O75A 3G71F 4BT6A 2O8CB 5C0YA 2OTLT 2NWMA 3VQ8A 1BA0A 5FJ4C 1OX8A 1LW0A 4EFHA 3RRHA 3ZT4A 3SIVA 3BEXA 1IBLK 2O8DA 5HY1A 4CZEA 3OY9A 2F9WA 1HJRA 4FLUA 1UA0A 5E26A 2D4WA 5GAMh 1DBFA 4GW6A 2O8BA 1ZBLA 3GYQA 1VQMQ 5KTQA 3R0PA 1OULA 2DVJA 4DUYK 2O2OA 4DSJA 3LWIA 1TKXA 2QW9A 3HVTA 2CZ1B 4M7DA 2VG5A 5LA6A 3V1OA 4KRFA 2KK4A 2RI5A 1Q86R 3D7SB 1VQ4N 2CZ7B 3MXJA 1NMUB 3UKUA 2QAZA 3X25B 1MDUB 4BDZA 3T1AA 3EG1A 4H5TA 2PZSA 1YI2T 3A5ZB 2L2PA 2GUPA 4GY2B 4JD2B 1M30A 1KVBA 2D0CA 2KGTA 3IS9A 3V4IA 5JH7A 5LJ3j 1OEBA 3JAME 2DFEA 4PNOA 4LSNA 3U6FA 1X9SA 1J3TA 1HQUA 1N6QA 3JAWB 5EYPA 2H6LA 1YHQN 4E19A 3M84A 2AP1A 2FBYA 2DEUA 3HHTB 4CIEA 2FRYA 5IT9E 3OS2A 3PIPL 3NGIA 3TAQA 1TK0A 1KQSS 3MXMA 4M3YA 1WFWA 4FO0A 5KH6A 2AZVA 3RSEA 4HUGA 1MGQA 4YTLA 4JK9A 4NLBA 3IR9A 3CMAF 2BIVA 4KGZB 1NGFA 1RGIA 3OMCA 3QSUA 4B8AB 3ZO8A 5IYZA 4M63C 3HPHA 3N4QA 4TV8A 3FEOA 3DB3A 2XRIA 3SV3A 4B9TA 2KZMA 3G4SA 4KH6A 3NGZA 2EWNA 3P8BB 3EGXB 1UFFA 1UFYA 3VS7A 4WF9L 1QP3A 4BR9A 3FZMA 1BGXT 3M8PA 4PKIA 4BRHA 1P92A 4R0KA 3EG9A 4CBUA 3NH1A 4LNUB 4NL2A 5IHNA 2P9SB 2WONA 3VTIC 3QDRB 5M9OA 1GOBA 1DKGD 2RHYA 2XICA 5AJ3K 5J2UB 3OYDA 4EI8A 2F5KA 3CCLT 1VQNQ 2DA9A 4V2SA 4HTUA 1SPKA 2COWA 2Z1JA 2GFUA 1VQPQ 5AZJA 1ABOA 2NRZA 1GX1A 3J80M 4M78E 5KMGB 4LUDA 1IRXA 2BTFA 3HP9A 4DLGA 3ID8A 3ITHA 3RVCA 1Q9YA 3TREA 3CETA 2A1RA 1W57A 3CC2N 1K4US 1BQNA 3OJUA 1ZBUA 4FWKA 5JVHL 3CCUF 3PMTA 2DL4A 4PJMA 1RDBA 2RF2A 1JJ2M 1B9FA 4BRIA 4J6WA 5CA1A 1WDXA 3HKDA 3RYCB 3L2VA 1SHGA 1FX7A 1HYVA 3V9ZA 4CBXA 4YNQA 3PX4A 3SUPA 3LGLA 2BZYA 4F7UE 1K9MR 1TAQA 2HX0A 3CF5L 4AT1B 3O9QA 3R9PA 3W0LA 1YAGA 2D0OA 2FB7A 4BG8A 5C2DA 3K59A 4OF1A 4PFOA 4WF2A 3V9UA 4BRLA 1VHAA 1SRMA 1VRTA 2PMPA 1VAZA 2K5LA 3L6QA 3H0FA 4LC9B 4G1QA 2W42A 4C8EA 1XC3A 5AQUA 2RPIA 3REAB 4LF6K 4NCBA 1UOCA 1QAHA 3GOIA 1QP2A 3QIPA 3VEWA 1NJIO 3QO9A 4BGAA 4FYYB 2PUKB 4TSXA 4CZJA 4UC4A 3HOTA 4OKKA 4J2DA 3OYJA 4PA1A 4RCHA 3LWMA 4PJOA 2ED1A 4BD3A 2GX9A 4X1KA 2KNBB 3SWNB 1J53A 4RW6A 3CCSN 3V9SA 3RKXA 5MN6A 1VQNF 5CY4A 4DFPA 2PY5A 4LDYA 1WZOA 4AM6A 4IUUA 1XQHA 2QI2A 4TVRA 1S3XA 4DTRA 4JKFA 3F0GA 2OANA 5DY9A 3INZA 5GMKe 2QA4Q 3QNOA 3CCMQ 1W581 2FRWA 1ZBSA 4ILGB 4ZK7A 3PSIA 4C8QB 1JCFA 3VQCA 3K12A 3OYCA 2ZGZA 2RM4A 3BY5A 2DD4A 2DPNA 5CKDA 2XIDA 2Z1UA 2VWFA 1M1KO 3NAEA 1NK6A 1YJWT 2OTLQ 2CP7A 1TV6A 1VQKT 2O4XB 2X74A 2I7NA 3GNGA 5GAGP 2CVLA 2D1XA 3KWIA 1O13A 4JNEA 4X34A 1YGYA 5FLXM 2RH2A 2QQBA 3PGGA 3VI6A 3M6GA 4KUDK 1I3AA 1NG9A 1HPZA 2CH6A 1KRPA 2BKDN 4ZI7A 4FJ5A 1NBWA 3A5MC 3ZBDA 2L0AA 4RW7A 2P5GA 2DY4A 3G7ZA 2Q3SA 4CFAA 4CJKA 2HHQA 5EB0A 3WJRA 1TOVA 3H9NA 4CK2A 3CCVT 2DVEA 1YIJN 5CQXA 1MV3A 1GLBG 1L3SA 4BVTA 4YJ3B 1WUAA 1K8AH 4C92B 1YI2Q 4QS7A 1OQKA 2CP5A 1QU9A 3I56F 1H8KA 2HAXA 1XQSC 2VYPA 3ME9A 1T3LA 5GAMd 1VQ6N 4AFZC 4KGXB 1RILA 1PSEA 3B6OA 1ZSZB 3MN5A 3IKFA 1YVUA 3EN9A 3J7YP 4FWRA 3UKRB 4LF4K 3MDOA 1KAZA 2KRMA 4QQGA 3A8LB 1I81A 2YUPA 1Q82U 1JEGA 2E88A 3OW2M 3TCJA 2KVQG 3M0RA 1QQMA 3W3DA 4NL3A 2G9IA 4O2AA 4W5OA 4HNAB 4Z4GA 4CJTA 2WFBA 1JQQA 4E7LA 2BGGA 2WSFE 3JXUA 3GLXA 4A63B 4DR3K 1K8AO 2KT8A 3SAFA 3VCZA 1VSLA 3M5AA 4JI3K 2OTJA 4XEIA 4CRIA 1WBDA 3G6EF 2HVYD 3ON1A 1QWEA 2DAQA 2VV5A 1W55A 1W59A 3J7AR 1QS4A 1GLEG 3VEVA 3R6NA 3Q1JA 2J6FA 3O9TA 2RHLA 2R5MA 2YRCA 5FU7B 1ZBFA 5SWMA 3NCIA 1UGVA 1YJ9A 3HPOA 1HYZA 1BU6O 5HXUA 4O0IA 1TYQA 3H0IA 4O4HA 1NJZA 3CCLQ 3LGFA 1Q82H 1H92A 4Z4FA 1B07A 2D8JA 4WQ4A 4F3OA 4LSLA 4H5NA 3CCEF 3ZT1A 4BRKA 2B6AA 5GAN4 4AILC 1RT7A 1MMAA 2LJ0A 1T6CA 3CCJT 1X75C 4M78A 4M75G 2HS4A 5GANK 1U6ZA 3EO3A 2RNAA 4C0DB 5J39A 3U23A 1H3HA 2P9UB 3HM9A 4FWMA 4JAXA 2UXBK 1M3CA 2J05A 3CQ8A 3D0PA 1QCOA 4D6WA 1TK8A 1S1NA 3O9UA 4Z4CA 1YQNA 3OS5A 4J8FA 2FZKB 3AVKA 4EB6A 4U7BA 1Y57A 4F7UA 1KAXA 2ATQA 2ZPEB 3QIIA 5GAN7 1RDAA 3L3VA 3U3GA 2XY7A 1Q82O 1H48A 2RMOA 1MUZA 2L89A 3RYHA 2L5QA 5L8RE 5EG2A 3FDRA 1RADB 3T80A 3U0OA 3MEAA 2MMPA 1TWBA 2KTQA 1YHQT 2RO0A 5GMKl 4MDAA 2QK9A 1G99A 3HOSA 3E2UA 2MAMA 1X2QA 4KBMB 3KWGA 2HKQB 4FW2A 3RE3A 1QW1A 2LQWA 5CO7A 1VSFA 3MO8A 1RQ7A 1OU8A 2UYNB 3L7QA 3HSBA 1XV2A 2HP3A 2JW4A 4CZMA 4EIKA 3VMFB 1YITA 1VQLF 1VQ8A 4O55A 5HP1A 1BCMA 4LDWA 1LCKA 3OYMA 4PJOD 4J5YA 1YVNA 3KK3A 3SQ1A 4M42A 5HKCA 1D9FA 1HUXA 5GANg 2QWRA 5GMKh 4YJ2B 4J8OA 4BC5A 4N0AA 1GFCA 3S6WA 3SMPA 2JUFA 1HR0K 2G8VA 4CJLA 4FFBA 2DD5A 3TSQA 3KZBA 3OYFA 1V76A 3CMAN 5AQGA 5I2SA 1YJWQ 2E65A 2HSEB 1M90C 1C6VX 1VQKQ 2DRMA 5CB4A 2Q97A 2LCLA 1AVZC 1IV0A 3CC2T 3CQTA 4BT5A 2QWQA 4V19S 5FNVA 3QYGB 2KEAA 4AQYK 5AQVA 2CUBA 6AT1B 3NH2A 1SHFA 1C0FA 5CYQA 1VQMN 4B9LA 1X7PA 3J8AA 4FYVB 3ZP7A 1BI4A 4A53A 3O5BA 3L4IA 4M75E 1QVFA 1NGCA 1X7OA 3A8GB 1N8RC 3MHXA 4DHYA 2FC0A 3CCVQ 4BRDA 3OMGA 1W6XA 5CE3A 1FNJA 4J9IA 3HRTA 1K8KB 3VO8A 4DTUA 3T69A 3QXEB 3HSTB 5CKHA 2HQXA 1KQ2A 3RYIA 4HWIA 5JCOC 2NUZA 2QQRA 4F4KA 2AIRB 1NOZA 4I2QA 2DTHA 4M77A 4JK7A 4CHZA 2VGNA 2RF0A 1GCQC 4DR4K 2P0PA 4X65K 4N5SA 1EXQA 3CCUN 5LP6A 5BRFA 3JARB 2CZ6B 4CGGA 5MN4A 4FJIA 1BK2A 3WXKA 4C8OA 4DSKA 3VQBA 3FFMA 2O9SA 1KIKA 4OPHA 5A2QM 3C9RA 4X64K 3C8LA 3JSMA 1N36K 4KHUA 2XMFA 4ZN1A 3EGDB 4ANJA 3L2WA 1SL0A 2QEXF 4BT3A 1H1VA 2CP3A 2A37A 1NU0A 2YLBA 1YJNA 4WQ5C 5CZ1A 1NOYA 3KTQA 3LAMA 4BY6C 2OPPA 2P9PB 3BZKA 3HJFA 4B3OA 2K3YA 3K57A 1N34K 4CF1A 1TVKA 1LWFA 4HCBA 3U4LA 4CF2A 1U3OA 4RW4A 4FVMA 4DRXA 3AGRA 3A1PA 3UA6A 4GNIA 4E6RA 1J54A 4KO0A 2K6DA 1K76A 2PQWA 4DR1K 2AJQA 3CC7F 1TUCA 1Y0MA 5BRDA 1R0CB 1KD1U 1RFQA 1XWLA 4EMKA 3P83D 5KYXA 1M5Q1 3M4YA 3M8SA 5LJ3g 2E5KA 1Q95G 3DOKA 1YUWA 2MIOA 3IDHA 3K58A 4FM0A 3CCVF 3JALA 2EJ9A 1IPAA 1M3BA 1N32K 1VQNN 2LJ1A 4ELYC 2LBWA 4FJNA 4LNPA 2PVGB 3C7NA 1QVFS 4CFCA 1VQ5A 1CXUA 5GINA 4FK4A 2K1SA 2K4YA 1GLAG 2YHXA 3O5ZA 1C0UA 4R79A 4CJRA 4OPKA 2P0QA 3CCJQ 2HHTA 2HDAA 3H6ZA 1H3ZA 4RTZA 1Q82R 5ITZA 1HNZK 2CSQA 2ZPHB 4JK8A 4CGJA 3JAMM 3L42A 4OB0B 3PIOA 1KD1H 1B7TA 5GAOm 3VUBA 4I4TB 2DETA 4MDBA 2B86A 1TUBB 4KHQA 1G3YA 1TXQA 1PWTA 4M78D 3VQ7A 4KHWA 1JLAA 3AO5A 2DXCA 3THWA 4YDUA 3CJ9A 3RRGA 3EFOA 4O4IA 1RLPC 1VQ6T 3UE5A 3UDCA 1J9AA 4DQ2A 1GO1A 4ZTJA 4CGHA 4FLZA 2GTOA 4WBNA 4A4KA 2IVNA 3RBBB 2P4RA 4JI7K 5A0DA 1YHQQ 1V4TA 5IXBA 5GMKi 3NMZC 1I39A 3DMJA 1S72T 4N4IA 2DERA 3C6UA 4IO9L 3VTHA 3JATA 2RHKA 4C8IA 3IUCA 2O01E 2JVVA 2MCNA 2P1JA 1HLUA 4FZYA 1X3MA 4O5VA 2M0OA 3KK2A 5LYJB 5C2FA 1AZGB 1UHCA 2B4JA 3PLAC 1EFNA 2AZSA 1SDSA 4M41A 1Q81U 5HRRA 1ZBJA 3L0QA 1S9GA 3VS4A 3M53A 2I7PA 4AF1A 3I56N 3N4YA 4TUYA 1NGAA 3ZEUB 4E1JA 5KX5B 1WHMA 3D2FB 4KHYA 4PHTX 3N2GA 4AMCA 3CCJF 4UQGA 3DRRA 5HOOA 1ZUYA 2P9NB 4RW9A 2YUQA 3VRZA 2OZMA 3C6AA 4DFMA 4DBFA 1ZUKA 3N4ZA 4EIAA 2E5LK 1B92A 4CJ5A 1X9JA 3DLKA 4AFUC 3JCMJ 2EJFA 2DTIA 3GP8A 5FWCA 4WTOB 1JU5C 1JJ2P 2RHOA 3THXB 1W1FA 4FYXB 4ZGDB 5C0MA 5KYYB 4B62A 3H0HA 3LDTA 4M7DG 3B6NA 2F96A 4FLXA 2V7YA 3CC2Q 4K25A 1Q81H 3VF2A 4NCGA 3G6EN 4A4EA 4H4MA 1MMGA 5AQTA 1C0TA 3WGMA 2HF3A 1KC8U 3K5NA 3V9XA 2DRKA 3LWHA 2W41A 2QDYB 4CI0C 1JLQA 2O8CA 4IIJB 4ISFA 3DWLA 2RJDA 4DQSA 3G71T 3CD6T 2D5RA 1D3BA 5FU6C 3C9UA 3P39A 4BRMA 3MWTA 1WB9A 4DTXA 1ZQ1A 4AFSC 1UGSB 1FWZA 2ROLA 3NTIA 4M75A 3L1AA 4FSSA 2B33A 3L2UA 5I42A 3VS0A 2ETJA 3TQ7P 3CCEN 1YI2N 3I55F 4CVNE 1JJ2F 2JM9A 3HI0A 4F7UB 3ZL7C 2BTQB 1TS9A 3A8HB 3FJPA 4CF0A 3MMVA 2W6KA 2Y1JA 4I55A 3L2ZA 3CQXA 3O6WA 2BH1A 4C92E 4IURA 3FFIA 5HRSA 2M9UA 3DLLA 3T1HK 1KC8H 3IG1A 3PT9A 4M3UA 4JD2A 3FC3A 1QLYA 2IG0A 2X4JA 2ZM6K 2M16A 2OAUA 2CZ0B 4XH1A 4B1YB 4W5RA 3KJVA 3UF4A 5KI6A 3E9PA 4M7YA 3E22B 3LFOA 4E7IA 2K2MA 4IOCL 3JASB 5KPTA 2A5XA 1PG5B 5K14A 1XC9A 3JAWA 4OPAA 2YXZA 2LBXA 1XJWB 4JRPA 2OCEA 4BT2A 4Z8AA 3PMIA 2WBNA 1JXEA 1KQ1A 4EPCA 2KXDA 3DRPA 3O3GA 4FJMA 2HVHA 1K1ZA 3EHRA 4BR5A 2ZPBB 3QFUA 2GELA 2X3WD 3E1SA 3LP3A 5EU7A 2ECZA 3X28B 5ADXH 3CMAT 3KVGA 2RHUA 2GUIA 3AY9A 4BRCA 4YORA 3CC4A 1E3MA 1X25A 1KHCA 3O85A 3SI6A 4ORZA 5JS1A 4OMNA 3SPYA 2EYYA 5CIUA 1S9EA 2E20A 3HRGA 5AQIA 3RMDA 1VUBA 1OZ2A 5LJ5e 5JMVA 1VQLN 1T0AA 2UYKA 4OMOA 2A7YA 3FE1A 5EY4A 3TAPA 1GL5A 4B3MK 4CEQA 2X35A 4XH5A 1Z25A 4M7DE 1TGOA 3RMSA 1WNSA 2P9SA 2XKOC 4LNUA 1VQPF 1WHHA 2P9LB 4PLIA 1D1CA 4YOWA 5J2UA 3AV9A 4PY5A 4B3RK 2VASA 4G4ZA 3NVKE 1KFDA 3PY8A 4XCQA 3SV4A 1KQSP 4AG2C 5KMGA 4C4WC 3DLGA 4B08A 5ADXA 2GV9A 3G25A 5JS2A 3NVIB 2X9HA 1OX9A 1CSKA 1VQ4A 4OJRA 3ZLJA 4K41A 4RUGA 1LNXA 3ZSWA 2F2VA 3OB9A 5F0XA 3NBPA 4PJOG 2RI3A 4DSIA 4PWDA 2AK5A 1VQ6Q 2LRQA 3IEWA 1J7HA 1SZQA 3CCUT 2LBTA 1KD1R 3RYCA 4KULA 5EWRA 2E1HA 3NF7A 1BIZA 1UAXA 1VRUA 4KB0A 3CMEF 1S72Q 1KLMA 5EC7A 3TAMA 3CBMA 3CFPA 1PRMC 5C15A 1SSHA 1HMVA 3RMBA 4J7FA 4XTXA 1YTAA 1NM7A 3EZWA 4IG0A 1JLBA 2FPFA 5EOYA 5J2MA 4FJGA 3VKIA 1S22A 2C0IA 2P84A 2HSPA 3OSSC 4XTUA 5TKYA 3DLBA 3M8RA 2D0NA 3DXKB 1TAUA 1KQSF 3J80O 1QKWA 3SCXA 1ASUA 3AA5X 5I22A 2OZSA 2GWJA 1RACB 4XU3A 5BRHA 2W6LA 1DLOA 1YF5L 1N8RO 5C8YB 3SUNA 1YWPA 3ZX3A 4JKHA 4NYFA 3LWVC 2QWLA 2ZD1A 3F5TA 4FWSA 5FROA 4JS4A 5CZ2A 4DV5K 3SWNA 1ATNA 3PTAA 1JN1A 3L8BA 5FDLA 3META 4Z0UA 4PKCC 3ELCA 4OLBA 1I94K 3T3FA 3R1XA 2VGMA 4FJJA 2F8SA 3P0ZA 3EORA 2QEXN 4IJAA 1S6PA 1XMQK 3D6RA 1AZEA 1TH7A 1M8VA 1VQKN 1U5SA 1KSWA 1TKDA 1BG3A 4IJNA 2ZF5O 4C8QA 2NRWA 5LJ5f 2HEQA 2HP0B 4G4YA 2ENMA 3CYPB 2QTVA 5AFUH 3H1QA 5M1FA 2LX7A 3HT3A 4O4LB 1ZX6A 2ESWA 1VSJA 1UG1A 2E1ZA 2Q36A 3ENHA 4CFBA 2E5QA 3S0HA 1QSLA 4QKUA 4K8XA 1CN7A 2ZE2A 5HY0A 2G6FX 2XY6A 3HTRA 1VQOT 3G71Q 3CD6Q 4J9HA 1Q18A 1JY8A 1U45A 3RMAA 2IGIA 1Q81R 1UI9A 4C82A 3CCVN 4A2AA 5LMNK 3OQ5A 1UGPB 1QHTA 1UWBA 2EWCA 3QUWA 3LH5A 2HQEA 4IFEA 3M59A 3SBTA 2JLEA 2HB5A 5BMVB 5DLOA 1PRLC 2DXUA 1SF9A 3DAWA 5EO3A 2DILA 3L2RA 2BE9B 4DSEA 3CPQA 3G1JA 4ICLA 1BI2A 5DCVA 4JI5K 4FOIA 3UB5A 3WNGA 3WPXA 1KVCA 4M75D 2HNYA 4FWQA 4J9BA 2B8AA 2EKOA 1GFDA 4YJ3A 4A5BA 1X1PA 4AHRA 1NYGA 4J6YA 1TKTA 3A5OC 3OHRA 3H41A 4C92A 2HQSC 2RHJA 1HYSA 2HNZA 1LV5A 2RHIA 4C5GA 4I50B 2RA2A 4IUQA 1YT3A 5M1PA 4GV9A 3ZSXA 3G4SF 3CBPA 3CCSA 4QCLA 2V9YA 3VQ4A 3I56T 1ZSZA 1JKHA 1KC8R 1TKZA 5BPNA 1VQ7T 1MHNA 3UKRA 1QVPA 5CKEA 3HYFA 3JB9H 1ASWA 5FLXO 1XBIA 3V1RA 4JKGB 4JI8K 1FMKA 2QQSA 4XU0A 1C0MA 2OJ2A 4DBHA 5C25A 1IO2A 2CDTA 3KJKA 3LAKA 4BROA 3REBB 3IKMA 5BPLA 1CLIA 2Z1EA 3THYB 4F2SA 1CZ9A 4BB7A 4HNAA 3CD6F 4DF8A 4M78G 4QQDA 5AQNA 3CMAQ 2FBVA 1Z9ZA 4M78C 4KH5A 2MWOA 2RE2A 1SL2A 3OYKA 1JFFB 2UZHA 1ILYA 4EHTA 4BREA 3CFRA 4M8IA 4FSXA 4FL6A 4MO4A 1D1AA 1NGJA 1RT6A 3A98A 4JS5A 3MXIA 2E2PA 3G6ET 3JAKB 1ZSGA 1RAGB 5LJ5h 3QJ6A 4IWVA 3M57A 3CCJN 4XU2A 3RMCA 3WNFA 3LWOC 4F7UG 2KI7A 4CBWA 3A2FA 5HP7A 1VYVA 3MECA 3HO1A 4LD0A 3MP1A 3HKSA 3VEYA 5IHIA 2ASPA 3A5NC 2UYPA 3M56A 4DWIA 4B9MA 2QK0A 3NVKA 2CT3A 4X1YB 1YIJA 2Z1GA 3CCET 3O8MA 3GDQA 1XMOK 2G8WA 1W40A 4HHTA 1TUUA 4KHNA 2ASMA 3DC2A 3DM2A 3PUFA 4DS5A 2Z1TA 3SB2A 2P9UA 2FPEA 1N5ZA 4BI8B 3JCMb 3CCUQ 1A0NB 5A0LA 2EHGA 4BR7A 1PXWA 4JI4K 2VAPA 2LP5A 3VOVA 4CEOA 5FPEA 4LDXA 1L3UA 4KI6A 2NUTA 1WSHA 4XTVA 4PJJA 1HKBA 5H1SQ 2Q0UA 1NE8A 3VEXA 4F14A 4CJPA 4CF9A 5KQDA 4LFAK 4LD9K 1IKYA 2WUSA 2YNGA 4OPJA 2P0KA 2R58A 5J26A 1OKJA 1DTQA 3ZX0A 1QVGM 2MPXC 3PE0A 1GBRA 4ELUA 1VQ9T 1D4XA 2NUPA 3NTHA 3AO2A 1XHXA 1FMVA 1MU2A 3IRXA 4N0AC 5LMUK 1NJIU 4MO5A 4BACA 2ABLA 1MMDA 2LJ3A 4M7XA 4GBQA 4CZHA 3QESA 5EIBD 5AQKA 1B34B 1EX4A 3NPFA 8ATCB 2MQEA 2GQVA 4WCEL 4J9EA 1AWWA 4IG3A 3WVEB 4M3XA 3H1VX 1HK9A 1WQ7A 1G8XA 2DJZA 2LDMA 2CT4A 3F2KA 4BE1A 2UYNA 4DQIA 2JTFA 2OYQA 4JJDA 1TL1A 3TTFA 2GFAA 5GAEP 3QEXA 3S0WA 3FGUA 3GG4A 5KGWA 3BDLA 4IUPA 4ZGJB 1VQLT 1B9DA 2HVIA 2UYJA 3M0PA 1REVA 3AO3A 4FWLA 4YJ2A 2Z0WA 3C12A 1OV3A 3FRNA 1NJIH 4DS4A 2ZGWA 4RTTA 1OU9A 1M1KU 1IKVA 4IDHA 4CJUA 2HNDA 3MCPA 5FPDA 3SPZA 5EZYB 3DLEA 3V7CA 1F21A 3PX6A 5J2QA 4M77G 3MWPA 1VQOQ 1VIFA 2LT1A 2KTUA 3VS5A 1WYXA 2YHWA 3HZ6A 4BE2A 2QQ9A 5LP6C 2ZZDA 4E3SA 1NGIA 4CEAA 1XHOA 2ZAUA 1HXDA 5DM7R 5GAN8 2MF2A 3ZSYA 2VQFK 1X9WA 2HNIA 2GWKA 3JCMg 3DLMA 4YY3K 1U47A 1FW6A 1NLPC 3K0TA 2O8FB 1M1KH 3CCRA 3D00A 1ZLMA 3VERA 4J9FA 5GAN6 2CP2A 1EQYA 2LNVA 1BI0A 2MI6A 2E2QA 2G8UA 3LX7A 4BR2A 5IJ0B 2QYZA 4KRTA 1SUQA 3QZ5B 1WJSA 3RERA 1TUYA 3TD4A 4Y1DA 1ZBXA 2DNUA 2FZCB 2LVMA 1XI1A 2DL7A 2A40A 2OTJF 1RDWX 3I56Q 4BE0A 3JARA 5J2PA 1VQ7Q 3HFOA 3OYGA 3JB9J 2LNHB 4JJCA 1ATRA 1ESVA 1IH7A 2DK3A 1W0HA 3MEGA 4C92D 4K11A 2DL5A 4PKHA 4BRGA 1RAFB 4MLEA 4CFDA 1L3VA 1OFUA 2VYTA 3CCQA 3CMEN 2KR3A 1YJ9F 4N56A 1RLGA 2V8JA 2QWMA 1PNJA 3LWLA 1VQOF 3SQ0A 3FZHA 1JXMA 3CERA 1K8AU 4IIOA 4DB3A 2E2OA 2QEXT 3O1BA 3M54A 2P9PA 2RHHA 2E4LA 4BY6B 1C6VA 3LWRC 1Q7YC 3C0CA 1IZ6A 1WXTA 3CPEA 2I6RA 2JNGA 2LQNA 4M78F 3MEVA 1LWEA 4YOXA 2R751 3JB9I 4BRQA 4ERHA 2KE9A 5GANe 3G6EQ 4JDSA 2RB6A 3CC7T 1IG9A 4O2BB 4CHOA 2Q1YA 3EKSA 5AQMA 4H0XB 1X3NA 1XNIA 1VQMA 5AQPA 3ZETB 3QFPA 4BR0A 4C1NI 2Q1XA 4HVUA 3AVNA 1JBMA 3MJXA 4CEBA 5A2QO 5KPRA 2X4XA 5EX5A 3M0TA 3N5BB 3SAGA 3RA6A 1TG0A 1WJRA 4F7UF 4M77E 2CYZB 3TSPA 1W2BA 3CCEQ 2BZXA 3QBYA 3GL1A 3GBTA 5FPNA 3QHSA 2ZCFB 3E9GA 2O88A 2IVWA 3S3NA 4M7DD 4FJXA 5LJ5d 1VQ7F 1KQSM 1FK9A 5GONB 1WSEA 1K73C 1RI0A 2YT6A 2EGCA 1VIEA 2NYSA 3HBTA 2HHWA 2VWBA 4IZ9A 2KTVA 4I4TA 1BISA 5JQGB 2MYSA 1S72N 4LY7A 3MEEA 4CGDA 2GBZA 3E9LA 1PF5A 1TUBA 2GTDA 2P9IB 3GBQA 5GIOC 1CXQA 3QIOA 3VN5A 2EFIA 2P5OA 4JYAK 2BE2A 1RABB 3LDOA 4FVUA 1VQ9Q 3F0FA 3LH0A 3QUIA 1YITF 1VQ8F 1VA7A 3AAQA 3MPUB 1RAAB 2Q0RA 1IV3A 5GJVB 1IJJA 3CJCA 3VPZA 3PO5A 3LZJA 3P10A 1WSIA 3AA3A 3KJJA 3JCMP 2PVOB 3S02A 1W70A 1BI1A 4JJBA 1GXIE 1GLCG 3FZFA 2OI3A 4M3RA 1UGRB 3U9ZA 3JAMO 2KYMA 1TVRA 4CC3A 4AM7A 5HY4A 4G4VA 4AH9A 3VJPA 4B9VA 1ZA1B 4B1WB 3ZT2A 2CGLA 4M7AB 1N27A 4IFVA 3G4SN 5KX5A 4E7ZA 3D2FA 3BZCA 4JRIA 1VQLQ 1VQNA 4MLHA 1HJDA 1C1CA 2EPDA 4BY9D 2RJCA 1VQPA 2O31A 2P9NA 2X78A 3M1XA 2RPNA 3I5SA 3WXJA 1WHKA 3S41A 1LVKA 1U4BA 4M75C 1W2BS 3MP8A 1R59O 4HCKA 1NNEA 1QVFF 5GANf 2EQJA 1VSIA 3CXCA 5LJ3e 2KLAA 4BDYA 4K8ZA 2M0YA 4FIBA 3AGKA 1T0HA 3THXA 3G71N 3CD6N 2G8HA 5KYYA 3EE9A 5DLQE 1NJIR 3ALYA 4IBNA 1W5EA 1U04A 5HBMA 3FZKA 5KE3A 4NYNA 4M4ZA 3EKUA 1VQ9F 1HKGA 2O9VA 3BYQA 2HBMA 5AVMA 2HKNA 1D5AA 4B1ZA 2DIGA 3FJ5A 1ATSA 1DTTA 4OVAA 5GAOn 2V1QA 1XOVA 4XK8E 1D8YA 4FJ8A 3MCQA 1UE9A 1T0JA 4HKEA 2YDLA 2IC3A 3P4EA 3D2EA 3HXMA 4B9XA 3F9KA 3KLHA 5KYWB 2DX1A 5FU6B 3I8DA 4IOAL 3H45C 2YV0X 3MN6A 2F1LA 4JZ4A 1CZBA 3TEEA 4DTPA 4CD1A 1I07A 2R6R1 1W4SA 3NK7A 4FJHA 2RD1A 5EVZA 1YJNF 4RTFD 4BI3A 3OA9A 3RSEB 4E6EA 3I55T 4Y1CA 1M1KR 1CK2A 3I3FA 3VQPA 4CD3A 2NRHA 4Z4HA 4JHDB 2UU9K 3P8HA 3AVHA 2FO0A 3JRZA 3KK1A 4B9UA 3ULRB 1I5OB 2YHYA 3I56A 2QXFA 5CKFA 3J81E 1EP4A 3QBWA 4KTZA 2QA4A 2XY5A 4IUVA 4KHSA 5LL6S 3CCMA 4CJWA 2A6AA 2JT4A 3QICA 4RTUA 2FEIA 1PM3A 3LDSA 5J2TA 5D7UA 4ELZC 3VEOA 2QEXQ 2CS7A 3CXCS 3EG9B 3D7EO 3QDKA 4JKAA 5AQSA 1VQ5F 4JRKA 4H0VB 2CHSA 1D0XA 2CGHA 2XD0A 2EQKA 2EW3A 2C06A 2OTLA 3V8KA 2BO1A 4OLAA 4ID1A 1MNDA 5IWAK 4ISEA 4EMHA 3F9MA 5AQZA 3ZFJA 3RKYA 1W5BA 4IFYA 5KYUB 5HP8A 4BW0B 4EDUA 5D6XA 4A59A 4DV7K 2IAFA 3CC7Q 3PV8A 5GANh 3EH2A 3BF3A 4A4HA 3VA0A 3VYUC 3VGKA 2O8EB 1UTIA 1OH8A 5LJ3f 4RCBA 4ELTA 1H641 5CCAA 3TWHA 2CP6A 2DYYA 1Q86C 1U1SA 3CPWA 2DKGA 1FFXB 4DU1A 4B9WA 3HTNA 5IJ9A 1NEBA 4XU1A 1VSKA 3H08A 2HCKA 5AQRA 1G2BA 3QG1A 4X1IB 1NKEA 1RL2A 2P9LA 2CP0A 4EI9A 3IFRA 4ZHVA 4JKEA 4XQ3A 3BE3A 5FPMA 1YI2A 3TTCA 2HL3A 2F7TA 2EJGA 2W40A 5IAYA 3EG0A 4BC4A 1Z05A 1R77A 4KH4A 3QJYA 1QQNA 2YRDA 1K8AR 1DT9A 3HWUA 4MMKA 1BUPA 3VF4A 2M02A 1M4ZA 5FRMA 2CH4W 3HKBB 1ZWZA 4O0JA 2JN0A 2NRVA 4CJQA 3OBWA 4OGEA 4FK2A 1OAPA 3SEMA 5GAMj 5CKBA 1NLOC 1G3TA 4E47A 4BI4A 1RBTA 2KHOA 4FLYA 1SL1A 1JCGA 1JCEA 1U2VB 3DXMB 3EG3A 3NF9A 3T9NA 2AA4A 2GF7A 4OKJA 4X1KB 4J2BA 1TU0B 1BQMA 4F9OA 1Y96B 3IMPA 1RT2A 4JKDA 2ZWHA 3TI0A 4Z02A 2IS3A 2RHZA 4XTZA 1O9SA 1S1TA 4IXCA 3U3YA 3CMET 1EIFA 4KHPK 2DBKA 2K5FA 1JXBA 1S5JA 2PFUA 2VWKA 2COYA 4P5NA 4H4OA 2BZ8A 2Y1IA 1YFNA 2J6KA 3SD4A 4AHVA 4BRNA 3LDPA 2HHVA 4C8QG 4U39A 3DXKA 3ENOA 4M3TA 4DMNA 2DFFA 3CJ7A 1VSHA 4FT4A 3AO1A 1YTUA 4XIUA 3LW5E 5M1KA 1X27A 4PJNA 4WFAL 3SNNA 3O3HA 1VYUA 4G9ZA 1JLEA 2KROA 4X9DA 3CCLA 2OTJN 2RJEA 1BWFO 5HL7L 3AVGA 2RQWA 3CPWS 1XNRK 4DFJA 2KBTA 1NK7A 4PL7A 4B3SK 1QWFA 2RQTA 2E3IA 5C42A 4FPBA 1YJ9N 4GLMA 4ZN3A 4UY8O 1VQON 4M75F 1YCYA 5LJ3h 4E7KA 2E6ZA 3RIRA 1K9MC 3I7TA 4QAGA 3TABA 3VOBA 3ZT3A 4IOXA 2P9KB 2HL5C 1SQKA 5JLHA 3AA4A 2HP0A 5IT9M 3EZ5A 3SFMA 4BQZA 2E41A 4O4LA 2DXTA 1U49A 2PVDB 1BB9A 1IREB 1X6GA 1HNIA 2F69A 3NMUC 4C92G 2NLXA 3E9FA 1QVGP 1IV1A 3FB9A 3G10A 1EO1A 3TVTA 3UT5A 2LMJA 3X20B 1RAEB 1M8MA 1UJYA 1D09B 1I5LA 2V52B 3IMXA 3KXTA 1RTHA 4DR2K 4E1NA 4RTVA 1Q7YO 2BDPA 2D0PA 2PBDA 3D45A 4A57A 3NK6A 1VHXA 4Y28E 3EHQA 5BMVA 3LPTA 3LM9A 4NUTA 1K73H 5BN9A 3HJWC 4PL6A 3M4GA 4O4JB 4E1MA 1JD1A 3VOAA 1XRGA 4HUFA 3LM2A 4Z94A 3SDZA 3K14A 3IKEA 3I55Q 4RTYA 1BIUA 4EHUA 1YCSB 5D6WA 4BRFA 2Z1HA 4C1NK 5JVGL 1UECA 4QS9A 1VQ7N 2LCCA 4RWTA 4Q5VA 1RLUA 3BW1A 3VQEA 2FGYA 3GF5A 4CHQA 4CJ4A 2EKHA 4BT4A 2WC9A 2YSQA 1YN8A 5DK5A 2UXDK 4I50A 1JL2A 1QVGF 4R55A 1JLCA 4KAZA 2BTUA 3CC4F 2V7ZA 1X43A 3JS6A 2WSCE 3JB9G 3F0DA 1K0SA 2DZ9A 5FU7C 3G4ST 4CZFA 4C8QE 1M3AA 3CQYA 3P5JA 4F6RB 3VRYA 2M1HA 1Y71A 2X6NA 1WHLA 2RN8A 1YITN 1K73O 2KZZA 4IHJB 4JKGA 4PL8A 4M7DC 1YJWA 1WJQA 1YP5A 1Y7XA 2FXUA 3VEZA 5M1NA 1VQKA 2R5AA 2LQKA 4RCCA 3AVJA 3THYA 3WGNA 1BIBA 4C0ZA 4W5QA 2R57A 4Z4IA 3HKCA 4KTWA 2A41A 5HLFA 4JI0K 1RTDA 4FK0A 1JFFA 1QCFA 1YNZA 5KYNA 1U3LA 1N6AA 4FLTA 2PUOB 1VQ4F 4K43A 3E01A 3OBYA 4L59A 4A2BA 4BC3A 3JAKA 3CCVA 5AQHA 4X3LA 1FXXA 3SLCA 3K5LA 4CJSA 3X26B 5CYMA 4Y91A 3O4QA 3E1YA 3LWPC 1WSJA 1OH7A 1RLQC 2HMPA 4EB6B 2GGRA 1RQ2A 2CWJA 3AT1B 5KRSA 4G4WA 2HHUA 5GANd 3QMLA 1HNXK 3FZLA 1GZ0A 3QEIA 1PC0A 3I5RA 4X1YA 2NUBA 5KE2A 4BVQA 1Z5VA 2H3GX 2DJQA 4M77D 2QXLA 4LF8K 3A8YA 3MX5A 1RAIB 3RESA 4AG1C 3OVNA 2PZ1A 3VF6A 2C0TA 1VQ9N 3MAQA 1UDLA 4BY9C 4N41A 4KUIA 1TSFA 3H3OB 3ZP4A 1NK9A 2DBMA 2VAMA 1C0GA 4HVVA 1JLGA 2YHAA 2EVRA 2DFUA 1M90U 3K0SA 3FLGA 2PYLA 1IHVA 3BUZB 1ONIA 2VCPA 2KQWA 2BTOA 2FYKA 4PFPA 3CMEQ 4ILHA 1QE1A 2KG4A 5I2MA 3VIUA 4OMMA 4B46A 3QBXA 3HVRA 2JJ9A 4XTYA 1QVFM 1U8RA 1ASVA 4A4FA 4JKCA 3SK3A 1GO0A 3FLCO 1YJNN 3EGXA 4DV1K 1N8RU 1DGKN 3QPHA 5AZIB 4C81A 3JCMM 2VG7A 2DE0X 3HKEB 4N47A 3OJSA 4HXJA 2UUCK 1UUEA 5GAHP 4HTLA 2F8TA 3BF1A 3TR8A 1J5OA 3VETA 1LPLA 3L3UA 4M7AE 3LYIA 2YX6A 3JCMW 5BREA 1TL3A 2EAYA 3VYTC 5GAOl 1M90H 5HRNA 4J9GA 3HAXD 5I3UA 3CCJA 4I9QA 2JNBA 4FL9A 4AFQC 3M4SA 4KV8A 1M1FA 2YWWA 2CGJA 4O5FA 1EKEA 1AWXA 3KKRA 3MN7A 4C8NA 1HQEA 2YYEA 4H0OA 3TD3A 2BUDA 3OSVA 2IVPA 3DRSA 4DTJA 1VQ5N 3IQLA 1OPLA 4CERA 3S3MA 4LDUA 2A3ZA 2X3XD 5BPMA 1ODEA 2UUAK 3KE1A 3TPQA 1S6QA 2LCAA 1N8RH 1A5VA 5C10A 4GLKA 5EZYA 4PJOC 3C9SA 5CK9A 1Q86H 1VSMA 3WEEB 1B3QA 2PYJA 3BP8A 4BR4A 3RR7A 1U06A 3VQ5A 3DYAA 2Y4XA 1D9DA 3NVMA 2JM8A 3O3FA 1YHQA 4C92F 3VQ6A 3KHYA 5GIPA 5LJ3d 3QB0A 3WXIA 5I21A 3LP1A 4FJKA 3CCSF 1PD1A 1T3VA 4GVEA 2FBTA 2IOCA 1EWRA 1VOMA 3CYMA 3RYFB 3ZCMA 4YOUA 3CI5A 1KTQA 4EP5A 2O8FA 1YBYA 3Q7CA 1JJ2A 2K9GA 1Q86O 2ZAEA 5AYFA 4E2FB 2IQQA 3N2KB 4CJ3A 3KD1E 2RJFA 3QEPA 5JCOA 3O80A 4DRXB 3TU4K 1GLJO 4LF9K 1SAZA 2NZTA 4DCHA 2A0FB 2GZLA 4E7HA 3EFSA 1GCQA 3BFMA 5A0GA 3HPWA 3G4SQ 3AVCA 4DEXA 4EMGA 4WFNL 4BT7A 1WPYA 2OTJT 5IHKA 1LJOA 4ZHRA 1NJXA 2GLZA 4RTXA 2G8IA 2UXCK 5LXTB 2P6YA 2HMIA 4NS5A 2YUOA 4CEFA 1GLDG 3QEWA 4CW7B 4LF5K 1M9SA 4HA8A 1EETA 4F2RA 4KWEA 1I1JA 3LALA 4H5RA 1KK7A 3CC2A 3SZ2A 1YJ9T 3RKWA 5HK3A 4M7DF 3PSFA 1RT3A 3K5MA 3QEVA 2NRRA 2V51B 4WQ5A 3CC7N 3MBMA 2RQRA 9ATCB 4BVPA 4DQRA 4OB3B 2O4XA 2VVKA 2A28A 1NPRA 1WX6A 3UATA 4CC4B 1A5XA 2HZYA 4RHAA 5EAZA 3V4DA 3O08A 3ENBA 3MX2A 2YI1A 3C6HA 1WNLA 2HBKA 4CZIA 2DYIA 5GMKj 2A3LA 2D0BA 2CKKA 1H47A 3F70A 2K3BA 2ZOVA 3V7EA 2OZBA 2PAVA 5AQQA 5E41A 4LUEA 2DZCA 3F6MA 3ATUA 3ZETA 2JTMA 5AFUA 1NG2A 2ATCB 4KFBA 1WSGA 4G88A 3J7AP 3V7SA 4LN2A 1D0YA 5HWEA 1RNHA 4CEEA 1G15A 1RDUA 3SUQA 1Q9XA 1JJ2S 4CZKA 4L6V5 1SKRA 2ZODA 3NGPA 3I35A 1C1AA 2PTKA 4TV9B 3FIFA 4IKFA 4C5HA 5HROA 1BYMA 4NQ3A 4E7JA 3ZEHA 5AQWA 4DV3K 5J3BA 1UJ0A 1SRLA 1JRIA 3JCMe 3U8XA 2HF4A 2KKZA 4ZHQB 3O1WA 3VQDA 2O4GA 3O9SA 1LAVA 3LYBA 1NM1A 1K9MO 2ROTA 3URGA 4B9NA 4Y0WA 2YUNA 4WQ4C 1U43A 4TUYB 3UWNA 4EZ9A 2KRNA 1T0KB 1U48A 4GV3A 2V8KA 1AT1B 2HHHK 1JO8A 3J7AF 3PAFA 1YITT 2ED0A 4IUTA 1VQ8T 1PD0A 4WE1A 1M1GA 3GE1A 2EQUA 3ULEB 1JLFA 3V6DA 5GAMg 5L23A 4CI6A 4DV0K 2CUDA 2DIQA 2HBJA 1W5AA 1GRIA 3C65A 4BRAA 3PLAA 4RQOA 4DOVA 1Q82C 2VG6A 3CFOA 1FKOA 3OYAA 4M7AA 4YHHK 3CC4N 3CIPA 1KCFA 1RBVA 5FW9A 3OW2A 4CCHA 1OVQA 3OS1A 4JJNK 3BY7A 4RTWA 1FMWA 1D3BB 2FHDA 1M90R 3M8QA 1T6DA 4FOEA 4H0PA 4FJ9A 2HRUA 4KI4A 5AT1B 4IIMA 2VKNA 4DSFA 1J6ZA 4M75B 3VQAA 3QO3A 1W7AA 2ZVZA 1ARKA 5GAN5 3CCRF 1VQ6A 1RI9A 1OVYA 1AEYA 4U3JB 4B45A 4BVSA 4H5WA 4PJOF 5ECAA 2EWSA 2W0ZA 1N8RR 4OX9K 3GHZA 3GTZA 1IHWA 4KGVB 1S72A 4CEDA 4I55B 2JTEA 2IIMA 3ZYYX 3VS2A 4ILJA 3WNEA 4R5PA 3K9KA 4FLWA 3LP2A 4A5AA 1UA1A 2E4HA 2L3SA 1MWMA 3VGMA 3WXLA 3I55N 3C6TA 2E6MA 1LOJA 4U67L 1BCOA 2EYXA 5KYWA 4CHYA 1QD9A 1VQVA 2H8EA 4NCAA 2XDPA 2MWPA 4D8KA 4DV2K 3EAEA 3CPFA 1BU1A 3JCMf 3M1FA 4JKBA 3CCQF 4DBQA 4DTNA 3JSCA 1Z5WA 4NWOB 5LJWA 4H03B 1QKXA 2XDDA 1W2BP 2EX3A 4NB4A 1P8ZA 2L3RA 3SQ4A 4JV5K 1K0XA 1QSSA 2CW4A 4FW1A 4MFBA 3ASKA 1YJNT 1RAHB 4O4GA 3TAFA 4JHDA 2D9TA 1FSZA 2Q2RA 2IIRA 2QTXA 3WQUA 2EQIA 4LXCA 2OTJQ 5E84A 1R0AA 3C94A 4JZ3A 4CC7A 5KCHA 3OW2S 1SKWA 2A36A 2ASOA 4YFUA 2AIFA 2L26A 4J9DA 5DMRA 1MMNA 4BGBA 3VA3A 1OPKA 1S1UA 2ALEA 2EIFA 2HHXA 3MCAB 1T3SA 1VQMF 1YJ9Q 3M0UA 3FBAA 1RDCA 3MEWA 4M77C 4YOTA 2Z1IA 4C8QD 1LW2A 1VQ5T 1W2BF 2XI9A 1RT5A 3G71A 3CD6A 4CE9A 3HRSA 1KLNA 2CSIA 1FKPA 3EFRA 4R56A 3B8AX 3WT0A 4CECA 5CA0B 3TARA 4N76A 5KYUA 4IDKA 1SA0B 1KHIA 4FU6A 4KH1B 1RCHA 2DL3A 3IAYA 2HBLA 4QOZB 1FJGK 3AO4A 2DTUA 1NWKA 2O8EA 2DYBA 3FD6A 3CM5A 3EEQA 2G8FA 3WQTA 4ELVA 5AQOA 2Z1FA 3TTDA 4MZMA 4PJLA 1RBUA 2ZJRL 1FFXA 1K8KA 4BWJA 3WJQA 3LZIA 4DF4A 4QVDA 4C8GA 4RKUE 3NHNA 3SBGA 1N33K 3DI6A 1BKBA 3WXMB 3H3NO 5CHIA 3OYYA 4NXNK 4X1IA 2BUPA 3G0ZA 2DO3A 1IKXA 3MK6A 2RQUA 3QZ9B 2NMUA 4JLHA 1GLFO 2OAWA 3CXCP 4EMKC 2FF3B 3DJCA 1I4K1 4RMOA 3L2QA 4CK3A 5HY6A 1NGHA 3HKBA 3C95A 4CC2A 2E8AA 3OYLA 4KREA 4X20B 1WBBA 4LD6A 3JCMh 1TTHB 3T19A 3K9JA 4JI1K 3D54A 2DPPB 5GINC 2FVUA 3EGDA 5GADP 1WA7A 1NZ9A 2EYZA 2KGWA 2LQ8A 5GMKm 1BDGA 1U2VA 1BO5O 3DXMA 5M1OA 4XH4A 2ZJPL 2EBPA 5JICA 2IG8A 1I0CA 4JRQA 1Y07A 2E1YA 2ZQBA 1YITQ 1Y96A 3Q7BA 1HD3A 2RK1A 1VQ8Q 3CMAA 1KG1A 3E66A 3U9DA 4J7IA 3ER0A 4FXDA 1IV2A 2E2NA 5KCOA 2XDBA 1UGQB 2X4YA 2WOMA 4JI6K 4PUOA 2CH4A 3ASMA 1VH8A 1M2VB 2JS0A 3EG2A 2JMCA 2OPQA 2OPRA 4DTMA 2CSLA 4LH4A 3I0RA 3CXCF 2K7AA 4NXMK 3UA7A 3VS1A 4FWNA 4C8MA 3BDUA 3R6OA 4PKGA 4YDUC 4OP0A 2GTJA 2RK2A 2KDSA 2NRTA 3P1GA 3HL8A 2L8DA 2A1SA 4BVOA 1C1BA 2KY9A 2LZ6B 3B6PA 2PHNA 3HM8A 1AOJA 3QTYA 1WGSA 2YKMA 3LL3A 1SS6A 4CHNA 4KKOA 3PIOL 5AR0A 1QQCA 3E9OA 5JVDB 2YNFA 3JB9D 3CJBA 4L3QA 2LCSA 5DM6L 4ZOLB 1SSFA 3ULDA 3GIBA 4I9LA 3KLFA 2N48A 4C23A 2KAFA 1MWKA 3T7ZA 4M7AD 3SHWA 4QQ6A 4N4HA 2OX7A 1NGDA 1KD1C 1WAFA 3CB2A 3ESJA 4GV6A 3KUFA 3A0IX 1VSEA 3WUHA 3EY1A 4H0YB 1U1TA 3GOXA 3CCUA 1COMA 3FR0A 2OHWA 2P9KA 4LCKA 4IO8A 2FPDA 3LWQC 1WHJA 3JCMV 2GQIA 3JCMQ 4ZNXA 1CZAN 1JL1A 4I6MB 3VGLA 2XO7A 5LOVB 5CQYA 1VSDA 3A8MB 3EYZA 4DOWA 1KNJA 2CREA 2DTOA 4LE9A 2BANA 4ID5A 3AA2A 2J6OA 1WSFA 2DMOA 1QQOA 4BRPA 3RNJA 1E7KA 3QWXX 1QVFP 1WOQA 3TSUA 4H5VA 2QA4F 1ZXOA 3ZOPA 3KBGA 3ZSOA 4G4XA 3NFCA 2BE7D 4DTSA 3CCMF 3CPWP 4A62A 4MZTA 4II1A 4DR6K 3QLHA 4CEZA 4O4JA 1V29B 1HNVA 2AIZP 5LYJA 5LJVA 2VXEA 3MKDA 1WLJA 2AKLA 3LMEA 2NLUA 4QW2A 3UIQA 4F16A 1QQJA 5SZTA 3TD5A 1YJNQ 3NF8A 2K57A 5IT9O 2OTLF 1GLLO 3S3OA 3I9QA 3ZEUA 3PO4A 4IEEA 4FJLA 3RR8A 4CIFA 2YXYA 3E20B 4DR5K 4BQLA 4OMPA 5GAPK 2F9ZC 2EGEA 4H0TB 1ZBHA 2O8DB 3I33A 1V1CA 2IDOA 3BGRA 3R8EA 4CK1A 1W5FA 3CC4T 5T7BA 5EXWA 4DU3A 3CG7A 4EZ6A 2VWJA 4F6RA 3S03A 2GNCA 2JWLA 2HD0A 2P51A 2O8BB 4IHJA 3CPWF 3SYZA 1Q81C 1VQ5Q 2DFHA 1VQOA 3QERA 4M7DB 2MOXA 3NE6A 2QTPA 4B1VA 5LA6B 4M77F 4PFZA 4F3TA 2ZPIB 1VYTA 4WYBA 5C6SA 4MQ3A 4J83A 1T05A 1YI2F 4IIJA 1QHAA 4JPBW 3UKUB 1BL3A 1KXPA 4FM1A 3M3ZA 1T44A 1VK3A 3CYQA 4ZHWA 1D0ZA 3THKA 2V8IA 3S06A 1OOTA 4ATOA 2VXYA 3HFNA 5JH7B 2VC8A 4OB2B 4DA4A 4XTWA 3VV0A 4EP4A 1T7PA 5EYPB 3DLLL 2GVIA 1VQ4T 2RKIA 2DM1A 3OA6A 2NUTB 4ESRA 4C8KA 1RT1A 3DKMA 3X24B 3V9WA 4KTQA 1QTMA 1NK0A 3OYEA 4A54A 4XAXB 1KC8C 3K5OA 4FPAA 5IXFA 4PWTA 2NUPB 5IYZB 2KYBA 3R3LA 4TV8B 4OMLA 1PCXA 3P31A 2MK5A 3JCMc 3TSZA 1Z26A 5GAOq 3PIPA 1VQ7A 1KFZA 1Z6RA 3CCRN 3RA5A 4NOYA 4F17A 5J1EA 4FT2A 5CVIA 5AQJA 1LCUA 3PNWC 3DB4A 3E22A 4QVZA 3JASA 4JN4A 1U40A 3C0BA 3HTVA 3NDKA 4B1UB 3KD5E 2D8HA 4MDXA 1KJWA 1Q8RA 5CR4A 3CCLF 3RUXA 4BWMA 3K2PA 2H3JA 1BHLA 5BR9A 3E19A 3ZSQA 3CJ1A 1NKBA 2JZ2A 1HYOA 1E4FT 3DOLA 2QM1A 3KIOA 1SZ2A 5AZJB 1WXBA 4B6MA 3CCQN 2SEMA 1K6YA 3JCMd 2RN2A 2RB9A 3JV3A 5LY3A 2D0QB 2HSTA 3QKJA 3G6EA 4CJVA 3RWUA 4X9CA 1M90O 4DG1A 4DFKA 5AZIA 5I9EB 3V1QA 1NKCA 2L3PA 3TAEA 1X6BA 2COZA 4HVWA 3OTOK 2QKKA 3HKEA 2LT4A 4E7SA 4ISGA 3EE8A 5CA1B 3HKDB 1IBKK 3Q8HA 2KSSA 4OB1B 3ZSZA 3WGJA 4HCZA 4O6JA 5EIBC 1CKBA 1IGQA 1N9RA 1X69A 2K5IA 1NBEB 1WN7A 2XHBA 4C8LA 1GBQA 5GAOp 5D3GA 4FYWB 5D6YA 5GIPC 2F9TA 4K42A 3VTIA 3CCEA 1NEGA 5C24A 4DV6K 4C5EA 3WNHA 3NH0A 4FCYA 2W8BC 1KAYA 3O9RA 1RDDA 5GAN2 2HBWA 2LSNA 3TANA 2K79A 4B8CA 1Y97A 4DKWA 4DLEA 4FZXC 2AKKA 1RBRA 4KBOA 2KFNA 1PHTA 4H8KA 3M58A 1OYXA 2GCXA 4X1VA 5LJ5j 4QS8A 2H8HA 3T1YK 1BIAA 4X3MA 4O8KA 3ISNC 3WEEA 3SWNC 4PJOB 1A5WA 1UEBA 1XUPO 4FM2A 1Y64A 3SJJA 1VQ9A 1IB8A 4DR7K 3DLRA 1X52A 1Q7YU 1R0BG 5KGXA 1JB0E 2E64A 4CF8A 2Y90A 1BOTO 4E89A 1NQ3A 8AT1B 2QTDA 2YJEA 4IEIA 3SIUA 2YHTA 1IG8A 2F4VK 2IVOA 3KKSA 2CHTA 3OONA 2DLPA 1OI1A 5CAIA 4C8QC 4I7FA 1JXOA 2FBXA 2UYTA 5HRPA 4O44A 3CCST 1T03A 2J4RA 3RYFA 1E6HA 3IEQA 5C8YA 4BG9A 1YJWF 4DSLA 4AHUA 2JOYA 4DUZK 1W2BM 3LDLA 1VQKF 1E6GA 4J6XA 3MDQA 2QGFB 1U3PA 3C4SA 3QWYA 3DDNA 3OYHA 1F1BB 3AVLA 4RW8A 3N2KA 1VQLA 3D01A 1ABQA 3QETA 1Q7YH 1WQWA 3ATVA 5HY2A 1K73U 4CESA 4Z4EA 3CC4Q 1RA4A 3KIZA 4ZI7B 3AVBA 2PU9B 3NFAA 3PX0A 2FSJA 3LP0A 4C0FA 5LXTA 2Q1NA 2IAJA 5MLCQ 4KT0E 5F1XA 3WGKA 4RG8A 2HS0A 5HXZA 1VQPN 5IN1A 1IKWA 2QKBA 1ZA2B 1LWCA 3A5LC 1HKCA 1NMDA 3KK7A 1K9AA 3VQ9A 4LFBK 4C92C 4HT9A 3VYGA 1AWOA 3N4PA 4JEPA 2F5TX 3KLGA 4O5BA 1G3SA 1T8EA 2WTUA 2ZGYA 2AT1B 2Q31A 3FPIA 1KVAA 1ZSZC 4AHCA 1RUWA 2HOEA 4JUVA 3J80E 2QWNA 4J2EA 4HT8A 2P4TA 1YIJT 1DEJA 2YCHA 2M51A 3MN9A 5DM7L 4QT7A 1N5YA 1VQ4Q 4GMJB 2FC3A 2E3HA 3V3TA 1CKAA 3RTVA 1PSFA 5FRNA 5GJWB 2GEMA 4J9CA 3LLRA 2LX9A 1XNQK 1W42A 3QINA 5KRTA 3P8DA 3VS6A 4EAHD 3M0SA 1G3WA 4O2AB 1FYNA 1HSQA 3SJHA 5BN8A 2JXBA 4CZGA 3AAPA 2HS3A 2YHBA 4F04B 3L4QA 1UHFA 2WACA 3EGUA 4N4GA 3V7RA 3CXCM 2DT4A 4TV9A 5HK0A 3K2XA 1NK4A 2J06A 1SG5A 2AMTA 2E6LA 4OGCA 4PLLA 4DEYA 2HBPA 5ELZA 4ZHQA 2BTTA 3CEYA 1KD1O 1VQ8N 4DBRA 3TSWA 2EGAA 1RT4A 4M7AG 3P4IA 2QEXA 3SMSA 3OS0A 5CR2A 4M7AC 3KHNA 1TYQB 3VU3C 5GIOA 4O4HB 4K0KK 4PQUA 4MMLA 4JLGA 2QA4N 1R8OB 3ZX2A 3CCMN 2VB6A 3CG6A 5J2NA 2QASA 2X6SA 2L3QA 1NJYA 2CH5A 1GOAA 1E4GT 2JGUA 4GKJK 1KSPA 3NHGA 2EYWA 2RQVA 4M78B 1TUDA 1X2KA 5FWBA 3WVDB 4C0DC 1GOCA 4WFBL 3CC7A 4Z88A 3QNNA 3ULEA 2A08A 4B3TK 1H7MA 2YNIA 1BA1A 3J81O 3UPUA 2FZGB 4MZPA 3UT1A 3LANA 4Q0BA 5B8FA 2OTLN 4FLVA 1M2OA 1IBMK 2QQAA 2E12A 2CZWA 1HJOA 4CJ7A 3CHWA 4GVMA 2XY8A 2KQ2A 3VYSC 2JWKA 1W97L 3VUZA 2A42A 3HPGA 3KLEA
chains in the Genus database with same CATH topology
3I8BA 1YHQF 2AHJB 2XHCA 1HPMA 3V7QA 5G4UC 3D2EB 3AARA 1BI3A 5FLXE 2LC4A 2I6DA 1HX1A 3PFSA 3JCMX 2DEQA 1QZ6A 4BVRA 2E10A 4BC2A 2ZJQL 3CCRT 1Q81O 4A61A 4BUGA 1V4SA 3CBOA 4ME7A 2XG8D 3A8OB 3LDNA 3NTKA 1B34A 2YLCA 3CPWM 2YJFA 4VUBA 4C8QF 1Q86U 5F2RA 3O4WA 2FF6A 1W3EX 3R6MA 2X4WA 3CCQT 3CC2F 4TZZA 1NPPA 3H46O 4FWOA 5M1QA 4HCCA 2E70A 1QVGA 4OO1J 2RI2A 3VENA 5AQXA 1KC8O 3M5RA 1NJIC 2CGKA 2Y4YA 3EL2A 3GNFB 1NGGA 3CCLN 4DQ8A 5GAMe 1NLVA 1LOTB 3TU5A 5GAN3 4NLCA 1VQMT 1OZ3A 5TKWA 1NGEA 4M77B 3H6EA 3M9QA 2NRXA 3J7ZO 4MDWA 3LDQA 4QVCA 3ID6A 4L5GA 3MP6A 5G4VC 3FFKB 5GAOr 4C5IA 1M1KC 2VXFA 2K3XA 3V8LA 3I55A 2WSEE 2NNWA 1ZHIA 4RG2A 4YOYA 3MEUA 4FM4B 4JLIA 5KQ8A 2EQMA 5JLFA 2FSNA 4EMKB 2VUBA 3HSCA 1K9MU 1P90A 1QVGS 3JB9F 3M55A 5AQYA 3C7NB 3V8JA 4YOVA 4M7AF 3OW2F 5B8HA 2XK0A 3CJAA 1I8FA 2K2VA 2FL7A 3SIVA 3AHUA 1YIJF 3VESA 3OYIA 1VQNT 4GY5A 1VQPT 1NGBA 2WALA 2QWPA 1YJWN 4EI7A 1G5VA 4CZLA 2ITMA 2I2LA 1W41A 1UB4A 2EYQA 5GAMf 3P38A 2ZPFB 1K9MH 1VQ6F 2ZPGB 2XU8A 3HRUA 4OMFB 4FWPA 4O8UA 5C12A 2G3RA 1K8AC 1S72F 4FSVA 1AHJB 2LTOA 3RMQA 3J81M 2FLOA 4ZGEB 2RHXA 1N9SA 2D1KA 5GANj 1X6OA 2DXBA 4C0GA 4A4GA 4ZTFA 3H8ZA 2KMTA 2P9IA 4I6MA 1ZC6A 4PJOE 1YXQA 2QWOA 2D6FA 4LDVA 3CMEA 3NMUA 3O8VA 1X01A 1QZ5A 4Q5WA 4B9QA 4NO7A 2E6NA 3OYBA 3VYHB 2YRVA 1KQSA 2QA4T 5LJ5g 3OYNA 3CCMT 1MA9B 3SAHA 5A2QE 1XTDA 5KPZA 3QYHB 5AQLA 1DJ7B 5AQFA 2FSKA 3GPLA 4B1XB 3G71F 1O75A 5C0YA 2OTLT 5FJ4C 1BA0A 4EFHA 3BEXA 5HY1A 4CZEA 3OY9A 2F9WA 5E26A 2D4WA 5GAMh 3GYQA 3LWIA 2QW9A 2CZ1B 4M7DA 2KK4A 2RI5A 1VQ4N 2CZ7B 1NMUB 3UKUA 3X25B 1MDUB 4BDZA 4H5TA 1YI2T 3A5ZB 4JD2B 2GUPA 4GY2B 5LJ3j 3JAME 3VUZA 4PNOA 1YHQN 2AP1A 3HHTB 5IT9E 3OS2A 3PIPL 1KQSS 4FO0A 5KH6A 3RSEA 1MGQA 4YTLA 4JK9A 4NLBA 3IR9A 3CMAF 2BIVA 1NGFA 1RGIA 3OMCA 3QSUA 4M63C 3N4QA 3FEOA 3DB3A 3G4SA 4KH6A 2EWNA 3P8BB 4WF9L 1QP3A 4BR9A 3FZMA 4PKIA 4BRHA 1P92A 4CBUA 4NL2A 2P9SB 3QDRB 5M9OA 1DKGD 2RHYA 2XICA 3OYDA 4EI8A 2F5KA 3CCLT 4V2SA 2GFUA 5AZJA 2NRZA 3J80M 4M78E 2BTFA 3HP9A 3ID8A 3RVCA 3TREA 3CETA 3CC2N 4FWKA 5JVHL 3CCUF 3PMTA 1JJ2M 4BRIA 4J6WA 3L2VA 1FX7A 4CBXA 3LGLA 4F7UE 3CF5L 3O9QA 3R9PA 3W0LA 1YAGA 2D0OA 2FB7A 4BG8A 5C2DA 4OF1A 4WF2A 4BRLA 1VAZA 2K5LA 3L6QA 4LC9B 1XC3A 5AQUA 3GOIA 1QP2A 3VEWA 1NJIO 4BGAA 2PUKB 4CZJA 3HOTA 4UC4A 3OYJA 4RCHA 4PJOA 4BD3A 2GX9A 3CCSN 3SWNB 3RKXA 1VQNF 4LDYA 4AM6A 4IUUA 1XQHA 2QI2A 4TVRA 1S3XA 4JKFA 2OANA 5DY9A 3INZA 5GMKe 1ZBSA 4ILGB 4C8QB 1JCFA 3OYCA 2ZGZA 2RM4A 2DD4A 2DPNA 5CKDA 2XIDA 1M1KO 1YJWT 1VQKT 2O4XB 2I7NA 3GNGA 5GAGP 4JNEA 3KWIA 1O13A 5FLXM 4X34A 2RH2A 2QQBA 3PGGA 3VI6A 3M6GA 4KUDK 2CH6A 2BKDN 1NBWA 3A5MC 3ZBDA 3G7ZA 3CCVT 2DVEA 1YIJN 5CQXA 1GLBG 4BVTA 1WUAA 1K8AH 4C92B 4QS7A 3I56F 2HAXA 1XQSC 2VYPA 3ME9A 1VQ6N 5GAMd 1PSEA 3MN5A 3EN9A 4FWRA 3UKRB 1KAZA 4QQGA 3A8LB 1I81A 2E88A 1Q82U 3OW2M 3TCJA 2KVQG 1QQMA 3W3DA 4NL3A 2WFBA 4E7LA 2WSFE 3JXUA 3GLXA 5HWEA 1K8AO 3SAFA 3M5AA 2OTJA 4XEIA 4CRIA 3G6EF 2HVYD 3ON1A 2DAQA 2VV5A 3J7AR 1GLEG 3VEVA 3Q1JA 3O9TA 2R5MA 5FU7B 1YJ9A 1BU6O 5HXUA 1TYQA 3LGFA 1Q82H 3CCEF 4WQ4A 4H5NA 4BRKA 5GAN4 1T6CA 3CCJT 1X75C 4M78A 4M75G 5GANK 1U6ZA 3EO3A 4C0DB 5J39A 2P9UB 4FWMA 4JAXA 4D6WA 3O9UA 3OS5A 4J8FA 4U7BA 4F7UA 1KAXA 2ZPEB 3QIIA 5GAN7 1Q82O 2L89A 2L5QA 5L8RE 5EG2A 3FDRA 3MEAA 2MMPA 1YHQT 2RO0A 5GMKl 4MDAA 1G99A 3HOSA 2MAMA 4KBMB 3KWGA 1QW1A 5CO7A 3MO8A 3HSBA 4CZMA 3VMFB 1VQLF 1YITA 1VQ8A 4LDWA 3OYMA 4PJOD 4J5YA 1YVNA 5HKCA 1HUXA 5GANg 2QWRA 5GMKh 4J8OA 4BC5A 4N0AA 3S6WA 3SMPA 2JUFA 2DD5A 3TSQA 3KZBA 3OYFA 3CMAN 5AQGA 5I2SA 2E65A 1M90C 2Q97A 2LCLA 3CC2T 2QWQA 3QYGB 5AQVA 1C0FA 1X7PA 1VQMN 3J8AA 4A53A 3O5BA 3L4IA 4M75E 1QVFA 1NGCA 1X7OA 3A8GB 1N8RC 3MHXA 4DHYA 4BRDA 3OMGA 5CE3A 3HRTA 1K8KB 3T69A 3QXEB 5CKHA 2HQXA 1KQ2A 4HWIA 2QQRA 4JK7A 2DTHA 4M77A 2VGNA 2P0PA 3CCUN 5BRFA 2CZ6B 3WXKA 3FFMA 4OPHA 5A2QM 4ZN1A 3L2WA 2QEXF 1H1VA 4WQ5C 2YLBA 1YJNA 4BY6C 2P9PB 2K3YA 4HCBA 3U4LA 3AGRA 4GNIA 2PQWA 3CC7F 3O85A 5BRDA 1KD1U 1RFQA 4EMKA 1M5Q1 3M4YA 5LJ3g 1YUWA 3IDHA 3CCVF 2EJ9A 1IPAA 1VQNN 4ELYC 2LBWA 2PVGB 3C7NA 1QVFS 5GINA 1VQ5A 2K4YA 1GLAG 2YHXA 4R79A 2P0QA 3H6ZA 1H3ZA 2ZPHB 4JK8A 3JAMM 3L42A 4OB0B 3PIOA 1KD1H 5GAOm 3VUBA 4MDBA 1G3YA 4M78D 2DXCA 4YDUA 3CJ9A 1VQ6T 3UE5A 3UDCA 1GO1A 4DQ2A 4ZTJA 4A4KA 2IVNA 5A0DA 1V4TA 5GMKi 1S72T 4N4IA 4IO9L 3VTHA 2RHKA 3IUCA 2O01E 2JVVA 1HLUA 1X3MA 4O5VA 2M0OA 5C2FA 3PLAC 1SDSA 1Q81U 3L0QA 3I56N 3M53A 2I7PA 4AF1A 3N4YA 1NGAA 3ZEUB 4E1JA 3D2FB 4PHTX 3CCJF 5HOOA 2P9NB 3C6AA 3N4ZA 4EIAA 1X9JA 3JCMJ 2EJFA 2DTIA 3GP8A 4ZGDB 5C0MA 4M7DG 2V7YA 4K25A 1Q81H 3VF2A 3G6EN 4A4EA 5AQTA 2HF3A 1KC8U 3LWHA 2W41A 2QDYB 4CI0C 4ISFA 3DWLA 2RJDA 3G71T 3CD6T 1D3BA 5FU6C 3P39A 4BRMA 3MWTA 1ZQ1A 1UGSB 1FWZA 3NTIA 4M75A 3L1AA 3L2UA 3CCEN 1YI2N 3I55F 1JJ2F 3HI0A 3A8HB 3FJPA 3MMVA 3L2ZA 3CQXA 3O6WA 2BH1A 4C92E 4IURA 1KC8H 2M9UA 3DLLA 3PT9A 4JD2A 3FC3A 2IG0A 2X4JA 2M16A 2OAUA 2CZ0B 4XH1A 4B1YB 3E9PA 4M7YA 3LFOA 4E7IA 4IOCL 5KPTA 2A5XA 4OPAA 2LBXA 4JRPA 3PMIA 2WBNA 1KQ1A 4EPCA 4BR5A 2ZPBB 3QFUA 2GELA 3E1SA 3X28B 5ADXH 3CMAT 3KVGA 2RHUA 3AY9A 4BRCA 4YORA 3CC4A 1KHCA 5CIUA 3HRGA 2E20A 5AQIA 1OZ2A 1VUBA 5LJ5e 5JMVA 1VQLN 5EY4A 2A7YA 3FE1A 2X35A 4XH5A 4M7DE 3RMSA 2P9SA 2XKOC 2P9LB 4PLIA 4YOWA 3NVKE 4XCQA 4C4WC 5ADXA 3G25A 3NVIB 1VQ4A 4K41A 1LNXA 3OB9A 5F0XA 4PJOG 2RI3A 2LRQA 3CCUT 4KULA 5EWRA 2E1HA 3CMEF 3CBMA 1M90O 5C15A 4J7FA 4XTXA 3EZWA 5EOYA 3VKIA 1S22A 3OSSC 4XTUA 5TKYA 3DXKB 1KQSF 2GWJA 4XU3A 5BRHA 1YF5L 1N8RO 3ZX3A 4JKHA 3LWVC 2QWLA 3F5TA 4FWSA 5FROA 4JS4A 3SWNA 1ATNA 3PTAA 3META 4PKCC 3R1XA 2VGMA 2QEXN 4IJAA 3D6RA 1TH7A 1M8VA 1VQKN 1BG3A 4IJNA 2ZF5O 4C8QA 2NRWA 5LJ5f 5AFUH 3H1QA 5M1FA 2Q36A 2E1ZA 3ENHA 2E5QA 1CN7A 5HY0A 1VQOT 1Q18A 3CCVN 4A2AA 3OQ5A 1UGPB 4IFEA 2HQEA 3M59A 3SBTA 5DLOA 2DXUA 3DAWA 5EO3A 3L2RA 3CPQA 1BI2A 5DCVA 4FOIA 3UB5A 4M75D 4FWQA 2B8AA 2EKOA 4A5BA 4J6YA 3OHRA 3A5OC 4C92A 2RHIA 4C5GA 2RA2A 4IUQA 5M1PA 3G4SF 4GV9A 3CBPA 3CCSA 3I56T 5BPNA 1VQ7T 1MHNA 3UKRA 1QVPA 5CKEA 1XBIA 3JB9H 4JKGB 2QQSA 4XU0A 4BROA 5BPLA 3IKMA 4BB7A 3CD6F 4M78G 4QQDA 5AQNA 4KH5A 4M78C 2MWOA 2RE2A 3OYKA 1ILYA 4EHTA 4BREA 4FSXA 4FL6A 4MO4A 1NGJA 4JS5A 2E2PA 3G6ET 5LJ5h 3QJ6A 4IWVA 3M57A 3CCJN 4XU2A 3LWOC 4F7UG 4CBWA 3MP1A 3HKSA 3VEYA 2ASPA 3A5NC 3M56A 3NVKA 1YIJA 3O8MA 3CCET 3GDQA 1W40A 1TUUA 2ASMA 3SB2A 2P9UA 4BI8B 3JCMb 3RA6A 4BR7A 5A0LA 1PXWA 3VOVA 5FPEA 4LDXA 4XTVA 5H1SQ 1HKBA 2Q0UA 1NE8A 3VEXA 5KQDA 4LD9K 2WUSA 2P0KA 2R58A 5J26A 1OKJA 3ZX0A 1QVGM 1VQ9T 1D4XA 3NTHA 4N0AC 1NJIU 4MO5A 4BACA 4M7XA 4CZHA 5AQKA 1B34B 2GQVA 4WCEL 3WVEB 3H1VX 1HK9A 1WQ7A 2DJZA 2LDMA 3F2KA 4BE1A 2JTFA 3TTFA 2GFAA 5GAEP 3FGUA 3GG4A 3BDLA 4IUPA 4ZGJB 1VQLT 4FWLA 3C12A 1NJIH 3FRNA 2ZGWA 1M1KU 4IDHA 5FPDA 3MCPA 3V7CA 4M77G 3MWPA 1VIFA 2LT1A 2KTUA 2YHWA 3HZ6A 4BE2A 2QQ9A 2ZZDA 1NGIA 1HXDA 5DM7R 5GAN8 2MF2A 2HNIA 2GWKA 3JCMg 3DLMA 1M1KH 3CCRA 3D00A 3VERA 5GAN6 1EQYA 2LNVA 1BI0A 2MI6A 2E2QA 3LX7A 4BR2A 1TUYA 3QZ5B 1WJSA 3RERA 1ZBXA 2LVMA 2A40A 2OTJF 1RDWX 4BE0A 3HFOA 3OYGA 3JB9J 1ESVA 1ATRA 4BRGA 2DK3A 4PKHA 4C92D 4MLEA 2VYTA 3CCQA 3CMEN 1YJ9F 1RLGA 2V8JA 2QWMA 1VQOF 3FZHA 3CERA 1K8AU 4DB3A 2E2OA 2QEXT 3O1BA 3M54A 2P9PA 4BY6B 3LWRC 1Q7YC 1IZ6A 3CPEA 2JNGA 4M78F 3MEVA 4YOXA 3JB9I 4BRQA 5GANe 4JDSA 2RB6A 3CC7T 3EKSA 5AQMA 4H0XB 1X3NA 1XNIA 1VQMA 5AQPA 3ZETB 3QFPA 4BR0A 4C1NI 1JBMA 5KPRA 2X4XA 5EX5A 3N5BB 3SAGA 1WJRA 4F7UF 4M77E 2CYZB 3TSPA 1W2BA 3QBYA 5FPNA 3GL1A 3GBTA 3QHSA 2ZCFB 3E9GA 2IVWA 3S3NA 4M7DD 1VQ7F 5LJ5d 1KQSM 1K73C 1RI0A 1VIEA 3HBTA 2KTVA 2VWBA 4IZ9A 1S72N 3E9LA 2GTDA 2P9IB 5GIOC 2EFIA 3LDOA 4FVUA 1YITF 3LH0A 3QUIA 1VQ8F 3AAQA 2Q0RA 1IJJA 3CJCA 3VPZA 3JCMP 2PVOB 1BI1A 1GXIE 1GLCG 3FZFA 1UGRB 3U9ZA 4AM7A 5HY4A 3VJPA 4B1WB 2CGLA 4M7AB 1N27A 3G4SN 3D2FA 4JRIA 1VQNA 4MLHA 4BY9D 2RJCA 1VQPA 2P9NA 3WXJA 3S41A 4M75C 1W2BS 3MP8A 1R59O 1QVFF 5GANf 2EQJA 2KLAA 3CXCA 5LJ3e 4BDYA 4FIBA 3AGKA 3G71N 3CD6N 3EE9A 5DLQE 3FZKA 5KE3A 3EKUA 1VQ9F 1HKGA 2HBMA 4B1ZA 2DIGA 1ATSA 4OVAA 5GAOn 1XOVA 4XK8E 4HKEA 3D2EA 4B9XA 4IOAL 5FU6B 3H45C 3MN6A 3TEEA 4CD1A 1W4SA 3NK7A 2RD1A 5EVZA 1YJNF 4RTFD 4BI3A 3OA9A 3RSEB 3I55T 1CK2A 4CD3A 2NRHA 4JHDB 3P8HA 3JRZA 2YHYA 3I56A 2QXFA 5CKFA 3J81E 3QBWA 2QA4A 4IUVA 5LL6S 3CCMA 2A6AA 3QICA 4ELZC 3VEOA 4JKAA 2CS7A 3CXCS 3QDKA 3D7EO 5AQSA 1VQ5F 4JRKA 4H0VB 2CGHA 2XD0A 2EQKA 2C06A 2OTLA 3V8KA 2BO1A 4ISEA 4EMHA 3F9MA 5AQZA 3ZFJA 3RKYA 4BW0B 4EDUA 5D6XA 4A59A 5GANh 3BF3A 4A4HA 3VGKA 5LJ3f 4RCBA 1H641 5CCAA 1Q86C 1U1SA 3CPWA 2DKGA 4B9WA 5AQRA 4XU1A 3QG1A 1RL2A 2P9LA 4EI9A 3IFRA 4JKEA 4XQ3A 5FPMA 1YI2A 3TTCA 2F7TA 2EJGA 2W40A 5IAYA 4BC4A 1Z05A 4KH4A 3QJYA 1QQNA 1DT9A 4MMKA 1BUPA 3VF4A 5FRMA 1M4ZA 1ZWZA 2JN0A 2NRVA 3OBWA 4OGEA 5GAMj 5CKBA 4E47A 1G3TA 2KHOA 4BI4A 1JCGA 1JCEA 1U2VB 3DXMB 3T9NA 2AA4A 2GF7A 4F9OA 1Y96B 4JKDA 2ZWHA 4Z02A 2RHZA 4XTZA 1O9SA 4IXCA