2VGNA

Structure of yeast dom34 : a protein related to translation termination factor erf1 and involved in no-go decay.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
382
structure length
360
Chain Sequence
MKVISLKKDSFNKGGAVITLLPEDKEDLFTVYQIVDKDDELIFKKKFDLVKLKIKVISEDFDMKDEYLKYKGVTVTDESGASNVDIPVGKYLSFTLDYVYPFTIIKQNFNKFMQKLLNEACNIEYKSDTAAVVLQEGIAHVCLVTSSSTILKQKIEYDVLKFDEKTEKFYKAIYSAMKKDLNFDKLKTIILCSPGFYAKILMDKIFQYAEEEHNKKILDNKGMFFIAHCSTGYLQGINEVLKNPLYASKLQDTKYSKEIMVMDEFLLHLNKDDDKAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLTGIACILKYPLPDLDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DOM34
publication title Structure of Yeast Dom34: A Protein Related to Translation Termination Factor Erf1 and Involved in No-Go Decay.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 90
structure length 360
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03463 eRF1_1 eRF1 domain 1
A PF03464 eRF1_2 eRF1 domain 2
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.870 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vgnA01
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2vgnA02
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2vgnA03
3CXCF 3CCLF 3NMUC 3CCEF 3SIVA 2OZBA 5GAPK 1VQ4F 3PAFA 1YIJF 1VQOF 1K8AH 3MCAB 2QI2A 4X3MA 1PXWA 1Q86H 2OTJF 1KD1H 1GO1A 1IPAA 1H7MA 2KTVA 3HAXD 5EO3A 3J80M 3RA6A 1S72F 1RA4A 3N4YA 5GANK 2OHWA 1N8RH 3N4ZA 4BY9D 5GIOC 1YJNF 1KC8H 3CC2F 3JAMM 1YJWF 5IT9M 1W40A 2AIFA 3CPQA 3J81M 3V7EA 2JNBA 5GINC 5GIPC 5FJ4C 3HJWC 4AF1A 4X3LA 4NUTA 1E7KA 1VQPF 1KQSF 1YITF 1QVGF 3LFOA 3IR9A 1X7OA 2ALEA 5G4UC 1VQ9F 3CCVF 1GO0A 3JCMM 1CN7A 1CK2A 3CMAF 2VGMA 4BW0B 5DCVA 1GZ0A 2LBWA 3OBYA 3LWOC 2I6DA 3NK7A 3LWVC 3LWQC 3CCUF 4TZZA 1YJ9F 1SDSA 2QA4F 1VQ5F 3ON1A 1VQ6F 1W2BF 3OBWA 1W41A 3SIUA 3O85A 3CC4F 3G4SF 3E20B 2QEXF 2KG4A 3CCMF 1YI2F 1VQ8F 3FFMA 2KTUA 3NK6A 1NJIH 3CMEF 3CD6F 1ZWZA 1NMUB 2VGNA 1RLGA 1W42A 1Q82H 2CZWA 3RA5A 1XBIA 3G6EF 2HSTA 1M1KH 4LCKA 3CCQF 5A2QM 1QVFF 3CG6A 1VQKF 3NVKE 2WALA 1VQNF 1K9MH 3AGKA 1DT9A 4C4WC 3NVIB 3LWPC 3I55F 1T0KB 5FLXM 5G4VC 1Q81H 3E1YA 1JJ2F 2LBXA 1M90H 1X7PA 3CCRF 3WXMB 3CC7F 3CCJF 1YHQF 3I56F 3OW2F 1VQLF 1Q7YH 3LWRC 1W3EX 1VQMF 3J7AR 1VQ7F 2HVYD 3VI6A 3CPWF 2OTLF 2FC3A 1X52A 3V7QA 2BO1A 3CCSF 3PLAC 3G71F 3GYQA 1K73H 3VMFB 5EWRA
chains in the Genus database with same CATH superfamily
4O4LA 3VQBA 4YJ2B 5GAHP 2OAWA 3T1HK 4M7DA 4OMLA 1KAXA 3I8BA 4DV5K 3U0OA 5GAMe 1TYQA 4AG1C 3TEEA 1WHLA 1U3PA 1IO6A 2RQUA 1YJWA 3SQ0A 2FL7A 1FMKA 2YDLA 3P5JA 4PKHA 2LT4A 1VOMA 1NG2A 2DVJA 5H1SQ 2ZVZA 2FLOA 2B4JA 3EE9A 1RAIB 2A1RA 4NOYA 3F0GA 1BIBA 5CVIA 2W10A 4AHCA 3MQWA 1TH7A 3O8VA 4BDZA 3CCUT 2HQHA 2L5QA 4M75C 4E7IA 1N8RU 4M7AA 1BU6O 5L8RE 1RBTA 3CJBA 5LJ5d 3ID8A 3N4ZA 3ZO8A 3VRZA 1UAXA 2FBYA 1ZSGA 3E2UA 1VK0A 3FB9A 4FWMA 2KE9A 5CYMA 3ULEA 1IG9A 3CC2N 4ELUA 1IBLK 5C8YB 4X1YA 4O4IB 4RCBA 4RMOA 2DTUA 2K6DA 3VF4A 2ZF8A 5KYNA 4IUUA 2E5QA 1KJWA 3TQ7P 4N4GA 5C2FA 4KHWA 1ZSZB 2CSQA 3AA4A 1CLIA 1YJ9A 2Z1UA 1Z9ZA 3HWUA 2P0KA 2K5LA 1WSHA 3AVAA 1YWPA 4K8XA 2K57A 2NMUA 1HUXA 8AT1B 3CCQQ 2RHIA 3OBYA 5LJ3f 3KUFA 3TD4A 1BCOA 3ZT1A 4JJDA 2I6DA 1XQHA 4DV3K 4X9DA 5BR9A 1LWFA 2B8AA 1C0FA 1ZA1B 2R5MA 4M78D 3QICA 4H5RA 4IG3A 3P31A 5LY3A 4YOXA 1K8KB 4DMNA 1VQNT 1WN7A 2DIQA 1YXQA 2XDDA 4GNIA 4JK9A 2QW9A 3O85A 3BF1A 3UT5A 2MK5A 1KD1O 3C4SA 3CD6Q 1QTMA 4HVJA 3E20B 3THWB 4W5OA 4ZHRA 4ZHVA 2X4XA 3GOXA 5DM7L 4E3SA 1YVUA 5L23A 3QDFA 3M5RA 1IV4A 1C0MA 3CMEF 2Q1NA 3ZSQA 3I35A 4JLIA 3WNEA 4IUQA 4LNPA 4M8IA 4FU6A 2EGEA 2UYNA 3X24B 1ARKA 4FT4A 3D45A 2GBQA 1AEYA 3TD5A 3TI0A 3G6EN 3OYGA 4LCKA 4RW8A 1X3NA 3HBTA 3O80A 1VQ4Q 3KLGA 2DT4A 2CKKA 3NVKE 3I55Q 4C92G 3ZSRA 3WJPA 3M1FA 1D9DA 1QHAA 2H3GX 3MMVA 4EMGA 4C4WC 4FSSA 3ENHA 1OZ2A 5J26A 1SQKA 2A1SA 5KTQA 4BT3A 2MPXC 4LXCA 3GTZA 1NGIA 3QLHA 5G4VC 2GFAA 1KD1C 1W5EA 1IGQA 4BDYA 1VQOT 3OYKA 4ILHA 3K5NA 2GV9A 3QHSA 4JI0K 1LW2A 1VQ8N 1ZUKA 2E6LA 4M7XA 4C0DB 1RT1A 4GY5A 4KGVB 5FPNA 2BUDA 3LGFA 4OGEA 2D5RA 1HJOA 1Y7XA 3C0BA 4C8QD 5AZIB 5LJWA 3CC7N 1GBRA 2OTLQ 4CRIA 2NRXA 1OVQA 3EGUA 1WHKA 5HK0A 3ATVA 3DWLA 5EY4A 5AZJA 4DTNA 1UA0A 1NKCA 4KBMB 1ESVA 3JATB 1FXXA 4OMPA 2QDLA 2KSSA 4I50A 1KNJA 5GMKe 3JB9H 1TUYA 1TS9A 1GLCG 2O8EB 5I2SA 3BDPA 2HBPA 3PMTA 3H45C 3WJRA 1WSJA 3OS5A 4G4YA 3A8GB 4OP0A 3AAQA 2RJDA 1U8RA 2HBWA 2VWJA 4O4LB 3CCLN 3DDNA 2QEXT 1PCXA 1TK0A 4WYBA 1W2BS 1SRMA 4LD9K 1A5VA 3JCMP 1TYQB 2Z1GA 4BR2A 1QMCA 3MCAB 3R6OA 3MN6A 3N2GA 2JNGA 1KD1H 4ZHQA 4J9EA 1IPAA 3KK7A 4NXMK 3CQTA 5KYWA 3SFMA 2DNUA 2GTDA 4KHNA 2L26A 4K41A 1UB4A 1TGOA 5EO3A 4LDVA 3G0ZA 4B46A 3SWNC 3J81E 4C8EA 1BUPA 2KRNA 4M7AB 1P8ZA 3WJQA 2DPPB 2G8WA 4CGHA 1CLQA 3S6WA 4C92A 3K14A 4ZK7A 4NL3A 3ULEB 3IFRA 4CJTA 1NNEA 3EFSA 1R0AA 3CCVQ 3MX5A 3A8OB 1KQSF 1NE8A 5DLQE 2DERA 1XHZA 8ATCB 4DR2K 1PNJA 3LFOA 1QE1A 5IJ9A 3RSEA 3P4EA 3HTVA 1WZOA 3FJ5A 2IS3A 4CI6A 4CJSA 3QERA 2EFIA 2YNHA 3UA7A 5EU7A 4DCHA 2BTFA 2RHOA 5C6SA 1FKPA 3BE3A 3CYMA 2I2LA 3QNNA 4B1WB 3ZLJA 2VWFA 2PYLA 4J2EA 2ED1A 3F6MA 4X65K 2K3BA 4AFQC 5MN5A 1W6XA 1QS4A 3MBMA 2DXTA 3SPZA 3G4SA 2KT8A 1YF5L 5GAN7 5I11A 3QESA 1LCUA 2HHXA 3CCUN 4B8CA 3OW2S 4M77D 3RKXA 4RG8A 3IRXA 4A53A 2LBTA 3CJ9A 1VQ5F 3ULRB 3L6QA 2WOMA 3HZ6A 5HP1A 5GADP 2HQEA 1K8AO 4XCQA 4LSNA 3T9NA 3W3DA 3EORA 2M0OA 3CXCM 3IG1A 3VV0A 2V1RA 3V3TA 3S02A 4QW2A 2G6FX 2GNCA 1NJIU 1DKGD 3KJKA 5C12A 2DETA 4C8GA 1YI2F 4X9CA 3HRGA 3VESA 2PU9B 2P9NA 3CJAA 5FW9A 4AHVA 2DL8A 4DWIA 3VS2A 2DJQA 3WNHA 3I56T 4M7DE 3FZKA 2KAFA 3BY5A 4FXDA 2UYNB 3U9DA 3BW1A 3V4IA 4LUDA 2DKGA 3EFOA 4CGFA 3HK2A 2HHSA 2FO0A 1YJWT 4DR4K 4FVMA 3H1VX 2QTPA 1N34K 4BRMA 2HSPA 3M53A 3G71T 4JKCA 1VQKF 1D9FA 2LZ6B 2UUAK 3TSWA 1ZC6A 4BY9C 3PX4A 3VCZA 4M7AE 1VQNN 1QCNA 5FLXE 4A61A 1RACB 1FSZA 2QG9B 3HKBA 5C0MA 3CEYA 1CZBA 2DBMA 3RDVA 1OPLA 1K8AC 3FZLA 3CC4N 2G9IA 4JI1K 2JTEA 1LAWA 4N76A 1HPMA 2DYYA 4L59A 4IOAL 4V2SA 3CPWA 3VYTC 1G5VA 1X3MA 4DTUA 1OQKA 3GNFB 2HHUA 2ZD1A 3WNFA 4XU1A 4ISFA 3BY7A 1I5OB 3OYFA 2B6AA 3DB3A 1KG1A 4CFDA 5BRDA 3KWIA 4M78G 3QUIA 5FRMA 3KK1A 1N6QA 2BTUA 1W1FA 1CXUA 4F3OA 3B6OA 2X4WA 3ZT4A 4HTUA 4EZ6A 5BPLA 4PJOG 4B6MA 4BT6A 3OTOK 5KRTA 1X52A 2V52B 2YV0X 5FU7C 4RW6A 5B8FA 4X20A 1GRIA 2OTJA 1RT5A 4E89A 1XNIA 1SUQA 3JCMg 3C8LA 3M0QA 4KRFA 1IH7A 2JW4A 1G3YA 4V19S 2HZYA 3O08A 3CXCP 1Y07A 4PKCC 4OVLA 4J9DA 2ASOA 2YNFA 4MQ3A 5LJ5h 4I6MA 3CF5L 3RYFA 1YJNA 1J6ZA 1PD0A 3FRNA 4CF2A 4CFBA 3N2GB 4U39A 2CT3A 1K8AH 1W59A 5KE3A 4WQ4C 5J39A 3K0SA 4FOEA 5KYWB 3NPFA 1QVGA 2RO0A 2XICA 5E26A 1L3VA 4II1A 3O6WA 2F7TA 4M7DC 4IIMA 4AHRA 3NGZA 1UI9A 2KGWA 4OMQA 1VSMA 2KVQG 3S0YA 2AIFA 3V7EA 2D0NA 3V9XA 2QQRA 4C92B 1ATRA 4O4HB 5HP7A 4CFCA 3L2RA 1S22A 2LQKA 4GKJK 5LJ3e 3FIFA 1M90H 4HT9A 1WX6A 3GIBA 1BYMA 3O9SA 1X7OA 4O4JA 5IJ9B 5G4UC 2P84A 2D9TA 1G99A 3RSEB 1OYXA 4PUOA 4YJ3B 4M7AC 3OB9A 2E12A 1X2KA 3OHRA 1CN7A 1P92A 4H03B 3NH1A 4MZPA 2FSJA 5DCVA 4M3TA 3CMET 1LPLA 2RHXA 1S1VA 1NPRA 2QA4A 1YJ9Q 1TUBA 4XK8E 1U3OA 4M78A 1U47A 3H3NO 1JJ2S 3T7ZA 1GCQA 2WACA 3AVGA 3C7NA 1WNSA 4PJOA 1IXDA 3RNJA 2YLBA 3QTYA 1QP3A 1G3TA 1T6DA 2IVOA 4BC4A 3OYYA 5CE3A 1OFUA 1WAFA 3JCMf 2VAWA 1RT3A 2HNZA 2PUKB 1VQ6F 1KHCA 4N5SA 2K2VA 1OZ3A 2QWRA 1M3BA 2GGRA 4A5BA 3O4QA 3I7TA 4IOCL 2D6FA 3QHDA 2CZ0B 4JK8A 1D4XA 1EETA 4MDXA 1TL1A 4FWRA 4IO8A 1FNJA 4OMOA 5BN9A 2YCHA 1QKXA 3MN5A 3L2WA 1S9EA 1ZWZA 3INZA 2H3JA 2P9NB 5AQFA 2DXCA 1TAQA 4DR7K 4L5GA 2ASMA 3N5BB 5M1KA 4E7LA 3AARA 4BR0A 3OYNA 4I55B 3EFOB 1BIZA 4JUVA 2RI2A 4BWJA 1T6CA 3H41A 1QSYA 1JXMA 2HNDA 2QWQA 2WTUA 2WSCE 2NLUA 3UDCA 2NNWA 4H5WA 3HVRA 3HKBB 2FRYA 1GL5A 1K0XA 3VQ6A 4C92E 1NBEB 2CP7A 1SKRA 2FPFA 3QNOA 3JSMA 3M84A 1EQYA 3K5MA 2YX6A 3QB0A 4KH4A 1OULA 3CFPA 1VQ7A 4CHYA 4DQIA 3S0HA 4CGJA 2K2MA 3QBYA 1E4FT 4MDAA 2COWA 3WXMB 4DR6K 1X9JA 3CFOA 3ME9A 4LF6K 1YHQF 2OPPA 2W41A 2LQ8A 4BRCA 3I56N 1YCYA 3TTDA 3HFNA 4M77G 2CZ6B 4R55A 4TSXA 3WQTA 1B3QA 5M9OA 4QQGA 3H1QA 4DSIA 2HSEB 1RBSA 4RG2A 2EYXA 1NJYA 2O4IA 1M2OA 4FFBB 2K7AA 4C5HA 1S1UA 3LP0A 5J2TB 1E7KA 4X20B 3G71N 3ZEUA 1D3BA 4RTUA 3HKEA 3CXCF 2O8DA 4ZN3A 2QQSA 1TKTA 2G8FA 4BG9A 4BC2A 1D09B 4J2DA 3M8QA 1XC9A 5JH7A 1D0XA 4JRQA 4LFCK 4I6MB 2H8HA 1KK7A 1NGJA 3RYFB 4RCCA 2QGFB 2B86A 2IGIA 1SHFA 2RN2A 3RA6A 4CZEA 1ZUYA 4MZTA 4KO0A 4C1NI 1H7MA 3REBB 2QQAA 4BE0A 4HT8A 2NLXA 3NE6A 1LAVA 4IJNA 4J9IA 3VYHB 1GLAG 2G8UA 1RA4A 5CZ1A 1HYOA 3J80M 4M75F 1V4TA 1NEBA 2EYZA 1RT2A 2LTOA 4DB3A 4BY9D 1VQ9A 3RMCA 3MEWA 1W40A 3PMIA 4CJ5A 3CPQA 4PFZA 3J81M 2ZAUA 3MEGA 4JJNK 1VQ5T 4AF1A 1HNXK 4C0GA 4NS5A 5AQGA 5B8HA 3VQEA 5GANd 3KVGA 1YNZA 3AHUA 1Z25A 3TAGA 4LNUB 1YI2T 2HP0A 1K9AA 1ZHIA 4CEAA 4BW0B 3MXJA 3GPLA 1VSIA 5LJ5j 1LW0A 4Z4CA 1VRUA 1X6OA 1YIJN 2OZSA 2OPSA 4M3XA 4M77A 2YT6A 2JWLA 2LBWA 3ITHA 1I1JA 4CZMA 1TUBB 4HHTA 4M78B 1K0SA 5I9EB 2FVUA 4AMCA 2A36A 1Q95G 3MKDA 3C7NB 4CJ3A 1NG9A 2HBJA 4O5BA 2R751 4X1YB 2NRHA 1VQ8A 4BRPA 4TV9B 1BU1A 3MN7A 5AQTA 1RFQA 3P8BB 1VQKT 3ZX0A 4R56A 2PBDA 4LE9A 3AO4A 5CCAA 3V8JA 1AWOA 2YHBA 3OA9A 1U2VA 3KLEA 4WF2A 3P10A 2CZ1B 5KQDA 3M57A 5GAOm 3OYHA 3V8LA 2XK0A 4RTTA 2QASA 1NMNA 4LN2A 3LDTA 3R0PA 4EHUA 3MHXA 2JOYA 4BD3A 4PL7A 2QWMA 2NWMA 5EOYA 1TVRA 1XI1A 3NK6A 5A0GA 3I3FA 2F2VA 5AR0A 2JGUA 2RHZA 3WXLA 3CMEN 3CD6F 4CI0C 3OSVA 4O5VA 1BISA 4CC7A 2OYQA 1H92A 1F1BB 5D3GA 1RUWA 3R6NA 3FEOA 3JB9F 3M0SA 5GAGP 2ENMA 4DSFA 2E6ZA 4H8KA 4MFBA 1W57A 1NKBA 3EGXA 4E6RA 1SZ2A 2CW4A 1B9DA 4C8LA 1J9AA 4GMJB 4FM4B 4DLGA 4J2AA 3THXA 2KT1A 2RK2A 1M5Q1 2EX3A 3FLCO 3SAFA 3JASA 3LLRA 4O2AB 3NVIB 4EP4A 1M1GA 3OYMA 4O6JA 3VUZA 4F17A 2JM8A 1KIKA 1Q86R 1JLAA 3SQ4A 2VXEA 3I55F 5FLXM 1N9RA 1VQMA 5BPMA 1S72Q 1PHTA 1OAPA 5IHIA 3QG1A 4D8KA 1Y96B 2VG7A 3EG1A 3CCSA 3NTIA 3HPOA 4OVAA 4FLZA 1YCSB 1Q7YU 4JEPA 3U6FA 1OU8A 4UQGA 1YITQ 4DA4A 2DBKA 1VQ4A 4B3TK 4HVWA 2KY9A 2DYBA 2KBTA 1R77A 4QQ6A 3VQ8A 5CR2A 3HM9A 2OTLF 4M78E 1QQMA 4B1XB 4LDYA 1U40A 2RPNA 3P0ZA 3JXUA 3M4GA 3ZEUB 1D3BB 4BB7A 4YNQA 1TSFA 1SV5A 5D6YA 1O13A 4CZJA 2O8DB 4LC9B 3T80A 3DRRA 2GUPA 4CJUA 4BVRA 2YXYA 4FJLA 2Z1JA 1NU0A 1F21A 1VH8A 5GIOA 4J7IA 3SYZA 4FOIA 2JM9A 4J8OA 2EHGA 3UIQA 1L3TA 1ILYA 2F5KA 1WXUA 1I81A 2YNIA 3QUWA 2FZKB 3DRPA 3RYHA 1BKBA 1YJNQ 5C0YA 4PLLA 2WUSA 3NF7A 3JAWA 4XIUA 4KREA 4B3OA 2GEMA 4H0TB 1K1ZA 1KLMA 1ZXOA 4BC3A 1N6AA 4LF9K 1MHNA 5IH2A 4FCYA 3O9RA 1OX9A 1M3CA 1IV0A 3PTAA 1S1WA 1IKWA 4X3LA 1LNXA 1VQ6T 4IHJA 5AQRA 1TG0A 3OQ5A 1RGIA 3FBAA 4WQ5A 2P9KB 3SUNA 2PVDB 1WLPB 2J4RA 4EDUA 3CERA 2HBLA 4BE1A 3CCVF 1GO0A 2L3SA 5GAEP 3CCEN 5F2RA 1OH6A 3JCMe 3H3OB 4A5AA 3FZFA 4Z94A 2Z1IA 3NCIA 2HP0B 4GY2B 2FBVA 3QEPA 4J6WA 5LJ5f 1RAGB 4CBUA 1RAAB 1IV1A 4CIFA 1W2BA 4M77B 4GKKK 2NRWA 5KX5A 2CP6A 2PNIA 4E7SA 2QA4Q 4KUIA 1MNEA 3CC4A 3DLLA 3M3ZA 4CF9A 2AKLA 3NVKA 2P9LA 1K4US 3WPWA 4XTVA 3OS1A 3D2FA 3DLEA 3KLFA 4FJMA 3GHZA 5FPDA 4FYYB 4BVQA 4PWDA 3MN9A 4IG0A 2QDYB 1VQ5N 3HTNA 1W0HA 4M41A 3MCPA 2L89A 2A7YA 5DY9A 3TREA 4PJOC 3RWUA 3LALA 3VEXA 1M30A 4AHSA 1OPKA 4IIJA 4XQ3A 2QEXF 2DF6A 1CSKA 2H8CA 1PWTA 3AO3A 5CKFA 3B6PA 1YI2N 2VB6A 4A2AA 1VK3A 3HJFA 4D8DA 2LX7A 3SHWA 1YHQT 1W42A 1VSJA 1LVKA 2WSEE 2ZPFB 5AQWA 3BEXA 2GWJA 4IKFA 3JVHA 1RT6A 4BR9A 2YRCA 4G4XA 3MP6A 1K73R 3EGXB 2Q2RA 2LNHB 3D0PA 4Y1CA 4FJHA 3WGNA 4A4EA 2KGTA 2XRIA 2YKMA 1Q9YA 3PY8A 4PFOA 1U3LA 1J5EK 3AO5A 1K9MU 3THXB 1VQKN 2HRUA 2EGAA 1WXBA 1Y0MA 5GAMd 3OW2A 2Q0RA 3ZT0A 2A0FB 3L2ZA 1KVAA 4FWNA 1I5LA 4A59A 4IUTA 3IDHA 3TWHA 3B8AX 3LM9A 2PHNA 5LOVA 1K8AU 2JUFA 1M90R 1GLFO 3C6HA 3D01A 3F0EA 3JCMJ 5GIPA 3AVLA 2EJ9A 3M9QA 4GW6A 2PAVA 4CK2A 2VQEK 2VG6A 4QS7A 3FFIA 1XHOA 2UXDK 3RMDA 1VQ7Q 1N8RR 4F7UB 2EQMA 2RQTA 3BDLA 4KB1A 4RKUE 5KYXA 5AQJA 2M02A 3I8DA 1XMOK 3WPXA 3P83D 4M77E 3EO3A 1N9SA 1RILA 3R3LA 4B9NA 5JS1A 1QLYA 2QWOA 4DSLA 1WJSA 1ITGA 3HI0A 3VQQA 4AFSC 4BRIA 2CDTA 3M0PA 4PJLA 3DXMA 3VOVA 4NQ3A 4OB2B 4ATOA 4ORZA 3O9TA 2EPDA 4IFEA 3TU5A 5C42A 2MAMA 3KK2A 3NMUC 5GAPK 3LWLA 3PAFA 5FNVA 1GFDA 3WVDB 1TUGB 3LPTA 1BQMA 2W6LA 3MAQA 4Y92A 2DD5A 4W5TA 1GLEG 1SA0A 4DXDA 4FL9A 4O4GA 1GO1A 3A5MC 2BZYA 4JJBA 4HA8A 1W70A 4C5EA 2FXUA 4HWIA 1KRPA 3RYHB 3JAWB 3RIRA 3ID6A 4BVOA 4KTZA 2GQIA 4M7DF 4BGBA 5GANh 1QD9A 3CCQT 4CZGA 2ZOVA 2AZSA 4B9QA 3B6NA 1YJWF 1NK9A 3SJHA 4PHTX 3META 1VQ9Q 4WCEL 3HJWC 2DZ9A 4NUTA 4IHJB 3DMJA 5D6WA 4CZLA 2UU9K 5LP6A 5TKYA 4B1UB 1RTHA 2I6RA 2JS2A 5FU6C 1U43A 2PVGB 5J1EA 4M7AF 2E41A 4J83A 2J6OA 3OYDA 1QVFS 1RDDA 3K57A 3RMAA 2COZA 3PV8A 2HP3A 2Y4YA 3AVKA 2RHLA 2PY5A 2Q1YA 5HY4A 5HXZA 3CIPA 1AHJB 3CD6T 1GZ0A 1PRMC 4JD2A 3TR8A 2RQVA 2HMIA 1BG3A 2Y4XA 1EIFA 1JLFA 3UPUA 5J2UA 4DTSA 2HQXA 2MIOA 3SUPA 5KX5B 3VGKA 1JL1A 1RBVA 1YJ9F 2P9LB 1BL3A 3NF8A 2VYTA 4ZGDB 1JLQA 3D2FB 5AQZA 2F1LA 2YUPA 4B3MK 2CP2A 3LAMA 3CPWM 1X01A 3VERA 2A3ZA 5J2NA 4FO0A 1LV5A 1VQ8Q 1W41A 1GX1A 1VQ6N 5C2DA 4JRIA 4DF8A 1Y97A 4X64K 3VO8A 2DM1A 2YNGA 1X9MA 2YKNA 1VA7A 1KQSP 3EE8A 5AJ3K 2OZMA 2E1HA 1HYSA 4XEIA 3I55T 4N47A 2LQWA 4IIJB 1NJZA 4DQ2A 3EYZA 4A4GA 3LWIA 2E4LA 5JLFA 3VETA 3DLBA 3HT3A 2C0TA 1YGYA 1Q82U 3C65A 4CD3A 5JVHL 5EIBD 2P9IA 2XY8A 4ZGEB 4A54A 4KBOA 5ADXA 1M1KU 2YUNA 4OKJA 2FZCB 3EG3A 1AWWA 2HF4A 1NK6A 3A8MB 1I94K 1MGQA 1YWOA 3NGPA 5HXUA 3NAEA 2RPIA 4QVZA 2DPNA 2OTLT 4TUYB 1JJ2A 2NUZA 3RMSA 1EWRA 2A41A 4TVRA 3BZCA 1WUAA 3MWPA 2DIGA 1VYVA 3C9UA 4DBQA 3SUQA 5KRSA 5F1XA 4DSJA 1UDLA 3CCJA 3AGKA 5EXWA 1QVPA 1SS6A 1YVNA 3VQ5A 5KPRA 1QVGM 4FJ7A 2L3QA 4JZ3A 5KE2A 4M3ZA 1VSFA 1O9SA 3OS2A 4JS5A 5LOVB 4E1JA 2Z0WA 1XTDA 4CHNA 1XJWB 3S3NA 3CCMN 4JJCA 4A4KA 1VQMQ 2BANA 2F5TX 2FF3B 1R1MA 1BB9A 2CGJA 3HVTA 2X35A 4BY6B 3P39A 2ZJQL 3N4PA 1YHQN 1SRLA 4BR5A 2GF7A 3OYBA 3CCSQ 4PY5A 5CKEA 4M3RA 2A40A 2QK0A 1U48A 4Q0BA 1T0AA 5KYXB 3LDNA 4E19A 4DBRA 3UATA 3FR0A 2EKHA 1YIJA 2KW4A 1JO8A 3PLAC 3QETA 4QAGA 4F6RA 1QSLA 5CO7A 2CZWA 4YDUA 3DXMB 3RUXA 4JKFA 3VEZA 1XC3A 4KAZA 2XY7A 2WC9A 3V7SA 3CCVT 4CF0A 2XY6A 4BACA 3HKDA 2ROTA 5KYYA 5AQNA 4XTUA 3F5TA 1SA0B 3KXTA 2KDSA 1UGSB 2MOXA 1REVA 1VYTA 1JLGA 5BRHA 3CCRN 3JCMc 3JAME 2EAYA 4FM2A 3C6AA 4FM0A 2O9SA 3F0DA 1KC8U 4CCHA 3TAQA 4F2RA 1W581 5GIOC 4E47A 3MX2A 2MMPA 1X6GA 1DLOA 3QIOA 3TSZA 5LJ5e 3FGUA 3JYTA 3CMAA 3WGJA 4EI8A 1MNDA 4H0PA 4IFYA 3TAPA 3VYSC 3JRZA 2JXBA 5JQGA 3I5SA 1QVGP 3IR9A 3PNWC 5LP6B 3WEEA 4OB1B 1OU9A 2CUDA 1WSIA 3L0QA 4FWQA 4G1QA 5SWMA 3Q8HA 4UC4A 2LQNA 2ETJA 2RE2A 3EL2A 2LJ0A 4C92F 1JLCA 1MWMA 4AHTA 1BO5O 3LDOA 4JKEA 3J80E 1A0NB 2MWOA 3AY9A 3VS1A 3C9SA 4JD2B 4WQ5C 3SBGA 3VTIA 3V9ZA 1X43A 1VSEA 3LGLA 4LF8K 5J2UB 3LWVC 1ZBXA 1NK4A 2AK5A 2KZZA 5DLOA 1LJOA 3FC3A 1QW1A 2K3XA 5AQXA 1OV3A 4L6V5 2YWWA 2HS0A 2V9YA 2DL4A 2JS0A 1IHWA 3CC4Q 4BROA 4B9VA 5GANj 1V76A 1Z5WA 3P4IA 3JV3A 4O4HA 3DJCA 4B9XA 3ZSYA 1ZUUA 3FZMA 5BREA 3JARA 1LOJA 2AA4A 3LX7A 3QFPA 1Q86O 2JLEA 2HB5A 4JRKA 1X2QA 3G4SF 1RADB 4UY8O 1BK2A 1TKXA 1XV2A 4YJ3A 2P1JA 3ISNC 4BRGA 1M9SA 5AFUH 2GVIA 3X25B 2L0AA 1JCFA 3JS6A 4FLWA 1C1CA 4DBFA 2Q0UA 2V51B 3L4IA 4FWKA 3J80O 2F8TA 2FSKA 3ZSVA 4CJKA 3TCJA 3CD6N 1KLNA 1WHMA 2F2XA 2O31A 5GAMh 3EGDB 1CZ9A 2GELA 2P9IB 2VCPA 3GL1A 5FPMA 3A1PA 1WAJA 3J81O 4QQDA 2XDBA 1ZSZC 3M5AA 4B3RK 1ZQ1A 1WHJA 3H6ZA 3VS7A 3M54A 1PG5B 1ZLMA 2P4TA 3VS6A 1YN8A 2DL5A 4ZGJB 1UUEA 4PL8A 4G4WA 2X6SA 5AYFA 1JXEA 2ECZA 4RW9A 3M8RA 2O88A 2KFNA 1JY8A 1C1AA 1VQLA 2AZVA 1T0JA 2FG0A 4NL2A 4BI4A 1Q86C 1GCPA 3IUCA 1HR0K 4MLHA 3I55N 3K59A 1VHAA 2KMTA 2RHJA 4ILGB 4ILJA 1SG5A 2B33A 2ZODA 3C95A 1H8KA 2F4VK 2HVHA 1AWJA 2HKQB 4M75D 1DTQA 3TTCA 4FZYA 4ELVA 3OONA 2ZZDA 2MF2A 2E6MA 3A8LB 3WT0A 4M63C 1J7HA 1B07A 1MV3A 3CCEA 1FMWA 4CC2A 3BF3A 1RQ2A 4I55A 1WPYA 1RTJA 3VOBA 4B45A 4YHHK 2HVYD 5LJ3d 3CPWF 4FLUA 5AT1B 2NRVA 1PF5A 5HY2A 1T0HA 5I2MA 4BY6C 1JXBA 2WFBA 1RDCA 2OCEA 2ZM6K 4CK1A 2OTLN 1D5AA 1HPZA 4KHQA 4FWPA 3JASB 5EWRA 4KV8A 1TOVA 3ZETA 2ZJPL 4DKWA 3ZEHA 3SIVA 2DTOA 4KPYA 2DJZA 3LW5E 2ZPBB 3RKWA 1S72A 2E2QA 4FWLA 2CGLA 1BI0A 5GAOn 3P1GA 2E8AA 3HKDB 2E10A 3M8PA 4BRKA 3SI6A 5KYYB 1Q86H 3VPZA 4LDWA 2E2OA 2ZPGB 3REAB 4DSKA 5LXTA 4RWTA 2OTJF 3NMZC 5EZYB 5MN6A 4CHZA 2KTVA 3ZFJA 1VQPA 1C1BA 2X6NA 1YITA 3DI6A 4JK7A 4KKOA 1IV3A 2D0QB 4E6EA 2F2WA 1OEBA 3RR8A 3KD1E 2CP3A 1RBRA 2KTQA 3AVJA 1YJ9T 5FDLA 5KH6A 2DE0X 1YJNF 4PL6A 2NUBA 1KVCA 4FFBA 2H6LA 4C0DC 4I7FA 4DTMA 4GV3A 5J2TA 3T19A 1DBFA 4QT7A 5AVMA 1QVGF 3NF9A 3ZT3A 5JQGB 4JKGA 5FLXO 2NRTA 4CJPA 1YBYA 3WEEB 5ITZA 5LYJA 5CKHA 3MCQA 3CCVN 3J7ZO 4CHOA 4A4HA 5J3BA 2ZF5O 5M1PA 2XHBA 4DV1K 4NCBA 2M1HA 3EG2A 2Z1HA 1VQON 3JB9D 3ZSOA 1WBDA 1S6PA 3MEUA 4C23A 3FLGA 1IO2A 3SV3A 3KBGA 1U6ZA 1K73O 3E66A 5JLHA 5KPZA 2E6NA 2BDPA 2VG5A 1I0CA 3U3YA 1N32K 3NK7A 2DX1A 2HNIA 3NFCA 2IDOA 3Q7CA 4DFJA 3AA3A 5GANf 3CJCA 1GFCA 4QS8A 5AQLA 3SAGA 3GP8A 4EAHD 1SDSA 1NOZA 3CJ7A 2QA4F 4C8OA 1HD3A 1KVBA 4M78F 1WJRA 3QEVA 1T8EA 3H0FA 3JARB 1WNLA 4DU3A 5IHKA 4PJOF 3NGIA 3V7CA 1M90O 3OA6A 1E3MA 1SF9A 4CERA 3RE3A 4PJJA 5KMGA 4LNUA 2LMJA 5KGWA 1QCOA 2JMAA 4K11A 2W40A 1HJDA 2QEXN 1PD1A 1OOTA 1RAFB 4C8QG 4OO1J 3HKCA 2KI7A 1N8RO 4L3QA 4F2SA 2E88A 1BQNA 3MECA 4M3UA 3V8KA 2Q3SA 4E1MA 5EYPA 2CH6A 2CGHA 4KFBA 1XBIA 3VQAA 2QTXA 1RQ7A 4RTYA 4NLCA 4X62K 4OLAA 1FKOA 1LWCA 3ZX2A 2VV5A 1K73C 1T7PA 1BWFO 3AGRA 2CHTA 4TV9A 4WCIA 4BVSA 4BVPA 2IVWA 2XO7A 1BDGA 4F3TA 3ENOA 4A4FA 4DFPA 3HHTB 3CCJQ 5AQMA 4PKIA 1Q81U 3RBBB 4FJXA 1M90C 1YAGA 3VJPA 4KUDK 2IVNA 4CJQA 3KD5E 3JAKA 2VASA 2EVRA 4FZXC 2O8BA 4BRQA 5JVDA 4BRNA 1N8RC 4Q5VA 4B62A 4HNAA 2X51A 2K3YA 2GBZA 5KI6A 3S06A 2V1QA 1VQ7F 1FK9A 2ZQBA 1BI4B 1HKBA 3HM8A 2BO1A 3HRUA 2YJFA 1WOQA 4PLIA 1XMQK 5GONA 1K73H 1QCFA 1YIJQ 1W2BM 4FW1A 3L2QA 3ZETB 4O2AA 3RR6A 2IPOB 3BZKA 4GVMA 5HLFA 1W5AA 1IKYA 2K79A 4C8QA 5ADXH 3R6MA 1SL1A 2OA8A 1X25A 3CC2A 2XD0A 1R8OB 3TSQA 2QI2A 1XWLA 2ZWHA 3HTRA 5GINA 3EEQA 4KHPK 1Y96A 2A5XA 4IOXA 4CGGA 5LXTB 1WJQA 3FDRA 4MDWA 4WF9L 4YDUC 3EFRA 3NH0A 4J2BA 4RTWA 2EBPA 5IT9E 2O8FA 2YXZA 3ZCMA 3N4YA 1MDUB 3VA3A 2CUBA 1WA7A 2PUOB 5CB4A 2KLAA 1N8RH 3LDSA 2PZ1A 5TKWA 3JAMM 3VQDA 3WUHA 4KHSA 4CIEA 1YJWN 1NGFA 1QQCA 2E20A 2E3HA 5CIUA 4O5FA 4DR3K 1NJWA 4BDPA 2IG8A 3OYCA 4M3WA 1BIUA 5GAN5 1XHXA 1UGRB 3QFUA 2MI6A 1NK8A 4TV8A 2YHYA 1M2VA 3CMAQ 4XU0A 4N4IA 5GAN4 3G4ST 4JKGB 4EB6A 1QWFA 4BI8B 5ITZB 1VQ9F 5LYJB 1Z05A 2RN8A 2HMPA 4BRLA 3UWNA 3HOTA 1M4ZA 3R9PA 2LVMA 1NGDA 4FPAA 3N2KA 1NMDA 3NDKA 3RYCA 1NEGA 2P6YA 2YJEA 5C10A 1ASUA 3G7ZA 3CPFA 1NPPA 3O1BA 2D0OA 4CEDA 2R58A 3C94A 2OJ2A 3G10A 1WBBA 4B9MA 2RH2A 1V4SA 3M55A 3UA6A 3OW2M 5BR8K 1EWQA 4N0AA 4TV8B 3AAPA 4MO4A 1JN1A 3C6UA 3CBPA 1GLJO 1FJGK 2COYA 2HKNA 4XAXB 3CCMA 2QTDA 5DMRA 3PIPL 2DK3A 4DV2K 1OH5A 4I9QA 3PX6A 1KQ2A 2BGGA 4M77F 1W55A 2RHUA 1U04A 2V8KA 5GAN3 3CI5A 4IIOA 4OB3B 1W2BP 5BMVA 2BZ8A 2P9KA 3IKMA 1X27A 3GF5A 3BUZB 4AHUA 3SMSA 4L8RB 3G6EA 1M27C 2DEQA 1VQ8F 5KMGB 2XHCA 2GFUA 4HCKA 5IAYA 4JZ4A 4CJLA 4HUGA 2G8HA 2RNAA 4C92C 1U45A 2CSLA 2P9SA 4DQ8A 2RI5A 4J6YA 1Y57A 1J54A 1NM1A 4OX9K 1QVFA 1Q7YR 3HKCB 4U3JA 1SHGA 2P0PA 1S72T 2CGKA 5AQIA 3CQXA 5J2PA 5DK5A 4R5PA 3V9SA 4XTYA 5EYPB 2X3XD 4PJMA 4F7UG 2D0BA 5HCKA 2DXBA 3RRHA 2UYKA 3NHGA 3CCQF 5HOOA 4BT4A 4KHUA 3VF6A 2KRSA 2KHOA 2WONA 3SPYA 2CHSA 1YITT 2VXYA 2IAJA 3CCRA 5EC7A 3CC7A 3CM6A 3OJUA 2M9UA 4IBNA 4B9SA 4MMLA 3KLHA 5FWCA 2RF2A 4IO9L 3HP9A 5DM6L 4EZ9A 3C12A 1UEBA 1KQSS 1FX7A 2P9PA 3E1YA 1VQLQ 3DOKA 5LJ3h 1R0BG 2QXLA 1BGXT 4CBXA 1FWZA 4FJNA 2R57A 2OTJT 3JAKB 3S03A 5BPNA 1A5XA 5BRFA 4M7DD 3LMEA 5KQ8A 2O8BB 5JVDB 3VU3C 3OW2P 3CCLA 4OPJA 3J7AR 1W3EX 4HNAB 3X20B 4G4VA 3ULDA 2ROLA 2O4GA 1VQMF 1YJNT 4ELYC 4K8ZA 4JKHA 3A8HB 3CCEQ 2HEQA 2RJFA 4JI8K 4BT7A 1KAZA 3MEDA 3CCSF 3IS9A 3PSIA 1U49A 3J7YP 3IMPA 4M7AD 2BH1A 4O0JA 5GONB 4XU3A 1NJIO 4FJGA 4HCZA 3I0RA 4C8NA 3JCMd 3CETA 1NLPC 2YLCA 3KIOA 1VQ4F 4B3SK 4C8QB 3HPHA 1N33K 1KD1U 3TARA 4YFUA 3X28B 5JMVA 4ELTA 1N27A 2RHKA 1VSKA 2YRVA 1RAHB 4P5NA 2F9WA 3H46O 4F7UA 1HMVA 1SZQA 3AO2A 5LJ5g 2K9GA 4IZ9A 2O8FB 5GANK 1VQPQ 2OHWA 5CB4B 4CJWA 1W97L 3A5NC 2CT4A 3A5ZB 3QIIA 1EKEA 2JNBA 2QA4T 1LOTB 4EI9A 3KHNA 1YI2Q 2V26A 4FYXB 3CPEA 2ZGZA 2ITMA 1FMVA 5CYQA 1RABB 3PT9A 4R40B 1M2VB 2O4XA 4BRDA 3KK3A 3SUOA 3VS5A 3CYQA 3SZ2A 4EB6B 1NJIC 2NUTB 3CCUA 1JXOA 5GANe 4N4HA 4IUPA 2I7PA 1VQOF 3M0TA 2V7YA 1JJ2M 3N2KB 1AOJA 3H6EA 3RYCB 1R59O 3ZT2A 3P38A 2ATQA 3EHRA 1GOBA 1KFZA 5FNVB 5GJVB 5AQQA 2GQVA 5IN1A 4R0KA 1AD5A 4B9TA 2GUIA 3QEWA 2HW3A 2J05A 4Z4IA 3O4NA 4KH5A 1U1SA 3MEVA 4K43A 4LY7A 3ZSXA 1K9MR 1ZYQA 1WSGA 2UXCK 4GLKA 3LDLA 2DVEA 4O44A 4DU4A 2LP5A 1W2BF 1IBKK 2RI3A 5CHIA 1XUPO 1MWKA 1RI9A 4WFNL 2FRWA 5BMVB 3CC4F 1M1FA 4C1NK 2ZPIB 1J5OA 3ER0A 4Y28E 2NYSA 3UKRA 3WGLA 3G4SN 4CC3A 4F9OA 1WHGA 4C8MA 4FYDA 3I33A 2E5KA 2K5IA 3MWTA 3V1QA 2LDMA 1NJIH 3H08A 2KEAA 5GJWB 4QVCA 1EFNA 2HNYA 2CVLA 1OH8A 1NMUB 2P9SB 1WXTA 4DLEA 1RLGA 3VEVA 1VQNA 1S6QA 5AQPA 3LWHA 1ZBSA 4C8QE 4U3JB 1YTUA 4AT1B 1H48A 4LD6A 2H8EA 1G3WA 5A2QE 5CKDA 1HNWK 2KNBB 2OAUA 2F96A 1MU2A 1MMNA 1VQ7T 1RCHA 3VGMA 2DL3A 4E1NA 4A57A 1JFFA 4XTXA 2X78A 1W4SA 4F8RA 2O8CA 1UGVA 2XDPA 5HRNA 4N56A 4M78C 2QKBA 3SWNA 2R7YA 3ZL7C 1GCQC 4CEQA 1VAZA 1NK5A 1T0KB 2FBXA 4H4OA 4LFBK 4ZI7A 2C0IA 4IEIA 4CEBA 1LCKA 4ZN1A 4LUEA 2P9PB 3VENA 2LBXA 2NUPA 1BI3A 2YHTA 2YHXA 1D1AA 4DEXA 1S1TA 3BYQA 3T69A 3QBXA 4EP5A 1IV2A 3OW2F 4CFAA 3SBTA 5IYZA 3RYIB 3LZIA 2HHTA 2HBKA 3LWRC 1QQOA 2N48A 4BR7A 1NGHA 1Z5VA 2KYMA 4Z02A 3C9TA 1VQOA 3Q1JA 4IXCA 1TXQA 3A5OC 3UKUA 3K2XA 2DILA 4CGDA 3LYBA 3QMLA 5GAOr 4K25A 1X6BA 4KH0B 2CH5A 1EXQA 3VQPA 1VQ9T 4B08A 4DS4A 1YFNA 4DQRA 4J8FA 1QZ6A 1T3VA 1XNQK 4CBWA 4PQUA 4CHPA 2E64A 3M8SA 4J9BA 1RAEB 3SB2A 3QZ9B 1JBMA 2OTJN 1TUDA 3CC2Q 1HKCA 2ESWA 2HOEA 4MLEA 2VUBA 4EI7A 3LDPA 2HL5C 2D1KA 1GLBG 4XH1A 4LF7K 3TD3A 5IT9M 1C6VX 3EKUA 1YJNN 1BI1A 1RBUA 2JTFA 3QBWA 5F0XA 3KZBA 4JYAK 2HS4A 5GINC 1D0ZA 2NRRA 4Q5WA 2XI9A 1L3SA 3ENBA 1SL2A 2E3IA 1RDBA 2FPEA 1Q8IA 1FW6A 2RM4A 3HOSA 5C25A 2ALEA 3ZSZA 5HY6A 2O4XB 1BI2A 2P51A 5M1QA 1D1BA 3E9LA 1VQ8T 4NYNA 4C0FA 1CK2A 2FF6A 3D6RA 3DRSA 1KNKA 2VGMA 4M42A 1Q82R 1E6HA 4XTWA 1RDUA 3TABA 4K0KK 2ZGWA 2GCXA 3DKMA 5KYUA 2ZPHB 3OYJA 2FBTA 3VEWA 4IEEA 4W5QA 2HS3A 3VYGA 2LSNA 2GX9A 3DM2A 1UGQB 4BRFA 4BVTA 1A5WA 4E0DA 1UWBA 5I3UA 1RLPC 2D8HA 4OMFB 4CJ4A 2MYSA 2EWSA 3VTHA 4G4ZA 1ABOA 4WFBL 4OF1A 2X74A 2QA4N 3CCMQ 3C6TA 4NO7A 3WXJA 4HXJA 3LZJA 2FYKA 2IIRA 2L3RA 1UJYA 4DR1K 5SZTA 4N0AC 4DF4A 2Y90A 3O4WA 4DRXB 2DZCA 3UKRB 2O2OA 2QGGA 1WSEA 1KXPA 2KFZA 4KRTA 1JU5C 1NGGA 3FFMA 5EG2A 3CXCS 4OB0B 3M4YA 2WBNA 3QIPA 4JI2K 2R6R1 3G6EQ 1WQWA 1FFXA 2DO3A 2P9UA 3F9KA 3JCMX 2Q97A 2VGNA 1BA0A 3QO9A 3K2PA 1WIEA 4DQSA 2KQWA 1VQMT 2HSTA 3AVBA 4XH4A 3QEIA 2MQEA 3QXEB 4JLHA 3SNNA 3EG0A 4PNOA 4CF8A 4AM6A 2FHDA 1TKZA 3MEEA 1ONIA 3IQLA 4F7UE 2PTKA 3CCST 4WQ4A 1JFFB 3CQ8A 2O8CB 2LNVA 4M77C 3E9FA 3BDUA 3I56A 3NVMA 5JCOA 3OMGA 4I4TA 1V29B 2OI3A 3CBMA 3SWNB 3CCRQ 1VQ4T 4IURA 3CC7Q 2RK1A 1NLVA 1CKBA 2HVIA 4BUGA 5GMKl 3AVIA 3VEYA 4ZI7B 1M90U 1JJ2F 2LX9A 4E7JA 1UJ0A 4JAXA 5FWBA 1B92A 2NUPB 1YUWA 1N5ZA 3JALA 2P4RA 3G71A 1EO1A 2DY4A 3CCJF 1QHTA 3BGRA 1KC8R 3EGDA 2LCSA 3JCMh 1B34B 1U06A 4C0ZA 5IYZB 1BOTO 4J5YA 4DTXA 3PGGA 3ZOPA 3H0HA 3FE1A 1UHCA 2RB9A 1RI0A 3CCLQ 3NBPA 4Z4GA 1VQ7N 5E41A 1JD1A 1UOCA 1ZBFA 1WFWA 3R8EA 2H3EB 3UKUB 1BA1A 3S3OA 7AT1B 3VOAA 3U3GA 4FJ5A 5AQHA 1FYNA 2DA9A 2AKKA 1X9WA 2RHYA 1TUUA 3V1RA 4JI6K 1UTIA 4CGIA 3TVTA 4C8KA 4ZHYB 2G8IA 2WSFE 1YIJF 2A28A 4WE1A 3UF4A 1NK0A 4MZMA 3JCMV 1KTQA 3LYIA 4ME7A 1OVYA 3U8XA 1WB9A 4KT0E 2RF0A 4FZZA 1ODEA 3IEWA 1SKWA 2DTHA 2RHHA 1XRGA 1W7AA 4C82A 1ATSA 3LP3A 1D0YA 2ZCFB 4DUZK 4KH6A 2ITGA 2NRZA 2QKKA 1H3ZA 1T03A 5M1OA 3RESA 1YQNA 2VXFA 3HSBA 4HCCA 3CPWP 4PJOD 2EQJA 4JRPA 4FLVA 2DEUA 4NWOB 1G15A 2F69A 4E2FB 3P8DA 4JN4A 2HQSC 1BBZA 3CC4T 4BE2A 4NCAA 3LM2A 4IDKA 2CWJA 4QKUA 4EFHA 3L3VA 2C0OA 3JCMM 4K42A 4WFAL 1VQ9N 2LJ3A 3L42A 4FIBA 4FSXA 1W9HA 3CMAF 4CECA 3TANA 1Q7YO 3CCUQ 2W42A 2VWBA 2QM1A 4BWMA 4CESA 3EZ5A 4LDUA 5EZYA 2CS7A 3GG4A 2D8JA 1NGAA 5KYUB 4I2PA 3V9WA 1M8MA 3LWOC 1G3SA 1T3SA 4KTQA 2HHWA 4BI3A 4C5GA 4TZZA 2OX7A 3VN5A 3S9HA 2UYPA 3VIUA 2JTMA 4DV6K 5HRPA 2LJ1A 3E9PA 4FJIA 2QXFA 2RKIA 5E84A 1SEMA 1ATNA 3CMEA 3N4QA 4CJ7A 3PIOA 1ZBJA 4E7KA 2J7IA 5JICA 2BTTA 5T7BA 5CA0B 5MN4A 4JHDA 1RLQC 1HQEA 1TTHB 1KFSA 4RTXA 3AVMA 4DV4K 4U67L 3TAFA 3KJVA 1PKSA 3JSCA 1NJIR 4BGAA 4XTZA 2KG4A 3V4DA 2HBMA 2I7NA 3EN9A 1N36K 2EKOA 4OGCA 1M8VA 4DV7K 3RRGA 2AMTA 2Z1EA 4M3YA 5FU7B 1FFXB 2P9UB 4KH1B 1VSDA 2CREA 2X4JA 1DGKN 4CZKA 1Q7YC 4WBNA 5DM7R 1WYXA 2KKZA 2EGCA 4OMMA 3RA5A 1NWKA 3SCXA 3JAMO 4Z4EA 1VQNQ 1NGCA 4FLYA 2BIVA 3GOIA 1E7OA 4KGZB 3L4QA 6AT1B 3JB9J 1TVKA 1RDWX 3D2EA 4AQYK 3HFOA 3QWXX 4FLTA 4B5CA 5A2QM 2KK4A 1JLBA 2IOCA 3CCQN 4F4KA 2X3WD 4JLGA 3LL3A 2AIZP 1MA9B 2PVOB 2EJGA 2RD1A 2F9TA 4DHYA 3LWPC 4I4TB 3QINA 4M7DB 2D0PA 3KFVA 2DXUA 3ZSWA 3KHYA 3C9RA 3QSUA 1Y71A 4AH9A 2R5AA 1X7PA 1HKGA 3D7EO 2FZGB 4ZOLA 2QQBA 2V8JA 3JALB 2XKOC 1VQLF 4CC4B 1QQJA 2KXDA 1Q7YH 3ESJA 3QJYA 4BREA 1VQMN 2PQWA 3AVCA 1G83A 4GLMA 4IUVA 3VQ4A 5CKBA 3OYIA 5K14A 2IAFA 2NZTA 3L7QA 2BZXA 3CCSN 2YUQA 1HNIA 3VMFB 4CZFA 3DYAA 1SPKA 1TK5A 1VQOQ 2KRMA 4DU1A 3WNGA 4B8AB 3CCEF 1QZ5A 2B5JA 1EP4A 2A08A 1RTIA 3SQ2A 2LC4A 1VQ4N 4DTOA 5CA1A 2EWCA 4Z8AA 1IJJA 2UYTA 4Y1DA 3CFRA 4AFUC 2SRCA 4X3MA 1PXWA 2J6FA 4XU2A 2DFUA 2D0CA 4GVEA 4KGXB 1I8FA 4EIAA 3UT1A 2QYZA 2RQRA 1KQSA 4C5IA 5GMKm 5LJVA 1N5YA 3K12A 2DMOA 5A0LA 1RT4A 5HRRA 3AT1B 4RCHA 2KQ2A 4X1IA 1S72F 1K9MO 4MO5A 4LF5K 3DLGA 5GIPC 4FVUA 3MP1A 2HHVA 2QEXQ 1BI4A 2DLPA 1U4BA 3AA5X 4GBQA 5CZ2A 3RTVA 1WI7A 3NTHA 4HKEA 1VQPF 1QVFM 1YITF 4FJKA 5GANg 4F04B 3KWGA 3UT5B 3DLMA 4OJRA 3RVCA 4DUYK 2FPDA 3O9UA 1TUCA 1X69A 4ERHA 1HK9A 4LD0A 3J8AA 3GLXA 1SSFA 3T3FA 2UUBK 3MEAA 4KI4A 1VSHA 2I5JA 2P5OA 1AWXA 3DXKA 3DLRA 4OPKA 1VQ5A 5M1FA 5CY4A 2GWKA 1MMDA 1LWEA 1UG1A 1VYUA 4FWOA 4HVUA 4OPHA 1WHHA 2CP0A 3TSPA 4DQPA 1YI2A 3JCMb 1AZEA 4JI4K 2ZVYA 5EB1B 3V9UA 4JS4A 1K9MC 1KAYA 1S9GA 3GDQA 4DFMA 4W5RA 1VQVA 3ON1A 4YOTA 1JB0E 1IRXA 3OBWA 3VYUC 1JEGA 4B1VA 1BCMA 2JVVA 2JJ9A 4H5VA 1XNRK 2FGYA 4KHYA 1Q81R 5GAN2 2C06A 4CJFA 1C6VA 1NM7A 3EG9A 4JHDB 4NB4A 4DV0K 2LCAA 1UA1A 4JI3K 3H0IA 3OYLA 3TTFA 4XH5A 3SQ1A 4OKEA 2FEIA 3HPWA 3MJXA 3HXMA 3SLCA 2GLZA 2Q31A 1NZ9A 4BC5A 4PWTA 1K76A 3E9OA 4X66K 3I9QA 2O9VA 3CCJT 3MXMA 4ESRA 1VQKA 3ATUA 5LP6C 4WBNB 5AZJB 3F2KA 1UFFA 5CQYA 2HL3A 4JI5K 2DD4A 4EMHA 1QSSA 2BE9B 2XU8A 5EVZA 2E1ZA 2QK9A 4I50B 1HQUA 3S41A 4U7BA 1TVKB 2HMAA 1B9FA 3D2EB 1HRHA 1WDXA 3FFKB 1SAZA 3SJJA 1QVFP 2QWNA 5AQKA 1Z9QA 1ASVA 1K9MH 3T1AA 1MMAA 3M56A 4OMNA 5GMKh 1VHXA 3I56Q 1NJXA 3KKRA 3RR7A 3ZBDA 2XG8D 3QYGB 1YIJT 1DEJA 5JVGL 4EMKA 3GBTA 4ZHWA 2FB7A 2MCNA 3LANA 4W5NA 3AA2A 3UB5A 4RHAA 4ZHQB 3QPHA 1AVZC 4ID1A 5M1NA 3O3FA 1YJWQ 2DFHA 2HDAA 2PFUA 3GBQA 4JI7K 3THVA 4FJJA 4B9LA 3A5LC 4ZOLB 5C24A 5JCOC 3HRTA 3T1YK 4H4MA 3G71Q 4HCBA 4NCGA 4QS9A 3URGA 3MXIA 5GAOl 3VI6A 4J9GA 4I9LA 5HL7L 3NFAA 5LMNK 2EQUA 3GYQA 1HNVA 1IHVA 3VA0A 2IG0A 1PM3A 2DRMA 4LF4K 1ZBUA 2M0YA 2GTJA 4B9WA 3ERNA 3OY9A 3E1SA 3RKYA 2QWPA 3GE1A 3UE5A 2M51A 5AQSA 3WQUA 4YOWA 4LDXA 4OLBA 1Q82O 2QTVA 5CA1B 3CMAT 1WGSA 3NGYA 3VUBA 3L2VA 1ZBHA 3QWYA 3HL8A 3P8HA 1DTTA 2J06A 1IKVA 4FSVA 2OPRA 4PKGA 1M1KO 3EHQA 3EH1A 2A6AA 2VQFK 4EPCA 3DLKA 3SDZA 5IJ0A 2CYZB 1TU0B 4J9HA 2AJQA 1U5SA 4X1IB 2EYWA 4C8QF 3PO4A 4FWSA 1ZBIA 4A2BA 3AV9A 4CJRA 1VIEA 4HUEA 2BKDN 1NKEA 3CC2F 4Y0WA 5CR4A 5GAMj 4ID5A 3LH0A 3M6GA 3CG7A 4DOWA 1RNHA 2E2PA 1QKWA 2LRQA 2YSQA 2AHJB 4HVVA 3RMBA 2QAZA 2ZAEA 4B1YB 3L8BA 3DAWA 4M4ZA 4FJ8A 4ANJA 4EIKA 3CQYA 3O5BA 2KYBA 3A8YA 1SL0A 4M45A 2VAMA 3SEMA 1JRIA 4CEEA 4VUBA 1NGEA 4Z88A 3SAHA 3IAYA 1Q8RA 2JT4A 1PSEA 4C8IA 1Q82C 3K9JA 4KB0A 1W5FA 2E65A 3DXKB 5D7UA 1VQ6A 2PYJA 2UYJA 3PVLA 1I39A 2DYIA 3G1JA 2FSNA 4KWEA 1M1KC 2LT1A 5KCHA 3FD5A 3IEQA 3S3MA 5FRNA 4H0YB 4JNEA 4PJNA 4YOYA 1H641 4DR5K 3VQ7A 3QZ5B 4DG1A 2JMCA 3O3GA 2P5GA 2BE7D 3VS0A 2YHWA 1ZX6A 3EH2A 1C0GA 1BIAA 1B7TA 1E6GA 1O75A 3U23A 3PO5A 4CEOA 3CMEQ 1OH7A 3EG9B 3PFSA 5I22A 3K5OA 4JKBA 2NUTA 1QP2A 3NF6A 3CCMF 4H0XB 3PVQA 1BHLA 1KSWA 2J6KA 3LH5A 2AT1B 4M75G 4B9UA 5J2QA 5CQXA 1HLUA 1KCFA 4RW4A 4F6RB 1KC8O 3WXIA 2HF3A 5CAIA 5BN8A 4CK3A 2HCKA 4BQZA 2KZMA 3CHWA 2IIMA 1Q82H 4H0VB 5IWAK 1VQLT 4F14A 5IXBA 3OJSA 3NMUA 2GTOA 3M58A 5IT9O 3G6EF 1IZ6A 4RQOA 2HAXA 3CB2A 1M1KH 3THYA 1KFDA 3E22A 1RDAA 3E9GA 5HK3A 2A42A 3MK6A 1YJ9N 3DLLL 3M4SA 3VS4A 4CEFA 1QVFF 1VSLA 4HTLA 5GAMg 3TU4K 3AVHA 1X75C 2KXCA 5C15A 5HBMA 2IC3A 1YHQA 4FYVB 3VTIC 2EQKA 3CCET 1TAUA 1ACMB 2BUPA 3H8ZA 5ELZA 2EYYA 4RUGA 4PK4A 1KD1R 3HP6A 4H5NA 3K5LA 3O1WA 2Z1TA 4EMKB 3K58A 5AQOA 3QEXA 3CCRF 1X9SA 3CC7F 2VKNA 1IKXA 1YP5A 3DOLA 4KULA 4BQLA 3LP1A 3CCJN 3M0RA 1IG8A 1NOYA 2W6KA 3LP2A 4E7ZA 3CXCA 1KC8C 4RW7A 4DSEA 2V8IA 1KHIA 2DL7A 3I5RA 4B1ZA 4X34A 2A37A 5FROA 4DTPA 5HROA 3J7AP 2CH4A 1GOCA 3KJJA 1ZA2B 3JCMW 4M7YA 2VAPA 3BP8A 2CSIA 3KLIA 1QQNA 4NYFA 3V7QA 1O1WA 4GV6A 2OANA 1RTDA 1VQPT 4MMKA 1I07A 5CK9A 2PMPA 3GNGA 2ZJRL 4IJAA 4O4JB 3CCLF 1HYVA 2UUCK 3MP8A 4Y91A 3EY1A 4N41A 2OZBA 2YRDA 4AM7A 1Z6RA 4Z0UA 1NK7A 4M75A 2E2NA 1WQ7A 5LA6A 1S1NA 1T3LA 3CM5A 3D7SB 3WGMA 2D1XA 4FYWB 3JB9G 2AIRB 3VF2A 1GLDG 4QOZB 5GMKj 2Z01A 1L5UA 4BG8A 3SD4A 4EHTA 1TV6A 3HAXD 5KPTA 4TUYA 1SSHA 4CIGA 2ASPA 4DQQA 5IJ0B 1AZGB 1TK8A 2Q1XA 1AT1B 3D54A 3O5ZA 4PJOB 2BE2A 3RYIA 1OKJA 2JWKA 3ZP7A 4AILC 1SKSA 1KC8H 2X9HA 1MV0B 5GAMf 3G4SQ 1U1TA 4DOVA 2Z1FA 3U4LA 1EX4A 1UFYA 1E4GT 2QQ9A 1TWBA 4KTWA 1DJ7B 3HRSA 1J53A 4J7FA 2D0AA 2FC0A 3EZWA 3HYFA 1OI1A 4YORA 4JKDA 4F7UF 3CYPB 4PFPA 4X1KA 4IFVA 4O0IA 1XOVA 3OVNA 4OPAA 4ELZC 3ALYA 2HRYA 1H1VA 1ZBLA 5JS2A 2IQQA 4Z89A 4QCLA 3NH2A 1I4K1 3CCQA 2IVPA 3M59A 1SKUB 3G25A 3MDQA 2DAQA 2AP1A 2EJFA 3AVFA 3CMAN 4LFAK 4NXNK 1ABQA 4X1VA 1COMA 1PKTA 3MDOA 3I0SA 1Q18A 4H0OA 1EZZB 4D6WA 1HX1A 3PUFA 3BFMA 1VQ5Q 3AO1A 3HSCA 4O8UA 2MWPA 3CCUF 4O8KA 5GAOp 4YOVA 5HKCA 1H47A 2F9ZC 2ZGYA 1W5BA 3ZP4A 3O3HA 1IBMK 4LH4A 2CZ7B 3H9NA 2RQWA 1GXIE 4CZHA 3CD6A 1C0TA 5AQYA 3SIUA 2KR3A 4FT2A 3CPWS 3ASMA 4GV9A 1G8XA 1UGPB 2SEMA 1NYFA 3FJPA 3HPGA 1V1CA 4NLBA 2XY5A 3HO1A 3ELCA 2ATCB 3WVEB 4H5TA 3PLAA 2K5FA 3KKSA 4CW7B 2UZHA 2RJCA 3V7RA 3F9MA 3NTKA 2O01E 3QO3A 5IHNA 3OS0A 5GAOq 3O9QA 4ISGA 4LSLA 3U9ZA 5FPEA 1Y64A 4O2BA 4QVDA 1NQ3A 1VQKQ 1T05A 4J9CA 3VQCA 5D6XA 3OYEA 3I55A 5LL6Z 3X26B 3THYB 1T44A 3E22B 4IDHA 4ZTJA 4FPBA 3TAEA 2XMFA 3A0IX 3CG6A 4PJOE 1VQNF 5AQUA 1QU9A 3HKEB 2JZ2A 2OTJQ 4E7HA 3WXKA 2QWLA 1K8AR 2VVKA 2Q36A 4DRXA 5JH7B 3IMXA 1PC0A 4ZTFA 3PE0A 4DBHA 1QVGS 2RA2A 2VYPA 3QDKA 3R1XA 2X4YA 4RTFD 3V1OA 1HNZK 4JV5K 2JN0A 9ATCB 3CBOA 2YI1A 2OTLA 3L3UA 1Q9XA 2Y1JA 3M1XA 4ISEA 2GZLA 5KCOA 1K6YA 3DC2A 1IB8A 2VC8A 5FU6B 3VEOA 3J7AF 5AFUA 1VUBA 1VQLN 2HD0A 3K0TA 2BTQB 5EIBC 3CC2T 4EMKC 1UECA 1CXQA 4CZIA 2CH4W 3FZHA 1FNKA 1VRTA 2FC3A 1HSQA 2EIFA 3IKFA 2EWNA 3JCMQ 3NHNA 1QAHA 4G88A 5I42A 2DFEA 4JDSA 2BTOA 3F0FA 1TKDA 4BT2A 1MMGA 4O55A 4YJ2A 4JKAA 4FJ9A 1RL2A 4I2QA 3IKEA 1CKAA 3EKSA 2G3RA 2M16A 4A62A 1RLUA 4M75B 5LA6B 3VKIA 3OSSC 2DTIA 2E70A 3THKA 1UE9A 3L2UA 1Q86U 4DFKA 4HUFA 3MO8A 2HHQA 2I0NA 4R79A 1S5JA 2W0ZA 1JJ2P 1JQQA 2RB6A 4BR4A 3PX0A 1GOAA 1Z26A 3PIPA 1UHFA 1NGBA 2L2PA 2ED0A 4AFZC 3AVNA 1B34A 3MPUB 1KSPA 1HYZA 5LMUK 5A2QO 1J3TA 1S72N 2HX0A 2OPQA 3CCVA 2RJEA 1WSFA 4YY3K 1IREB 3VGLA 3W0LA 3QDRB 4CJVA 4F16A 2L3PA 4IWVA 5HP8A 5C8YA 5FJ4C 4O4IA 2K1SA 1KQ1A 5A0DA 2K4YA 1Q81O 1OX8A 4DTRA 2W8BC 1WLJA 3RMQA 1U2VB 3HSTB 1VQPN 3LDQA 1YITN 4X1KB 2A3LA 1JL2A 2KROA 1YT3A 3RERA 1TL3A 3FD6A 4C92D 4ICLA 3SK3A 1JLEA 3FPIA 1ZSZA 3S0WA 3E01A 1XQSC 3CCMT 4MDBA 2D4WA 5GAN6 5I21A 2ZPEB 1ASWA 5EAZA 5HRSA 1M3AA 3JB9I 1I3AA 1RT7A 3LPUA 2LCCA 2ABLA 1YTAA 5LJ3j 3LWMA 1D8YA 3A2FA 3G6ET 3LWQC 1VQ6Q 3HKSA 3VS3A 2VWKA 3V81A 3TPQA 4CF1A 3QJ6A 1L3UA 3QKJA 3QYHB 4RTVA 4G9ZA 4FL6A 2QEXA 4C8QC 4PA1A 4A63B 3Q7BA 5J2MA 3CJ1A 2EYQA 5HY0A 2LCLA 1K8KA 4BRAA 4BRHA 5MLCQ 4CEZA 4OKKA 3OMCA 2YUOA 2V7ZA 4CVNE 2L8DA 3TSUA 2YYEA 4FW2A 4CHQA 1Q81C 1GLLO 3THWA 1NLOC 1GBQA 3PIOL 4BT5A 1CZAN 4KI6A 1QWEA 1S1XA 4M7DG 2KTUA 5HY1A 4DS5A 2HHHK 1HJRA 4YOUA 4DTJA 3E19A 5GMKi 2F8SA 1PSFA 3CCRT 2ZE2A 3F73A 3CC7T 2G8VA 3SV4A 4M75E 4LH5A 3V6DA 4YTLA 1IGUA 4RTZA 4Z4FA 2XIDA 1M1KR 3OYAA 2UXBK 4O2BB 3EAEA 3VQ9A 1JKHA 4CJEA 1HXDA 3L1AA 4M7AG 2G8KA 5IXFA 5GAN8 5HWEA 5ECAA 4FK0A 3LAKA 2WALA 1G2BA 4FLXA 3SMPA 1KQSM 1DT9A 3CCLT 5CA0A 1C0UA 3WGKA 4CD1A 4CE9A 4FK4A 2OTMA 2DFFA 1YHQQ 3VRYA 2CP5A 2P0QA 1S3XA 1X1PA 2Y1IA 4WTOB 4ZNXA 2E5LK 3DLHA 1Q81H 1JCGA 3D00A 4J6XA 3KIZA 1VIFA 3C0CA 2E1YA 5EB0A 3KTQA 3A98A 1NYGA 5AZIA 5KGXA 2RMOA 4FM1A 1JCEA 2EQIA 3I56F 2EW3A 5EX5A 3JATA 3ZX3A 3F70A 4J9FA 3O8MA 3KE1A 1H3HA 5LL6S 3DB4A 5LJ3g 4FK2A 4C81A 2DRKA 1R0CB 1P90A 2PZSA 3K9KA 1NBWA 3ASKA 5AQVA 2O8EA 2YHAA 1D1CA 3PSFA 4DEYA 2E4HA 1K73U 1MUZA 4JPBW 3G71F 3TAMA 1PRLC 4Z4HA 3M0UA 4AG2C 3ZYYX
chains in the Genus database with same CATH topology
5GAHP 4M7DA 1KAXA 3I8BA 5GAMe 1TYQA 3TEEA 1YJWA 2FL7A 4PKHA 5HY2A 2LT4A 5H1SQ 2FLOA 3EE9A 4NOYA 1BIBA 5CVIA 1TH7A 3O8VA 4BDZA 3CCUT 4E7IA 2L5QA 4M75C 1N8RU 1BU6O 4M7AA 3CJBA 5L8RE 3EL2A 3ID8A 5LJ5d 3N4ZA 3FB9A 4FWMA 3ULEA 3CC2N 4RCBA 4RMOA 3VF4A 4IUUA 2E5QA 5C2FA 4N4GA 1YJ9A 2P0KA 2K5LA 2K57A 1HUXA 2RHIA 3OBYA 5LJ3f 3KUFA 2I6DA 1XQHA 4X9DA 5BR9A 2B8AA 1C0FA 2R5MA 4M78D 3QICA 4H5RA 5LY3A 3P31A 4YOXA 1K8KB 1VQNT 1YXQA 2DIQA 4GNIA 2XDDA 4JK9A 2QW9A 3O85A 3BF1A 1KD1O 3C4SA 3E20B 2X4XA 3GOXA 5DM7L 3M5RA 3CMEF 2Q1NA 4JLIA 4IUQA 4FU6A 3X24B 4FT4A 3G6EN 3OYGA 4LCKA 1X3NA 3HBTA 3O80A 2CKKA 3NVKE 4C92G 3M1FA 1QHAA 2H3GX 3MMVA 4EMGA 4C4WC 3ENHA 1OZ2A 5J26A 1SQKA 1NGIA 5G4VC 2GFAA 1KD1C 4BDYA 4ILHA 1VQOT 3OYKA 3QHSA 1VQ8N 4M7XA 4C0DB 4GY5A 5FPNA 2BUDA 3LGFA 4OGEA 3C0BA 1HJOA 1Y7XA 4C8QD 5AZIB 5LJWA 3CC7N 2NRXA 5EY4A 4CRIA 3ATVA 3DWLA 5AZJA 5HK0A 4KBMB 1ESVA 1FXXA 2KSSA 5GMKe 3JB9H 1TUYA 1GLCG 5I2SA 2HBPA 3PMTA 3H45C 3OS5A 3A8GB 4OP0A 3AAQA 2RJDA 1U8RA 3CCLN 2QEXT 4WYBA 1W2BS 4LD9K 3JCMP 1TYQB 4BR2A 3R6OA 3MCAB 3MN6A 2JNGA 1KD1H 1IPAA 3KK7A 2GTDA 3SFMA 4K41A 1UB4A 5EO3A 4LDVA 3SWNC 3J81E 1BUPA 4M7AB 1P8ZA 2DPPB 3S6WA 4C92A 4NL3A 3ULEB 3IFRA 3EFSA 3MX5A 3A8OB 1KQSF 1NE8A 5DLQE 3LFOA 3RSEA 3HTVA 4CI6A 2EFIA 4DCHA 2BTFA 5C6SA 2I2LA 4B1WB 2DXTA 3G4SA 1YF5L 5GAN7 1LCUA 3CCUN 3OW2S 4M77D 3RKXA 4RG8A 4A53A 3CJ9A 1VQ5F 3L6QA 3HZ6A 5GADP 2HQEA 1K8AO 4XCQA 3T9NA 3W3DA 2M0OA 3CXCM 3VV0A 3V3TA 4QW2A 1DKGD 1YI2F 1NJIU 5C12A 4X9CA 3HRGA 3VESA 2PU9B 2P9NA 3CJAA 3I56T 4M7DE 3FZKA 2KAFA 3U9DA 3BW1A 2DKGA 1YJWT 3H1VX 4BRMA 3M53A 3G71T 4JKCA 1VQKF 1ZC6A 4BY9C 4M7AE 1VQNN 5FLXE 4A61A 5C0MA 3CEYA 3FZLA 1K8AC 3CC4N 1HPMA 4L59A 4IOAL 4V2SA 3CPWA 1G5VA 1X3MA 3GNFB 4XU1A 4ISFA 3BY7A 3OYFA 3DB3A 1KG1A 5BRDA 3KWIA 4M78G 3QUIA 5FRMA 2X4WA 5BPLA 4PJOG 1X52A 2V52B 5FU7C 2OTJA 1XNIA 3JCMg 1G3YA 3O08A 1Y07A 4PKCC 2ASOA 5LJ5h 4I6MA 3CF5L 1YJNA 1J6ZA 3FRNA 1K8AH 5KE3A 4WQ4C 5J39A 4FOEA 1QVGA 2RO0A 2XICA 5E26A 4II1A 3O6WA 2F7TA 4M7DC 2KVQG 2AIFA 3V7EA 2QQRA 4C92B 1ATRA 3L2RA 1S22A 2LQKA 5LJ3e 3FIFA 4HT9A 3GIBA 1BYMA 3O9SA 1X7OA 5G4UC 2D9TA 1G99A 3RSEB 1OYXA 4M7AC 3OB9A 2E12A 3OHRA 1CN7A 1P92A 4H03B 4MZPA 2FSJA 5DCVA 3CMET 2RHXA 1NPRA 2QA4A 4XK8E 4M78A 3H3NO 1JJ2S 3T7ZA 2WACA 3C7NA 4PJOA 2YLBA 1QP3A 1G3TA 1T6DA 2IVOA 4BC4A 3OYYA 5CE3A 3JCMf 2PUKB 1VQ6F 1KHCA 2K2VA 1OZ3A 2QWRA 4A5BA 4IOCL 2D6FA 2CZ0B 4JK8A 1D4XA 4MDXA 4FWRA 4IO8A 5BN9A 2YCHA 3MN5A 3L2WA 1ZWZA 3INZA 2H3JA 2P9NB 5AQFA 2DXCA 4L5GA 2ASMA 3N5BB 5M1KA 4E7LA 3AARA 4BR0A 3OYNA 4JUVA 2RI2A 1T6CA 2QWQA 2WSCE 2NLUA 3UDCA 2NNWA 4H5WA 4C92E 1EQYA 2YX6A 3QB0A 4KH4A 1VQ7A 1M90H 3QBYA 1E4FT 4MDAA 3WXMB 1X9JA 3ME9A 1YHQF 2W41A 2LQ8A 4BRCA 3I56N 1YCYA 3TTDA 3HFNA 4M77G 2CZ6B 4R55A 3WQTA 5M9OA 4QQGA 3H1QA 4RG2A 4C5HA 3G71N 3ZEUA 1D3BA 3CXCF 4ZN3A 2QQSA 4BG9A 4BC2A 4JRQA 4I6MB 1NGJA 4RCCA 4CZEA 4MZTA 4C1NI 1H7MA 2QQAA 4BE0A 4HT8A 2NLXA 4IJNA 3VYHB 1GLAG 3J80M 1RA4A 4M75F 1V4TA 2LTOA 4DB3A 4BY9D 1VQ9A 3MEWA 1W40A 3PMIA 3CPQA 3J81M 4JJNK 1VQ5T 4AF1A 4C0GA 4NS5A 5AQGA 5B8HA 5GANd 3KVGA 3AHUA 1YI2T 1ZHIA 4BW0B 1YIJN 3GPLA 5LJ5j 1X6OA 2LBWA 4M77A 2JWLA 4CZMA 4M78B 5I9EB 2FVUA 3C7NB 2HBJA 2NRHA 1VQ8A 4BRPA 3MN7A 5AQTA 1RFQA 3P8BB 1VQKT 3ZX0A 4R56A 2PBDA 3OA9A 5CCAA 3V8JA 1U2VA 4WF2A 2CZ1B 5KQDA 3M57A 5GAOm 3OYHA 3V8LA 2XK0A 4EHUA 3MHXA 2JOYA 4BD3A 4PL7A 2QWMA 5EOYA 3NK6A 5A0GA 3CD6F 5AR0A 2RHZA 3WXLA 3CMEN 4CI0C 3OSVA 4O5VA 3JB9F 3FEOA 5GAGP 2E6ZA 1SZ2A 4FM4B 2RK2A 1M5Q1 3FLCO 3SAFA 3LLRA 3NVIB 1M1GA 3OYMA 4O6JA 3VUZA 2VXEA 3I55F 5FLXM 1N9RA 1VQMA 5BPMA 3QG1A 1Y96B 3CCSA 3NTIA 4OVAA 1Q7YU 4JEPA 4DA4A 1VQ4A 2KY9A 4QQ6A 5CR2A 2OTLF 4M78E 1QQMA 4B1XB 4LDYA 3JXUA 3M4GA 3ZEUB 1D3BB 4BB7A 4CZJA 5D6YA 1O13A 4BVRA 4LC9B 2GUPA 5GIOA 4J7IA 4FOIA 4J8OA 1ILYA 2F5KA 1I81A 1BKBA 5C0YA 4PLLA 2WUSA 2GEMA 4H0TB 1ZXOA 4BC3A 1N6AA 1MHNA 3O9RA 3PTAA 4X3LA 1LNXA 1VQ6T 5AQRA 3OQ5A 1RGIA 4WQ5A 2P9KB 2PVDB 2J4RA 4EDUA 3CERA 2HBLA 4BE1A 3CCVF 1GO0A 5GAEP 3CCEN 5F2RA 3JCMe 3H3OB 4A5AA 3FZFA 4Z94A 4GY2B 4J6WA 5LJ5f 4CBUA 1W2BA 4M77B 2NRWA 4EHTA 4KUIA 3CC4A 3M3ZA 3DLLA 3NVKA 2P9LA 4XTVA 3OS1A 3D2FA 5FPDA 4BVQA 3MN9A 2QDYB 1VQ5N 3MCPA 2L89A 2A7YA 5DY9A 3TREA 4PJOC 3VEXA 2QEXF 4XQ3A 5CKFA 1YI2N 4A2AA 1YHQT 1W42A 2WSEE 2ZPFB 5AQWA 3BEXA 2GWJA 4IKFA 4BR9A 3MP6A 2Q2RA 4A4EA 1K9MU 1VQKN 2Q0RA 5GAMd 3OW2A 4A59A 4FWNA 3L2ZA 1I5LA 4IUTA 3IDHA 3B8AX 3LM9A 1K8AU 2JUFA 1GLFO 3C6HA 3JCMJ 5GIPA 2EJ9A 3M9QA 2PAVA 4QS7A 4F7UB 2EQMA 3BDLA 4RKUE 5AQJA 4M77E 3EO3A 1N9SA 3R3LA 2QWOA 1WJSA 3HI0A 4BRIA 4NQ3A 3DXMA 3VOVA 4OB2B 4ATOA 3O9TA 4IFEA 3TU5A 3NMUC 2MAMA 5GAPK 3PAFA 3WVDB 2DD5A 1GLEG 4FL9A 1GO1A 3A5MC 4HA8A 4C5EA 2FXUA 4HWIA 3RIRA 3ID6A 4BVOA 4M7DF 4BGBA 5GANh 3CCQT 4CZGA 1YJWF 4B9QA 3SJHA 4PHTX 3META 4WCEL 3HJWC 2DZ9A 4NUTA 5D6WA 4CZLA 5TKYA 4B1UB 5FU6C 2PVGB 4M7AF 2E41A 4J83A 3OYDA 1QVFS 2Y4YA 5HY4A 5HXZA 3CIPA 1AHJB 3CD6T 1GZ0A 4JD2A 1BG3A 2Y4XA 1EIFA 3UPUA 2HQXA 3VGKA 1YJ9F 2P9LB 2VYTA 4ZGDB 5AQZA 3D2FB 3CPWM 1X01A 3VERA 2A3ZA 4FO0A 1W41A 1VQ6N 5C2DA 4JRIA 3EE8A 2E1HA 4XEIA 3I55T 4DQ2A 4A4GA 3LWIA 5JLFA 3VETA 1Q82U 3C65A 4CD3A 5JVHL 2P9IA 4ZGEB 4A54A 4KBOA 5ADXA 1M1KU 2HF4A 3A8MB 5HXUA 1MGQA 4QVZA 2DPNA 2OTLT 1JJ2A 3RMSA 2A41A 3MWPA 4TVRA 1WUAA 2DIGA 5F1XA 3CCJA 3AGKA 5EXWA 1QVGM 1QVPA 1SS6A 1YVNA 5KPRA 5KE2A 1O9SA 3OS2A 4JS5A 4E1JA 1XTDA 3S3NA 3CCMN 4A4KA 2FF3B 2F5TX 2CGJA 2X35A 4BY6B 3P39A 3N4PA 1YHQN 4BR5A 2GF7A 3OYBA 5CKEA 2A40A 3LDNA 3FR0A 1YIJA 3PLAC 5CO7A 2CZWA 4YDUA 3DXMB 3RUXA 4JKFA 3VEZA 1XC3A 2WC9A 3V7SA 3CCVT 4BACA 5AQNA 4XTUA 3F5TA 3KXTA 2KDSA 1UGSB 5BRHA 3CCRN 3JCMc 3JAME 2EAYA 3C6AA 1KC8U 5GIOC 4E47A 3MX2A 2MMPA 5LJ5e 3FGUA 3CMAA 4EI8A 4H0PA 3JRZA 3IR9A 3PNWC 3WEEA 4OB1B 3L0QA 4FWQA 4UC4A 2RE2A 4C92F 1MWMA 1BO5O 3LDOA 4JKEA 3J80E 2MWOA 3AY9A 4JD2B 4WQ5C 3SBGA 3VTIA 3LGLA 3LWVC 1ZBXA 5DLOA 1LJOA 3FC3A 1QW1A 2K3XA 5AQXA 4L6V5 4BROA 5GANj 3P4IA 3DJCA 4B9XA 3FZMA 5BREA 1LOJA 2AA4A 3LX7A 3QFPA 1Q86O 4JRKA 3G4SF 4UY8O 4BRGA 1M9SA 5AFUH 3X25B 1JCFA 3JS6A 2V51B 2Q0UA 4FWKA 3L4IA 3CD6N 2FSKA 3TCJA 2ZJQL 5GAMh 2GELA 2P9IB 2VCPA 3GL1A 5FPMA 4QQDA 2XDBA 3M5AA 1ZQ1A 3H6ZA 3M54A 2P4TA 4ZGJB 4PL8A 5AYFA 1VQLA 4BI4A 3IUCA 4NL2A 1Q86C 4MLHA 3I55N 2KMTA 4ILGB 4ILJA 3C95A 4M75D 3TTCA 2ZZDA 2MF2A 3A8LB 3WT0A 4M63C 3CCEA 3BF3A 1WPYA 2HVYD 5LJ3d 3CPWF 2NRVA 2OTLN 5I2MA 4BY6C 2WFBA 5EWRA 4FWPA 3ZETA 2ZJPL 4DKWA 3ZEHA 3SIVA 2DTOA 2DJZA 3LW5E 2ZPBB 3RKWA 1S72A 2E2QA 4FWLA 2CGLA 1BI0A 5GAOn 2E8AA 2E10A 4BRKA 1Q86H 3VPZA 4LDWA 2E2OA 2ZPGB 2OTJF 4RWTA 2KTVA 3ZFJA 1VQPA 1YITA 4JK7A 2D0QB 1YJ9T 1YJNF 5KH6A 4PL6A 4C0DC 4GV3A 1QVGF 4JKGA 2NRTA 1YBYA 3WEEB 5CKHA 3CCVN 3J7ZO 4A4HA 5J3BA 2ZF5O 5M1PA 2M1HA 1VQON 3JB9D 3MEUA 4C23A 3FLGA 3KBGA 1U6ZA 1K73O 3E66A 5JLHA 5KPZA 2E6NA 3NK7A 2HNIA 3NFCA 3Q7CA 3CJCA 5GANf 4QS8A 5AQLA 3SAGA 1SDSA 3GP8A 4EAHD 3CJ7A 2QA4F 4M78F 1WJRA 1WNLA 1M90O 4PJOF 3V7CA 3OA6A 2QEXN 2W40A 4C8QG 4OO1J 1N8RO 4L3QA 2E88A 3V8KA 2CH6A 2CGHA 1XBIA 2QTXA 4NLCA 3ZX2A 2VV5A 1K73C 1BWFO 3AGRA 4BVSA 4BVPA 2IVWA 1BDGA 3ENOA 4A4FA 3HHTB 5AQMA 4PKIA 1Q81U 1M90C 1YAGA 3VJPA 4KUDK 2IVNA 4BRQA 4BRNA 1N8RC 2K3YA 1VQ7F 1HKBA 3HM8A 2BO1A 3HRUA 2YJFA 1WOQA 4PLIA 1K73H 1W2BM 3L2QA 3ZETB 5ADXH 4C8QA 3R6MA 3CC2A 2XD0A 1R8OB 3TSQA 2QI2A 2ZWHA 5GINA 1Y96A 2A5XA 4IOXA 1WJQA 3FDRA 4MDWA 4WF9L 4YDUC 3EFRA 5IT9E 3N4YA 1MDUB 1N8RH 2PUOB 2KLAA 5TKWA 3JAMM 3WUHA 1YJWN 1NGFA 2E20A 5CIUA 4O5FA 3OYCA 3QFUA 5GAN5 1UGRB 2MI6A 2YHYA 4XU0A 4N4IA 5GAN4 3G4ST 4JKGB 4BI8B 1VQ9F 1Z05A 2HMPA 4BRLA 3UWNA 3HOTA 1M4ZA 3R9PA 2LVMA 1NGDA 4FPAA 1NMDA 2YJEA 5C10A 3G7ZA 3CPFA 1NPPA 3O1BA 2D0OA 2R58A 3C94A 2RH2A 1V4SA 3M55A 3OW2M 4N0AA 3AAPA 4MO4A 3CBPA 1GLJO 3PIPL 4XAXB 3CCMA 2QTDA 2DK3A 1KQ2A 4M77F 2RHUA 2V8KA 5GAN3 3CI5A 4OB3B 2P9KA 3IKMA 3GF5A 3BUZB 3SMSA 3G6EA 2DEQA 1VQ8F 2XHCA 2GFUA 5IAYA 4C92C 2P9SA 4DQ8A 2RI5A 4J6YA 1NM1A 1QVFA 2P0PA 1S72T 2CGKA 5AQIA 3CQXA 4XTYA 4F7UG 2DXBA 3CCQF 5HOOA 3VF6A 2KHOA 1YITT 3CCRA 3CC7A 2M9UA 4MMLA 4IO9L 3HP9A 5DM6L 3C12A 1UEBA 1KQSS 1FX7A 2P9PA 3E1YA 5LJ3h 2QXLA 4CBXA 1FWZA 2R57A 2OTJT 5BPNA 5BRFA 4M7DD 5KQ8A 3VU3C 3CCLA 3J7AR 1W3EX 1VQMF 3X20B 1YJNT 4ELYC 4JKHA 3A8HB 2RJFA 1KAZA 3CCSF 4M7AD 2BH1A 4XU3A 1NJIO 4HCZA 3JCMd 3CETA 2YLCA 1VQ4F 4C8QB 1KD1U 3X28B 5JMVA 1N27A 2RHKA 2YRVA 4P5NA 2F9WA 3H46O 4F7UA 5LJ5g 4IZ9A 5GANK 2OHWA 1W97L 3A5NC 3A5ZB 3QIIA 2JNBA 2QA4T 1LOTB 4EI9A 3CPEA 2ZGZA 2ITMA 3PT9A 2O4XA 4BRDA 1NJIC 3CCUA 5GANe 4N4HA 4IUPA 2I7PA 2V7YA 1JJ2M 3H6EA 1R59O 3P38A 5AQQA 2GQVA 5IN1A 4KH5A 1U1SA 3MEVA 4K43A 4GLKA 3LDLA 2DVEA 1W2BF 2RI3A 5CHIA 1XUPO 1MWKA 4WFNL 3CC4F 1M1FA 4C1NK 2ZPIB 3ER0A 4Y28E 3UKRA 3G4SN 4F9OA 3I33A 2K5IA 3MWTA 2LDMA 1NJIH 4QVCA 1NMUB 2P9SB 1RLGA 3VEVA 1VQNA 5AQPA 3LWHA 1ZBSA 4C8QE 4LD6A 1G3WA 5A2QE 5CKDA 2OAUA 1VQ7T