2VGNA

Structure of yeast dom34 : a protein related to translation termination factor erf1 and involved in no-go decay.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
382
structure length
360
Chain Sequence
b'MKVISLKKDSFNKGGAVITLLPEDKEDLFTVYQIVDKDDELIFKKKFDLVKLKIKVISEDFDMKDEYLKYKGVTVTDESGASNVDIPVGKYLSFTLDYVYPFTIIKQNFNKFMQKLLNEACNIEYKSDTAAVVLQEGIAHVCLVTSSSTILKQKIEYDVLKFDEKTEKFYKAIYSAMKKDLNFDKLKTIILCSPGFYAKILMDKIFQYAEEEHNKKILDNKGMFFIAHCSTGYLQGINEVLKNPLYASKLQDTKYSKEIMVMDEFLLHLNKDDDKAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLTGIACILKYPLPDLDED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DOM34
publication title Structure of Yeast Dom34: A Protein Related to Translation Termination Factor Erf1 and Involved in No-Go Decay.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 90
structure length 360
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03463 eRF1_1 eRF1 domain 1
A PF03464 eRF1_2 eRF1 domain 2
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.870 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vgnA01
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2vgnA02
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2vgnA03
3V7QA 1W41A 3HJWC 2HVYD 1YJWF 1X7PA 5FLXM 2BO1A 3CCSF 1X7OA 1Q82H 1KQSF 1VQ8F 1K73H 3SIVA 1X52A 3CD6F 1GO1A 1Q81H 2KG4A 5GINC 1YJNF 1NMUB 1IPAA 3CCJF 1GO0A 2FC3A 5GIOC 1VQ7F 3NVKE 1N8RH 2KTVA 5EWRA 1VQLF 2CZWA 3CPQA 1VQ9F 4AF1A 1M1KH 3O85A 1YHQF 2I6DA 5IT9M 3AGKA 3NK6A 4NUTA 3HAXD 3G71F 5G4UC 4BY9D 3LWQC 1M90H 3J81M 1JJ2F 1VQPF 5GIPC 3CPWF 3VI6A 3LWOC 3FFMA 3LWPC 4TZZA 3NMUC 3SIUA 2QI2A 3CMAF 3CCUF 3V7EA 3LWRC 4LCKA 1QVGF 3E20B 1W42A 5FJ4C 1K8AH 3LFOA 2QEXF 1PXWA 3CCRF 3JCMM 4C4WC 3GYQA 2VGNA 3NK7A 2JNBA 1YI2F 5G4VC 1S72F 1DT9A 3I56F 1GZ0A 2VGMA 1VQ6F 3RA5A 3CC2F 3J7AR 3CXCF 1VQ5F 3OBYA 3WXMB 2OHWA 3I55F 1KC8H 1VQNF 3CG6A 5EO3A 3NVIB 1XBIA 1YJ9F 1T0KB 1W2BF 3MCAB 5A2QM 2LBXA 5DCVA 3CC4F 3J80M 2WALA 1VQOF 3CCEF 2OZBA 3ON1A 1YIJF 3G4SF 3CCMF 1K9MH 3PAFA 2AIFA 3LWVC 1VQMF 1Q86H 2LBWA 1E7KA 2OTLF 4X3LA 1VQ4F 3PLAC 1CK2A 1VQKF 1RA4A 3VMFB 2KTUA 3JAMM 3OBWA 1YITF 5GAPK 3N4YA 2OTJF 2HSTA 1Q7YH 3N4ZA 1CN7A 3E1YA 3CCQF 3CCLF 3G6EF 4BW0B 3CMEF 1RLGA 4X3MA 1NJIH 1H7MA 3IR9A 1ZWZA 3OW2F 2ALEA 2QA4F 3CCVF 1SDSA 1W3EX 3RA6A 5GANK 1W40A 1QVFF 3CC7F 1KD1H
chains in the Genus database with same CATH superfamily
1R1MA 1JCFA 2B33A 3TD4A 2HBPA 2EQIA 3CCLQ 3B6OA 3AA3A 2QWRA 3EFOB 4K8ZA 1Z9ZA 4Q5WA 1HYVA 2ZOVA 5GAOp 4KV8A 3VQPA 2KR3A 3JCMb 4XU1A 2IIMA 3CCVQ 3KLIA 5HLFA 1ZA2B 2QA4N 1WJQA 4DV0K 3OYGA 4IOXA 4NXMK 2DILA 2JLEA 2RF2A 2AZSA 2O4GA 4OPJA 4DV1K 1W5FA 3UF4A 3K9KA 4DQ8A 1XTDA 4KH0B 4KTZA 5CKEA 4EDUA 4FJLA 4A4FA 4Z02A 5JQGA 2KNBB 2E2NA 4N5SA 3MN7A 3PUFA 3PIPA 3U9DA 3NK6A 1VQ8Q 1HYZA 1LAWA 2NUTA 3CCEA 4JKDA 4DR5K 4ELTA 4MDAA 1U8RA 1U2VB 2V1RA 3KKSA 4B9VA 2IG0A 2RB9A 1VQPF 2X4YA 3WGJA 3QICA 1YJ9T 1QQMA 3QZ9B 1VIFA 4TV8A 5AVMA 1PSEA 4BREA 1QKXA 3AVNA 5TKWA 2E6MA 4K8XA 1U48A 2ITMA 2VXYA 1XWLA 3O3HA 4ZI7B 3BY5A 3QIOA 3KK3A 1FYNA 1YIJT 1NGJA 2UYKA 3K9JA 2A36A 3L2QA 1LW2A 1NOZA 4CC7A 5J2TA 2CWJA 1C0GA 5LJ3f 2LC4A 2G8FA 4CZFA 2YXZA 4HKEA 4WBNA 1Q9XA 2ZGZA 3C6UA 3J7YP 3JCMP 2A0FB 3WVDB 3OW2A 5LP6A 3WNGA 5JICA 2P9NB 2OYQA 4OMNA 1QQCA 2F1LA 4JYAK 4F7UA 4OB1B 4XTYA 4HT8A 3BZCA 5AQPA 3NTHA 1HRHA 4LD9K 1OH5A 3VEVA 2AHJB 2YJEA 1WSHA 1X1PA 4HUGA 4XH4A 2E5KA 3KD5E 4IHJA 1JLCA 3WXKA 4TV8B 3G71T 3AVCA 2RD1A 4J8FA 2MOXA 5FRNA 3C9RA 4YNQA 2P9KA 1QZ6A 3LP1A 4DTNA 4DBQA 1GCQA 2ZPBB 1S1TA 4CIGA 3TD5A 5HY0A 3N2GB 2UU9K 5L8RE 5BPLA 3Q1JA 1SPKA 1XNQK 5J2TB 5JVDA 1VQ5Q 1TV6A 4FWPA 3LP2A 1QZ5A 1TU0B 3RDVA 3GG4A 4F16A 1WXBA 3SBGA 1XI1A 5GAOn 4OLBA 1FXXA 1GOBA 4HVUA 3HKBA 2OTLF 1TGOA 3DRRA 5M1PA 2GWKA 1QSLA 1Q82U 3D00A 1VQ4F 2LCAA 4ZGJB 4F7UB 1QKWA 5GMKh 1HKCA 2D4WA 3SWNC 4E19A 4LH5A 1S1VA 1IG9A 3CC4N 2VAPA 2YI1A 5GAOl 3JCMc 3JCMf 4E2FB 2FBXA 2Q36A 1S9EA 3RRHA 4PFPA 3I7TA 3CD6A 5KCOA 4CESA 3QWXX 4K25A 1RBSA 3V9UA 1RI0A 4IHJB 1YJNA 4AILC 3MECA 4KFBA 1NGIA 1M1KU 4JK9A 4FK2A 4JKAA 1ONIA 2QYZA 2E12A 1RBVA 1NJIH 4EMHA 5IWAK 1JFFB 2P9KB 3EZ5A 1HYSA 2Z1UA 4XU3A 2DXUA 3E66A 3IG1A 2QA4F 3LGFA 3RIRA 1OKJA 1SS6A 3THKA 4J9DA 1IJJA 3O4WA 4H0OA 2FSJA 4LSNA 4A2AA 2HKQB 3SI6A 1NMDA 1WA7A 3ULDA 5JCOC 1JO8A 4JS5A 2GUIA 1ZUKA 2ED0A 1GLLO 1IBLK 5JVDB 1W57A 3NH2A 4C8NA 1KVBA 3AVAA 1X7PA 2QDYB 4IXCA 1HK9A 4BVRA 3E9OA 3T19A 4FZZA 1T6DA 2KRMA 3SIVA 5CR2A 1ASWA 3AVBA 3ASKA 4J2BA 3PVLA 4BR5A 2KG4A 1QQOA 2BTUA 2LQ8A 4KGXB 4M75D 1EQYA 4RHAA 2O2OA 3L2WA 1TG0A 5KPZA 4F3OA 3BYQA 5I9EB 3M0SA 1S3XA 2GFUA 4RCHA 3AARA 1IKWA 3EKUA 5IYZB 1X75C 1AZEA 2I6DA 5CR4A 5GANh 4G1QA 1YJWN 4PWDA 4NUTA 4CEOA 2FPEA 1D3BB 5EOYA 1M90H 3JV3A 4M78E 4GMJB 4CJPA 2VWJA 1B9FA 1W0HA 3CCJQ 2RJDA 2I7PA 2H3GX 4JKCA 1W2BM 1JJ2F 3QYGB 1MMNA 4ID5A 4O5FA 5AQMA 2ASMA 2QWLA 5AJ3K 5LJ3j 1ZC6A 5KRTA 2GZLA 2R751 1QVFS 2LQWA 5GAN8 1CXQA 5M9OA 3LWPC 3P8DA 4YOUA 3CYMA 2O9VA 4JZ4A 3QEIA 3HKSA 2EYZA 4PJMA 3VF6A 1WDXA 1MWKA 3EO3A 2IQQA 5HCKA 4FM1A 3V1QA 2VKNA 3VPZA 3FDRA 2KQWA 2HKNA 3DLLA 4YDUC 1MNDA 4H5WA 3O80A 4P5NA 1NYGA 3KHYA 2ZVYA 2LT4A 1W2BA 1T05A 2Z1HA 1T8EA 2K9GA 4UQGA 1X3NA 4AM7A 6AT1B 1M4ZA 2KFNA 3IDHA 3OMCA 2AKKA 1EKEA 2JWLA 5B8HA 5LXTB 4RMOA 4IURA 2D0BA 3VGMA 3K5NA 2FGYA 3SQ4A 4IKFA 3NF8A 5D6XA 4KGVB 3CCRQ 1ZBHA 1O75A 1A5XA 1UOCA 1NPRA 4RTFD 2X51A 1I07A 4DFJA 2NRZA 2QEXN 5KYWA 4FJ9A 4I55A 3CCVT 2PUKB 3M0TA 4KRTA 1DEJA 3RUXA 1WHLA 3O5BA 2EWNA 2ZPEB 3BEXA 4FJ7A 2IAFA 3VO8A 3ZOPA 4LDYA 4QS7A 3QWYA 4FO0A 2YRVA 1IKYA 2ENMA 5C25A 1TAUA 3RR6A 3WUHA 4EAHD 3GHZA 5IJ0B 2JM9A 5KX5B 5A2QM 1OQKA 3CC4F 3J80M 5LJ5f 2KHOA 3JB9I 5GAMg 2JT4A 4I9LA 1WFWA 2VYTA 4KKOA 1VQ8T 2JMAA 3ZX0A 1YWPA 1HKGA 2ZGYA 4FIBA 4D8DA 3L6QA 5EY4A 3VQQA 2XO7A 2K1SA 2KLAA 1IHWA 1B34B 2K3XA 1K9MH 2OTJN 2ASOA 2NRRA 4CZGA 1Q86H 1HXDA 2SRCA 3H6EA 3V8LA 4JKHA 4DV5K 4WF2A 2CH4W 4Z4EA 2KROA 3JB9H 2E2OA 2UXDK 1RA4A 3G6EN 2ZZDA 2HP3A 1NGDA 4B3TK 3QO9A 2DYYA 3CCEQ 4CF8A 3DM2A 4DTJA 2KY9A 2OZMA 5I22A 3H3OB 3K5OA 4O5BA 3CJAA 4FLWA 4FK4A 5KYWB 1EX4A 3KWGA 1RDCA 5E26A 3F0EA 2DNUA 3O8VA 1VQMN 1D1BA 2ZGWA 4B9XA 2ALEA 3VCZA 5DY9A 1GOAA 4EI7A 5CQYA 3JB9J 2IGIA 5C42A 4BRCA 5HL7L 2UXBK 3DJCA 3PVQA 3AVLA 3V81A 4FSVA 1JLGA 1UJYA 4O55A 1NZ9A 2MWOA 4CI0C 3ZYYX 4HNAB 1H8KA 1C0TA 2YUQA 4EP4A 5A0DA 1YJWF 4B62A 1KQSF 3S3OA 1LWEA 5CB4A 4H03B 4TVRA 1TUYA 1WSEA 3CMEN 1Q81H 1YCYA 4DOWA 4LUDA 5D3GA 4DBHA 3RVCA 3MP6A 4DS4A 2P9SA 2YRDA 2ZAUA 3WVEB 4FJXA 4OB2B 3SJHA 5KTQA 3CQTA 1VQ4T 1WNSA 3ATVA 2G8HA 2D6FA 4J9EA 1XUPO 4Z8AA 3D6RA 5F1XA 2XDBA 1NBWA 1KNJA 1LOJA 1M3BA 3IKEA 1VQ5T 2FF3B 4QAGA 3PO5A 1GX1A 3HAXD 5AQQA 4J5YA 3QHDA 3J81M 2IVWA 2V7YA 2CKKA 4DR6K 2D0PA 2NYSA 3E9FA 1RFQA 2MI6A 4IIOA 1JLEA 2HCKA 1VA7A 4BRGA 3KUFA 2F69A 3MX5A 3ZSWA 1VSKA 2FF6A 4CI6A 5EB0A 3LAKA 5M1QA 2VG6A 5HKCA 2QTXA 5C15A 4R56A 4ID1A 3F5TA 3IS9A 5C6SA 4FW2A 3ID6A 2OCEA 4L5GA 3V9XA 2P5OA 3DYAA 4M7AG 2ZE2A 2EYQA 2NUZA 4X62K 2ZVZA 2QEXF 3CCQA 1ZLMA 1YF5L 2P9SB 4CEAA 2HHSA 4LF4K 1YJ9A 2UYPA 2YX6A 1YJ9F 4PKHA 4B46A 4W5OA 3S06A 5KCHA 2EQMA 2F2WA 3KLHA 1YCSB 3I55N 2K3YA 4BT2A 3CCUQ 3VS1A 4E47A 1YIJA 2PFUA 2HNZA 4G4WA 1WJSA 2EWSA 2VUBA 4FLUA 3QETA 1VIEA 1XHXA 3WGNA 2P9LB 1S1WA 1W70A 4O8UA 4I2PA 2XHBA 5CK9A 4B9QA 1LAVA 3WNHA 1VQON 4C8LA 3MWPA 3M9QA 1S72Q 2YHBA 3L3UA 3LP0A 3QINA 4FVMA 4XCQA 2HSPA 4IOAL 4BC3A 1NQ3A 4Z88A 2DXCA 4EHUA 2CGKA 2BE9B 1VQ6N 2KFZA 5KQ8A 1VYTA 3CERA 1G99A 3G0ZA 4FJMA 1XMOK 3CBPA 3HPWA 5KYUA 1KC8C 1P92A 1VQ9A 2F9WA 4BWMA 3D0PA 4GY2B 3ZSXA 1NE8A 1RBRA 2AJQA 3LANA 3G10A 4M3ZA 5EZYA 3QDKA 3CCJT 3G71A 4E7KA 2A3ZA 3MMVA 1UJ0A 3SYZA 1VOMA 2HRYA 1VQMF 1E7KA 4C8QC 3HRUA 4Y1DA 1VQNN 3BDLA 1SKSA 4ME7A 2ZAEA 1QWEA 1AD5A 2H3JA 3EFRA 4BE1A 3JAMM 3ZSQA 5FW9A 4CBXA 4B8AB 1QWFA 4D8KA 4M7AF 1TXQA 4W5QA 4X64K 3PIPL 2O4IA 1M27C 1NLPC 2ROTA 1AOJA 5AQVA 3VTIA 3AVHA 4AHVA 1S22A 2EPDA 3C0BA 1WHJA 4CFCA 4C0DB 5KRSA 1C6VX 3H8ZA 2HDAA 2M0YA 4C8KA 3CMEF 2F2XA 3VU3C 1NK0A 1P8ZA 4BR4A 4BDYA 1H7MA 4QVCA 1NWKA 4CJEA 3I9QA 4M7DC 4PL7A 4IUPA 4H5NA 3JCMQ 4F8RA 3CFPA 5HY1A 1SDSA 2BZ8A 2DFFA 5J2NA 1QVGM 4E0DA 4M3TA 2XDPA 2YKMA 3ENHA 5CCAA 1BU1A 1RLPC 2VWFA 4J9IA 4FYDA 4G4VA 4YOTA 5KYUB 3HYFA 2JTMA 3DAWA 2DEUA 1WI7A 2KXDA 1T0HA 3AVJA 4CZEA 4XH1A 2NLXA 3R9PA 5EZYB 3CCRT 4G4XA 2JW4A 3WQTA 4LD6A 4H0YB 2E3HA 2CP7A 1GLJO 3WXLA 4MZMA 1K73H 2K2VA 1M30A 2GBZA 2DTOA 3GP8A 1LW0A 1KC8R 3S41A 4L6V5 2NMUA 4JRPA 1OH6A 3S0WA 4AFUC 5MN6A 3V9SA 4CGFA 2K5FA 3CJ9A 1D4XA 2KTVA 5GIPA 4BVSA 1VQLF 4HUFA 1ZUYA 2XG8D 3BUZB 1QVPA 2RJCA 1BKBA 4CGGA 1KHIA 4CFDA 1NK9A 1ZX6A 3QEWA 3OYBA 1K8AC 1ZHIA 1J5OA 1YTUA 4KAZA 2VWKA 2DL3A 3VS2A 5JLFA 1VSHA 2OPQA 3A8YA 3NCIA 1C0UA 1UGPB 1KQ1A 3V7SA 4AG2C 4IUQA 4JS4A 4ZTJA 3KK1A 2VAMA 5A0GA 4X1KA 1VQ7N 1L3VA 3R0PA 4B1ZA 1ZA1B 2UUBK 4DR2K 5ADXA 3CCET 3MEVA 2GNCA 4M77C 2GQVA 4KHQA 1WBDA 3R6MA 3ZT2A 4CK1A 1PF5A 4F4KA 3NFCA 4FJGA 2WOMA 3E20B 1Q7YR 1NK4A 3AVKA 2XD0A 3UKUA 1GCPA 2A5XA 1NBEB 1KFSA 2ZF5O 1U3OA 5I42A 5CKDA 2QK0A 1I4K1 1BDGA 2GV9A 4ZOLA 4J7FA 5KQDA 2CT3A 4E1MA 1M3AA 4KUIA 4CHPA 3EGUA 4C0GA 3VS7A 1G15A 4KULA 5JLHA 2HVHA 4B45A 4LDWA 1FW6A 3LYIA 3VS4A 4K0KK 4PJOE 3VOVA 1ZBLA 4BRQA 3F9KA 3EE8A 5ECAA 1VQ6F 3H46O 1TTHB 4EB6A 1SV5A 3KJJA 4M75A 5EX5A 3MDQA 4DSJA 3O4QA 4DR3K 3PT9A 3V8KA 5JS1A 2HHHK 5IAYA 2Z01A 3B6NA 3LYBA 3HM9A 1VQNF 2CGLA 5AQXA 2E1ZA 4I9QA 1WPYA 1X6GA 3EEQA 4FWSA 4IO8A 1SRMA 3NVIB 5CYQA 2RKIA 3QB0A 3DB4A 5FRMA 5BN9A 4KHNA 1BI0A 4U67L 3P4EA 1V4SA 4FZYA 4RTVA 2DPNA 3UKUB 4GV3A 3T80A 3FLCO 3J81E 4N47A 2CHSA 3MXJA 5CY4A 3THWA 1ABQA 3CJBA 3A8OB 3CC2N 1S5JA 5EXWA 4B9WA 3CCVA 3J81O 5C10A 3O08A 3WQUA 1JLAA 5J26A 4AMCA 4PKIA 4DTSA 2K5LA 5FLXE 5LJWA 3HK2A 2Q2RA 4BC5A 1MUZA 3EHRA 1K8KA 1R0BG 5FLXO 2CH4A 1NGAA 1ZUUA 2GF7A 2NRTA 4DKWA 3EYZA 3MXMA 4FJIA 2QKKA 4EB6B 4M75B 1L3SA 3OYFA 2CSQA 2GWJA 3KFVA 1VQ8A 2DY4A 4C8GA 4WE1A 5BRHA 3TAPA 4DQIA 2ZJQL 1IXDA 2EYYA 3G4SN 3VS0A 1T03A 3N5BB 1JJ2P 1D9FA 1NJWA 4DV2K 3JAWA 5IT9E 4BI3A 3VENA 4GV6A 3NMUA 1VQKQ 3EORA 4M7AD 3LMEA 3P31A 5HRSA 5IT9O 3E2UA 5C0MA 1LWFA 2CDTA 4CZLA 2EQJA 1JLQA 4CBUA 3CCUT 5HRNA 1IBMK 2P9UA 2JJ9A 2FEIA 3R1XA 3UKRB 3JCMe 1YP5A 4BVTA 3CCQQ 3DLLL 4BY9C 1YJ9Q 5J2PA 1AT1B 2EFIA 1Q82H 3L4IA 4O5VA 1T3LA 4CC2A 1OH8A 5GINC 1K8KB 1WYXA 3O9SA 2EQUA 3TABA 1S72T 2PAVA 1YIJQ 1IG8A 1VSIA 2JWKA 3HTRA 3T1HK 1WAJA 3KTQA 1VQ7F 4I6MB 1N8RH 3O6WA 1BIBA 3UWNA 5LL6S 3V3TA 1WQWA 4NB4A 4ZTFA 1LCKA 5EB1B 1M1KH 1HSQA 3VQAA 2YRCA 3QDRB 3QIPA 2NWMA 4GV9A 2JM8A 1UDLA 3EG9B 3EH1A 4QVZA 2F9TA 4CZMA 4WCEL 4ZHWA 3JAWB 1BIAA 1UE9A 3META 4J8OA 4F17A 4DR7K 3RERA 2I7NA 5KGWA 3PX0A 1IV1A 5J39A 1NG2A 4BY6B 3VQDA 4LDUA 4MLHA 5JVGL 3C12A 3B6PA 1MWMA 3T1YK 3K0TA 2OTLA 2P51A 1PWTA 1U5SA 1VQ4A 1VQ9Q 2P9UB 4HUEA 4ZK7A 1IGUA 4RKUE 1BIUA 1RAAB 4IIMA 3SB2A 4NLBA 5BMVA 1PD0A 4KHUA 4DU4A 1YI2N 3SQ0A 3G71Q 4ILGB 3CI5A 1V76A 3EH2A 4II1A 5FJ4C 1U04A 2HW3A 2E6NA 1KJWA 4DV3K 4FYVB 2W6LA 1SHFA 5FPEA 3RMQA 4C8QG 5GAMh 3OYHA 3WEEA 1ZXOA 1QS4A 3AO1A 3KHNA 4J2EA 2CH6A 3CG7A 5J2MA 2QGGA 5LJ3g 1IHVA 5C2DA 2RO0A 5DLOA 3K59A 4I4TA 2D0NA 4KTWA 2LTOA 4X9CA 1RACB 4CJRA 2XI9A 2R58A 1VQLT 1LV5A 2NUBA 1K0SA 3X28B 2L2PA 4DU1A 5DM7R 2DM1A 4FYWB 3LWMA 1X25A 3CC2F 3ITHA 3CETA 3RSEB 1QVFM 3M59A 3JCMW 1TYQB 4BRDA 2HNIA 4M7DG 3NVKA 5HY2A 2NUPA 4O0IA 3TU4K 2O8EA 1KIKA 3M5RA 4BT6A 2EHGA 4CFAA 2OA8A 4AHUA 2R5MA 4DQQA 4CIFA 4A57A 4CF9A 2VCPA 2MYSA 1WUAA 2Z1TA 1K8AO 4C92C 2PVOB 4BR9A 3M54A 3LWHA 1KQSP 3TSPA 3WJRA 4CC3A 4LDXA 1HX1A 2UYNB 4CJVA 3G4SF 1HJRA 1R0CB 2H8CA 2DAQA 8AT1B 1M2VA 4J9FA 1BB9A 1QP3A 3OYYA 2LBWA 1QVFA 5BPNA 2YNFA 3A2FA 3CCLN 3LDLA 4I4TB 4Y0WA 1CZBA 3QZ5B 2EJFA 3P1GA 3LZJA 1N6QA 3VS5A 3QDFA 4M3UA 4PWTA 4WFAL 1PRMC 3UA7A 3OYAA 2ZPFB 5LJ5e 1NPPA 1M9SA 4C8QF 3G25A 3LDNA 4ELZC 2O8FA 3KLGA 3L0QA 4O4HA 1BI4B 3HKEB 2K79A 1WHKA 3FJ5A 2V51B 3CCMN 4O4JA 4LSLA 2NUPB 3SUOA 2X74A 4KH1B 4IFVA 1X69A 2QQ9A 3OYDA 1IRXA 3RBBB 5FU6B 4C1NI 4DSIA 1N33K 1XC9A 1WN7A 4CC4B 4KBMB 2ZPGB 1W5AA 5GAN2 4M77G 1HLUA 1KD1H 1GLFO 1IREB 2VASA 4Y92A 1A0NB 1VSMA 5TKYA 3T69A 3HVRA 1HNWK 4M7DF 2HHQA 2PUOB 1W41A 1GOCA 4U39A 4YJ3A 3OJSA 3VOAA 3VYUC 1UTIA 2RB6A 1JD1A 2DD4A 1K76A 3E01A 4CD3A 2YUOA 4LF7K 1NGHA 2XRIA 4M78C 4IG3A 3OJUA 1BI1A 4V2SA 4MO4A 4OP0A 4FLZA 2RI2A 1IV4A 5GANf 2HBLA 4FWLA 2QTVA 5HK3A 3U0OA 3NF7A 4FJNA 1YWOA 3LL3A 2C0TA 4LY7A 1WHGA 2RNAA 1Z05A 2IVOA 1Y7XA 1BHLA 4DLEA 1HNXK 3CCRA 3AGKA 4O4JB 4MLEA 2HP0B 2RPIA 3BF3A 4UC4A 3DRPA 3HPGA 1NGEA 4JZ3A 3LWQC 5I2MA 3I5RA 4JJBA 1NLVA 3QNNA 1OULA 2QK9A 3GDQA 4EZ6A 4OGCA 4NOYA 1OX9A 4ZI7A 1AVZC 2WFBA 3RMDA 2DJQA 2E64A 4R79A 5IHNA 2RJFA 1KC8U 1NKCA 3FFMA 4TZZA 1J3TA 2KMTA 3E9LA 2QI2A 3RMSA 2DF6A 2WTUA 1YHQN 4G9ZA 1Z5WA 2JTFA 2ZJRL 3AGRA 3CIPA 3MAQA 1HNZK 1O9SA 4KH4A 1RDUA 1VQPQ 1NOYA 2KXCA 2RHYA 4WYBA 3QNOA 4M77F 3UT1A 3RKYA 1VQKT 2W40A 2P9NA 4N76A 4KWEA 4F6RA 2K7AA 4IWVA 3HKDB 4DTRA 3I3FA 4ZHYB 3MX2A 2A28A 4QCLA 4FWOA 5CO7A 4N41A 3K57A 1TK0A 4WQ4A 4Z4GA 3I56F 4CEDA 2E41A 1FKPA 1UFFA 3D7EO 3JXUA 3CCQT 3ZO8A 3OW2M 2BUPA 5LY3A 1FMVA 4YHHK 2VAWA 4AFSC 2D0OA 2HOEA 2CVLA 3CXCF 3F6MA 4KTQA 4ZHRA 2HEQA 3FGUA 3F73A 1Q7YU 4IDKA 2R57A 2JOYA 5LP6C 1HNVA 2HAXA 4KGZB 2FRYA 1IKXA 5KI6A 1SZQA 1UECA 5HY4A 4B1YB 3N2GA 4RTWA 8ATCB 3NGPA 3AA4A 4J2AA 1GLBG 2L0AA 1UWBA 3OYLA 4KPYA 3JATA 3OONA 4QQ6A 3VYTC 2E2PA 2K3BA 4B6MA 5IHKA 4R40B 1OZ3A 4N0AA 2RHUA 3PE0A 3OS2A 1QSYA 2XKOC 3CCMF 2A1SA 3GTZA 4F6RB 2DFHA 2XY8A 4CFBA 5CYMA 1NJIC 2KK4A 1GCQC 2VWBA 2WONA 2MF2A 2DVEA 1CSKA 1E7OA 2RN2A 3I8BA 1CK2A 1VQ9T 3VEOA 4OMMA 1NGCA 5GAPK 1WZOA 3PNWC 4FPBA 2F96A 4JDSA 3VYHB 1ATSA 1K8AU 3A1PA 3PFSA 2X3XD 4KT0E 5HWEA 1C1CA 1JFFA 3QERA 3BW1A 1MU2A 1KVAA 3IFRA 2E6ZA 2RF0A 4JRQA 1ASUA 3OVNA 2OTLQ 2Z1IA 1VQ4Q 4CJ4A 1UUEA 3L8BA 2FO0A 2QWNA 1H1VA 4KI4A 3M57A 1ZBUA 3JATB 1RT4A 4C8QD 3HKCA 3QESA 3HL8A 1BWFO 3JVHA 1YITN 2LZ6B 2HMAA 4IG0A 5GANj 3OA6A 3QMLA 5F0XA 1S1NA 4JLIA 2Q97A 1WHHA 1ZBFA 2X6NA 4MO5A 4A5BA 1U43A 3WGLA 3GBTA 3LWLA 1OU9A 1RLQC 2L3RA 5LYJB 4DXDA 3BGRA 3V7RA 1Q95G 3THYB 3ZL7C 1BU6O 2CREA 1M90C 3HFNA 2QA4Q 1I39A 3MEGA 2DTIA 2NLUA 3RYFA 4BVOA 3RMBA 4C92E 5AFUA 1ABOA 3FEOA 5CQXA 5FNVA 2Z0WA 1SA0B 4M7DD 3FLGA 5IYZA 4LXCA 3CCUA 1BQMA 3NBPA 3DOKA 3TQ7P 1WQ7A 4BT3A 5CIUA 1D3BA 3EY1A 1YHQF 2E2QA 2CP0A 4A5AA 3MDOA 4IUVA 4BRMA 3CCSN 1Z9QA 3ZX2A 5D6WA 4BI8B 1O13A 4M63C 2QASA 3QJ6A 4O44A 2G8KA 3X24B 2ASPA 1M5Q1 4DS5A 1N9SA 1U1SA 2QGFB 1S72A 4N56A 3SUNA 1XRGA 3HKCB 4IFEA 4LE9A 4A4EA 1KAXA 1Y07A 4JNEA 3VQCA 3ZSZA 5BPMA 3CPWF 5A0LA 4DSLA 2IVNA 3PY8A 1KNKA 3ULEA 4JAXA 3WNEA 1CKBA 3CPWS 3E9PA 2O31A 2F8TA 1NYFA 4FT2A 3ASMA 5GAHP 1HUXA 4M7AA 4NXNK 2CP5A 3WGMA 4BT4A 1BCOA 5CZ2A 3LWRC 3JSMA 3TSWA 5BR8K 5AFUH 3U4LA 3RYFB 2HBWA 4PKGA 1PXWA 1NLOC 3QBWA 2CUBA 2RHZA 1W5EA 3JCMM 4C4WC 5FNVB 4EIAA 2J7IA 2PYLA 1PC0A 1BCMA 5GAMd 4JUVA 3P5JA 4LC9B 4B3SK 3AHUA 5LXTA 4DWIA 1IB8A 4ZN3A 3MN9A 2HBKA 3HHTB 4LFBK 2XHCA 1DT9A 2OX7A 3HOSA 3SNNA 4M77D 2EJGA 1HKBA 4KHYA 3C8LA 2C06A 4DMNA 4U3JA 2LJ3A 1E3MA 3H0IA 1JJ2S 1K9MC 1MDUB 5JCOA 5IJ0A 1SG5A 1Q86C 1NK5A 1VSLA 2OI3A 4Y28E 4KH6A 5KX5A 3OYIA 1RGIA 2YNGA 3MCQA 3CC7T 4MFBA 2DKGA 2YSQA 3INZA 3V7CA 3TEEA 3ULEB 1N32K 3F0GA 5DCVA 4M7AB 2BGGA 1VQLA 2H8HA 2KVQG 1RDDA 4OMPA 3SQ1A 3IMXA 1B34A 1R77A 4XK8E 3G7ZA 2PY5A 2CP3A 5FWBA 3ON1A 1J7HA 1SEMA 3AO3A 3E9GA 3SWNB 3M0RA 1KCFA 1ZSZC 1NJZA 4M78G 2V9YA 4C5HA 4J9GA 2Z1GA 1GBRA 4JPBW 3VRZA 5KPRA 2EBPA 4H0PA 4NWOB 2M0OA 4FW1A 4E6RA 1N27A 2PVDB 1RTIA 3NAEA 3FD5A 3CC4Q 3EG2A 4TSXA 5AZJA 2EX3A 3SD4A 3VF4A 5CHIA 1YITF 2LJ1A 4CK2A 2DLPA 1VHAA 2NRVA 5HP8A 1VUBA 4AFZC 3DRSA 3I56T 1RT5A 2BKDN 1Y57A 4U3JB 2X3WD 4RCBA 4A63B 4KRFA 5KGXA 4ZN1A 1VQPT 3M8SA 4M8IA 4BW0B 4OB3B 1Q81C 2RN8A 3HPOA 2G9IA 3IR9A 3H9NA 2CP6A 4LH4A 3VQEA 3VA0A 3VEZA 2HBMA 1W55A 3MXIA 3EKSA 2LMJA 4HNAA 2O8EB 2O4XA 2AZVA 2YHYA 5GIOA 2F4VK 4YDUA 3FJPA 3VV0A 4JKBA 2E4HA 4F7UE 3CCSF 3JCMJ 1OX8A 3M0PA 4BE2A 3FR0A 3SLCA 1GLEG 2LRQA 1X52A 2I0NA 3A8LB 5MLCQ 3LWIA 4NLCA 3VKIA 5FPDA 3DLBA 1MV3A 3N2KB 5AZJB 5DM7L 2CZ1B 4BB7A 1VQNA 4QQDA 1H92A 1QCFA 3KD1E 2LQKA 4RCCA 1H3HA 1U6ZA 4M78F 5LJVA 1YJWQ 2ESWA 5JS2A 3HJFA 3NHNA 4CZJA 2LCCA 2FHDA 4B1VA 2KTQA 1YBYA 1IV2A 1NJIO 2CSIA 2DX1A 4BY9D 2HHVA 1KFZA 4OPAA 3CD6N 3FBAA 3DLHA 1EFNA 3M1FA 2HS3A 2EVRA 1YJNN 3IKFA 2V7ZA 2VV5A 3V6DA 1XNRK 3NMZC 2ECZA 1U1TA 2QXLA 2QWPA 2ZD1A 4CZIA 2DFEA 2O4XB 3QBXA 4QVDA 1XNIA 5AQWA 4ELYC 1PM3A 2E1HA 4PJOC 4J9CA 5FPNA 2KZZA 4JJNK 1QQNA 4GKJK 5HP7A 4A61A 1KQSS 3QEVA 2BZXA 3S02A 3CJ1A 4CECA 4B08A 1M8VA 2O88A 2F5TX 4A54A 2OTLT 1RDBA 2X78A 5GMKm 1DKGD 3AVMA 2JXBA 1ZQ1A 4YOVA 3NK7A 4CGDA 2F2VA 1RL2A 1I5LA 4E7IA 4EP5A 4GKKK 2RHOA 3TAFA 2NRWA 1CZAN 4M3XA 4BT5A 3NGZA 4JI0K 2O8CB 4RUGA 4QS9A 4E89A 2MPXC 2G8IA 1YT3A 2V8IA 2P9LA 3CMAN 3JCMX 1M90O 2A40A 3QIIA 2QEXQ 2O8CA 1RABB 2GTJA 3CM5A 3RR7A 4E1JA 1LJOA 2DL8A 4CEFA 1D1CA 2QA4T 3ZEUA 2RHLA 3VS3A 1VQKA 4EI9A 4AM6A 4BR7A 2XDDA 1N34K 2BDPA 2JZ2A 2RQRA 3T3FA 1EZZB 1TKZA 2RHHA 2VG5A 2FYKA 3MCAB 2YYEA 3PLAA 4FLVA 3DMJA 2D0CA 2YHAA 4GNIA 3ULRB 1OH7A 3FZLA 4J7IA 3PIOA 3M56A 4C0DC 3OYNA 4K42A 3VTHA 1GRIA 3VOBA 3C9SA 3VQ6A 4JEPA 3I35A 3QO3A 4D6WA 3SCXA 2LNHB 1WSIA 2UZHA 2LVMA 2EW3A 2MK5A 2X6SA 4CF0A 1IV0A 1NM7A 3JARA 2W8BC 4L3QA 2ETJA 5LJ5j 3H0FA 1EO1A 3ZFJA 3O3GA 3BDUA 2YT6A 4H0TB 2OTJF 5HP1A 3V8JA 2BE7D 2B4JA 2IOCA 3CJCA 3ZEUB 2KGWA 3C9TA 4YJ2A 4Q5VA 2RHXA 3I5SA 5GMKe 1VQMQ 3JCMV 4ISFA 2M02A 5AQZA 4C8MA 1K73C 3MWTA 2HMIA 3G6EF 1OZ2A 1UFYA 2YHXA 4G88A 5C12A 2KE9A 5AQJA 5J1EA 1TUCA 4RTUA 3RKXA 4K43A 1E4FT 4JRIA 4CHOA 3I33A 3VESA 2ZQBA 4B8CA 4XIUA 4O0JA 3J7AF 2O9SA 1WIEA 1J5EK 1W3EX 1JCGA 2YHTA 1KSPA 3CYQA 4J6YA 2HD0A 1PRLC 4HCKA 4JK7A 4IIJB 3MPUB 1V29B 3VTIC 5JMVA 1H48A 5KE2A 4ATOA 4CZKA 4O4LA 4JLHA 1K9MO 3GIBA 1Q86O 4I50B 3CMEQ 4EMKC 3U9ZA 1G2BA 1L5UA 3K58A 2QKBA 2RQWA 3QG1A 3TSQA 3CD6F 4J6WA 5IHIA 4RW6A 4BQLA 2A42A 1YJNF 1I0CA 2QWOA 3A8HB 3KKRA 4F04B 4E1NA 4DU3A 4EIKA 4C23A 3CFRA 1YN8A 3JARB 4C1NK 1WSGA 2NRHA 1TKXA 3KWIA 3TR8A 4F3TA 3W3DA 2IS3A 2PTKA 4GLKA 5DK5A 4BD3A 1ZBSA 2CZ7B 2COWA 2PQWA 1KAYA 3HP6A 2XU8A 4YJ2B 3SV3A 4L8RB 5GAN4 4EHTA 1BGXT 1NGGA 3CXCP 2CW4A 1HYOA 4M3YA 4ISEA 2QG9B 4AG1C 1WLPB 3D2EB 3WXIA 3K0SA 5DMRA 3LZIA 4FZXC 1I5OB 2EGEA 3G4SA 3TD3A 4LF9K 4HCZA 3K5LA 4M78D 2OAWA 3FFKB 3NVMA 5GIPC 2QQAA 5GANe 1VQLQ 1QSSA 3CC4T 3M8RA 2G8UA 4RTZA 2LBTA 2G8WA 5GAMf 3CMAF 2EKHA 3MCPA 3FRNA 1RBUA 1Q81O 4C8QA 1QQJA 3TTDA 5A2QE 1GFDA 3J80E 2HF3A 4JI3K 3HOTA 3EHQA 3NGYA 2DRKA 2JVVA 1M2OA 3GYQA 3PMTA 4HCBA 1C0MA 4CBWA 5A2QO 3MJXA 1JY8A 5ELZA 3J80O 1EWRA 5EYPA 1YAGA 4XU0A 1JXOA 3U6FA 1IZ6A 3LDPA 2PZ1A 3QFUA 3W0LA 2KTUA 3NHGA 1KSWA 1LPLA 4C81A 1X43A 1KRPA 4QQGA 1RT1A 3CEYA 4FVUA 4VUBA 5AQOA 1EWQA 4QW2A 2DBMA 3S0YA 4M7DA 5T7BA 3TREA 5KPTA 5AQRA 3P0ZA 2LJ0A 3C0CA 5AQLA 5IXBA 3I55F 3VN5A 1KC8H 1QLYA 2H6LA 4BRFA 4Z89A 1TH7A 3C95A 2W0ZA 3ALYA 4H0VB 4CJ7A 3M58A 5EO3A 4OGEA 2LP5A 3CQXA 3D01A 1W2BF 1UI9A 2E5QA 1VQ6Q 5HBMA 2KYMA 3B8AX 4PL8A 4M75C 4IOCL 1N6AA 3WJQA 1YJWT 3ZP7A 4DEYA 4C8QB 5AR0A 1C0FA 1QD9A 1M90U 2G6FX 3BFMA 2DT4A 4ZHVA 1VQOF 1DBFA 3DLRA 4DG1A 4ZHQA 4NCGA 2K6DA 3A5MC 3ZSYA 4HHTA 3F9MA 1E4GT 3DB3A 1VQNQ 4OMQA 5M1KA 1OVQA 1O1WA 3LDSA 3HWUA 3PAFA 5EYPB 3WPXA 1KHCA 5F2RA 1UEBA 4B1XB 3CC7A 3M3ZA 5AQHA 4E3SA 1RTJA 1JL2A 1YJ9N 4PNOA 5IXFA 3JRZA 1RQ7A 2AA4A 4EI8A 2FBTA 2O01E 2HL3A 1DLOA 1VHXA 4DRXA 4M7DB 1Q7YH 2B5JA 2V8KA 1YIJN 1X9JA 1U47A 1X3MA 5KE3A 3C6HA 2RI3A 3REAB 1Q82C 2VB6A 1BA0A 1K8AR 2J4RA 4CJFA 5GAOm 3M4YA 1DTQA 3CPWP 4FU6A 1XHOA 3PV8A 3M0QA 4A59A 4M77A 5GANK 3CQYA 3UKRA 4BRKA 4BQZA 3ZBDA 4CK3A 4KHPK 2RQTA 4PJOG 3REBB 1N8RC 4MDWA 1KTQA 4HXJA 2DXTA 2DRMA 3I56A 4ZHQB 4FFBA 1CLIA 3Q7CA 1WBBA 2QEXT 2NNWA 3E19A 3DLGA 3WT0A 1VQPA 3WXJA 2DO3A 1D5AA 2EYWA 1GO1A 1T6CA 3ISNC 2O8DB 1V1CA 1LNXA 1J53A 3QSUA 4GVMA 4I6MA 1YUWA 3G71N 1VH8A 4JRKA 3EL2A 1JLFA 1S1UA 4DA4A 1RNHA 1X2KA 3EG9A 3SV4A 3HTNA 3CPQA 1VSFA 1PNJA 1U3PA 2IVPA 2R6R1 4DRXB 2Z1FA 1U40A 2UYJA 5GANg 4CEBA 4J9HA 2CZ6B 1IH7A 1K9MU 3C7NA 2LSNA 1Q86U 4DCHA 2A37A 2OTJT 2LNVA 5LJ3d 3QEXA 3AA5X 1W581 3L2ZA 4OVLA 4M77B 3CCMA 4RW7A 1LWCA 4DFKA 1VQ7Q 3G6ET 3X20B 3K2PA 4MMKA 2QQRA 2AIRB 4N4GA 2Z1JA 2BE2A 5LOVB 4BDZA 4LUEA 3RNJA 4FFBB 3OSVA 1XQSC 2IPOB 1NK8A 2ABLA 3SIUA 4CEQA 4W5RA 3V7EA 4OMFB 1K73O 1YGYA 1HQUA 1I3AA 3D2FA 1Y96A 2KRNA 4R55A 1RBTA 3LX7A 1VQMT 1VRUA 4O4GA 4FYYB 2E10A 4TV9B 4PJOF 5MN4A 4Z0UA 2K5IA 1GLCG 4NCAA 2VQEK 4FLTA 2X4WA 4GBQA 3L2RA 3ZSRA 3IAYA 1KLNA 4BE0A 2KT8A 2RHIA 1GZ0A 3UT5B 4ERHA 1W1FA 3C7NB 1SL2A 3N4QA 3ER0A 2P84A 4DF4A 1TSFA 3JAME 1Q81U 3RSEA 3SUPA 1TYQA 3CMET 2VVKA 3UE5A 1FX7A 1ZBJA 2C0OA 4Y91A 3UPUA 2I2LA 3JAMO 1HPMA 4NYFA 3OBYA 3SFMA 5L23A 5CE3A 3P38A 5EIBC 3V9WA 2L89A 1HNIA 2OAUA 1NEBA 2JTEA 2XIDA 4HVVA 4ESRA 4X9DA 2GTDA 3H08A 1ZYQA 3NF6A 3KK7A 2P5GA 2E70A 4RW4A 5CZ1A 4MZPA 2D0QB 2ZCFB 3KZBA 4Z4HA 3QJYA 2UYNA 1AWOA 3D2FB 2KI7A 3KVGA 1Y96B 5C0YA 2LT1A 5BN8A 2DYBA 3CC2Q 3R8EA 1YIJF 1WXUA 2W10A 3LAMA 2QA4A 3GNGA 1RAIB 3R6OA 1Y0MA 1K6YA 1M3CA 3RE3A 3EG1A 2P9PA 1NGBA 4NQ3A 4FSSA 5FU6C 3CJ7A 3DKMA 1XHZA 2CYZB 2YDLA 4YOXA 4RG8A 1Q9YA 3S0HA 3CPWA 2RK2A 4XTWA 3N4PA 1BI4A 4FOIA 1KD1C 3SAHA 3KJKA 3RYHA 5KYYB 1OOTA 2ITGA 1N5YA 1JJ2M 4IDHA 3G4SQ 3JASA 1WOQA 4FT4A 1VYUA 4H4MA 3GE1A 5GAN3 2WACA 5FU7C 4JI8K 3ZP4A 1OU8A 1RLGA 2MIOA 3DXKA 5CA0A 2J6OA 2IAJA 3EGDA 4XTUA 3VEWA 2KBTA 3I55T 2QW9A 3FE1A 2PVGB 9ATCB 2FBVA 3CM6A 5GAEP 4DFMA 1T7PA 4LFAK 1FNJA 4FM2A 1BL3A 4O4IA 1N36K 2DA9A 1S6PA 4ZGDB 1RAHB 3GNFB 3KXTA 4FWRA 3HJWC 2OZSA 3QFPA 3DDNA 3TAMA 3VGLA 4CJ3A 2DYIA 1JJ2A 1X7OA 1VQOT 2P9PB 2L3QA 1KAZA 2XK0A 4HT9A 4M75E 3ERNA 3ENBA 1Z25A 1TVKA 2YJFA 1RAEB 2QQSA 4EZ9A 1MMGA 2KRSA 3CCVN 1AWXA 2ZODA 4E6EA 5DM6L 4DTUA 2ATQA 3RYHB 5LMUK 1VQ6T 5BRDA 2EGCA 1M1GA 1BIZA 4BRHA 2KT1A 4DUZK 4B9MA 2WBNA 1U3LA 1QHTA 2EWCA 2SEMA 2HP0A 3OYCA 3JCMg 3JASB 1RUWA 1J6ZA 2X4JA 1UA0A 4WQ5A 3DXKB 5CA0B 2YCHA 1VQ8N 1VQNT 2HX0A 3EGDB 2PYJA 2ZM6K 3VF2A 4O4IB 3BDPA 3E1SA 4C0ZA 3VI6A 4M7YA 1LCUA 3RKWA 4YOYA 4FWQA 4RWTA 5BREA 1U49A 3PIOL 1MV0B 1ZBXA 4EMGA 1YITA 4I7FA 3L42A 3VA3A 1Q82O 1CLQA 4H8KA 5AQUA 2GEMA 4KB1A 1JN1A 1QVGF 4PFOA 1UGQB 5EC7A 2RM4A 1SZ2A 5AQIA 3CC7Q 2P0PA 2W6KA 1TVKB 4RQOA 1EIFA 5GJVB 1R0AA 3HKDA 1SL1A 5LL6Z 4ILJA 2BIVA 1QVGS 2J05A 1N8RO 2JNBA 4B1WB 1KVCA 3OY9A 1YI2F 3CC4A 5G4VC 4J83A 1FMKA 2DK3A 1FMWA 2B86A 2ZJPL 3TANA 3ZLJA 3BE3A 3HKEA 1KFDA 4PJOD 4HCCA 4PY5A 1D1AA 1BISA 3A5LC 4HWIA 2R5AA 2A1RA 1IBKK 4DTOA 1K9AA 5AZIA 3LFOA 2OHWA 2DBKA 5ITZA 3J7AP 4WQ4C 5CA1A 4JHDB 3I56Q 1P90A 5GAN7 4A2BA 3QTYA 3L2UA 4M42A 3GOIA 1KQSM 4HVJA 2HS4A 1T3SA 2BTTA 4N4IA 1B7TA 2AMTA 3OQ5A 4FOEA 3SHWA 1XMQK 3U8XA 2CP2A 1F1BB 3AA2A 5C2FA 1FFXB 1NM1A 4BGBA 5IN1A 3KE1A 1VQ5N 2RJEA 2RK1A 1GLDG 5B8FA 2GUPA 4BRPA 4WFNL 4JKFA 1VQ7T 4X3LA 4K11A 3SZ2A 1SKRA 3JSCA 3MEEA 2YNHA 4AHSA 2DVJA 2GQIA 3OBWA 1H641 2K4YA 4PJJA 4NS5A 3X26B 1YJWA 1EXQA 2ZWHA 3VGKA 3HTVA 4CJSA 3TAEA 4N0AC 3GPLA 1ATRA 4A4HA 2AP1A 3DOLA 3P83D 1UGRB 1KQSA 5AT1B 3KJVA 5HROA 3TAGA 5GMKj 3CCMQ 1MA9B 3K14A 1G5VA 2HMPA 1HPZA 5AZIB 3CXCS 2GX9A 4XH5A 2XICA 4CJQA 2UUAK 2KDSA 1TS9A 2YUNA 2FSKA 3M6GA 4E7HA 1IKVA 1S9GA 3H45C 4JI1K 4B3MK 3QUIA 5CA1B 5ITZB 4JD2A 4JI6K 4CGHA 4BROA 2G8VA 3OYKA 3CCVF 3ZSVA 2P9IA 4X1IB 3R6NA 3O3FA 3HSCA 2EYXA 4JK8A 3I8DA 2LX9A 2PNIA 4M78B 5LYJA 4W5TA 5LJ5g 4ANJA 3THYA 5CKBA 2I5JA 2R7YA 2KEAA 3RR8A 2BO1A 1Z26A 3H3NO 4OKEA 4CJ5A 5GMKi 1VQ8F 2FZCB 2RPNA 1SA0A 3D54A 3GLXA 2HNYA 3HRTA 1GO0A 4YY3K 3HRSA 3BY7A 2IC3A 4YTLA 4GVEA 4H5TA 4YORA 4J9BA 3NVKE 2WSCE 4LFCK 5EWRA 1QCOA 4XTXA 1VK0A 2E4LA 3EG3A 2ZPHB 1BI3A 3CC2T 3AV9A 2QEXA 4Z4CA 4I2QA 4CD1A 2LCLA 5JQGB 4X1YA 4JD2B 2YNIA 4WCIA 2ED1A 1YVNA 2P9IB 2NUTB 2HF4A 3LM9A 3CCJN 4KO0A 5AQTA 3HBTA 1W2BP 5SZTA 3SPYA 1KD1O 2O8BA 3TSZA 4CEZA 4E7LA 1HD3A 5KYNA 1SHGA 1YHQQ 1YXQA 5BRFA 2VQFK 2BTQB 5CKHA 1FKOA 1E6GA 5KH6A 2D1KA 1D0XA 3NTKA 3G4ST 1EETA 2KKZA 2YV0X 2LCSA 2OTJA 3NE6A 4DV6K 1V4TA 5GONA 4M3RA 2DL4A 2DE0X 3QKJA 1KXPA 4IBNA 2CUDA 1L3TA 4IUUA 3G6EA 1NJIR 1AWJA 1S1XA 3Q8HA 1UGSB 3CF5L 4JJCA 2DZ9A 3HVTA 1OI1A 4CJUA 4CHNA 5AQKA 4WBNB 1K1ZA 4M7AC 4LNPA 3QXEB 5LP6B 5GAMe 3RMAA 4LF6K 3V4DA 1UB4A 3F70A 4AT1B 4JI4K 1VQMA 3ZT3A 1OVYA 3J7AR 3CCRN 1VQ5F 2B6AA 4OJRA 3EGXA 3WXMB 5GAOr 2E1YA 2HVIA 2O8BB 4C92G 1N8RU 4XQ3A 4OF1A 4DFPA 2HHWA 3CB2A 4PLLA 1KG1A 2FPFA 4FWMA 2HQSC 1D0ZA 3A8GB 3AO4A 1TL3A 1X6BA 2UUCK 4WFBL 3SWNA 5LA6A 2E5LK 4IO9L 2Y4XA 1C1AA 1T0JA 3CMEA 4O2AA 2J06A 2KYBA 2YLCA 4X1VA 5GONB 1QMCA 1H47A 4LNUA 4E7SA 1MMDA 4DSKA 3NGIA 1M90R 2AIFA 3VYSC 1TKTA 3JAKA 2AT1B 2D8HA 3M53A 3OA9A 4BGAA 2P6YA 4DQSA 4BWJA 4PA1A 2GBQA 1BQNA 3HKBB 4BUGA 2IDOA 1NKBA 3FB9A 3F0FA 1ARKA 1ATNA 1XOVA 1YI2T 4QS8A 4DQ2A 3TI0A 1NGFA 4FLYA 2FVUA 1NJXA 4JKEA 1ZBIA 4BC4A 2KZMA 5HXZA 4E7ZA 3CCEN 1RT7A 1PSFA 3HPHA 4KHSA 2XY5A 3CMAA 5J2UA 3LPUA 3EGXB 1N9RA 1JKHA 2DXBA 2BZYA 2KQ2A 3VUBA 2G3RA 3M5AA 3JS6A 4LN2A 2J6KA 1T0KB 5GJWB 3OTOK 3THVA 2DJZA 1I94K 1W97L 1YITQ 3RA6A 5J2QA 4KB0A 1X9MA 2YWWA 1W40A 3L2VA 3TWHA 3FD6A 4YFUA 5LA6B 4CJLA 2DETA 1QVFF 4FPAA 3H1QA 1BI2A 4O2AB 4Z4FA 4OKJA 4LNUB 4C92F 4BG8A 4ELVA 1I8FA 4C5EA 4BDPA 2DTUA 3JAKB 3N2KA 1B07A 1VK3A 1CZ9A 5EU7A 4F9OA 4PUOA 3KIZA 5SWMA 3CCJF 1GL5A 1T0AA 3ELCA 1BBZA 3I55A 3GF5A 1SF9A 5GAGP 3K12A 4H4OA 3H6ZA 5GIOC 4OKKA 3C94A 2BUDA 4JI2K 4HTUA 3UATA 4OPHA 4BR2A 3GOXA 3CCSQ 3HT3A 5J2UB 2OPPA 3O9UA 3TCJA 3ATUA 3TTFA 4C8OA 3JALA 1VQOA 3AVFA 3QUWA 3P8HA 2WUSA 4CJKA 5G4UC 2JUFA 3D7SB 3P39A 2QWMA 1SKWA 1K9MR 1PKTA 2QXFA 3CCLT 1TL1A 2RHKA 4CJWA 1Q86R 4PQUA 1PCXA 2C0IA 4XTVA 3QYHB 4RTXA 2CGHA 2HNDA 1VQ6A 3LPTA 3JYTA 2DIQA 2V52B 2L5QA 1ZSZA 2HQXA 2UXCK 4G4YA 4LDVA 3IEWA 4LCKA 3CCMT 2CGJA 4IUTA 3C6AA 3LDTA 2HS0A 2MAMA 4ILHA 3Q7BA 3CCRF 3O5ZA 2Q3SA 3IMPA 3F0DA 3AAPA 2IIRA 4B9UA 4FJKA 3FPIA 1IV3A 1KD1U 4CF2A 3EZWA 2E88A 4QKUA 2WSFE 5LJ3h 3NTIA 4CGIA 3VQ5A 1I81A 4FJ8A 2DTHA 3AVGA 3O1WA 3VUZA 1HJDA 2M9UA 2H3EB 3JALB 4BT7A 3CCUN 3OYJA 1OPKA 1W9HA 4RW9A 1OFUA 4F7UG 4YOWA 3RTVA 2HHTA 4XTZA 1G3SA 1X2QA 5HRPA 4NL3A 5AQSA 4BC2A 1BOTO 1TAQA 3VS6A 4JJDA 4CGJA 2E8AA 2NZTA 1RLUA 1I1JA 2QDLA 1SRLA 1Q81R 4MMLA 3S9HA 1J9AA 2RI5A 4I55B 3CG6A 1S72N 2PHNA 4B3RK 1XBIA 1BA1A 1ZSZB 1VYVA 4PLIA 4MZTA 3HSBA 2VG7A 2GVIA 3L1AA 3A98A 4DLGA 4CHZA 3S6WA 2BH1A 2XY7A 2LBXA 1U4BA 3LP3A 2P0QA 1UGVA 2RH2A 3KLFA 1S6QA 1G3TA 4FSXA 1HR0K 3CCEF 2FSNA 4OLAA 1C6VA 3GL1A 1JLBA 4C5GA 1R59O 4PJLA 2Q0UA 3L7QA 4O4LB 5D6YA 3L4QA 5EVZA 2EKOA 3M55A 3A0IX 4AHTA 3VRYA 4FJHA 5EIBD 2DFUA 3DXMA 3PLAC 4ICLA 4J2DA 3OHRA 1MMAA 1C1BA 1YHQT 2BANA 3EN9A 2GLZA 1AWWA 4FYXB 2EIFA 2F5KA 4U7BA 3N4YA 2Y4YA 2FZGB 5J3BA 2FLOA 3EE9A 4O8KA 1ACMB 1Y71A 2A3LA 4M7AE 3O9TA 3NH1A 1VSDA 1PKSA 3MHXA 3JCMh 1WB9A 1NK6A 3WNFA 1VQ7A 3OW2F 3GBQA 1RTHA 3HI0A 4PJOA 5K14A 2DL7A 1Q18A 3RRGA 1LVKA 3LM2A 5GAOq 2D9TA 4F7UF 4MDBA 4IIJA 3RYIA 3HZ6A 3MK6A 1FJGK 3OW2S 3QEPA 2OTJQ 4WTOB 3O1BA 3U3GA 4I50A 1QVGP 3SBTA 3SMPA 3V7QA 4DB3A 4NYNA 3MEAA 5FLXM 2FB7A 1X01A 4PKCC 3G6EQ 1VQLN 3ZT0A 4ISGA 3RYCA 3DLMA 3MP1A 1TWBA 4NO7A 5C8YA 4H5RA 2W41A 5FDLA 2QQBA 2GCXA 3DXMB 1JXEA 2HHUA 1FWZA 1NMUB 4A4KA 1IGQA 4Q0BA 5CB4B 5AQFA 1TVRA 2FC3A 2CSLA 3IQLA 2A6AA 4JI5K 4C92D 3ME9A 1UAXA 3A5NC 4DOVA 3AVIA 2DMOA 1WXTA 2HSEB 3IRXA 4AF1A 4DSEA 3KK2A 2L26A 1WSJA 2DEQA 3LW5E 4C5IA 3D2EA 2M51A 2K2MA 4JN4A 5IT9M 3VETA 2GFAA 3CD6Q 3FIFA 5LMNK 3FFIA 1YJNQ 3KIOA 3SDZA 2ZPIB 4PJOB 1Z5VA 4XEIA 1OEBA 1B3QA 3T7ZA 4CHQA 3RYIB 2FG0A 1VQVA 4EPCA 3ZCMA 5CVIA 2JNGA 1BYMA 5C24A 1JCEA 4EFHA 4QOZB 1TKDA 3FZKA 4W5NA 4DBFA 4PHTX 4CHYA 2DERA 1WLJA 3CC2A 3HP9A 4IEIA 5FPMA 4NCBA 3CCUF 3S03A 1CKAA 3DC2A 3UDCA 1D8YA 3RYCB 5C8YB 2J6FA 4XAXB 1JL1A 4CJTA 4K41A 4ORZA 1WGSA 2JS0A 1YFNA 2L3SA 4NL2A 5AQNA 3RWUA 4BACA 2KSSA 2QM1A 3M4GA 3P10A 1UG1A 1TUDA 1H3ZA 1YITT 2FZKB 2YKNA 1RCHA 1NNEA 4B9NA 1S72F 4PJNA 3EG0A 4FLXA 1DGKN 3H0HA 3V1RA 3CMAQ 3VERA 3ZETA 1Y97A 2CZ0B 1QAHA 3AO5A 2MCNA 4AHRA 3P8BB 2WSEE 3UA6A 3FC3A 3RA5A 3ZSOA 3CPFA 4KH5A 4JKGA 3WGKA 3FZMA 3QPHA 3JB9G 3MKDA 3LH5A 1GXIE 3CYPB 3R3LA 2D1XA 4HA8A 1WSFA 1N5ZA 1K73R 4DR4K 3LALA 5E84A 1AZGB 3WPWA 1YVUA 2FPDA 2Q0RA 3PO4A 4DTXA 3PTAA 2AK5A 4FWKA 4HTLA 1NJIU 3NPFA 3HSTB 4AHCA 4F2SA 4R5PA 2DD5A 3AT1B 1QCNA 2KAFA 4EMKA 4OPKA 1X9WA 2Z1EA 5JVHL 5IJ9A 3CCST 2WALA 2HRUA 4M4ZA 2QWQA 3BF1A 1Q7YC 3ZT1A 3A5ZB 1NG9A 1RT2A 4RTYA 1B9DA 3I55Q 3I0SA 3HM8A 2YUPA 1W59A 5LJ5h 4OMOA 3C65A 1JXBA 3CPEA 1YTAA 4CEEA 1VAZA 3CFOA 2L3PA 5I21A 3VMFB 3ZETB 2QTPA 2X35A 3DLKA 4IJAA 4FXDA 1VQOQ 1X9SA 1MNEA 2HQEA 1XV2A 2Q31A 4JKGB 4OMLA 1AEYA 5JH7A 1GFCA 4Z4IA 1HJOA 2FBYA 2X4XA 4CZHA 3MBMA 1W6XA 1QVGA 3OMGA 2EJ9A 1ITGA 1SUQA 1VSEA 4RTTA 4BRIA 2Y1IA 4MDXA 1D0YA 1TK8A 5GANd 1QW1A 1VQKN 2GTOA 2V26A 1A5VA 3SPZA 4G4ZA 1W2BS 4EMKB 3MEWA 5IJ9B 1YI2A 4A4GA 3JB9F 5E41A 3RMCA 1K0XA 1FSZA 1MHNA 5HXUA 4DEXA 4BR0A 2EAYA 2OPSA 2VYPA 3K5MA 3DWLA 3O8MA 3QHSA 2HVYD 2RA2A 3CHWA 5HY6A 2O8DA 3CCQN 4FL9A 1WX6A 2Y1JA 4HVWA 4E7JA 1SQKA 2JS2A 2PMPA 1UHFA 1VRTA 2JGUA 2P1JA 2QTDA 2H8EA 3OB9A 1ESVA 3K2XA 4X1YB 4DUYK 1WJRA 3HFOA 4X65K 5M1NA 1ASVA 1Q8RA 3MQWA 2M1HA 3QBYA 1T44A 4KI6A 2RQUA 3AY9A 2BTFA 4IZ9A 3J7ZO 4DHYA 2CZWA 2ROLA 3CXCM 5KYXA 5JH7B 3O85A 2N48A 3X25B 3LDQA 3P4IA 1BG3A 3PSIA 2HQHA 3RESA 2COZA 1TUUA 4KUDK 3VQ4A 5AYFA 3VQ7A 2RQVA 3VEXA 1DTTA 4TUYA 4OB0B 5LOVA 2YXYA 5M1FA 2IG8A 5M1OA 1M1FA 1PD1A 2LDMA 1YNZA 5IH2A 1NU0A 3C9UA 1M1KC 2CH5A 4M3WA 1XQHA 5FWCA 1E6HA 2KW4A 3ZT4A 3LWOC 3TU5A 4PFZA 5LJ3e 2D5RA 1SAZA 3NMUC 5FROA 4X1KB 2HZYA 2A41A 1VQ9N 4YJ3B 3ZEHA 4O2BA 4A62A 2LQNA 4BY6C 5ADXH 2GELA 3CXCA 4DQRA 3A5OC 4B5CA 4TV9A 4DQPA 4LF5K 3ESJA 3LGLA 3BZKA 1W42A 7AT1B 1K8AH 4DR1K 3M84A 1KK7A 1ILYA 3LLRA 2PZSA 3CCLA 3T1AA 5I2SA 1Q8IA 2VGNA 3M1XA 4BRAA 1G3WA 1TUBA 4PL6A 4B9LA 5EG2A 3UT5A 4BVQA 1CXUA 4ZOLB 2DL5A 4J6XA 5KYXB 1Z6RA 5GAMj 2W42A 4CVNE 1A5WA 2WC9A 3OS5A 4KHWA 3SUQA 2OJ2A 3M0UA 1J54A 4TUYB 1TUGB 4ZNXA 4RW8A 1NKEA 5MN5A 1BO5O 5GAN5 1UHCA 1WNLA 3NF9A 2GGRA 1Q82R 4CRIA 2BTOA 1RADB 3EAEA 4LF8K 1JXMA 1JB0E 1QVFP 1T3VA 4H0XB 4JLGA 3OS0A 3KLEA 4B9TA 4O2BB 1RILA 4V19S 1IO6A 3PSFA 2JN0A 1N8RR 1OPLA 2CS7A 4OX9K 1M1KR 1W4SA 1OYXA 5KMGA 3CD6T 4XU2A 3VQBA 1FK9A 3C4SA 3TSUA 1YJNT 4AFQC 2X9HA 3DLEA 1TUBB 1RAFB 2FL7A 3THWB 1B92A 2AIZP 3CCLF 2F7TA 3VQ9A 2HHXA 1YQNA 4C0FA 1VQKF 1OAPA 1X27A 2VC8A 5KYYA 4DV7K 4GY5A 4H5VA 2L8DA 1X6OA 3C6TA 4M7XA 3PX4A 4B9SA 4IJNA 4RG2A 4FL6A 1RT6A 4OVAA 1WHMA 5CKFA 1LOTB 3F2KA 4FWNA 3SQ2A 3SEMA 4N4HA 4DV4K 1CN7A 3MEDA 4PK4A 3CPWM 1KC8O 3CCQF 2E3IA 4CW7B 2CHTA 2XY6A 4IFYA 1OV3A 4C8QE 1QE1A 3O9RA 4FK0A 2DIGA 5HK0A 3U23A 3JCMd 1HQEA 4DTMA 3HO1A 1R8OB 1KQ2A 3TPQA 5GINA 3QLHA 1YHQA 2E65A 1RT3A 2HBJA 3SAFA 3CMAT 1K4US 3ID8A 1RDWX 5KMGB 4FM4B 4MQ3A 1TOVA 2MWPA 3IEQA 2KGTA 4B3OA 5BR9A 2OPRA 5CAIA 4UY8O 1SKUB 3URGA 4GW6A 3G1JA 1JU5C 3VYGA 2LX7A 3JB9D 4M7DE 2ZF8A 1VQ5A 3DI6A 1IPAA 2PBDA 3VEYA 3TVTA 3CBOA 3NFAA 4AH9A 3CQ8A 3CC7N 1Q7YO 4Z94A 3H41A 2NRXA 3TARA 1VQ9F 3THXA 1DJ7B 2RE2A 3FZHA 4JI7K 2OTMA 2V1QA 1G3YA 2CT4A 2F8SA 3M8QA 3AAQA 4X20A 2Q1XA 2E6LA 3G71F 5H1SQ 5I11A 2VXEA 3KBGA 4BG9A 3V9ZA 2FXUA 4ELUA 2JMCA 4KBOA 4CCHA 1GBQA 2UYTA 3MP8A 1HMVA 1D9DA 3EFSA 3MEUA 1JBMA 3UB5A 1W7AA 2FC0A 2P0KA 4WQ5C 4B1UB 4L59A 5GMKl 1NEGA 5GADP 4AQYK 1G8XA 2M16A 1EP4A 1SSFA 4DF8A 3I56N 5D7UA 1NJYA 2A7YA 2YHWA 4C8EA 5BMVB 4BI4A 1F21A 1GLAG 2K57A 4Y1CA 2P4RA 3M8PA 2COYA 3MN6A 1VQPN 1JQQA 3IKMA 4OO1J 4R0KA 2V8JA 1SSHA 1NMNA 3PGGA 3WEEB 4BVPA 1RTDA 2OANA 4DBRA 3THXB 4M77E 3MN5A 1UA1A 1COMA 2VXFA 4F2RA 2VGMA 4M41A 1KD1R 4X20B 4WF9L 1QTMA 1PHTA 3NH0A 4C8IA 1FNKA 3LDOA 2F9ZC 2EGAA 3FZFA 3PMIA 3OS1A 4C92A 3V1OA 2DZCA 3WJPA 4JHDA 3OW2P 4M75G 3S3NA 3S3MA 3M4SA 3V4IA 1YI2Q 4CERA 3TTCA 1W5BA 2OZBA 4CIEA 1U06A 4C82A 1TK5A 2YLBA 1QP2A 3CCJA 4FJJA 2MMPA 5AQYA 3ZX3A 2P4TA 2D0AA 3I0RA 3H1VX 4M45A 5AQGA 2AKLA 4BRNA 1SL0A 2MQEA 2Q1YA 1FFXA 2FRWA 3VQ8A 1BK2A 3E22A 1U45A 4DTPA 2RHJA 2QAZA 1NK7A 5HRRA 2HB5A 5HOOA 3OYEA 1M1KO 4GLMA 1RI9A 2RMOA 3EFOA 4ZGEB 5I3UA 3UIQA 1IO2A 1G83A 1RQ2A 4DSFA 3LWVC 5LJ5d 2D8JA 1PG5B 3HRGA 5EAZA 4JV5K 1QU9A 1M2VB 1XC3A 1ZSGA 4F14A 1K73U 1XJWB 1WAFA 1KLMA 3VJPA 3CBMA 5GAN6 1QHAA 3J8AA 1JRIA 4FM0A 1D09B 2PU9B 1MGQA 5FU7B 1ODEA 3MO8A 3OYMA 1AHJB 4FCYA 3CCSA 1Y64A 2B8AA 2E20A 3IUCA 1L3UA 2A08A 3PX6A 1M8MA 5DLQE 2HSTA 4LD0A 3D45A 2Y90A 3SMSA 4X66K 2EQKA 3T9NA 4C92B 3HXMA 3E1YA 3L3VA 3N4ZA 4A53A 1VSJA 4IEEA 4BRLA 3O4NA 1REVA 2O8FB 4QT7A 3ENOA 2I6RA 4O4HB 4X34A 4X3MA 4FJ5A 1RDAA 4CF1A 2ATCB 3SJJA 1ZWZA 2OTLN 4X1IA 1VQ4N 1U2VA 4KREA 2HL5C 4O6JA 3LH0A 4CE9A 4M78A 3NDKA 2DPPB 2Q1NA 3BP8A 3TAQA 3OSSC 1JEGA 3SK3A 1RAGB 3SAGA 3U3YA 3CC7F 3VIUA 3E22B 3O9QA 3AO2A 2XMFA 1BUPA 4M75F 3A8MB
chains in the Genus database with same CATH topology
1JCFA 2HBPA 2QWRA 4Q5WA 5GAOp 3JCMb 4XU1A 2QA4N 1WJQA 3OYGA 4IOXA 4DQ8A 3K9KA 1XTDA 5CKEA 4EDUA 4A4FA 4Z02A 2E2NA 3MN7A 3PIPA 3U9DA 3NK6A 4JKDA 3CCEA 4MDAA 1U8RA 1U2VB 2IG0A 1VQPF 2X4YA 3QICA 1YJ9T 1QQMA 3QZ9B 1VIFA 1PSEA 4BREA 5TKWA 2ITMA 1YIJT 1NGJA 3K9JA 3L2QA 1C0GA 5LJ3f 2LC4A 4CZFA 4HKEA 2ZGZA 3JCMP 3WVDB 3OW2A 5JICA 2P9NB 4F7UA 4OB1B 4XTYA 4HT8A 5AQPA 3NTHA 4LD9K 3VEVA 2AHJB 2YJEA 4XH4A 3WXKA 3G71T 4J8FA 2RD1A 5FRNA 2P9KA 1QZ6A 2ZPBB 5HY0A 5L8RE 5BPLA 3Q1JA 4FWPA 1QZ5A 3GG4A 3SBGA 5GAOn 1FXXA 2OTLF 5M1PA 1VQ4F 2GWKA 1Q82U 3D00A 4ZGJB 4F7UB 1HKCA 5GMKh 2D4WA 3SWNC 3CC4N 2YI1A 5GAOl 3JCMc 3JCMf 2Q36A 3CD6A 5KCOA 4K25A 1RI0A 1YJNA 1NGIA 1M1KU 4JK9A 4JKAA 2E12A 1NJIH 4EMHA 2P9KB 4XU3A 2DXUA 3E66A 2QA4F 3LGFA 3RIRA 1OKJA 1SS6A 1IJJA 3O4WA 4H0OA 4A2AA 2FSJA 1NMDA 4JS5A 1GLLO 1X7PA 2QDYB 4IXCA 1HK9A 4BVRA 3E9OA 1T6DA 3SIVA 5CR2A 2KG4A 3ASKA 4BR5A 1QQOA 2LQ8A 1EQYA 4M75D 3L2WA 5KPZA 5I9EB 1S3XA 2GFUA 4RCHA 3AARA 3EKUA 1X75C 2I6DA 5CR4A 5GANh 1YJWN 4NUTA 1D3BB 5EOYA 1M90H 4M78E 1W2BM 2I7PA 2RJDA 2H3GX 4JKCA 1JJ2F 3QYGB 5AQMA 4O5FA 2ASMA 2QWLA 5LJ3j 1ZC6A 1QVFS 5GAN8 5M9OA 3LWPC 3P8DA 4YOUA 3HKSA 3VF6A 1MWKA 3EO3A 3VPZA 3FDRA 2KQWA 3DLLA 4YDUC 4H5WA 3O80A 4P5NA 3KHYA 2LT4A 1W2BA 1X3NA 4AM7A 1M4ZA 3IDHA 3OMCA 2JWLA 5B8HA 4RMOA 4IURA 3VGMA 2FGYA 4IKFA 5D6XA 1O75A 1NPRA 4RTFD 2QEXN 2NRZA 3CCVT 2PUKB 1DEJA 3RUXA 3O5BA 2EWNA 2ZPEB 3BEXA 4LDYA 4QS7A 4FO0A 2YRVA 3WUHA 4EAHD 5A2QM 3CC4F 3J80M 5LJ5f 2KHOA 3JB9I 5GAMg 2VYTA 1VQ8T 3ZX0A 3L6QA 1HKGA 2ZGYA 4FIBA 5EY4A 2KLAA 1B34B 2K3XA 1K9MH 2OTJN 2ASOA 2NRRA 4CZGA 1Q86H 1HXDA 3H6EA 3V8LA 4JKHA 4WF2A 1RA4A 2E2OA 3JB9H 3G6EN 2ZZDA 1NGDA 2KY9A 3H3OB 3CJAA 3KWGA 5E26A 3O8VA 1VQMN 2ZGWA 4B9XA 2ALEA 5DY9A 4EI7A 5CQYA 3JB9J 4BRCA 5HL7L 3DJCA 4FSVA 1NZ9A 2MWOA 4CI0C 3ZYYX 1YJWF 5A0DA 1KQSF 3S3OA 4H03B 4TVRA 1TUYA 3CMEN 1Q81H 1YCYA 4DOWA 3RVCA 3MP6A 2P9SA 3WVEB 4OB2B 3SJHA 1VQ4T 3ATVA 2D6FA 1XUPO 3D6RA 5F1XA 2XDBA 1NBWA 1LOJA 1VQ5T 2FF3B 3HAXD 5AQQA 4J5YA 3J81M 2IVWA 2V7YA 2CKKA 2D0PA 3E9FA 1RFQA 2MI6A 4BRGA 3KUFA 2F69A 3MX5A 2FF6A 4CI6A 5M1QA 5HKCA 2QTXA 5C15A 4R56A 3F5TA 5C6SA 3ID6A 4L5GA 4M7AG 2QEXF 2EYQA 3CCQA 1YF5L 2P9SB 1YJ9A 2YX6A 4PKHA 5KCHA 2EQMA 3I55N 2K3YA 4E47A 1YIJA 2PFUA 1WJSA 2EWSA 2VUBA 1VIEA 2P9LB 4O8UA 5CK9A 4B9QA 1VQON 3MWPA 3M9QA 4XCQA 4IOAL 4BC3A 2DXCA 4EHUA 2CGKA 1VQ6N 5KQ8A 3CERA 1G99A 1VQ9A 3CBPA 3HPWA 1KC8C 1P92A 2F9WA 4GY2B 1NE8A 3QDKA 3CCJT 3G71A 4E7KA 2A3ZA 3MMVA 1VQMF 1E7KA 4C8QC 3HRUA 1VQNN 3BDLA 4ME7A 3EFRA 4BE1A 2H3JA 3JAMM 4CBXA 4M7AF 3PIPL 5AQVA 3VTIA 1S22A 3C0BA 4C0DB 3H8ZA 3CMEF 3VU3C 1H7MA 1P8ZA 4BR4A 4BDYA 4QVCA 1NWKA 4M7DC 4PL7A 4IUPA 4H5NA 3JCMQ 5HY1A 1SDSA 1QVGM 2XDPA 3ENHA 5CCAA 4YOTA 2JTMA 3DAWA 4CZEA 4XH1A 2NLXA 3R9PA 3CCRT 3WQTA 4LD6A 4H0YB 1GLJO 3WXLA 1K73H 4MZMA 2K2VA 2DTOA 3GP8A 3S41A 4L6V5 4JRPA 4BVSA 2K5FA 3CJ9A 1D4XA 2KTVA 5GIPA 1VQLF 2XG8D 3BUZB 1QVPA 2RJCA 1BKBA 1KHIA 3OYBA 1K8AC 1ZHIA 5JLFA 3A8YA 1UGPB 1KQ1A 3V7SA 4JS4A 4IUQA 4ZTJA 5A0GA 1VQ7N 4B1ZA 5ADXA 3CCET 3MEVA 4M77C 2GQVA 3R6MA 3NFCA 3E20B 2XD0A 3UKUA 2A5XA 3LFOA 2ZF5O 5CKDA 1BDGA 1I4K1 4J7FA 5KQDA 4KUIA 4C0GA 5JLHA 4KULA 4LDWA 3LYIA 4PJOE 3VOVA 4BRQA 1VQ6F 3EE8A 3H46O 4M75A 5EX5A 3MDQA 3PT9A 3V8KA 5IAYA 1VQNF 2CGLA 5AQXA 2E1ZA 1WPYA 4IO8A 4FWSA 3NVIB 3QB0A 3DB4A 5FRMA 5BN9A 1BI0A 4U67L 1V4SA 4GV3A 2DPNA 3UKUB 3FLCO 3J81E 2OZBA 3CC2N 3CJBA 3A8OB 5EXWA 4B9WA 3CCVA 5C10A 3O08A 3WQUA 5J26A 4PKIA 2K5LA 5FLXE 5LJWA 2Q2RA 4BC5A 1K8KA 1NGAA 2GF7A 2NRTA 4DKWA 4M75B 3OYFA 2GWJA 1VQ8A 5BRHA 2ZJQL 3G4SN 3N5BB 5IT9E 4BI3A 3VENA 4GV6A 3NMUA 4M7AD 3P31A 5C0MA 4CZLA 2EQJA 4CBUA 3CCUT 2P9UA 3R1XA 3UKRB 3JCMe 4BVTA 3DLLL 4BY9C 2EFIA 1Q82H 3L4IA 4O5VA 5GINC 1K8KB 3O9SA 2EQUA 1S72T 2PAVA 1IG8A 2JWKA 1VQ7F 4I6MB 1N8RH 3O6WA 1BIBA 3UWNA 5LL6S 3V3TA 1WQWA 4NB4A 4ZTFA 1M1KH 3QDRB 4GV9A 4QVZA 2F9TA 4CZMA 4WCEL 1BIAA 3META 4J8OA 3RERA 2I7NA 5J39A 4BY6B 4LDUA 4MLHA 5JVGL 3C12A 1MWMA 2OTLA 1VQ4A 2P9UB 4RKUE 3SB2A 4NLBA 1YI2N 4ILGB 3CI5A 4II1A 5FJ4C 2E6NA 5FPEA 3RMQA 4C8QG 5GAMh 3OYHA 3WEEA 1ZXOA 2CH6A 5LJ3g 5C2DA 2RO0A 5DLOA 2LTOA 4X9CA 2XI9A 2R58A 1VQLT 3X28B 5DM7R 3CC2F 3CETA 3RSEB 1QVFM 3M59A 3JCMW 1TYQB 4BRDA 2HNIA 4M7DG 3NVKA 5HY2A 3TU4K 3M5RA 2R5MA 4A57A 2VCPA 1WUAA 1K8AO 4C92C 2PVOB 4BR9A 3M54A 3LWHA 3TSPA 4LDXA 1HX1A 3G4SF 2DAQA 1QP3A 3OYYA 2LBWA 1QVFA 5BPNA 3CCLN 3LDLA 4Y0WA 3QZ5B 2EJFA 4WFAL 3OYAA 2ZPFB 5LJ5e 1NPPA 1M9SA 4C8QF 3G25A 3LDNA 4ELZC 3L0QA 2V51B 3CCMN 2QQ9A 3OYDA 5FU6B 4C1NI 4KBMB 2ZPGB 5GAN2 4M77G 1HLUA 1KD1H 1GLFO 1IREB 5TKYA 3T69A 1W41A 4M7DF 2PUOB 2RB6A 2DD4A 4CD3A 1NGHA 4M78C 1BI1A 4V2SA 4MO4A 4OP0A 2RI2A 5GANf 2HBLA 4FWLA 5HK3A 3LL3A 1Z05A 2IVOA 1Y7XA 3CCRA 3AGKA 4MLEA 3BF3A 4UC4A 1NGEA 3LWQC 5I2MA 1NLVA 3GDQA 4OGCA 4NOYA 2WFBA 2E64A 4R79A 1KC8U 2RJFA 3FFMA 4TZZA 3E9LA 2KMTA 1YHQN 2QI2A 3RMSA 4G9ZA 2JTFA 2ZJRL 3AGRA 3CIPA 1O9SA 4KH4A 1RDUA 2RHYA 4WYBA 4M77F 3UT1A 3RKYA 1VQKT 2W40A 2P9NA 4IWVA 3MX2A 4FWOA 5CO7A 4WQ4A 3I56F 2E41A 3D7EO 3JXUA 3CCQT 3OW2M 2BUPA 5LY3A 2D0OA 2HOEA 3CXCF 3FGUA 1Q7YU 2R57A 2JOYA 2HAXA 5HY4A 4B1YB 1GLBG 3OYLA 4QQ6A 2E2PA 1OZ3A 4N0AA 2RHUA 3OS2A 2XKOC 3CCMF 1NJIC 2KK4A 2VWBA 2MF2A 2DVEA 3I8BA 1CK2A 1VQ9T 3VEOA 1NGCA 5GAPK 3PNWC 4FPBA 4JDSA 3VYHB 1ATSA 1K8AU 3PFSA 4KT0E 5HWEA 3BW1A 3IFRA 2E6ZA 4JRQA 2QWNA 1H1VA 3M57A 4C8QD 3HL8A 1BWFO 1YITN 5GANj 3OA6A 3QMLA 5F0XA 4JLIA 2Q97A 4MO5A 4A5BA 3GBTA 2L3RA 3V7RA 1BU6O 1M90C 3HFNA 2DTIA 2NLUA 4BVOA 4C92E 5AFUA 3FEOA 5CQXA 4M7DD 3FLGA 3CCUA 1WQ7A 5CIUA 1D3BA 1YHQF 2E2QA 4A5AA 4IUVA 4BRMA 3CCSN 3ZX2A 5D6WA 4BI8B 1O13A 4M63C 3QJ6A 3X24B 2ASPA 1M5Q1 1N9SA 1U1SA 1S72A 4IFEA 4JNEA 4A4EA 1KAXA 1Y07A 5BPMA 3CPWF 5A0LA 2IVNA 3ULEA 4JAXA 3CPWS 3E9PA 4FT2A 5GAHP 1HUXA 4M7AA 3LWRC 5AFUH 3U4LA 4PKGA 1PXWA 3QBWA 3JCMM 2RHZA 4C4WC 4EIAA 5GAMd 4JUVA 4LC9B 3AHUA 4ZN3A 3MN9A 2HBKA 3HHTB 2XHCA 1DT9A 3HOSA 4M77D 2EJGA 1HKBA 2C06A 1JJ2S 1MDUB 1K9MC 1Q86C 4Y28E 4KH6A 3OYIA 1RGIA 3CC7T 2DKGA 3INZA 3V7CA 3TEEA 3ULEB 5DCVA 4M7AB 1VQLA 2KVQG 3IMXA 1B34A 4XK8E 3G7ZA 3ON1A 3E9GA 3SWNB 4M78G 4C5HA 5KPRA 4H0PA 2M0OA 1N27A 2PVDB 5AZJA 5CHIA 3SD4A 3VF4A 1YITF 2NRVA 1VUBA 3I56T 2BKDN 4RCBA 4ZN1A 1VQPT 4BW0B 4OB3B 1Q81C 3IR9A 3VEZA 2HBMA 3EKSA 2O4XA 2YHYA 5GIOA 4YDUA 3FJPA 3VV0A 4JKBA 4F7UE 3CCSF 3JCMJ 4BE2A 3FR0A 3SLCA 1GLEG 2LRQA 1X52A 3A8LB 5MLCQ 3LWIA 4NLCA 3VKIA 5FPDA 5AZJB 5DM7L 2CZ1B 4BB7A 1VQNA 4QQDA 2LQKA 4RCCA 1U6ZA 4M78F 5LJVA 4CZJA 2LCCA 2FHDA 4B1VA 1YBYA 1NJIO 4BY9D 4OPAA 3CD6N 3M1FA 1YJNN 2V7ZA 2VV5A 1U1TA 2QXLA 2QWPA 4CZIA 2O4XB 3QBXA 4QVDA 1XNIA 5AQWA 4ELYC 2E1HA 4PJOC 5FPNA 4JJNK 1QQNA 4A61A 1KQSS 3CJ1A 1M8VA 2F5TX 4A54A 2OTLT 5GMKm 1DKGD 1ZQ1A 4YOVA 3NK7A 1I5LA 1RL2A 4E7IA 2NRWA 1CZAN 4QS9A 2V8IA 2P9LA 3CMAN 3JCMX 1M90O 2A40A 3QIIA 4E1JA 1LJOA 4EI9A 2QA4T 3ZEUA 1VQKA 4AM6A 4BR7A 2XDDA 2JZ2A 2FYKA 3MCAB 3PLAA 4GNIA 3FZLA 4J7IA 3PIOA 3M56A 4C0DC 3OYNA 4K42A 3VTHA 4JEPA 4D6WA 3QO3A 2LVMA 4L3QA 1EO1A 5LJ5j 3ZFJA 3BDUA 2OTJF 3V8JA 3CJCA 3ZEUB 2RHXA 5GMKe 4ISFA 5AQZA 3JCMV 3G6EF 1K73C 3MWTA 1OZ2A 2YHXA 5C12A 5AQJA 4K43A 3RKXA 1E4FT 4JRIA 3I33A 3VESA 1W3EX 3J7AF 1JCGA 2YHTA 4J6YA 2HD0A 4JK7A 1V29B 5JMVA 5KE2A 4ATOA 4CZKA 1K9MO 3GIBA 1Q86O 4EMKC 3U9ZA 3QG1A 3TSQA 3CD6F 4J6WA 4BQLA 2A42A 1YJNF 2QWOA 3A8HB 4C23A 4C1NK 2NRHA 3KWIA 3W3DA 4GLKA 4BD3A 1ZBSA 2CZ7B 2PQWA 1KAYA 2XU8A 5GAN4 4EHTA 1NGGA 4ISEA 3D2EB 3WXIA 3G4SA 4HCZA 4M78D 3FFKB 3NVMA 5GIPC 2QQAA 5GANe 3CC4T 5GAMf 3CMAF 3MCPA 3FRNA 1Q81O 4C8QA 3TTDA 5A2QE 3J80E 2HF3A 3HOTA 2JVVA 3GYQA 3PMTA 4HCBA 4CBWA 5ELZA 1YAGA 4XU0A 1IZ6A 3LDPA 3QFUA 3W0LA 4QQGA 3CEYA 4FVUA 4VUBA 5AQOA 4QW2A 4M7DA 3TREA 5KPTA 5AQRA 5AQLA 3I55F 1KC8H 4BRFA 1TH7A 3C95A 4H0VB 4CJ7A 3M58A 5EO3A 4OGEA 3CQXA 1T0KB 1W2BF 2E5QA 3B8AX 4IOCL 4PL8A 4M75C 1N6AA 1YJWT 4C8QB 5AR0A 1C0FA 1VQOF 1M90U 3BFMA 3A5MC 3F9MA 1E4GT 3DB3A 5M1KA 3PAFA 1KHCA 5F2RA 1UEBA 4B1XB 3CC7A 3M3ZA 5AQHA 1YJ9N 4PNOA 3JRZA 2AA4A 4EI8A 2O01E 4M7DB 1Q7YH 1YIJN 2V8KA 1X9JA 1X3MA 5KE3A 3C6HA 2RI3A 1Q82C 1BA0A 2J4RA 5GAOm 3M4YA 4FU6A 4A59A 4M77A 5GANK 3CQYA 3UKRA 4BRKA 4BQZA 3ZBDA 4PJOG 1N8RC 4MDWA 2DXTA 3I56A 3Q7CA 2QEXT 2NNWA 3E19A 3WT0A 1VQPA 3WXJA 2DO3A 1GO1A 1T6CA 1LNXA 3QSUA 4I6MA 1YUWA 3G71N 4JRKA 3EL2A 4DA4A 3CPQA 2IVPA 5GANg 2CZ6B 1K9MU 3C7NA 1Q86U 4DCHA 2OTJT 2LNVA 5LJ3d 3L2ZA 4M77B 3CCMA 3G6ET 3X20B 4MMKA 2QQRA 4N4GA 4BDZA 3OSVA 1XQSC 3SIUA 3V7EA 4OMFB 1K73O 3D2FA 1Y96A 4R55A 3LX7A 1VQMT 2E10A 4PJOF 2K5IA 1GLCG 2X4WA 3L2RA 4BE0A 2RHIA 1GZ0A 3C7NB 3N4QA 3ER0A 3JAME 1Q81U 3RSEA 1TYQA 3CMET 3UE5A 1FX7A 4Y91A 3UPUA 2I2LA 1HPMA 3OBYA 3SFMA 5CE3A 3P38A 2L89A 2OAUA 2XIDA 4X9DA 2GTDA 1YJ9F 3KK7A 2E70A 4MZPA 2D0QB 2ZCFB 3KZBA 3QJYA 3D2FB 3KVGA 1Y96B 5C0YA 2LT1A 5BN8A 3R8EA 1YIJF 2QA4A 3GNGA 3R6OA 2P9PA 1NGBA 4NQ3A 5FU6C 3CJ7A