2VGNA

Structure of yeast dom34 : a protein related to translation termination factor erf1 and involved in no-go decay.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
382
structure length
360
Chain Sequence
MKVISLKKDSFNKGGAVITLLPEDKEDLFTVYQIVDKDDELIFKKKFDLVKLKIKVISEDFDMKDEYLKYKGVTVTDESGASNVDIPVGKYLSFTLDYVYPFTIIKQNFNKFMQKLLNEACNIEYKSDTAAVVLQEGIAHVCLVTSSSTILKQKIEYDVLKFDEKTEKFYKAIYSAMKKDLNFDKLKTIILCSPGFYAKILMDKIFQYAEEEHNKKILDNKGMFFIAHCSTGYLQGINEVLKNPLYASKLQDTKYSKEIMVMDEFLLHLNKDDDKAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLTGIACILKYPLPDLDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Yeast Dom34: A Protein Related to Translation Termination Factor Erf1 and Involved in No-Go Decay.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
molecule keywords DOM34
total genus 90
structure length 360
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03463 eRF1_1 eRF1 domain 1
A PF03464 eRF1_2 eRF1 domain 2
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.870 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vgnA01
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2vgnA02
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2vgnA03
2WALA 1S72F 3PLAC 1VQ8F 2LBWA 3SIUA 5GANK 1VQMF 5EO3A 3CCVF 4LCKA 5GIPC 1KC8H 2CZWA 1VQ6F 1YI2F 3N4ZA 3V7QA 1YJWF 1NMUB 1W2BF 2I6DA 2ALEA 4X3MA 1GZ0A 1VQNF 1W41A 3NVKE 4NUTA 3CXCF 2KTUA 3CPWF 1VQPF 3CCQF 1KD1H 2QEXF 1VQ4F 2AIFA 3NK7A 3VI6A 2HVYD 3CC2F 1DT9A 2KG4A 3CC7F 2LBXA 3LWPC 1W3EX 1X7PA 3CCEF 1CN7A 3JAMM 3OBWA 3AGKA 3RA5A 3I55F 1Q82H 1SDSA 1YHQF 2VGMA 3E20B 3CD6F 2OHWA 3G6EF 1M90H 3NVIB 2QI2A 1Q81H 1T0KB 1QVGF 1K9MH 1IPAA 3CCRF 1K8AH 3O85A 3V7EA 1W40A 2OTLF 3ON1A 5FJ4C 2OZBA 5GINC 3LWOC 3J80M 3CCSF 1KQSF 1ZWZA 1N8RH 4AF1A 3LWQC 3CMAF 1VQ5F 1X52A 3CC4F 1YJ9F 1QVFF 1H7MA 5G4VC 2QA4F 5EWRA 3OBYA 3E1YA 3GYQA 1GO0A 1Q7YH 4C4WC 1VQLF 1PXWA 3CMEF 1YIJF 3JCMM 5DCVA 4X3LA 5GIOC 1VQ9F 3HAXD 1W42A 5A2QM 3PAFA 3WXMB 1NJIH 1VQ7F 3CCUF 4BW0B 5G4UC 3LWVC 1RA4A 3LFOA 4TZZA 2OTJF 3CCLF 3CPQA 1CK2A 3LWRC 3RA6A 2KTVA 5GAPK 4BY9D 3SIVA 2BO1A 1YITF 3J7AR 3CCMF 1K73H 2JNBA 1VQOF 3I56F 3NMUC 3OW2F 3IR9A 3N4YA 5FLXM 1YJNF 3G71F 1GO1A 1RLGA 3FFMA 3J81M 2VGNA 3VMFB 3G4SF 2HSTA 3CG6A 1M1KH 3NK6A 1E7KA 1VQKF 2FC3A 1JJ2F 3HJWC 1XBIA 3CCJF 1X7OA 1Q86H 3MCAB 5IT9M
chains in the Genus database with same CATH superfamily
4C92A 3D2EA 5D7UA 2DKGA 3HTVA 4H0XB 2EIFA 3HSCA 4BVQA 4DR6K 2V9YA 4B1XB 1ZSZC 3DB4A 5CKEA 2O4XB 3VQQA 2YRCA 4CC2A 1HPZA 3R6MA 4KHWA 5GAN7 3F9KA 3ULRB 4IFYA 4RG8A 3M4SA 4N4IA 1CZAN 4IOXA 1U1SA 3UKUA 3MO8A 4CZMA 5CQXA 3OYAA 2I7PA 5HBMA 1S1TA 2L26A 2OTLT 4FLZA 4PA1A 1W41A 4OGCA 4DU4A 3HWUA 4N0AC 2ASOA 2Y1IA 2KNBB 2KTUA 2FRYA 1L3UA 2F9ZC 3OS1A 2W0ZA 4MDXA 2PUKB 3CMAQ 1W9HA 5AQSA 1SL0A 3QEPA 3M54A 4BC3A 1JXMA 3OYKA 1XNRK 3RESA 3KFVA 2HCKA 3CCQT 3BF1A 2LZ6B 2Y1JA 4LF5K 3LALA 1MNDA 1BG3A 4DQ8A 1DT9A 2E1YA 4PJNA 3VKIA 2RNAA 4W5RA 1VQNN 2Z1FA 2HQSC 2KDSA 1O9SA 2JZ2A 4C8QF 3KD5E 4M77A 3UF4A 1QQMA 3KKRA 4DLEA 1DLOA 2F96A 2A41A 1W5AA 3R8EA 1B9FA 3MEDA 5CVIA 1NWKA 2RHOA 4O6JA 1M3BA 3V7SA 5AQQA 2YLCA 1K73U 3CCJA 3CPWM 1D4XA 3R3LA 4H0PA 2E20A 3CMAN 2E10A 4M7DB 1RT4A 3X28B 4AFZC 3BUZB 3ZT4A 2XY5A 2RHJA 1V4SA 4K25A 1ZBJA 4KGXB 3S6WA 1KQ2A 4ZI7A 1RI9A 3QXEB 2K9GA 4J5YA 1YJWT 1Q86U 3CETA 4IEIA 4II1A 3GNGA 3WVEB 2K1SA 1CSKA 1NBWA 5KQ8A 3JAKA 2NUPA 3WPWA 1KQSF 4WCIA 5HXUA 1WYXA 3CD6A 1RDCA 3RR8A 1ZWZA 3AHUA 2CH6A 4OB2B 1R8OB 3MWPA 1WSIA 5CR4A 1EP4A 4CVNE 5BRDA 2CHTA 3EGXB 3K5LA 1M3CA 3RIRA 5HOOA 1REVA 5HY0A 5HY6A 1NK7A 1R0AA 2JN0A 3FDRA 4FT4A 3J81M 2E8AA 4M7AC 1KHCA 3R9PA 3G10A 3P0ZA 3CXCP 5AR0A 3WGLA 4C4WC 3MMVA 2DYBA 5EX5A 4LC9B 4DTMA 2C0TA 1HX1A 2EYWA 2IVOA 5GONB 2D0NA 3LX7A 4FK0A 5GONA 4KHUA 1QS4A 4ANJA 3WQUA 3DB3A 4L8RB 5GAMj 4TV8B 2RF2A 4FK4A 4ESRA 3D2FB 3GNFB 1TYQA 4EMKB 4BVTA 2G9IA 2Y90A 2HQXA 2PZSA 3JB9H 4FFBB 5GAOp 1BIUA 1RAGB 3MHXA 1VQ9N 3OQ5A 1MA9B 1W0HA 1HNWK 1JJ2A 2VQEK 3HPHA 2DXBA 1S3XA 2Q0RA 1JB0E 2GF7A 2YRVA 4RW7A 1U45A 3N2GB 4JLGA 3NGYA 1YWPA 2VAWA 4C92C 3C9TA 5LOVB 3NMUC 3VETA 4DEYA 4NCAA 4WF9L 2JS0A 1S72A 1Q9YA 1LVKA 5LJ5j 2M16A 2OYQA 3TREA 4HCKA 3NK6A 1E7KA 1X01A 1K9MR 2OTJT 1S6PA 2FF3B 3MXJA 3CQXA 2QA4A 2Q97A 3UT1A 3THYB 3NBPA 1NM1A 3HTRA 4J9FA 1JLEA 2HBPA 3K9JA 5HRPA 3PX0A 2WALA 2HMPA 5C2DA 1VQKQ 2HP0B 1D5AA 4WQ5A 3VYGA 3NDKA 2H3JA 3QBYA 2O8EA 5SWMA 4MLEA 3NE6A 1W57A 5KTQA 4CBWA 4IIJA 3MX5A 2OPPA 3N2KA 1ABOA 2JOYA 1FX7A 5AQVA 5ELZA 2ZZDA 4NS5A 5GAHP 4FJ8A 2NMUA 4A61A 5BR8K 4XU0A 3O8MA 2RHZA 4K8XA 1YI2Q 3BP8A 5DM7R 3S02A 4KHSA 4OPAA 2EKHA 1I0CA 4C8QE 3E9OA 2QGGA 3RSEB 2O8CA 3K2XA 2QEXF 1WAFA 3TU5A 3W0LA 3HL8A 1Q81C 1X27A 1K76A 3P8HA 4VUBA 1WA7A 1M1KC 1Q81O 1Z5WA 4E7HA 1N5ZA 2EX3A 4Y28E 3AGRA 4GNIA 3EL2A 1VQ7T 1XJWB 4HCBA 2W41A 2KT1A 2CSLA 4DSIA 1XC3A 3ASMA 3OONA 1VH8A 4OLAA 3TSZA 2GWJA 3CCRT 2HVIA 3NMUA 5DY9A 2GELA 3KHYA 3I3FA 3SAHA 4I4TB 1K9AA 2OHWA 3CBMA 1EO1A 1Q82C 5FPEA 4IOAL 1JN1A 1IJJA 2HHHK 2O8FA 3LH0A 4CD1A 3SPYA 4KI6A 5EZYB 1Q81H 5J2TA 5J1EA 2BTOA 3K5NA 3JAWA 1M90U 4H5VA 3MCQA 5GINC 3AAPA 4N4HA 1S1NA 3VERA 3HKBB 3FFIA 4PHTX 2CSQA 2PHNA 1PC0A 5JVHL 4FYVB 3M5RA 1GLJO 4FWPA 5LMNK 4PJOC 5CA0A 5MN5A 2E1HA 1TUGB 3C9SA 2DFEA 4FVUA 3PLAA 1NJIO 3EY1A 1RAIB 2HL5C 3H08A 3CCVA 2DMOA 4XTXA 3MP6A 1QZ6A 4A5BA 2G8WA 3LP0A 2HZYA 4H0VB 1TKTA 3EG2A 1FNKA 4BY6C 1H1VA 4BI8B 2FBTA 3GBQA 4RTVA 1M90R 3TU4K 4JRIA 3A8YA 3TAEA 3JCMM 4JJBA 4BQZA 3OJUA 1ODEA 3AVFA 2L0AA 1WQWA 4U3JA 3C7NB 1NJIH 4LDXA 1NOYA 3I7TA 1IREB 2OI3A 4DA4A 1Z05A 3D6RA 3O3GA 1YCYA 2P9IA 3CCLQ 4ZNXA 3MDOA 1NGHA 3GE1A 4JS5A 1AWJA 3HM9A 1HPMA 4RG2A 3Q7BA 1J7HA 4ZGDB 5KH6A 1HNXK 4BRLA 2ZPBB 5KMGA 1CLQA 4O0IA 3JYTA 4BT6A 1NYGA 4M3WA 1NEGA 1YITF 5GANd 1KQSS 1VQPT 3PMIA 5GAN5 1U8RA 1NU0A 3DLHA 4KB1A 1AOJA 1FWZA 3ALYA 1KC8C 3CC4N 4OVLA 2EWCA 3IR9A 3UT5B 4JZ4A 4CJLA 1UG1A 5KE2A 4DQRA 3RYCB 2VYPA 1M2OA 1WUAA 1IB8A 3I33A 4RTFD 1I1JA 2K2MA 1N6AA 3HFOA 4ICLA 1NK5A 1JD1A 4KUIA 1YHQQ 4FL9A 5HXZA 1U47A 3IEWA 1JJ2F 3BFMA 2EGAA 1Z6RA 3I5SA 4DWIA 3J8AA 3WNGA 3Q1JA 2E2NA 2B8AA 1WX6A 1T6CA 3AA3A 1Q86H 3ZOPA 3ITHA 3ZO8A 1NYFA 1VQ8F 2R751 3CCJN 4KGZB 2CUBA 1GBRA 2W6KA 2CGHA 1XQSC 3C6TA 1WLJA 1G3WA 4M41A 4J83A 3WEEB 2KZZA 3IFRA 3CC2Q 3F0EA 5MN4A 3L2UA 1XUPO 4A57A 4DSEA 5HKCA 2DA9A 4HWIA 4DTOA 3CCEQ 4C8QD 4OB0B 3CC2T 1GLBG 1YQNA 4RTZA 3C6UA 3IAYA 3AVHA 2X51A 3I35A 2YV0X 3BZCA 3S9HA 3VYTC 2HNYA 3T1YK 3EFOB 3CJ7A 4J9DA 4C92D 3L4IA 4MQ3A 4EB6B 1NGCA 3DWLA 5AT1B 1VQ9A 4QQ6A 1UJYA 1HYOA 3CXCF 5CKBA 1PG5B 2SRCA 1NGJA 3LYBA 4BB7A 3CCQF 2DE0X 5AJ3K 3VYSC 2O88A 2GV9A 3ZEUA 2RHHA 3MQWA 7AT1B 1ESVA 1UEBA 3LP3A 1SA0B 3CCMQ 4X1KB 2IC3A 5JQGB 2KEAA 3GHZA 4F7UA 3O9UA 2EBPA 1FW6A 2YWWA 2CGLA 1OH8A 4FZZA 2LC4A 2W8BC 2EYZA 4XTUA 4J6YA 3O9TA 3QMLA 2P9IB 3I55F 4KHPK 3OW2A 1VQKT 4CGDA 1UGQB 2IVWA 1WB9A 1KQSM 3UATA 4DSLA 4F7UB 2YX6A 1TL1A 3H45C 4AQYK 3M1XA 4L6V5 3ISNC 2E2OA 2VWJA 1VSEA 1W40A 5CA1A 2DFHA 4CZEA 3H8ZA 3LH5A 4CBUA 4CZKA 4X20A 4TV9A 5C6SA 3WNEA 4DTUA 1G3YA 4FWRA 2HHQA 2AMTA 3WGJA 4H8KA 5IJ9A 1S72Q 1XHZA 2DXUA 3MDQA 4CGIA 5LL6Z 3LLRA 3I56A 2Z1TA 4EB6A 1U3OA 3I55Q 4V19S 4KHQA 1CLIA 1UFYA 1J6ZA 3GBTA 3L0QA 3QNOA 5JH7A 3O5BA 3CCSQ 2H8CA 1YWOA 2OX7A 3V7RA 4DOVA 4M7DG 4DV5K 1YVUA 2YHBA 5CZ1A 4RKUE 1GO0A 3CCVQ 3UPUA 1R1MA 2XU8A 2MI6A 3CCEN 3GDQA 4LUEA 3NTHA 2RK1A 4PJOA 3VQ8A 1HKCA 2GTJA 3PAFA 3FLCO 3CC7Q 2FVUA 2W6LA 2OZMA 2CHSA 2VYTA 3QUWA 4CIFA 3EE8A 5LL6S 1Q8IA 1RUWA 4OJRA 3M0PA 1VQ4N 1J9AA 5EU7A 1N8RR 4WF2A 4GV6A 1N5YA 1RA4A 4LNUA 4JKBA 2L3SA 2AKLA 1M8MA 1T44A 4MDBA 4CHZA 2A37A 1D9FA 2QQRA 1ZUUA 4A62A 2HSEB 2ROLA 5M1FA 1IZ6A 3KWIA 1OX8A 5I42A 2ATQA 2YDLA 3JCMV 3RBBB 2V1QA 4N5SA 1VQON 3DLKA 2LCLA 4BT3A 2OTLQ 1TV6A 1VSHA 3F6MA 3G71A 4OMFB 3EFSA 3SWNA 4C8QG 4KH6A 3DLLL 1KD1C 4D8DA 3HBTA 1MGQA 2RJDA 1H92A 4KV8A 3VEWA 4CGHA 2EAYA 4KHNA 5C12A 4GBQA 4KTWA 2DEQA 4CFBA 5C15A 1K1ZA 3PV8A 1ASVA 1JCEA 2JLEA 4CFAA 4PWDA 4PLLA 1JXEA 1UGPB 1M1KR 4DMNA 1WN7A 4QVCA 4N47A 4CHPA 3GLXA 3VU3C 2Q1XA 3CCLN 1HXDA 1VQMF 1VQ6N 3VTIA 2LP5A 2DETA 2BKDN 4BRPA 4M7AB 3OB9A 1X3MA 4B1WB 2K3BA 3O1BA 3CCRN 2DTIA 2QQAA 4M7AD 1YN8A 5FU6B 2KVQG 4BRCA 3SUOA 4QW2A 3JCMQ 1MUZA 5KYNA 1YTAA 1PRLC 3G25A 3ZL7C 4BVPA 4ELUA 2ALEA 5C8YA 1M1KO 4BVRA 3O4WA 3FZFA 5HLFA 1HQUA 5AQIA 4DR4K 1NJZA 1TL3A 3AO3A 3AY9A 2R6R1 3SAFA 3VOAA 3H0IA 4A63B 2IVNA 1ARKA 2H3GX 2AKKA 2K57A 3EG0A 3EO3A 4XU1A 3OYGA 3G0ZA 3X26B 5J2NA 3FFMA 3H6EA 1PM3A 4FJMA 1VQ5T 4B46A 5JVDA 1NG2A 4JJCA 4JHDA 4I9QA 3AVBA 1IHVA 3JCMc 2CP3A 1HNIA 4FSXA 5J2TB 3BW1A 4FWNA 5AZIB 1VQ7A 3TTCA 4JRPA 1NBEB 4IDKA 3HKDA 5HY4A 1X2KA 2K5IA 3M5AA 2B4JA 1FFXA 3A98A 3EG3A 1UOCA 3CD6F 5FU7B 1NE8A 1JJ2S 1R59O 4B08A 2G8VA 1YAGA 4FLWA 3AA4A 4DOWA 3CJCA 3QJ6A 4ZGEB 3CCEA 3O5ZA 2QTDA 4QQGA 5IYZB 2L3PA 4PJOE 5LOVA 3V9WA 1YF5L 3HKCA 2ZPIB 4LUDA 2OTJN 1UI9A 1RT7A 3WPXA 4O5VA 1EWRA 2O8CB 4JAXA 2F1LA 4ZHVA 4QKUA 1BL3A 4JI3K 3CJBA 4CFDA 2MOXA 3EFOA 2FG0A 3H1VX 3E9GA 4XU3A 5IXBA 4BY6B 1VRTA 4FFBA 1D3BB 4JI2K 4CJRA 1TK0A 1Q82O 3CCVT 1QVFP 5L23A 1I5LA 3HSTB 1TK8A 1YI2N 4G88A 5JS1A 3NF6A 4CJ3A 5DM6L 2DL5A 4BRIA 1ZUKA 1M3AA 3BF3A 5BPNA 3QICA 4M7YA 2P9LA 2F2VA 2XHCA 1BWFO 3QEVA 5DCVA 2EYYA 3MEWA 1NJIR 2C06A 1NJXA 4LNPA 3HKSA 1C0GA 1T03A 4DBRA 2Y4XA 3THWA 3LPTA 3MXMA 3MBMA 1H48A 3W3DA 2G6FX 4IJNA 3NH1A 2HBLA 3BZKA 2UU9K 3MWTA 3CCUF 3MP1A 5CZ2A 3LWVC 1JXOA 2K4YA 3PFSA 4OGEA 3HI0A 5KPZA 4FM0A 3HJFA 3LFOA 2ZPHB 3FLGA 1YI2A 1VYTA 1YHQA 3KBGA 3E66A 4JI6K 2P5OA 2QGFB 2J4RA 4ELVA 3EGXA 3JCMJ 3VQ9A 4G4ZA 4C82A 2M0OA 4DQPA 5AZJB 3LWLA 4M3ZA 1TH7A 2YCHA 5LMUK 2WC9A 1KQSA 1X9MA 3CPFA 4CGFA 3FJ5A 3U9ZA 4HUFA 1X6GA 3CPWA 1Q7YO 5C0MA 3UIQA 1LW2A 1GCPA 5BPMA 3N4YA 4ZN3A 4IHJA 4L59A 5LJ3f 1I94K 2QYZA 2CUDA 1HD3A 2L2PA 3CCQQ 2A28A 3M58A 4A4HA 4KTZA 3PGGA 3G4SF 2ZPEB 2J05A 2ZPFB 5HK0A 1KVAA 3RERA 3VF4A 2JVVA 5LA6B 4QVDA 3P1GA 4CEEA 1NLOC 4J9IA 1J54A 4EP4A 3TAMA 1NKEA 5JLFA 1RAAB 3V4DA 4M78E 4Y1CA 5IT9M 1ZSGA 2LBWA 4FYDA 1JBMA 2Q0UA 4LCKA 1HQEA 4RTTA 4I9LA 1K0XA 4NXNK 4IFVA 2I0NA 3L2QA 1T6DA 2A7YA 1WFWA 2Z0WA 3QDFA 3RR6A 2A3ZA 1NKCA 1KXPA 4HCCA 4JK8A 3KIZA 1VQ8Q 4DS5A 2ROTA 3I55A 4JLIA 2D9TA 1D3BA 2HQHA 2V52B 1IBKK 1BKBA 5LP6B 4DSJA 1O13A 3M6GA 4NO7A 4NLBA 3TABA 1CZ9A 3VENA 3VQCA 3NVKE 4WQ5C 1U3PA 2E64A 1KLNA 4BR9A 3EKSA 3HAXD 1VSKA 2HX0A 2DO3A 2FHDA 1EKEA 4CW7B 3CFRA 4XH5A 3HKCB 2HVYD 2D1XA 4M3YA 4EI7A 1SG5A 1VSFA 1JJ2M 4B9MA 4GV9A 4ZTJA 3FZKA 3WUHA 4FJNA 2KG4A 2LBXA 4RHAA 2QQ9A 4XK8E 1GOCA 4C0DC 3SUNA 2JXBA 2VV5A 3CPWS 5LJ3h 3OJSA 2LBTA 2X9HA 5A0LA 4K41A 1CN7A 1L3TA 4IEEA 1M1FA 1QMCA 2P0QA 2MQEA 2K5LA 4PL7A 1OH7A 4CCHA 3KHNA 4LSNA 3TSPA 4BUGA 4JKGB 4OMNA 3D7EO 3FRNA 4F3TA 2E6NA 2NRZA 4EIKA 1YIJT 2CVLA 2COWA 3P39A 4JKHA 4Q0BA 3ZT3A 2DBKA 4M7AF 2FC3A 4DTRA 1AVZC 4EI8A 1VQNQ 4R0KA 4JI5K 2R57A 3CXCS 4FLXA 2F2XA 2ZCFB 3CC7A 2RI2A 3R1XA 1NK9A 2MYSA 5GANj 2MPXC 1NGFA 3BDPA 5CQYA 4M77G 2FBVA 3WJPA 4CEQA 2COYA 1RQ7A 2L5QA 3VTHA 1IKYA 1QVFF 2XI9A 1C0FA 2XY8A 4JYAK 1BI2A 2KYMA 4IO8A 4FXDA 9ATCB 3SYZA 3GG4A 5LJ5f 2VXFA 4NCGA 1QKXA 3JVHA 2P9PA 2COZA 3JB9I 1C6VA 3O08A 2F9TA 1IV0A 4YJ3B 2BE9B 1VQLF 3J80O 4JKFA 3P83D 5J2MA 2X4XA 3JALB 4JLHA 2JJ9A 3G6EN 1AZGB 3KLHA 3RMCA 5JS2A 3CMEA 3RMBA 2QDLA 1G8XA 3A5LC 3LGLA 1NKBA 2FL7A 2KT8A 2P4RA 3VRZA 1WLPB 4DR5K 2BUDA 5GAOn 3G4SA 1BISA 4ILHA 4C8QB 3DRPA 4BR0A 2CZ6B 1I81A 2O01E 5T7BA 1W2BM 3TSWA 4AM7A 1ZA1B 4M77F 4OMQA 3K5MA 2UXCK 3M8QA 3CYQA 4G4VA 2OTJF 1JEGA 3CF5L 2D0QB 4KUDK 2XHBA 1XHXA 3KTQA 3RA6A 3MEVA 3ZSYA 2HEQA 4DLGA 4F8RA 3F70A 1XQHA 2DD4A 2ED1A 2E12A 5D6YA 3GIBA 4YTLA 1JL2A 4KAZA 1W581 3N2GA 1W1FA 4CEAA 4PLIA 1IKVA 5M1KA 4O4IB 1KJWA 3I56Q 1TG0A 3QUIA 3G71T 3D7SB 3VS5A 3AVJA 1F21A 3VQDA 2FRWA 2EQKA 4A53A 4H5NA 1YGYA 1T7PA 1ZBXA 3G7ZA 4HT9A 2RK2A 1KLMA 3QINA 4PKGA 5KPTA 4M3TA 3VMFB 1VHAA 1TVKB 3CCMT 4AHVA 2QEXA 1S9EA 3QESA 2XDPA 1Q95G 4M75F 2X4YA 4JUVA 3OS0A 3L2ZA 4X9CA 3NGIA 2E70A 4RW4A 4DU3A 4H0TB 4I50B 3ZSVA 5J2UB 1HKGA 2M51A 4TV8A 2EHGA 5EG2A 2RHLA 4E6EA 2ZGWA 3WXLA 1YJWQ 4BE2A 1GFDA 5BMVA 3O4QA 5GAMh 4B8AB 4CFCA 2DPNA 3DKMA 1VQ8T 5AYFA 5M1OA 1ZBFA 4B3MK 5FNVA 3SHWA 3SQ4A 3V7QA 3NTIA 1PWTA 1VQLQ 4A59A 1K8KB 2AA4A 1KIKA 4AHCA 4FLUA 4KREA 2HS0A 3O9QA 4B1YB 3NHGA 1K73R 2QM1A 1VQ5N 1JFFB 5IWAK 4YORA 3NCIA 3KKSA 2KK4A 4OPKA 5IXFA 5CB4A 3DJCA 2GBZA 4FZYA 3WNHA 5GMKi 3VQBA 5BRHA 2UUBK 3AVIA 2EPDA 5GMKh 1KG1A 4OB1B 2IS3A 2IPOB 2OZSA 3DLRA 2DT4A 2HS3A 3LWPC 3ZSOA 2WBNA 1NK4A 3ESJA 1VSMA 1VQ4T 2E2PA 3FJPA 3D45A 4LF9K 5H1SQ 1M1GA 4RTXA 1NGEA 3EHQA 1FFXB 1X3NA 1X69A 4B9UA 1OU9A 5GAN6 2P84A 4LF4K 1U1TA 4BDZA 2CT3A 2D8JA 3X20B 5AZIA 3CCLT 3CHWA 3QIIA 1U40A 1RBRA 4CERA 3QBWA 4BRNA 2VQFK 3LAMA 1TKDA 5CIUA 4FOEA 1IPAA 3M3ZA 1XRGA 4O2AA 4BVSA 3CCRF 2F8SA 5FJ4C 3CC4A 4WBNB 1PRMC 1M30A 2ZE2A 1K9MC 4JEPA 4LH4A 1SKWA 2GWKA 4A4KA 2J6FA 1K8AC 1HYZA 5GJWB 1BA0A 4EIAA 1YJ9A 2IG8A 1OU8A 4DRXA 3UKUB 1RBUA 4ZHRA 4BWJA 3PY8A 1AWOA 4JN4A 2XICA 2GUIA 1RTDA 4DU1A 3R6NA 1K8AR 4GV3A 3V3TA 4LE9A 1Y57A 5C42A 2HNIA 1D9DA 3A5MC 2PY5A 4V2SA 3IUCA 2ZM6K 4O2BA 2A5XA 2EQUA 1NJIU 5AQPA 2O31A 3QEXA 1K9MO 4M75A 1TKZA 5CYQA 5AQTA 1UDLA 5EIBD 1MDUB 2RQVA 4FL6A 1B9DA 2EFIA 4JPBW 4BD3A 4H5RA 1RTJA 3ELCA 3CMEQ 3HSBA 1TUDA 2ZWHA 2G8HA 4TZZA 1HNZK 2M0YA 1YHQT 1GLEG 5GAN2 1VQNA 3SLCA 3I9QA 4LFAK 3D01A 2RHKA 3GPLA 3TSQA 5GANe 3TSUA 4FIBA 3SZ2A 3U3YA 2PBDA 3REAB 1J3TA 1CXQA 5AQZA 3SWNB 1OYXA 3IDHA 2E41A 1SL2A 3MP8A 2Z1JA 3CCMF 4DB3A 4ZN1A 3PNWC 4GLKA 1IKWA 3AVNA 3HT3A 5J26A 1MU2A 5AQXA 4A4FA 4WCEL 3V1QA 4XH1A 1ABQA 4DHYA 1RLGA 1JCGA 5C8YB 2QXFA 1V76A 3CD6Q 2HSTA 5KRSA 4DTJA 2PZ1A 2YHXA 3FC3A 4BRKA 1JLCA 3U8XA 3A8GB 2O4IA 3HXMA 2X35A 4F2RA 2ED0A 2LMJA 1R0CB 2OPQA 4M4ZA 4AM6A 3JCMP 1AHJB 1XBIA 2XY6A 2LNHB 1W97L 1BGXT 4ATOA 4C8GA 4EAHD 5J2QA 2XG8D 1GBQA 2DF6A 3C7NA 4CJEA 3SUPA 4OPJA 4Z4FA 3ATUA 2BE7D 3DOKA 3UA6A 4BC2A 3WGMA 2WOMA 2EQMA 2RQRA 4E1NA 4JHDB 1BI3A 1VOMA 2DD5A 2DRKA 4W5QA 4DQSA 2G8FA 2F8TA 3OY9A 4BI3A 2H6LA 1VQ6F 2HS4A 5FDLA 4B45A 2NUBA 3QLHA 1KVCA 1FK9A 4JV5K 4O0JA 3I55T 1X2QA 4XTWA 4CECA 1RDUA 4TUYA 4R40B 1W2BA 4CGGA 2DL7A 3M53A 1RCHA 2CS7A 1WZOA 4O4LB 5MLCQ 2YKNA 4JKAA 3F2KA 4CJ5A 3SCXA 2DX1A 4HVVA 1MV3A 4CEDA 5GANf 4Z94A 5TKWA 1U49A 3RYFB 1N32K 3JAWB 3H0FA 3G4SN 4FSSA 3HM8A 5CK9A 4O8UA 3CC7F 2RB9A 1S6QA 4JK9A 4ID1A 3EGDB 3CMEN 4ZHWA 1WJSA 1NPPA 3RMAA 3I0SA 2ENMA 4OB3B 3JAMM 3E1SA 4XTVA 1B34B 1S1UA 4ID5A 5GANh 2VUBA 4RW6A 3SV3A 3ZSZA 1TUBA 4LF6K 1DBFA 4P5NA 2YUQA 2QQSA 3CCJT 4CESA 1M90H 4B9WA 4FWQA 1VIFA 4M7DE 5JMVA 1QVPA 3BDLA 3QEWA 1E3MA 1MHNA 4XEIA 4A4GA 3BY5A 4KBOA 5CAIA 4JJNK 4BE1A 4GMJB 4XH4A 5BPLA 3SEMA 3AVGA 3LWOC 1K0SA 1GLCG 5ADXH 2KAFA 2YUPA 4IKFA 3EORA 3RKWA 4DR1K 4X34A 4O55A 2AHJB 4IWVA 1NQ3A 2PVGB 1FSZA 2QG9B 1M90O 2BANA 3RUXA 3JCMg 4C0FA 2KROA 1VQOQ 1C0UA 5AQKA 1H7MA 2I6RA 4G4WA 3S03A 1YCSB 5EWRA 2KXCA 4M8IA 1NJWA 3U4LA 2CW4A 2YXZA 3QTYA 4X20B 4FWOA 4H5WA 4PQUA 1PXWA 3TVTA 1VQ4Q 4MLHA 2DXTA 4HCZA 3WQTA 4JD2A 4MO5A 4NWOB 5LJ3e 3ZT0A 4F7UG 1IRXA 2IIMA 1N34K 1HJDA 5FWCA 1QKWA 2D5RA 3HKEA 3ZP4A 4AHSA 3OTOK 1JLAA 3CCUN 2YKMA 3CCLF 1NK0A 1Q86O 1NOZA 1RFQA 3MX2A 3LWRC 1BQMA 1WPYA 3DRRA 4FM1A 3CCSN 4FLYA 4HA8A 1BA1A 4M78B 4EMKC 2P9UB 1SKSA 2QXLA 3M9QA 3I55N 1K73H 1X43A 1MNEA 4TVRA 2M9UA 2NRHA 3QO9A 5CA1B 3I56F 4E1MA 1QWEA 5C24A 4CEBA 1U04A 5HRRA 1VQLN 5LYJA 1ZQ1A 4XTYA 1NGDA 2O8BA 3E22B 1QQJA 2AZVA 1EIFA 1WI7A 2J6KA 3C6AA 4FWKA 3UB5A 4BRHA 4G9ZA 3AT1B 2QEXT 1Q86C 1DKGD 1RDAA 1YTUA 2H3EB 2PAVA 4NXMK 2OTJA 2V7YA 2BH1A 3CPEA 5CKHA 4DTPA 2DEUA 3D2FA 3KLIA 1A5VA 4Y0WA 3T1AA 2O8DB 2E6MA 2LX7A 3KJKA 4OPHA 1JRIA 1TAQA 4M63C 2KFNA 4CZGA 3CCVF 2QAZA 2ZVZA 1SA0A 2ZF8A 1BQNA 2Z1IA 4DKWA 2KRSA 1Q7YU 1ZBUA 4FJ7A 4PJMA 2DY4A 1VK3A 4ZK7A 5HP7A 1KNKA 2V7ZA 1YJWF 3LPUA 3VQ4A 1ZSZA 4M7DF 3ZSWA 3CCMN 4B9TA 4ME7A 2MCNA 5GMKj 2BTUA 3HPOA 2RN8A 3V8LA 4M75E 4JI4K 3LMEA 2WSCE 4HVUA 4U7BA 3RYCA 1VQNF 1QP3A 4F14A 2K3XA 2QA4Q 1YXQA 2LSNA 3ZCMA 3LDSA 2JMAA 1LWEA 4FM2A 4IDHA 3CPWF 3ZSQA 1FMKA 2B6AA 5CYMA 4N0AA 3EAEA 3OHRA 5HROA 1OEBA 5IN1A 4RQOA 2O4GA 4IUQA 2NRRA 4DSKA 4A2AA 1GCQA 2XY7A 3JATB 1W59A 2E6ZA 4KWEA 3RVCA 4B9NA 5LP6A 4BR7A 2FZCB 1BIZA 1U5SA 2BTQB 1BYMA 3V1OA 5D3GA 1TUBB 4CZHA 4AHTA 1HYVA 3AGKA 3NH2A 4CHOA 1UTIA 2X6NA 3F0DA 3URGA 1UJ0A 3L2WA 3K9KA 3C9RA 3OYIA 3JCMb 1W5FA 3G6EQ 4DTNA 1SV5A 3A0IX 4AG1C 4KB0A 2NLXA 4U39A 1U43A 1FNJA 2NUTB 2VG6A 4FJXA 4C8LA 2EVRA 5GJVB 3IS9A 4FSVA 3P8DA 2NRTA 4C1NI 4X1VA 1X6BA 3O85A 3HHTB 4JJDA 4YHHK 3CC4T 4CI0C 1QVFA 3EFRA 2EWSA 3ULEA 3JCMX 1VQPN 4BR4A 1BI1A 4KTQA 4B62A 3DXKA 3VUBA 2Q31A 2GVIA 2P9SA 3ZT1A 4G4XA 4MZPA 4AFUC 4CJ7A 1EETA 3CM6A 4F9OA 4AILC 3RYIA 1XI1A 3M0UA 1QTMA 1TUUA 1QHAA 3KVGA 3C6HA 3VS0A 1QVGF 5GAGP 5ECAA 2DJZA 1W5EA 4I7FA 2E5LK 4WE1A 4AHUA 1WBDA 4FM4B 3V9UA 4N76A 2ETJA 2O8EB 2D6FA 1VQ9F 1J53A 2YSQA 1W42A 3CM5A 3V9ZA 2KHOA 5A2QM 2PU9B 2R5AA 2KRMA 3AVLA 4M42A 1XV2A 3NVIB 1KQSP 3E9PA 1BB9A 1PKSA 5AVMA 3ER0A 1E6GA 1LAVA 4CJVA 1UB4A 4X65K 3T19A 5GMKl 5GAOr 1AEYA 2W42A 1M1KU 1VQNT 4Z4GA 3CPQA 1IH7A 2P9NA 4CF8A 5GAPK 4BY9D 1Q8RA 5CA0B 4ZGJB 3ULDA 4HVJA 3CYMA 1KSWA 3JSCA 3LP2A 3IQLA 4FJKA 2VG7A 2LQNA 5GMKe 1VQPA 4Z4EA 4Z02A 1NM7A 2NRXA 2YHYA 4BRGA 4CJKA 3QBXA 3LDPA 2UYJA 5E26A 1TUCA 3G71F 2P9NB 1VQ8N 2EJ9A 3TTFA 5LY3A 4HNAA 1VQ6A 2G8IA 4CEZA 1SHFA 1M1KH 3E01A 5C2FA 1VQKF 3TEEA 3M8RA 1I07A 2A36A 3IRXA 1TYQB 4BRQA 3VF2A 1QAHA 2J7IA 2E65A 1ZLMA 2PVOB 2Y4YA 4CK1A 2HF4A 4J7FA 2LJ0A 3QERA 4AFQC 1OFUA 2D8HA 4M75B 1LCUA 2R5MA 3A2FA 3E9LA 1DJ7B 2BDPA 3RKYA 1G3TA 4B3RK 3JALA 1C0MA 2JGUA 1H8KA 2MAMA 1JCFA 4K42A 2CZWA 1YI2F 4OMPA 3M1FA 4BREA 1D1AA 5D6XA 4R56A 5KGWA 3RSEA 3VQEA 2A3LA 4DR2K 3C12A 5J2PA 2HVHA 2VB6A 1ZBSA 3O8VA 4CJQA 3J81O 2LRQA 1VQOA 4MFBA 4O4JB 2GCXA 4OF1A 5GAMd 5B8FA 4X3MA 4BE0A 3QKJA 1MMAA 3VGKA 3K2PA 3FGUA 4YOUA 4C92G 2HAXA 3SMSA 3WJRA 4IIJB 1C6VX 1D09B 2KLAA 4WBNA 3VEXA 2FPEA 3C94A 4Z0UA 1UGRB 3QEIA 2DBMA 2KY9A 4M7DA 4FYXB 4A54A 5CY4A 3NMZC 2HP0A 2DYYA 2GZLA 2HDAA 2CP2A 2HMAA 2ATCB 2HSPA 5CKFA 4PKCC 4CC4B 2E4LA 1XMQK 1Q82H 1OPLA 2CYZB 5GAEP 3V8KA 2M1HA 2JM8A 4X66K 3EHRA 2KGTA 3DYAA 3G6EF 4FPAA 4DV2K 1KC8U 4ZHQA 4Z4IA 4CC3A 3IMXA 4JNEA 4OO1J 2P9LB 3F5TA 4ELZC 2LTOA 4CF2A 1W70A 2JM9A 3QWYA 4LSLA 1FKOA 3N5BB 5AQWA 4FYYB 3J7AP 2ZVYA 4GY2B 3L7QA 1YITT 2ESWA 1W6XA 3C95A 1M2VA 2NUZA 1L5UA 2YLBA 1O75A 1YNZA 3I56T 3H46O 4KKOA 1YIJN 3J80E 3VRYA 4C92E 2OTJQ 3S3OA 1ATSA 4J6WA 3RNJA 2QA4F 1ACMB 3ZETA 4H4OA 1SZQA 4ZHYB 2BE2A 4DSFA 3TANA 2DTHA 1HJRA 1Q7YH 3DOLA 1N33K 3P10A 2VXEA 5AQLA 1YIJF 2HKQB 1ZBLA 1P90A 3D2EB 4K8ZA 4IUUA 5LJ5e 2ZGYA 3QFPA 3VQ7A 4NL3A 2WUSA 2F5KA 1NK6A 3GP8A 2A1RA 4K0KK 2XK0A 3DLMA 2KGWA 5J2UA 1VQ7F 4LDWA 2RH2A 4DV0K 2PTKA 3DDNA 5CKDA 1PD0A 4YNQA 1JLGA 3TI0A 2LJ1A 1WXUA 2OJ2A 4QVZA 2BGGA 1OAPA 2NYSA 1Q81R 3VS1A 5LA6A 2MK5A 1VYUA 5FW9A 4X1YB 5LJ5g 4HUEA 3SIVA 1KAYA 4M45A 5GMKm 3LWIA 4PJOD 3HRGA 4CJFA 1CKBA 2CP6A 3LM9A 3LZIA 3T3FA 3CG7A 1P8ZA 1EWQA 1N27A 2DIGA 1UECA 2DRMA 4FWLA 4HTUA 1FKPA 3LAKA 5EXWA 4ELTA 3NPFA 2G8UA 2B5JA 2VAPA 2QWQA 3AVCA 4BY9C 2VC8A 3WXKA 4M7DD 2HBWA 3S06A 5FPNA 1QCFA 1VQMN 2HHVA 3CMAT 1W5BA 4O4JA 1WSGA 4CJUA 3R6OA 2CP7A 4XAXB 2ZF5O 3ZYYX 4J8FA 4C5EA 2KRNA 1MMDA 3FEOA 3QPHA 4M77B 4FO0A 5IHIA 3WVDB 4N4GA 3J81E 1JLFA 3ZSXA 1X7OA 1SRMA 1F1BB 4C0ZA 3THWB 1RAEB 4EI9A 4LFBK 3SIUA 1GLFO 2ZOVA 3OYYA 3UE5A 2IIRA 4LD6A 4BRMA 2PFUA 1SQKA 1QW1A 2HNZA 4KH5A 2D4WA 3OYEA 4G1QA 4WQ4C 2FC0A 1SF9A 2ZJQL 1BI0A 3FD5A 1BCMA 2DILA 4FVMA 2XIDA 3ZX0A 5EVZA 2UYNB 2F69A 4JKCA 4CZIA 1LJOA 2FEIA 2PYJA 4M7AG 2DERA 2OTLN 1KD1R 4BG8A 2P9SB 2LT1A 1H3HA 2RM4A 2IGIA 3HYFA 3NF9A 2CZ7B 3ZX2A 4I55A 1TSFA 5M1QA 1J5EK 1HRHA 5FU6C 1T0HA 2FBXA 4J2DA 4M7AA 3O4NA 4C8MA 1S9GA 3VS2A 3SD4A 4F7UF 5IYZA 4DUZK 4QS7A 2VVKA 2DJQA 1WXTA 3TWHA 4FK2A 2AT1B 4YOTA 3M8SA 1JJ2P 4MDAA 2CP0A 3PX4A 1KFDA 2OAUA 1PHTA 4RMOA 2E2QA 5AFUH 2W40A 1TAUA 1QSLA 1N8RU 1SDSA 1BIBA 2VGMA 3E20B 3K59A 4G4YA 5KYUA 3OW2S 2P0KA 1KAXA 4FJGA 2AP1A 2IQQA 3CCVN 4ILJA 2RI3A 3CCET 4R55A 3CFPA 1GRIA 3M0TA 3KUFA 5GAN3 5F1XA 1VSIA 4HT8A 1RACB 2YXYA 3FR0A 3Q7CA 4JDSA 5GAN8 3L8BA 2YRDA 2QA4N 2JW4A 3THXB 4CEFA 4PKIA 2KI7A 3HFNA 2BUPA 4FZXC 5DLQE 4LD9K 2X4WA 2WACA 1HJOA 1U2VB 2A40A 2ZJPL 3LDTA 1S72N 1IGUA 3HOSA 2P1JA 2PYLA 3EZWA 3CEYA 3CMAF 5HY1A 1X9JA 3O1WA 3EYZA 2FSJA 2Z1GA 5MN6A 1YJNA 5I2MA 3JCMh 2D0PA 3KZBA 1E7OA 5G4VC 4QS8A 2P9KA 1X6OA 1NZ9A 1IHWA 2CGKA 1VYVA 2KBTA 4M3UA 4E47A 4IIMA 1WOQA 3HP9A 3DC2A 2B33A 3S41A 2K7AA 1RBSA 4X3LA 4NYNA 4RW8A 3OW2M 3KK7A 3RMSA 4YOYA 4O4HB 2FO0A 4D6WA 5KE3A 4FCYA 1QVGP 3ENOA 4EHTA 4YFUA 4OX9K 1VQ7Q 3WJQA 1C0TA 1Y07A 1QQNA 5KYYB 1PNJA 4CJ4A 1YI2T 5KPRA 2KQ2A 3VEVA 2FSNA 3NH0A 4M7AE 1XC9A 1X9WA 1H47A 1CK2A 3MPUB 2O8BB 3E22A 4BT5A 4FJLA 1XTDA 1QZ5A 2V1RA 1YJ9N 3G71Q 4X1KA 2HBMA 2QWOA 4E7ZA 4BACA 3IMPA 4Z4CA 1G3SA 2FF6A 1MV0B 2V26A 3M0QA 2YUOA 4JRQA 1V29B 1U4BA 4B9QA 5AZJA 2O2OA 1K73C 2F9WA 2E3HA 3J7YP 1R0BG 3JAMO 2RJEA 1ZBHA 1WNLA 1GFCA 2J06A 4ILGB 4CHQA 1TU0B 3CC2N 3H0HA 1C1BA 1RT2A 3VO8A 2HD0A 5GAMf 3LP1A 5AQFA 1LOJA 4LF7K 3CBPA 5LJVA 3H6ZA 2EQIA 4LFCK 3E2UA 1IGQA 3CCJQ 3RRGA 1U06A 3SQ1A 5BREA 1OV3A 3PLAC 5E84A 4PJOB 2XO7A 4CJTA 1W2BP 2L3QA 1C1CA 3P4EA 3JB9F 1WJQA 2K5FA 5M1PA 2ZJRL 1KC8H 4CF1A 1T0AA 2DVEA 3M84A 3RMDA 1OVYA 3ZEUB 1L3VA 1KK7A 1E4GT 3QYGB 3JARB 5EYPB 2EJFA 1CZBA 5AQYA 1NMUB 2VXYA 4DXDA 4IURA 4B9XA 2DTOA 2IG0A 1ZA2B 2VASA 3FFKB 1ASWA 2D0OA 3NGPA 3SV4A 3VIUA 2XDDA 1IV1A 1SS6A 5IHKA 1H3ZA 1NG9A 3VGMA 3UT5A 3T1HK 4M77D 4B8CA 4PKHA 3QETA 2RHXA 1RLQC 2E1ZA 4Z4HA 3T80A 4DV6K 1KSPA 4BQLA 2CP5A 4NYFA 3WEEA 3CIPA 4E7IA 4WQ4A 2HMIA 4GKKK 3JB9G 2HHXA 2RJCA 1Q7YR 3VA3A 1BCOA 1RQ2A 3SNNA 4LDYA 4R79A 3CCEF 1HSQA 4DTSA 3A8LB 3RA5A 2YJEA 1B34A 1VQVA 3VESA 1Y7XA 2XDBA 3CERA 3TQ7P 5A2QE 4J2BA 2KXDA 4E7SA 4DFMA 4E6RA 3PIOL 4YOWA 3A8OB 4LXCA 3EEQA 4FWSA 3VQ6A 3LYIA 3QNNA 2KTQA 5LP6C 4Q5WA 3JSMA 5HWEA 1YIJA 3LANA 1K9MH 1RAHB 5HL7L 1T3LA 1K8AH 3K58A 1YJWA 4HVWA 3F0GA 5ITZA 2OTLF 2HKNA 3B6NA 5EC7A 3AARA 1YUWA 3WXJA 1VSDA 2NWMA 5CB4B 2RO0A 3EE9A 1XNIA 3O6WA 4Y1DA 2V8IA 1PKTA 3CC7T 4CEOA 4CF9A 3V81A 4UY8O 3QSUA 2ZD1A 2ASPA 2VWKA 5BN8A 1ZUYA 2YYEA 3WT0A 3UWNA 3HRSA 2HHTA 1U2VA 5KX5A 3HK2A 3MKDA 4J9EA 3E1YA 1TVRA 3H9NA 2F4VK 2EJGA 5EYPA 5CR2A 4CZFA 2RMOA 1Y0MA 3I8DA 4O4HA 1UHFA 4ZOLA 1ASUA 4H4MA 5FNVB 4BROA 3NTKA 3VS7A 1ATNA 5GIOC 3FZLA 3CMET 3FZMA 1COMA 2CH5A 2GTDA 4F16A 2DL3A 3UDCA 3MEGA 4E89A 1GLAG 3J7ZO 3G4ST 2P0PA 2UYPA 3RTVA 3TAQA 1B07A 3QZ5B 3S0HA 1GL5A 3TD5A 3L2VA 3IKMA 1Q81U 2A42A 4EZ6A 4MZMA 2DAQA 2EYXA 3AAQA 4E19A 1TVKA 1RGIA 2KQWA 3G1JA 2I7NA 3HZ6A 1J5OA 4F3OA 3TPQA 4F4KA 3OS5A 1NGAA 1HR0K 3HKBA 5CCAA 1A0NB 2ZAEA 1V1CA 2DVJA 3PVLA 1NLPC 1PD1A 3ZEHA 4BG9A 2DZCA 1N6QA 4O5FA 1Q82U 1AWXA 1S22A 3SJHA 3B6PA 4PFPA 1VSJA 2EGEA 4EDUA 3I0RA 3PSIA 3EGUA 2BTFA 4J8OA 4Z89A 1TGOA 4RW9A 2VGNA 4E0DA 3CJAA 2YNHA 3DXMA 3X24B 1RLUA 3M0RA 5EY4A 1YJ9Q 1M90C 3N2KB 1KHIA 1JKHA 3O9SA 4DFPA 2QA4T 5ADXA 4WFBL 4FJIA 1VQKN 1LWCA 2LJ3A 3MAQA 4FLVA 2HL3A 4U3JB 5A0DA 1LW0A 2VG5A 3FIFA 5AFUA 4DV4K 4C0DB 4O2BB 1VQ8A 3LGFA 1Q82R 2GX9A 4J2AA 2ZAUA 3FPIA 4B9LA 2E5QA 3OYBA 4YJ3A 1M5Q1 1BI4A 3PUFA 4BDPA 2DFUA 3H3OB 2WSFE 3REBB 1KVBA 3GOIA 4C1NK 3VV0A 5HCKA 4ELYC 2F5TX 5DMRA 4EZ9A 2JTMA 4FT2A 4MDWA 1B92A 5EIBC 4BGBA 4J9CA 5B8HA 2J6OA 3SK3A 2QTXA 2Z01A 1QU9A 5JCOA 2JUFA 4Y92A 4NUTA 3E9FA 1T0JA 4LY7A 3PE0A 1VQPF 1TS9A 3L2RA 3F0FA 1SRLA 3FZHA 2RA2A 4WTOB 1VQ9Q 3AA5X 2EGCA 1LNXA 2RI5A 5DLOA 2CGJA 4KH1B 4CJSA 1SSHA 4D8KA 1WQ7A 3EG9A 1SUQA 1CXUA 3P5JA 4IZ9A 1LV5A 3WGNA 1NGBA 4NOYA 2XD0A 4FWMA 5F2RA 4FJ5A 2BZYA 3E19A 1VQ4A 1WXBA 3D00A 3UKRA 3OBWA 1NPRA 4KO0A 5M1NA 8ATCB 1YHQF 1ZX6A 3N4PA 3V9SA 2A6AA 1Z5VA 2HBJA 1YP5A 5IJ0A 3CPWP 3QDRB 1I39A 1B3QA 5GAN4 4CK2A 4X9DA 4CHNA 1AT1B 2RD1A 1FMWA 2QI2A 4DS4A 3PO5A 1TK5A 4YOXA 1Z9QA 4JKDA 3WGKA 3V7EA 1VIEA 3EG1A 4QQDA 1VQ5Q 2A1SA 1G2BA 5CHIA 2L89A 4O5BA 1GLLO 3PIPL 3OSVA 4IFEA 2OANA 2YUNA 3JRZA 3QJYA 4OVAA 4PJLA 1NMNA 3KK1A 1DEJA 1VQLA 4J9HA 3DAWA 2FZGB 1YJNT 1K8KA 3RR7A 1UA1A 1RILA 4O4GA 4AHRA 4B1ZA 3QG1A 5DK5A 5C0YA 3PSFA 2VWFA 2OCEA 4X64K 1YJNQ 1K73O 5BR9A 1YJWN 1SSFA 3CYPB 1DGKN 3SPZA 3CCSA 1D0XA 3CJ1A 4WFAL 4YDUC 4ZI7B 1BOTO 3AO4A 8AT1B 3WNFA 4DCHA 4DR7K 2IAJA 2DL8A 3CCUA 2XMFA 2EKOA 2L3RA 3DRSA 1FYNA 3ENHA 1NNEA 3V1RA 3ASKA 3TAGA 3THYA 1Q9XA 3RDVA 1S1VA 3KWGA 3VYHB 2X4JA 3V9XA 3SI6A 4NCBA 3PX6A 2AZSA 3U3GA 2GQIA 1P92A 3LWHA 1QVFS 3CQYA 1QP2A 3C0BA 2O9VA 4OMLA 1EX4A 3HPGA 5J3BA 3B6OA 1RI0A 4RTUA 1X75C 2RHIA 2HW3A 4CZLA 3T9NA 3CI5A 5JICA 2YHTA 4OMOA 4BR2A 1VQMQ 2CZ1B 4H0OA 4GKJK 1GO1A 2PQWA 4RCHA 1IG9A 1VQOF 3V4IA 4RWTA 3P31A 2CH4A 4KRFA 1E4FT 1KCFA 4K11A 4NB4A 1I8FA 3V7CA 1GCQC 4J6XA 4GY5A 3C0CA 5HRSA 1N9SA 4W5TA 5SZTA 2G8KA 2KYBA 3AV9A 2DTUA 1YITN 2NZTA 2DNUA 4IG0A 1JQQA 1RT3A 2GNCA 5FLXE 3ATVA 5KYXB 2GLZA 4C8QA 3VEZA 2QASA 4EMKA 3OVNA 3S0WA 4M3XA 5GIOA 2P4TA 4FOIA 1FJGK 1QQCA 4IBNA 3P8BB 1T8EA 5JCOC 2I2LA 4LDUA 5GANK 3K5OA 3KJVA 3SUQA 3NFCA 4RCBA 4H0YB 1M8VA 1BBZA 1UA0A 2FPDA 1WAJA 4DQQA 4BC4A 2QWRA 1WSHA 2F7TA 4Z8AA 3CC2A 3SBGA 3ZETB 1RABB 2HF3A 3QDKA 2HBKA 5A0GA 4HKEA 3MN6A 4A2BA 2QTPA 3SAGA 3DLBA 5KCHA 2K79A 1VQ9T 3KLEA 3VOBA 3CXCM 1IKXA 3OYHA 3OMCA 1NEBA 2LQWA 3CJ9A 3FD6A 4FLTA 1YIJQ 4O4IA 4DV7K 1IV4A 2ZQBA 3QIOA 4B9SA 3LDLA 2JTFA 3ID8A 1U3LA 2IAFA 3IG1A 4UC4A 1NGGA 2E4HA 1OOTA 3NF8A 4C81A 5BMVB 2KR3A 1W3EX 1M27C 1K4US 4AG2C 5FLXO 1G5VA 3QB0A 4LF8K 2RJFA 4PUOA 4M78C 4Q5VA 5LJ3j 1VQKA 1JLQA 4B5CA 4B3OA 2PMPA 3T69A 1VUBA 2B86A 1KD1U 1ITGA 1N36K 2UUAK 4HNAB 3ME9A 1RNHA 2WFBA 2PUOB 4DV1K 2RN2A 4N56A 5EAZA 1AZEA 4QS9A 4XIUA 4CGJA 2NRVA 2R58A 3VUZA 5LJWA 1ZYQA 4X1IA 3S3MA 3VTIC 5LJ3d 3DM2A 4AF1A 4DBFA 4J7IA 1Z9ZA 1SZ2A 1TOVA 2QW9A 1BK2A 2UYNA 1WHJA 4ERHA 2GBQA 3I8BA 1KQ1A 4LDVA 3OYDA 3DXKB 5LJ5h 4KH4A 4X1IB 1RDBA 4HTLA 3GYQA 2A08A 4M3RA 4UQGA 5L8RE 2FXUA 1V4TA 1WIEA 4LN2A 1DTTA 5F0XA 4HHTA 2LT4A 4DG1A 3CB2A 2A0FB 1Y97A 3LZJA 3KLFA 5J39A 3A5ZB 1NJYA 1IBMK 3RYHB 1NMDA 3VJPA 1ZBIA 1WJRA 3TR8A 4PNOA 2GEMA 2YT6A 3CCQN 4I6MA 2FYKA 2FZKB 3CXCA 2V8JA 1RTHA 3ZX3A 3KLGA 1W7AA 4C92F 1H641 2VKNA 1GOBA 1T3VA 4U67L 2X6SA 3HP6A 4FJHA 3M55A 2JNGA 1WSJA 3P38A 2GQVA 4GW6A 4KFBA 3DXMB 1RDDA 4BWMA 3SQ0A 1X25A 4ISGA 2RHYA 1RL2A 1KRPA 3TCJA 4C23A 5E41A 4WYBA 2YJFA 4BGAA 4E1JA 4E2FB 5GAMg 1WHGA 3ULEB 3HVRA 3JCMf 3KXTA 4K43A 3K0SA 1T05A 4M78D 1YVNA 1KNJA 1XWLA 2WTUA 3OW2F 1SHGA 3A1PA 1NK8A 3OMGA 1A5XA 4Z88A 1TXQA 1YJNF 2RKIA 3OA6A 4CE9A 2OTMA 1BIAA 2NUTA 4AFSC 4X1YA 3CG6A 4E7LA 5IT9E 1WHKA 3C8LA 3BYQA 3QYHB 2RQUA 3HRUA 1M4ZA 1WHLA 3EH2A 5I21A 1ZSZB 4C5GA 5GAMe 2D1KA 3OYFA 5I3UA 3M4YA 4L3QA 3MECA 2LCSA 4BC5A 3RWUA 3M0SA 3DLGA 1RAFB 4H5TA 5CE3A 1RADB 3K57A 4OP0A 1MMGA 2IOCA 4E7JA 1Y96B 3FB9A 2YNFA 3C9UA 2LVMA 4F7UE 5GIPC 1UE9A 2V8KA 3VQAA 3O3HA 4JK7A 2CH4W 2EWNA 1QCOA 4FW1A 3THKA 5HP1A 5AQHA 1UGSB 2LCAA 2JMCA 3SDZA 4GVEA 1TTHB 1VQMA 4CC7A 2JS2A 5GANg 1GZ0A 1RTIA 1PF5A 4KHYA 1M2VB 5LYJB 3H3NO 5AQOA 3HTNA 3MXIA 2BIVA 3M57A 1RT6A 5HRNA 4C8NA 4B9VA 4IIOA 3CBOA 1XHOA 2AIFA 4MMKA 4M7DC 1QSSA 3JV3A 1VQ5A 2P9UA 3LM2A 2PVDB 1QWFA 1VK0A 4AT1B 1VSLA 4IJAA 2XRIA 2AIZP 5ITZB 3P4IA 3AVKA 3KK3A 2E5KA 3CC2F 4W5OA 4CIGA 3F73A 1VQPQ 3R0PA 2QWPA 2DIQA 1C1AA 4DUYK 2O8DA 3F9MA 4ZHQB 3EN9A 3T7ZA 3VPZA 5IJ0B 3BGRA 2EYQA 2GTOA 2Z1EA 5KYXA 4JS4A 3HO1A 2DK3A 1OI1A 2DFFA 3UKRB 1BHLA 1CKAA 3HPWA 1GLDG 1RT1A 1LAWA 4ISEA 4A5AA 1R77A 2QQBA 3HRTA 4EFHA 4EHUA 4BT4A 2DPPB 1QE1A 3K14A 3ON1A 2W10A 3EG9B 4FYWB 2NNWA 1KFSA 4F2SA 3VEYA 4IHJB 3JATA 1YITQ 2M02A 4PL6A 3S0YA 2RQTA 3VQ5A 3ZLJA 1YBYA 5AQNA 3CCSF 1KFZA 2QWMA 4N41A 4R5PA 4M75G 2QEXN 2Z1UA 4M78A 5IH2A 5KGXA 1PSEA 1LWFA 3JCMW 3S3NA 3H1QA 1OVQA 3JXUA 2P5GA 1K6YA 1G99A 1VQ5F 4KRTA 1VQLT 3CCRQ 1SKRA 2HHWA 1HK9A 1YJ9F 3LDNA 1Q7YC 1QVGA 3OBYA 1VQ6Q 2LQKA 4EPCA 1S1WA 2CZ0B 2L8DA 3PMTA 1UUEA 4B1VA 3CCST 2K3YA 2RHUA 3U6FA 1OPKA 5HY2A 3HKDB 2EW3A 4PJOF 1BDGA 3M8PA 1WBBA 3FBAA 2IVPA 4CK3A 4M7XA 3JCMe 3CCUT 2FSKA 1W55A 1TWBA 2ZGZA 5DM7L 4NL2A 2DYIA 3H41A 6AT1B 2CREA 1NLVA 2D0BA 3ZT2A 3GF5A 5KCOA 3VS6A 4ZTFA 4DQIA 2RPNA 2ECZA 5M9OA 4PFOA 3HOTA 1UWBA 1A5WA 1RLPC 3A8MB 3L3UA 5C10A 2BTTA 2PNIA 4RCCA 2E6LA 4CI6A 1YJNN 4FU6A 3G6EA 3MJXA 5IT9O 2O9SA 1OKJA 1ATRA 2CSIA 3GL1A 4QAGA 4LH5A 3L6QA 3L3VA 5LXTB 2DXCA 1NGIA 4DR3K 5CO7A 2H8EA 3MN7A 1Y71A 2QWNA 2DM1A 5JVDB 1EXQA 3SWNC 3RMQA 4DEXA 1UAXA 2ZODA 4PJOG 4M77C 1FMVA 4Y91A 3X25B 3PIOA 1PCXA 3PIPA 4RTYA 3M56A 3U23A 1QHTA 1RT5A 5A2QO 5BRFA 3K0TA 4O4LA 4YJ2B 1E6HA 4RUGA 4BVOA 4KPYA 2CWJA 4J9GA 1VQ6T 2VWBA 3CC7N 1UHCA 2E3IA 2I5JA 1XOVA 1EQYA 4B1UB 3QO3A 3HKEB 3HJWC 3SFMA 5KYWB 3ZFJA 1Z25A 3EZ5A 1HMVA 1BO5O 3GOXA 5FRMA 2LDMA 1W2BS 2OPSA 3CCUQ 2FPFA 3EGDA 5JVGL 1QSYA 4JZ3A 1WSEA 4CJPA 2HHUA 1S72F 4F6RA 5JLHA 5GADP 4DQ2A 4YOVA 4QOZB 3UA7A 4F6RB 4ZOLB 3JASA 5FPMA 2C0IA 3META 2QK0A 1KD1O 3RYFA 3NF7A 1D0YA 2YNGA 3N4ZA 2MWOA 2QTVA 5KYWA 4MO4A 5FPDA 3L1AA 3JAKB 5KX5B 1QVGM 4KBMB 5GINA 2UYKA 1EFNA 1W2BF 5JH7B 3JS6A 1LPLA 1VQOT 1WDXA 2GFUA 4O44A 2OTLA 3RYIB 4TUYB 1VAZA 1W4SA 1OZ2A 3ID6A 4DBQA 2E88A 1UGVA 1SL1A 3A5NC 2AIRB 4DFJA 2SEMA 1EZZB 3K12A 5GIPA 2Z1HA 4M78F 1KD1H 1BI4B 2X78A 3MEEA 4IG3A 1VQ4F 4KT0E 1VRUA 4KI4A 4I2QA 3CCQA 3VI6A 3SB2A 4WFNL 3TAPA 3LDQA 3NFAA 3Q8HA 4C8OA 3BY7A 2P51A 4LD0A 5TKYA 1D1CA 4J2EA 4LNUB 4BT2A 5I2SA 1QLYA 5FRNA 3L4QA 3VYUC 3C4SA 2VCPA 1OZ3A 1S5JA 1OH6A 2D0AA 1U6ZA 3MEAA 1BU6O 1O1WA 1WSFA 2ITGA 1OH5A 1KC8R 4C5IA 3QFUA 2X74A 5KI6A 3JB9D 3GTZA 4QT7A 3WXIA 3LW5E 4EMHA 1T0KB 4CJWA 1KTQA 5JQGA 4XTZA 3TARA 2QKKA 3M59A 4C8QC 1AD5A 1SKUB 2YHWA 3MCPA 2C0OA 1Q86R 4DBHA 3ZBDA 4BRAA 3OW2P 4IOCL 5EB0A 4F17A 4OKEA 2HQEA 4F04B 4YDUA 1YITA 4CBXA 3CD6T 3G4SQ 3SMPA 3TD3A 1I3AA 4I55B 1N8RH 3V8JA 2HNDA 2QEXQ 3A5OC 1HUXA 3DI6A 1X52A 3PO4A 1ZHIA 3CC4F 4EMGA 2RB6A 1T3SA 3JB9J 3B8AX 4CHYA 2FBYA 5KRTA 1OX9A 4B3SK 3VEOA 4TV9B 4HUGA 2OPRA 4B6MA 3EKUA 5C25A 4FW2A 4OLBA 2MWPA 3JASB 3JCMd 3ZP7A 1Z26A 2OAWA 3PT9A 4IO9L 3TTDA 5G4UC 2ASMA 5AQGA 1N8RO 1XMOK 1YHQN 3NHNA 2AK5A 2GFAA 4PFZA 3KIOA 4JRKA 5D6WA 4CF0A 1FXXA 5KQDA 5I11A 2RF0A 4DV3K 2LX9A 4BW0B 1IBLK 2OA8A 3D54A 1JY8A 2UZHA 2FLOA 4MMLA 1MMNA 3CC4Q 4CZJA 4GVMA 3C65A 4L5GA 1M9SA 3L42A 3AVMA 3U0OA 3OS2A 2KTVA 4DRXB 1WGSA 4X62K 3M4GA 4BDYA 4YJ2A 2BO1A 1MWKA 1JU5C 2KW4A 5FWBA 1KC8O 4M75C 4KULA 3OYCA 3CQ8A 3CD6N 5IJ9B 1IV3A 5I22A 3PTAA 2JNBA 1RBTA 2RQWA 4J9BA 2DZ9A 3LDOA 3VCZA 1UFFA 2BZXA 1JFFA 4IUPA 1DTQA 5KMGB 5LXTA 1IXDA 3OYNA 3QIPA 4M78G 2ABLA 3OA9A 4KH0B 3VS3A 3ENBA 1S72T 3A8HB 1OULA 3CMAA 3CCMA 4FJ9A 4TSXA 4M77E 3D0PA 3TAFA 3SBTA 4OKJA 3RRHA 4JI7K 3LL3A 4DFKA 1K9MU 1U48A 1N9RA 1K8AU 2HRUA 3CCJF 4PL8A 5FU7C 5HP8A 3N4QA 2UXBK 4JD2B 2QDYB 2CKKA 2QKBA 5EO3A 3BEXA 3KE1A 5FROA 3QHSA 4XU2A 4DTXA 2Q1YA 2WONA 3AVAA 1D8YA 4E7KA 2Q3SA 4XCQA 3NAEA 1JO8A 1IV2A 4HXJA 4FPBA 2AJQA 2LCCA 2KZMA 2NRWA 3QZ9B 5GAOl 1VQMT 2Q1NA 1G15A 5I9EB 2KMTA 2I6DA 5AQRA 3HVTA 3VA0A 1NJIC 1S1XA 2P6YA 1LCKA 2K2VA 1HNVA 3NVMA 2QK9A 5AQMA 3LWMA 4E3SA 3I5RA 3QWXX 4AMCA 4JI0K 1ILYA 2LNVA 1ZXOA 3DLEA 2JWLA 2MF2A 3J7AF 1K8AO 4QCLA 2BZ8A 2GUPA 4H03B 3BDUA 3IKFA 1L3SA 3JARA 1IO2A 1D0ZA 1VA7A 2NUPB 2XKOC 1HKBA 1TUYA 4C8KA 3KJJA 1GOAA 3NK7A 1QVFM 2Q2RA 3U9DA 3RKXA 2HRYA 3JAME 1X1PA 2JT4A 1X9SA 2HHSA 4W5NA 3VOVA 4O2AB 4PY5A 1ONIA 4A4EA 2UXDK 3RE3A 4MZTA 4CIEA 4BT7A 3BE3A 1YT3A 2RE2A 2KFZA 2O8FB 1X7PA 2R7YA 3QHDA 3FE1A 5LJ3g 1G83A 3NGZA 1I4K1 3CCRA 3AA2A 3DLLA 4I6MB 4C5HA 5EOYA 2JTEA 2HOEA 3MEUA 3MN5A 4B3TK 1D1BA 1VHXA 4EP5A 4GLMA 2ZPGB 2LQ8A 3CCLA 4AH9A 1QQOA 2YI1A 1Q18A 4PJJA 2X3XD 4IUVA 1Y64A 3VGLA 1QD9A 2V51B 2OZBA 2CDTA 2X3WD 2RPIA 4CRIA 3ZSRA 4CD3A 4JI8K 3AO2A 3IEQA 3J80M 2WSEE 2FGYA 1YJ9T 4BI4A 3LWQC 3OYJA 4M75D 3PVQA 3O80A 3KD1E 2KSSA 1IO6A 2MMPA 3EH1A 3VS4A 3G71N 3OSSC 4IUTA 5GAOm 4OMMA 2UYTA 5KYYA 3OYLA 2JWKA 4C8IA 4NLCA 2IDOA 1XNQK 1JXBA 2O4XA 5LJ5d 5GAOq 1BUPA 2UUCK 2VAMA 2NLUA 4OKKA 2GGRA 4ORZA 4RTWA 5AQUA 3RYHA 3CMEF 1IG8A 1RBVA 1QVGS 4PWTA 1B7TA 1PSFA 2D0CA 3SQ2A 5IHNA 1HYSA 1Y96A 1WHHA 1AWWA 4DF4A 3V6DA 2Q36A 4C92B 1VQ7N 4I4TA 3O3FA 3WXMB 1BU1A 3INZA 4O8KA 3NVKA 2YNIA 3VQPA 2P9PB 2K6DA 1ZC6A 5KYUB 1MWMA 3DMJA 4ISFA 4I50A 4C0GA 2P9KB 2F2WA 3O9RA 4BR5A 4I2PA 3VN5A 2DLPA 4JI1K 3TD4A 5AQJA 2KE9A 3VF6A 2HB5A 3G6ET 1OQKA 1WNSA 2ITMA 4BRDA 3THVA 4DF8A 3CFOA 4BRFA 1GXIE 1LOTB 1YFNA 5BN9A 3J7AR 1N8RC 3IKEA 1SPKA 1TKXA 2DL4A 2EQJA 3OYMA 3AO1A 3SJJA 3MN9A 3THXA 1JLBA 5HK3A 1KAZA 2YHAA 1GX1A 5FLXM 2G3RA 5EZYA 3I56N 4YY3K 2CT4A 4IXCA 4C8EA 2FB7A 5K14A 4FJJA 4NQ3A 1JL1A 1HLUA 4JKGA 5EB1B 4KGVB 1SAZA 4PK4A 1QCNA 2H8HA 1RDWX 1I5OB 2KKZA 3CQTA 2QWLA 3AO5A 2HP3A 3ERNA 2N48A 3MK6A 4XQ3A 1WHMA 4JKEA 1SEMA 3KK2A 3MCAB 2MIOA 5IAYA
chains in the Genus database with same CATH topology
4C92A 3D2EA 2DKGA 3HTVA 4H0XB 2EIFA 3HSCA 4BVQA 4B1XB 3DB4A 5CKEA 2O4XB 3R6MA 5GAN7 4RG8A 4N4IA 1CZAN 4IOXA 1U1SA 3UKUA 3MO8A 4CZMA 5CQXA 3OYAA 2I7PA 2OTLT 1W41A 4OGCA 4N0AC 2ASOA 2KTUA 2F9ZC 3OS1A 4MDXA 2PUKB 5AQSA 3M54A 4BC3A 3OYKA 3RESA 3CCQT 3BF1A 1BG3A 4DQ8A 1DT9A 2E1YA 3VKIA 1VQNN 2KDSA 1O9SA 2JZ2A 4C8QF 4M77A 1QQMA 2A41A 3R8EA 5CVIA 1NWKA 4O6JA 3V7SA 5AQQA 2YLCA 1K73U 3CCJA 3CPWM 1D4XA 3R3LA 4H0PA 2E20A 3CMAN 2E10A 4M7DB 3BUZB 3X28B 1QVGF 1V4SA 4K25A 1KQ2A 3S6WA 3QXEB 1YJWT 4J5YA 1Q86U 3CETA 4IEIA 4II1A 3GNGA 3WVEB 1NBWA 5KQ8A 1KQSF 5HXUA 3CD6A 1ZWZA 3AHUA 2CH6A 4OB2B 1R8OB 3MWPA 5CR4A 5BRDA 3RIRA 5HOOA 5HY0A 5HY6A 2JN0A 3FDRA 4FT4A 2E8AA 4M7AC 1KHCA 3R9PA 5AR0A 4C4WC 3MMVA 5EX5A 4LC9B 1HX1A 2IVOA 3LX7A 3WQUA 3DB3A 5GAMj 3D2FB 3GNFB 1TYQA 4EMKB 4BVTA 2Y90A 2HQXA 3JB9H 5GAOp 3MHXA 1VQ9N 3OQ5A 1MA9B 1JJ2A 2DXBA 1S3XA 2Q0RA 1JB0E 2GF7A 2YRVA 4JLGA 4C92C 3NMUC 3VETA 1S72A 5LJ5j 2M16A 3NK6A 3TREA 1E7KA 1X01A 2FF3B 2OTJT 3CQXA 2QA4A 2Q97A 3UT1A 1NM1A 2HBPA 3K9JA 2WALA 2HMPA 5C2DA 4WQ5A 3VYGA 2H3JA 3QBYA 4MLEA 4CBWA 3MX5A 2JOYA 1FX7A 5AQVA 5ELZA 2ZZDA 4NS5A 5GAHP 4A61A 4XU0A 3O8MA 2RHZA 3BP8A 5DM7R 4OPAA 3E9OA 4C8QE 3RSEB 2QEXF 3W0LA 3TU5A 3HL8A 1Q81C 3P8HA 4VUBA 1M1KC 1Q81O 4E7HA 4Y28E 3AGRA 4GNIA 3EL2A 1VQ7T 4HCBA 2W41A 1XC3A 2GWJA 3CCRT 3NMUA 5DY9A 2GELA 3KHYA 3SAHA 2OHWA 3CBMA 1EO1A 1Q82C 5FPEA 1IJJA 3LH0A 4CD1A 1Q81H 1M90U 4H5VA 5GINC 3AAPA 4N4HA 3VERA 4PHTX 5JVHL 3M5RA 1GLJO 4FWPA 4PJOC 2E1HA 4FVUA 3PLAA 1NJIO 3CCVA 4XTXA 3MP6A 1QZ6A 4A5BA 4H0VB 4BY6C 1H1VA 4BI8B 3TU4K 4JRIA 3A8YA 3JCMM 4BQZA 1WQWA 3C7NB 1NJIH 4LDXA 1IREB 1Z05A 4DA4A 3D6RA 1YCYA 2P9IA 1NGHA 3GE1A 4JS5A 1HPMA 4RG2A 3Q7BA 4ZGDB 5KH6A 4BRLA 2ZPBB 1YITF 5GANd 1KQSS 1VQPT 3PMIA 5GAN5 1U8RA 1FWZA 3CC4N 1KC8C 3IR9A 5KE2A 2VYPA 1WUAA 3I33A 3J81M 4RTFD 3HFOA 1N6AA 4KUIA 4FL9A 5HXZA 1JJ2F 3BFMA 1Z6RA 3J8AA 3Q1JA 2E2NA 2B8AA 1T6CA 1Q86H 1VQ8F 3CCJN 2CGHA 1XQSC 1G3WA 4J83A 3WEEB 3IFRA 3L2UA 1XUPO 4A57A 5HKCA 4HWIA 4C8QD 4OB0B 3CC2T 1GLBG 3CJ7A 4C92D 3L4IA 1NGCA 3DWLA 1VQ9A 4QQ6A 3CXCF 5CKBA 3CCQF 1NGJA 4BB7A 3ZEUA 1ESVA 1UEBA 4F7UA 3O9UA 2CGLA 2LC4A 4XTUA 4J6YA 3O9TA 3QMLA 2P9IB 3I55F 3OW2A 1VQKT 1UGQB 2IVWA 1KQSM 4F7UB 2YX6A 3H45C 4L6V5 2E2OA 1W40A 4CZEA 3H8ZA 4CZKA 4CBUA 5C6SA 1G3YA 4FWRA 2DXUA 3MDQA 3LLRA 3I56A 1J6ZA 3GBTA 3L0QA 3O5BA 3V7RA 4M7DG 4DOVA 1GO0A 4RKUE 3UPUA 2XU8A 2MI6A 3CCEN 3GDQA 3NTHA 2RK1A 4PJOA 3PAFA 1HKCA 3FLCO 2FVUA 2VYTA 3EE8A 5LL6S 4GV6A 1RA4A 1VQ4N 4WF2A 4JKBA 1T44A 4MDBA 2QQRA 4A62A 5M1FA 1IZ6A 3KWIA 3JCMV 1VQON 2LCLA 3G71A 4OMFB 3EFSA 3SWNA 4C8QG 4KH6A 3DLLL 1KD1C 3HBTA 1MGQA 2RJDA 3VEWA 2EAYA 5C12A 5C15A 2DEQA 4PLLA 1UGPB 4QVCA 3GLXA 3VU3C 3CCLN 1HXDA 1VQMF 1VQ6N 3VTIA 2BKDN 4BRPA 4M7AB 3OB9A 1X3MA 4B1WB 3O1BA 3CCRN 2DTIA 2QQAA 4M7AD 5FU6B 2KVQG 4BRCA 4QW2A 3JCMQ 2ALEA 3G25A 4BVPA 1M1KO 4BVRA 3O4WA 3FZFA 5AQIA 3AY9A 3SAFA 2IVNA 2H3GX 2K57A 3EO3A 4XU1A 3OYGA 3X26B 3H6EA 1VQ5T 4JHDA 3JCMc 4FSXA 3BW1A 4FWNA 5AZIB 1VQ7A 3TTCA 4JRPA 5HY4A 2K5IA 3M5AA 3CD6F 5FU7B 1NE8A 1JJ2S 1R59O 1YAGA 4DOWA 3CJCA 3QJ6A 4ZGEB 3CCEA 2QTDA 4QQGA 4PJOE 1YF5L 2ZPIB 2OTJN 4O5VA 4JAXA 3CJBA 3H1VX 3E9GA 4XU3A 4BY6B 1D3BB 1Q82O 3CCVT 1I5LA 1YI2N 5DM6L 4BRIA 3BF3A 5BPNA 3QICA 4M7YA 2P9LA 2XHCA 1BWFO 5DCVA 3MEWA 2C06A 1C0GA 3HKSA 2Y4XA 3W3DA 4IJNA 2HBLA 3CCUF 3MWTA 3MP1A 3LWVC 3PFSA 2K4YA 4OGEA 3HI0A 5KPZA 3LFOA 2ZPHB 3FLGA 1YI2A 1YHQA 3E66A 3KBGA 2J4RA 3JCMJ 2M0OA 5AZJB 1TH7A 2YCHA 2WC9A 1KQSA 3CPFA 3U9ZA 3CPWA 1Q7YO 5C0MA 5BPMA 3N4YA 4ZN3A 4L59A 5LJ3f 3G4SF 3M58A 4A4HA 3PGGA 2ZPEB 5HK0A 2ZPFB 3RERA 3VF4A 2JVVA 4QVDA 5JLFA 5IT9M 4M78E 2LBWA 1JBMA 2Q0UA 4LCKA 3L2QA 1T6DA 2A7YA 2A3ZA 1KXPA 4HCCA 4JK8A 3I55A 4JLIA 2D9TA 1D3BA 2V52B 1BKBA 1O13A 3M6GA 4NO7A 4NLBA 3VENA 3NVKE 4WQ5C 2E64A 4BR9A 3EKSA 2DO3A 2FHDA 4XH5A 2HVYD 4EI7A 1JJ2M 4GV9A 2KG4A 4ZTJA 3FZKA 3WUHA 2LBXA 2QQ9A 4XK8E 4C0DC 2VV5A 3CPWS 5LJ3h 5A0LA 4K41A 1CN7A 4IEEA 1M1FA 2P0QA 2K5LA 4PL7A 3TSPA 4BUGA 4JKGB 3D7EO 3FRNA 2E6NA 2NRZA 1YIJT 3P39A 4JKHA 4EI8A 4M7AF 2R57A 3CXCS 3R1XA 2ZCFB 3CC7A 2RI2A 5GANj 1NGFA 5CQYA 4M77G 2L5QA 3VTHA 1QVFF 2XI9A 1C0FA 1BI2A 4IO8A 3GG4A 5LJ5f 2VXFA 2P9PA 3O08A 3JB9I 2F9TA 1VQLF 4JKFA 2X4XA 3G6EN 3CMEA 3A5LC 3LGLA 2FL7A 2BUDA 5GAOn 3G4SA 5G4UC 4ILHA 4C8QB 4BR0A 2CZ6B 1I81A 2O01E 1W2BM 4AM7A 4M77F 2OTJF 3CF5L 2D0QB 4KUDK 3RA6A 3MEVA 3F70A 1XQHA 2DD4A 2E12A 5D6YA 3GIBA 4YTLA 5M1KA 4PLIA 3QUIA 3G71T 2EQKA 4A53A 4H5NA 1ZBXA 3G7ZA 4HT9A 2RK2A 4PKGA 5KPTA 3VMFB 3CCMT 2QEXA 2XDPA 4M75F 2X4YA 4JUVA 3OS0A 3L2ZA 4X9CA 2E70A 4H0TB 1HKGA 5EG2A 2ZGWA 3WXLA 4BE2A 5GAMh 2DPNA 3DKMA 1VQ8T 5AYFA 5M1OA 3V7QA 3NTIA 4A59A 1K8KB 2AA4A 3O9QA 4B1YB 1VQ5N 2QM1A 4YORA 2KK4A 3DJCA 5GMKi 5BRHA 5GMKh 1KG1A 4OB1B 3LWPC 2WBNA 1VQ4T 2E2PA 3FJPA 5H1SQ 1M1GA 1NGEA 1X3NA 5GAN6 1U1TA 4BDZA 5AZIA 3X20B 3CCLT 3CHWA 3QIIA 3QBWA 4BRNA 1IPAA 4BVSA 5CIUA 4FOEA 3CCRF 3M3ZA 5FJ4C 3CC4A 4JEPA 1K9MC 2GWKA 4A4KA 1K8AC 1BA0A 4EIAA 1YJ9A 3UKUB 4JN4A 2XICA 4GV3A 3V3TA 2HNIA 3A5MC 4V2SA 3IUCA 2A5XA 2EQUA 1NJIU 5AQPA 1K9MO 4M75A 5AQTA 1MDUB 4FL6A 4H5RA 2EFIA 4BD3A 3HSBA 2ZWHA 4TZZA 1YHQT 1GLEG 5GAN2 1VQNA 3SLCA 2RHKA 3GPLA 3TSQA 5GANe 3TSUA 4FIBA 2PBDA 5AQZA 3SWNB 1OYXA 3IDHA 2E41A 3MP8A 3CCMF 4DB3A 4ZN1A 3PNWC 4GLKA 5J26A 5AQXA 4A4FA 4WCEL 4XH1A 4DHYA 1RLGA 1JCGA 2QXFA 2HSTA 2YHXA 3FC3A 4BRKA 3U8XA 3A8GB 2X35A 2FC3A 4AM6A 3JCMP 1AHJB 1XBIA 1W97L 4ATOA 4EAHD 2XG8D 3C7NA 3ATUA 4BC2A 2EQMA 4JHDB 1BI3A 2DD5A 1VQ6F 3OY9A 4BI3A 3I55T 4XTWA 1RDUA 1W2BA 3M53A 2CS7A 5MLCQ 4JKAA 3F2KA 5GANf 4Z94A 5TKWA 3G4SN 3HM8A 4O8UA 5CK9A 3CC7F 4JK9A 3CMEN 1WJSA 1NPPA 4OB3B 3JAMM 3E1SA 4XTVA 1B34B 5GANh 2VUBA 4P5NA 3CCJT 2QQSA 1M90H 3NVIB 4B9WA 4FWQA 1VIFA 4M7DE 5JMVA 1QVPA 3BDLA 1MHNA 4XEIA 4A4GA 4KBOA 3ON1A 5CAIA 4JJNK 4BE1A 4XH4A 5BPLA 3LWOC 1GLCG 5ADXH 2KAFA 4IKFA 3RKWA 4X34A 2AHJB 4IWVA 2PVGB 1M90O 3RUXA 3JCMg 4C0FA 5AQKA 1H7MA 5EWRA 3U4LA 4FWOA 4H5WA 1PXWA 4MLHA 2DXTA 4HCZA 3WQTA 4JD2A 4MO5A 5LJ3e 4F7UG 3CCUN 3CCLF 1Q86O 1RFQA 3MX2A 3LWRC 1WPYA 3CCSN 4HA8A 1BA1A 4M78B 4EMKC 2P9UB 2QXLA 3M9QA 3I55N 1K73H 4TVRA 2M9UA 2NRHA 3I56F 1VQLN 1ZQ1A 4XTYA 1NGDA 3FFMA 3C6AA 4BRHA 1EIFA 4G9ZA 4FWKA 3UB5A 2QEXT 1Q86C 1DKGD 2PAVA 2OTJA 2V7YA 2BH1A 3CPEA 5CKHA 3D2FA 4Y0WA 4OPHA 1JRIA 4M63C 4CZGA 3CCVF 4DKWA 1Q7YU 2V7ZA 1YJWF 4M7DF 3CCMN 4ME7A 5GMKj 3V8LA 4M75E 2WSCE 4U7BA 1VQNF 1QP3A 2K3XA 1YXQA 4IDHA 3CPWF 4N0AA 3EAEA 3OHRA 5IN1A 4IUQA 2NRRA 4A2AA 2E6ZA 3RVCA 4BR7A 1BYMA 4CZHA 3AGKA 3URGA 3L2WA 3K9KA 3OYIA 3JCMb 3A0IX 2NLXA 4FSVA 3P8DA 2NRTA 4C1NI 3O85A 3HHTB 3CC4T 4CI0C 1QVFA 3EFRA 2EWSA 3ULEA 3JCMX 1VQPN 4BR4A 1BI1A 3DXKA 3VUBA 2Q31A 2P9SA 4MZPA 4CJ7A 4F9OA 1TUUA 1QHAA 3KVGA 3C6HA 5GAGP 2DJZA 4FM4B 2D6FA 1VQ9F 1W42A 2KHOA 5A2QM 2PU9B 2R5AA 3E9PA 3ER0A 1UB4A 5GMKl 5GAOr 1M1KU 1VQNT 3CPQA 2P9NA 5GAPK 4BY9D 4ZGJB 3JSCA 5GMKe 1VQPA 4Z02A 2NRXA 2YHYA 4BRGA 3QBXA 3LDPA 5E26A 3G71F 2P9NB 1VQ8N 2EJ9A 3TTFA 5LY3A 1VQ6A 1M1KH 5C2FA 1VQKF 3TEEA 4BRQA 1TYQB 3VF2A 2E65A 2PVOB 2Y4YA 2HF4A 4J7FA 4M75B 1LCUA 2R5MA 3E9LA 1DJ7B 3RKYA 1G3TA 2CZWA 2MAMA 1JCFA 4K42A 1YI2F 3M1FA 4BREA 5D6XA 4R56A 3RSEA 2A3LA 3C12A 1ZBSA 3O8VA 2LRQA 1VQOA 2GCXA 4OF1A 5GAMd 4X3MA 4BE0A 3QKJA 3VGKA 3FGUA 4YOUA 4C92G 2HAXA 3SMSA 2KLAA 3VEXA 3C94A 1UGRB 2KY9A 4M7DA 4A54A 5CKFA 4PKCC 1Q82H 2CYZB 5GAEP 3V8KA 2M1HA 3G6EF 4FPAA 1KC8U 3IMXA 4JNEA 4OO1J 2P9LB 3F5TA 4ELZC 2LTOA 5AQWA 3N5BB 4GY2B 1YITT 3C95A 2YLBA 1O75A 3I56T 3H46O 1YIJN 3J80E 4C92E 3S3OA 1ATSA 4J6WA 2QA4F 3ZETA 2DTHA 1Q7YH 2VXEA 5AQLA 1YIJF 1P90A 3D2EB 4IUUA 5LJ5e 2ZGYA 3QFPA 4NL3A 2WUSA 2F5KA 3GP8A 2XK0A 3DLMA 1VQ7F 4LDWA 2RH2A 5CKDA 4QVZA 5LJ5g 3SIVA 1KAYA 4PJOD 5GMKm 3LWIA 3HRGA 3LM9A 1P8ZA 1N27A 2DIGA 4FWLA 5EXWA 2QWQA 4BY9C 2VC8A 3WXKA 4M7DD 5FPNA 1VQMN 3CMAT 3R6OA 4XAXB 2ZF5O 3ZYYX 4J8FA 4C5EA 3FEOA 3QPHA 4M77B 4FO0A 3J81E 3WVDB 4N4GA 1X7OA 4C0ZA 4EI9A 3SIUA 1GLFO 3OYYA 3UE5A 2IIRA 4LD6A 4BRMA 2PFUA 1SQKA 1QW1A 4KH5A 2D4WA 3OYEA 4WQ4C 2ZJQL 1BI0A 3ZX0A 2XIDA 5EVZA 2F69A 4JKCA 4CZIA 1LJOA 4M7AG 2OTLN 4BG8A 2P9SB 2LT1A 2RM4A 3ZX2A 2CZ7B 5M1QA 5FU6C 4M7AA 3SD4A 4F7UF 4QS7A 4YOTA 4MDAA 2OAUA 4RMOA 2E2QA 5AFUH 2W40A 1N8RU 1SDSA 1BIBA 2VGMA 3E20B 3OW2S 2P0KA 1KAXA 2AP1A 3CCVN 4ILJA 2RI3A 3CCET 4R55A 3KUFA 5GAN3 5F1XA 3Q7CA 4HT8A 3FR0A 4JDSA 5GAN8 2QA4N 4PKIA 3HFNA 2BUPA 5DLQE 4LD9K 2X4WA 2WACA 1HJOA 1U2VB 2A40A 2ZJPL 1S72N 3HOSA 3EZWA 3CEYA 3CMAF 5HY1A 1X9JA 3O1WA 2FSJA 1YJNA 5I2MA 3JCMh 2D0PA 3KZBA 5G4VC 4QS8A 2P9KA 1X6OA 1NZ9A 2CGKA 4E47A 1WOQA 3HP9A 3S41A 4X3LA 3OW2M 3KK7A 3RMSA 4YOYA 4D6WA 5KE3A 4EHTA 3ENOA 1Y07A 1QQNA 1YI2T 5KPRA 3VEVA 2FSNA 4M7AE 1CK2A 1XTDA 1QZ5A 1YJ9N 2HBMA 2QWOA 4BACA 1G3SA 2FF6A 4JRQA 1V29B 4B9QA 5AZJA 1K73C 2F9WA 2RJEA 1WNLA 4ILGB 3CC2N 2HD0A 5GAMf 5AQFA 1LOJA 3CBPA 5LJVA 3H6ZA 5BREA