2VGNA

Structure of yeast dom34 : a protein related to translation termination factor erf1 and involved in no-go decay.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
382
structure length
360
Chain Sequence
MKVISLKKDSFNKGGAVITLLPEDKEDLFTVYQIVDKDDELIFKKKFDLVKLKIKVISEDFDMKDEYLKYKGVTVTDESGASNVDIPVGKYLSFTLDYVYPFTIIKQNFNKFMQKLLNEACNIEYKSDTAAVVLQEGIAHVCLVTSSSTILKQKIEYDVLKFDEKTEKFYKAIYSAMKKDLNFDKLKTIILCSPGFYAKILMDKIFQYAEEEHNKKILDNKGMFFIAHCSTGYLQGINEVLKNPLYASKLQDTKYSKEIMVMDEFLLHLNKDDDKAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLTGIACILKYPLPDLDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DOM34
publication title Structure of Yeast Dom34: A Protein Related to Translation Termination Factor Erf1 and Involved in No-Go Decay.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 90
structure length 360
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03463 eRF1_1 eRF1 domain 1
A PF03464 eRF1_2 eRF1 domain 2
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.870 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vgnA01
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2vgnA02
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2vgnA03
5FLXM 3NK7A 1CN7A 2OTJF 2QA4F 5G4UC 1NMUB 2VGNA 2I6DA 1RA4A 1XBIA 3I56F 1VQMF 2KTVA 1VQ4F 3I55F 3CC7F 5A2QM 1QVGF 5GANK 2HVYD 3CXCF 1YITF 4NUTA 5FJ4C 3PLAC 3LWVC 1VQ9F 3CCUF 2QEXF 1VQ6F 3CCJF 5G4VC 3CC4F 1W42A 1Q86H 1YIJF 3AGKA 1X7OA 1GO1A 1YI2F 1KQSF 3HJWC 3CD6F 3IR9A 1K73H 3E20B 1DT9A 1GO0A 1YHQF 3CCSF 3CG6A 3NK6A 1KC8H 1W41A 4BW0B 1X7PA 3RA5A 1Q82H 3ON1A 3N4YA 5IT9M 1PXWA 3LWOC 3WXMB 3CCRF 1N8RH 3N4ZA 3LWQC 1VQ5F 3NVKE 1SDSA 2CZWA 1YJWF 4AF1A 3JAMM 1KD1H 2KTUA 1QVFF 4LCKA 3SIUA 2OHWA 1W3EX 3LWRC 3G6EF 1Q81H 3HAXD 3OBYA 5GIOC 3CPQA 1YJ9F 3RA6A 5GIPC 1M1KH 3JCMM 3VI6A 4BY9D 3CCLF 2VGMA 1VQLF 3V7EA 1RLGA 3PAFA 3J81M 4TZZA 2OZBA 1S72F 2WALA 3CCEF 2LBXA 3CC2F 2FC3A 1K9MH 3GYQA 4C4WC 1IPAA 1X52A 1VQKF 1T0KB 3CMAF 1H7MA 5EO3A 1W2BF 4X3MA 2KG4A 3CMEF 1ZWZA 3NVIB 5EWRA 3G71F 1VQ8F 3LFOA 3E1YA 3LWPC 1VQ7F 3V7QA 1VQOF 3SIVA 1Q7YH 2AIFA 3CCVF 3OW2F 2QI2A 3CCQF 2OTLF 3O85A 1NJIH 2BO1A 2JNBA 3G4SF 3CPWF 1M90H 1YJNF 3OBWA 3CCMF 1VQNF 1GZ0A 5DCVA 1W40A 4X3LA 2HSTA 2ALEA 3VMFB 1CK2A 1K8AH 3J7AR 3MCAB 1E7KA 5GINC 5GAPK 3FFMA 3NMUC 1JJ2F 2LBWA 1VQPF 3J80M
chains in the Genus database with same CATH superfamily
1AD5A 2ZD1A 1D1AA 5A2QE 2Y4YA 3M8QA 1KC8O 4KTWA 1VQ7N 1Z26A 1QKWA 5HCKA 5FRNA 3ZP4A 3BZCA 2O8EA 3DXKB 1X9SA 2B8AA 4KUIA 3RYHB 2RHKA 3BF3A 3NVMA 3SZ2A 5AR0A 3DRSA 1GLAG 2QM1A 3TARA 2D0QB 3AY9A 1B7TA 5AQWA 3HM8A 3HKEA 4CFBA 2WBNA 3WGNA 1T7PA 5EOYA 3AVJA 2B86A 2D8HA 1S1XA 1G2BA 4F8RA 4M7AB 3EH1A 1PC0A 3E2UA 2RHOA 2P5OA 2E2PA 2NUZA 3CC4F 3JCMd 1KXPA 1Y71A 4HCZA 2C0OA 3QTYA 2OTLQ 2QK0A 3V1OA 1N6QA 2A7YA 3CD6F 3V4DA 4CGGA 5L23A 1SSHA 2E41A 2QA4T 2YYEA 3VJPA 5GANe 4CK1A 3QWYA 1YTAA 2J4RA 2JOYA 1FMVA 4PKIA 4C1NK 3SJJA 5FWBA 4X1KA 1W4SA 2BUDA 4CJLA 2XY7A 4ZHQA 2YI1A 1MWKA 4BR2A 4K8XA 4EB6B 3I56N 3C6HA 2X3XD 4H0PA 1MMAA 4YOYA 3CCRA 4DA4A 4GVMA 1YT3A 2Z1GA 5C6SA 3JB9D 4J2AA 2OA8A 1EIFA 3NMUA 3P5JA 3CHWA 1QZ5A 1XUPO 4IKFA 5BPLA 3PIPA 1N32K 2NMUA 3C0BA 3RYFA 5BMVA 5I9EB 4C8QE 1NKEA 2YNHA 4C92D 2HD0A 5HBMA 5HXUA 3EFRA 1NPPA 1MGQA 2GTOA 3TQ7P 2Q0RA 3NF6A 3MN9A 4M77G 3ULRB 2QA4Q 1RILA 4DV3K 2CZWA 2VAMA 5KI6A 3QFPA 3SAFA 1OAPA 5E84A 1YI2N 3AVHA 4DBFA 3AO2A 2XY5A 1RDCA 3O08A 2EGCA 2GTJA 3RYIA 3PLAA 4FYVB 4HKEA 4RG2A 3DXMB 4DV5K 3AARA 3I56T 3KFVA 1FKOA 1EWRA 2ZGZA 3RSEA 3WEEA 1U47A 1TTHB 2K5FA 4DTOA 4BY9D 3RMCA 4OF1A 3O3GA 1EQYA 3ULDA 2A3ZA 1QWEA 2VG6A 3SQ0A 1QVFM 2HB5A 4DBQA 4A53A 2GCXA 4JKHA 2P6YA 3K0SA 4M77C 3LWLA 2KQ2A 3L3UA 3CMEA 2DE0X 1XMQK 2GLZA 2GV9A 2DT4A 4A4HA 4B9NA 1IPAA 3LX7A 1WHJA 2PHNA 3QINA 1VQ5N 1XRGA 3GDQA 3K5MA 1WA7A 3DLBA 3HKDB 3H46O 4ILHA 3UB5A 2KG4A 2KRNA 2QWPA 4FW1A 5CR4A 4Z4EA 1ZWZA 1HYOA 1RAEB 4WBNA 4YJ3A 2Q1XA 3QHDA 4FW2A 3G71F 1GLDG 2HVIA 4OB2B 2CWJA 3G6EN 3AA4A 4DRXA 2Q36A 5CKDA 4ELTA 2IAJA 4DSKA 3UT5B 1D0YA 4BT3A 4JYAK 4F16A 2XDPA 1RAGB 2FZGB 1M8VA 1Z6RA 3VOAA 5LOVA 1PKSA 3BE3A 1S72T 4FFBA 1YN8A 2E2NA 2P1JA 3VN5A 2V7YA 1NJIH 4QCLA 3VKIA 1HR0K 2ZODA 5CK9A 2J7IA 3OYGA 1EKEA 1HJDA 5B8FA 4BDZA 4M3TA 1KD1R 4DSJA 2FL7A 2DZCA 3F2KA 5CQXA 4IIJA 1Q81R 5KH6A 2F9WA 1EO1A 3TTDA 3QDFA 4B1XB 4FSXA 5HRPA 5M1OA 1ZSZA 4PY5A 1M9SA 1XJWB 4OMMA 4PJOA 1U4BA 2HHVA 3HWUA 3CQYA 3T3FA 1S72Q 2UUCK 2VUBA 3QHSA 4C8QG 3JCMP 1YAGA 2QWMA 4KGZB 4EMGA 4PL8A 2UXCK 4JK8A 4DV0K 3BDUA 2ROLA 1YJNT 3GF5A 1JFFB 1D3BA 3HL8A 1N8RR 4CHNA 2FHDA 1ILYA 3Q1JA 2HHSA 4JDSA 1NBEB 3ENOA 4IJNA 2FO0A 3BZKA 5EY4A 4HUEA 1YITN 4QS9A 4F2RA 1VQNN 1Z9QA 3GL1A 3MEUA 4RTVA 3QEXA 1B9DA 1GLBG 2BH1A 3EG0A 2IDOA 3IKMA 4ICLA 4QKUA 2QG9B 3VQAA 3OYLA 2CKKA 3RERA 2FF3B 1D5AA 1YIJF 4U3JA 3DDNA 4JRKA 1ABQA 4C8QC 1E4FT 1QVGM 4J9EA 1GLJO 4FJMA 2DRMA 3P0ZA 5AQIA 1TYQA 3OYEA 2O8BA 3KWGA 1YJNQ 2KE9A 2O4XB 4L3QA 5AQQA 1KC8H 4HVUA 1BA0A 1VSHA 1Q95G 2E64A 2HF3A 3C6TA 3H08A 4FWOA 4DFJA 5JS1A 1IZ6A 4O2BA 2HOEA 2P84A 1SF9A 4N4HA 1T8EA 3CXCA 1Y64A 4E2FB 5ADXA 1YITT 2MAMA 1XOVA 2VAWA 3HKCA 4J9DA 3ON1A 3GIBA 1QCOA 2RHIA 3FLGA 4Y92A 1WOQA 4G9ZA 3LWOC 2KK4A 3I33A 3F0GA 2EX3A 5KCOA 1NLVA 1NK8A 2BTOA 4CI6A 1Q9YA 4LF5K 4PJNA 1KSPA 1OH8A 4YNQA 1CKAA 5M1QA 3VTHA 1Q9XA 3S06A 3MX5A 2JLEA 3JCMg 2DD5A 3FC3A 1YHQA 3H0HA 2DYIA 3QBXA 3CCSA 4TV8A 5CKHA 4YOWA 4FU6A 2GF7A 2DLPA 1Q86C 2BUPA 4WFNL 3PFSA 4DTJA 3IMPA 1N36K 4DTRA 2P51A 1YITQ 4BWMA 4CJQA 4KH4A 3FDRA 1GLEG 2G8HA 1WI7A 3QDRB 3HYFA 2L5QA 4WCIA 1NK0A 4BB7A 3KHNA 4DTMA 1RLGA 1K8AU 4CJEA 3B6OA 3PAFA 3M5AA 1UB4A 2K1SA 1C0GA 4DOWA 5AQTA 2HL3A 1W5EA 4CEBA 2LCSA 3CM5A 3GOXA 1HNIA 1Y97A 3ENBA 2HQXA 3S6WA 4ILJA 4B8CA 4BR9A 3X28B 4CGHA 4C0GA 4C4WC 3KLHA 1LPLA 2VKNA 1HKCA 1SHGA 4M77D 4RW9A 4C8OA 4X3MA 3V9ZA 3PVLA 5CR2A 1WAFA 5LXTB 3M59A 2K3BA 3SFMA 3LP1A 3OYDA 4Z4FA 1OVQA 2OANA 4HNAB 4PJOF 4CZJA 2R57A 4YJ2A 4CK2A 2G3RA 4RTYA 2LTOA 1M1KC 4N5SA 1RBUA 5KX5B 4R0KA 1VQKT 1PNJA 2Q31A 5KPTA 1JD1A 1WDXA 3CCEN 1K73U 3CC2N 1K0XA 4FWQA 5CA1A 3QIOA 4JKAA 3I35A 4BRLA 1SSFA 1TU0B 1BCOA 2A3LA 2EYQA 4X3LA 4FZYA 1IG9A 2R751 5AFUA 4CGIA 3MN5A 4CJPA 1DEJA 3MP1A 1FFXA 3CPWM 2G8FA 2X35A 3N5BB 1TKTA 4C8NA 3SUPA 3TPQA 4FPAA 5JQGA 3RR7A 1RTHA 1CKBA 1GOCA 2RN8A 1K76A 4JLHA 2OTLA 1XTDA 2D0OA 3WQTA 2Q1YA 1BIAA 2VGNA 1VQKQ 2F4VK 3QEIA 5GMKe 3EG3A 3K59A 3KXTA 4H8KA 5LMNK 1KQ2A 5CYMA 3SCXA 2KTVA 3SHWA 1AVZC 3KD5E 3M0UA 3HFNA 5E41A 3DLKA 3ZSRA 3MEVA 3VQ6A 3CCMN 3V9SA 3H0FA 3WNFA 2LJ1A 4J7IA 2JNGA 3CXCF 1PSEA 2VV5A 3LYIA 3KZBA 3M4SA 4FWNA 5IHIA 4AHTA 2VYTA 1S22A 4B1UB 3J80O 4B1WB 2P9UB 9ATCB 2ZJRL 3VQPA 1K0SA 1CXQA 3D6RA 5HROA 3SPZA 3R8EA 1X7OA 4EMKA 1T0HA 1ZUUA 1RLQC 1R59O 4Z4HA 4J6XA 5KPZA 4H0TB 3L7QA 3VV0A 2ZF5O 3AVKA 1NQ3A 1YHQF 2E65A 4MFBA 1H92A 1GCQA 1K9MU 3CCSF 1KFDA 3WPXA 3UF4A 4C8QD 4IG0A 5AQVA 2DZ9A 4BW0B 4ELZC 3OYHA 2VYPA 3SMSA 4JV5K 5GAN7 3HP6A 2HRUA 2W6KA 2HBMA 2XD0A 1Q82H 3CCMT 5LJ3d 1L3UA 4E89A 4C0DC 4OGCA 1H3HA 3AVBA 1FK9A 3L0QA 3OW2P 4BRHA 3EG9A 3HRUA 5GAGP 2GWJA 1E6HA 3JALB 3JAWB 3VOBA 2R58A 1NM1A 3CC4N 4JRQA 4JRIA 1NBWA 1RT3A 1J5EK 4KH5A 1OPLA 1OU9A 2DO3A 5CKBA 4DFPA 1TKXA 4CC4B 3C9UA 1YBYA 1WSIA 2KEAA 5JICA 4BDPA 1UDLA 1VA7A 4M7DB 3KKSA 4CBWA 1QVPA 4R5PA 4DQSA 5IT9O 5LJ5h 5JH7B 5GIPC 1TAUA 2D9TA 4DQIA 4N56A 4BE1A 2LQWA 4JNEA 1TVKB 4DG1A 5KQDA 3OJUA 2LVMA 1MUZA 4ISFA 3VTIA 3GPLA 1ZC6A 2FF6A 2CSQA 1IO6A 2QXLA 3A8OB 3EL2A 2YNIA 2MWPA 2CH5A 1SL0A 2Q1NA 4ZN1A 3CC4T 5AQOA 3CBMA 3ATVA 3AO3A 3O9RA 3REAB 2PNIA 3DXKA 2QQAA 1H7MA 2DBMA 1QMCA 1QVFA 4H0YB 4J9BA 2HBKA 3CJCA 3SNNA 2XIDA 2XHBA 3D00A 4H4MA 2C06A 4NL3A 2PYJA 1RDBA 2ZAEA 3WUHA 2PBDA 2M1HA 2K6DA 4RG8A 1G15A 2G9IA 4FM1A 5AQPA 3UDCA 3KD1E 1I07A 3QYHB 4M7AA 3E9GA 4CF9A 2M9UA 2XKOC 3LW5E 2P0PA 4PJOE 4KHNA 2L26A 1Q7YH 4NCBA 4CEZA 1S72A 5GAN5 1NMNA 4IOAL 3AVMA 2OTLF 4HTUA 3THYA 4QQDA 5D6WA 3J8AA 2LJ0A 3K12A 4KTZA 1RT2A 2LJ3A 5IJ0B 4LC9B 3TWHA 5GIOA 1IBKK 1WQWA 4AFZC 3C4SA 4FJIA 2RA2A 2Z1HA 1MHNA 2W0ZA 3R0PA 4EB6A 4RKUE 2RK2A 1U06A 5GANd 3NGIA 1SRMA 4ZHWA 3DAWA 5FNVB 5GAPK 2IVWA 3FFMA 3NMUC 2AP1A 1VQPN 2FRYA 4AG1C 1SRLA 4WYBA 2DIGA 3U4LA 3G71N 1TK8A 1WJQA 1Y07A 4DSFA 3F70A 4ELYC 4IXCA 3E9OA 4YFUA 3RMQA 3QO3A 3JB9I 2HHWA 2QA4F 4FJGA 4FLYA 1YJNA 4CZKA 4DR4K 1W5FA 4J6WA 4FJ5A 2ZWHA 4WTOB 1WIEA 1VQ6A 4CJKA 2HVYD 3CQ8A 3EN9A 2A1RA 3FD6A 1ZXOA 3V1RA 3PLAC 1M27C 4GBQA 3DXMA 4J2BA 1HNVA 2L2PA 4QVZA 1ZBHA 1KVAA 4DSIA 4BI3A 1X25A 1JXEA 5G4VC 1ASVA 2RJEA 2QTPA 1VQPT 4C8KA 2F2WA 2F7TA 2CH4W 4J8OA 2YJFA 4EHUA 2KKZA 4JI1K 2BZ8A 1LAVA 2JW4A 3I56F 1BU1A 5SWMA 4FOIA 3E20B 1UUEA 1JLCA 4DXDA 2LC4A 2EQJA 1W2BP 3HTNA 1NJIR 1HQUA 3QYGB 4YOUA 1E4GT 4DWIA 2DFUA 2OPSA 4Z8AA 3HKDA 3KIZA 4IDHA 5KMGB 1Z05A 3VQ4A 3DKMA 4BDYA 1T6CA 3WXLA 3F5TA 2QDYB 2Y4XA 1NGJA 4C8IA 1X6GA 2YUQA 3HVTA 2LX7A 1LOJA 1N6AA 1QWFA 1SPKA 3L2RA 1VQPQ 3ISNC 3LWQC 3MEWA 3NF8A 1WSHA 2P9KB 3AA5X 1K8AO 1IV1A 2XK0A 4M3RA 3ZCMA 4B3OA 3UT5A 2DETA 4BT2A 2BE9B 2DAQA 2EAYA 4PJOG 4RCCA 3WEEB 4R79A 1QSLA 1JLFA 2WC9A 2KDSA 4KT0E 1BL3A 5KYWB 4NLBA 2R6R1 2CYZB 1QVFF 2ED1A 3CPFA 4KGVB 3P1GA 3SBGA 2RMOA 1KD1C 1QQNA 1P90A 2KXCA 1Q81C 4W5QA 3QUWA 2ITMA 3NMZC 1JJ2P 3BEXA 1NEBA 1X6BA 2QW9A 3VYUC 3AVGA 4M7AF 3E01A 2E12A 1IV3A 3CCRT 3ULEB 2DTHA 2QGFB 2COWA 2O88A 3Q7BA 4OVLA 4TZZA 1ZSZC 2E10A 5LJ3g 1S72F 4KRTA 2LBXA 4PJOC 3GYQA 4DTXA 2EFIA 2YSQA 1DTQA 3VGMA 1QU9A 4OMQA 4J2EA 1YTUA 4ERHA 2DXBA 2K4YA 3H1QA 1A5XA 3O1WA 2QDLA 4B3SK 2JS0A 1N8RC 3KK2A 3DC2A 2M0OA 1Z5WA 2XO7A 3QNNA 3JCMf 3RIRA 5D6YA 5LP6B 4CK3A 3OW2A 3D2EB 4BUGA 3FLCO 4BVRA 2JZ2A 1IKWA 2DNUA 3CCRQ 4PKHA 1C6VX 5I21A 2A37A 4E6RA 4BC2A 4FWMA 4WF2A 1RNHA 4FT4A 3P83D 1S9GA 2MWOA 4KHYA 1RT4A 4GY5A 1XNQK 2D4WA 2IC3A 3NTIA 4XK8E 4PL6A 3JCMV 4F7UE 2RHLA 1VQKA 1IXDA 4GV3A 1YJNF 2I2LA 2LRQA 2HX0A 3NFAA 4OJRA 2O4XA 3CMET 1EWQA 2HHQA 1G83A 1R0CB 3OW2S 4NXMK 3RR8A 4IFVA 3IAYA 2ALEA 3LP0A 3PIOL 2RHXA 2FPFA 2PFUA 4E1MA 1VQ8T 1G5VA 1MU2A 2ZJPL 2PTKA 3A2FA 3WNEA 1X43A 4RTZA 2RO0A 4E7KA 2PVOB 4R56A 2P9LB 1X6OA 1OH7A 1RI0A 4RW6A 3QZ9B 3OY9A 2E6MA 3CPWA 1NEGA 3R6NA 4NCGA 3ZFJA 1P8ZA 2BTFA 3CM6A 4DU3A 1SA0B 3CMEQ 2JUFA 4M4ZA 2X3WD 3LDSA 3VA3A 3A8HB 3C94A 3VENA 3RNJA 1QVGF 1FNKA 5I22A 1NK9A 1LV5A 1YITF 3ATUA 1VQ8Q 1C1AA 3LWVC 4JAXA 3MEEA 5CA0B 5KRSA 1ZX6A 5C42A 3RMAA 1PWTA 4OB3B 3DRRA 3E9PA 3BDLA 5GANg 3AGKA 1GO1A 3HJWC 1K9AA 2RF2A 1R0AA 2JT4A 1PCXA 2OTJT 1NKBA 4CF1A 2MYSA 3EE9A 1TAQA 4DV6K 1Z9ZA 4CZFA 1YCSB 4DU4A 4B9TA 4CC3A 4C23A 1HX1A 1D8YA 2FLOA 4OKEA 3P4IA 4I9LA 1PXWA 1T05A 5D7UA 1JO8A 5LXTA 2ZF8A 3EG2A 4B1ZA 5KYUB 3VGLA 3N4ZA 2YHXA 5KPRA 3I8BA 4FJJA 4PJJA 3NVKE 3BW1A 4HNAA 2OTJQ 3VS3A 1NG2A 4KI6A 1M1KU 2FBVA 3P38A 5M1FA 3ERNA 5C0MA 1WB9A 4CERA 3M0PA 3VQCA 5KX5A 5GAN2 4JHDB 2LMJA 2RNAA 3FFKB 4CI0C 1YHQN 5HY2A 2VC8A 3CCSN 2YX6A 3CPQA 1VQ9Q 4QW2A 4XTZA 3PNWC 3JCMh 3URGA 1ATRA 1CZBA 3EHRA 3L2QA 3QEPA 4GKJK 4I50B 2FPEA 4F04B 3N4PA 1ZQ1A 3H45C 4KH6A 1M8MA 3CFRA 2R7YA 1KTQA 4YY3K 2CW4A 2B5JA 4A2BA 5CB4B 5TKWA 3S02A 2FC3A 1K1ZA 4RHAA 1LNXA 4B9VA 4PQUA 1VQKF 3L4QA 3PUFA 3C9RA 3SWNB 4F7UB 3MCPA 1BDGA 3OSSC 4DSLA 5EO3A 4PKGA 1NMDA 1OEBA 7AT1B 4PJOD 3NH1A 3O4QA 4I2PA 3TU5A 3ITHA 3THWB 3WGJA 1HRHA 3WXJA 3EGDB 3UWNA 1YHQT 4E7JA 1C6VA 2A36A 2A40A 3EO3A 4KBOA 4LNUB 3X25B 3OQ5A 5CVIA 1Q82R 3NHNA 2L89A 3CCLT 3LDNA 2D0NA 4IFEA 4C92B 5F2RA 5AZJB 1LWEA 4RTXA 1W2BS 1WSFA 3S41A 3NGZA 4AFQC 3A8GB 3RDVA 2P9UA 4AH9A 2OPPA 3KTQA 3VUBA 4O6JA 4I55B 5JLHA 4EMKC 3H8ZA 1FNJA 3KUFA 3CPWF 1LOTB 2EBPA 1T03A 2KZZA 3HSTB 4WF9L 5GAN4 1K8KB 4LH5A 4Z4GA 1ZBIA 1W59A 3M54A 3O9SA 1GCQC 4F17A 2VWKA 4HVWA 3ZSYA 4LF4K 3C9TA 3M0TA 2BZXA 2VG5A 4DS4A 1ASWA 2ZM6K 1K9MC 3ID8A 2LNVA 2RKIA 1ZBUA 3GOIA 3MAQA 4B9MA 3LH0A 3CCLQ 1BBZA 3JB9H 4QAGA 3VS6A 1WXTA 3O9TA 1KAZA 2YXYA 3EE8A 1TKDA 5FU6C 1C0MA 4LDYA 4JKGB 1SZQA 1CN7A 3RRHA 1N5ZA 1WHKA 3CCQT 4FJ8A 1X2QA 4DQPA 4GKKK 1XWLA 3EFSA 2X74A 3O8MA 4F3OA 3JALA 3JAWA 4JJCA 1X75C 5J3BA 1QP3A 2OTLN 2P0QA 2X4WA 1JJ2S 1X9WA 3TD5A 3F0DA 2FB7A 4HCKA 1JXOA 1Y96B 5LMUK 4M7DA 4E7IA 1R77A 1I39A 3LALA 1MMGA 4FJKA 3LWHA 1M90C 5JH7A 1J6ZA 4FSVA 4Y28E 2E4HA 3ZT4A 4Z88A 3H3NO 4DV4K 1TVKA 3QPHA 4K11A 3ZETB 3CCQQ 1T6DA 4NO7A 4CECA 5HY4A 3VTIC 4M7AG 2IVNA 3MWTA 1Q7YR 4OKKA 3AVLA 1QQJA 2X6SA 3M57A 1QQMA 3AVNA 4FXDA 2Y90A 4H0XB 1CLIA 4JUVA 3MXJA 2GGRA 2QGGA 4EP5A 2E2OA 3O5BA 5EXWA 5A2QO 1VQ4T 2QA4N 3M53A 2HRYA 1U1SA 2OTLT 1KSWA 4ZTFA 2YRVA 5EVZA 3QKJA 5EYPB 4XTVA 5AQLA 2HS0A 2F2XA 2IIMA 4L59A 3H9NA 2XMFA 4OGEA 3RKYA 1HD3A 1WJRA 2KGTA 1T3LA 3G0ZA 2QKKA 4MO5A 2YHYA 4Y1CA 4CJ5A 4M7AC 3VQQA 1IRXA 1WZOA 2YWWA 3ZSZA 1C1CA 3WGMA 2DL4A 4IUPA 1KFSA 3HRTA 4KO0A 5CZ2A 5B8HA 2RJFA 1VQ4Q 5IHKA 4LCKA 3R9PA 2E8AA 5IJ0A 4KGXB 2K3YA 3SD4A 4CZMA 2W10A 3OBYA 5GIOC 1WAJA 1U04A 5GAOn 1UJYA 3QICA 3MECA 5FPDA 4LFBK 2QEXQ 3JCMM 3BF1A 5C2FA 1VSMA 2OCEA 4M3UA 4CW7B 2QYZA 4DQ8A 1EZZB 2V1RA 1VOMA 2P4RA 1YWOA 3L1AA 4FLUA 3PX0A 1U3PA 1W55A 5FNVA 3J81M 4M45A 3HP9A 2LBTA 3TD3A 3NH0A 3HRSA 3TAFA 2E70A 4C5GA 5CY4A 3NF7A 4Y1DA 3AO5A 3SJHA 1LWFA 5AQUA 3O3HA 1R0BG 1RDAA 4TV9B 3VO8A 5BPNA 1VIFA 2Q0UA 3WXKA 4DTNA 3A8LB 4MO4A 3V81A 3CBOA 2CP7A 1QP2A 2NWMA 2FBXA 5KGWA 4A57A 5GADP 4OPJA 2HNYA 3F0FA 3K2PA 1F21A 4K43A 3ZT1A 4BR5A 2V8JA 1A0NB 3AVCA 3NHGA 1SKRA 3WGLA 2DPPB 2ATQA 4E19A 2YV0X 3V9WA 3QIIA 3SIVA 2EKHA 2GNCA 5AQFA 2OJ2A 3S03A 1UAXA 3MWPA 4GY2B 3HOTA 2ZPBB 4G4ZA 3M56A 3ZL7C 4CFDA 3T1HK 3SBTA 1SZ2A 3ZBDA 2YRDA 4NYFA 1W581 3JCMQ 1LW0A 4BRDA 2X51A 4MZTA 1JXBA 4DKWA 1S72N 1I94K 3E22B 2UXBK 5LJ3f 4PFPA 2E4LA 2IG0A 3PGGA 4MZPA 2E5LK 4O4IB 2NNWA 3NFCA 4D8KA 2KROA 5GMKl 1V4TA 3H3OB 4NOYA 4ZHRA 2EWCA 2HSTA 1Q86O 2EQMA 3MEAA 2ZAUA 1VQ8A 4M7DF 2GUPA 3ELCA 3AHUA 5KMGA 1KJWA 2AK5A 2DYYA 1VQOT 1VQPF 4D8DA 2C0IA 4LN2A 2KT8A 4R55A 3NK7A 3MKDA 4LD6A 3CCVT 4F3TA 4AM7A 5G4UC 3RMDA 1NMUB 3OYNA 1S5JA 4BRCA 2P9KA 3F9KA 5FU7B 1I4K1 1FW6A 1TUYA 3JV3A 2F1LA 2OI3A 3CBPA 4QVCA 3V7SA 3CCJA 2QASA 5KYWA 1KD1U 4M7XA 3TI0A 1YJNN 2F5TX 1KK7A 1IV4A 1Q81U 4NUTA 3JSCA 1FJGK 1WHHA 2J6KA 3VESA 1VK0A 1ATNA 3LH5A 1VQOQ 2ASOA 4DBRA 4L5GA 3L8BA 3AGRA 3FD5A 1IGQA 2PAVA 1W42A 1O75A 3CCVQ 1UGQB 5IH2A 4EI9A 1D1CA 3VYHB 2O8CB 2K79A 4LFAK 2OTJA 2DX1A 2M16A 3CF5L 1SUQA 3G1JA 2NRTA 3L3VA 4BRFA 3VA0A 3QEVA 3HKBB 4CBUA 3CG6A 1M1KO 3K14A 1RGIA 4PFOA 1N8RU 1YXQA 2I7NA 4DLGA 1W41A 3VQ7A 1AZEA 4G88A 4DR2K 3TR8A 3RA5A 1WX6A 1UA0A 1E6GA 3K9JA 3K5NA 1VQ9A 1BG3A 2QTXA 5GMKm 4JKCA 5I3UA 4FK2A 5LP6A 1VQ6T 2VXFA 2MI6A 3D2EA 3IMXA 3O3FA 3NCIA 1VSEA 4DU1A 3CCRF 1U6ZA 1E7OA 3IFRA 1NJYA 4G4VA 3DOKA 2G8IA 4FWRA 4CGJA 4LF6K 2XU8A 2LX9A 5CO7A 4AF1A 3ID6A 5AYFA 1QQOA 2DTOA 5GANf 3AAQA 4FK4A 5KGXA 4M7AD 4II1A 1MV3A 4XAXB 4A4FA 1A5VA 2NRZA 4HWIA 3ZX3A 3LWRC 5MN6A 4CJUA 1WQ7A 1T0AA 4RMOA 1M1FA 4RWTA 3J7AP 1O9SA 5IYZB 1VQ6Q 3THVA 1IGUA 3Q8HA 2JGUA 2ZPHB 2DFEA 2AKLA 3PTAA 4B9XA 3P8DA 3FZHA 4E7LA 3CETA 2D8JA 2HHXA 1LCKA 3ZP7A 4KRFA 1WNLA 4BQLA 3VYSC 2KI7A 1D4XA 1BQNA 1OQKA 2P9LA 4QS7A 4FJHA 1PG5B 5KYNA 2WACA 4BRQA 3MEDA 4N4GA 3L2UA 4RUGA 4IUTA 4A63B 3JCMX 2JWLA 2CP2A 4CJVA 1RLUA 3CMEF 4RTUA 2JS2A 2RQUA 4J9HA 4M78E 5LJ3h 4O0JA 3VEOA 2WFBA 4X62K 1SA0A 3QETA 1TKZA 4JJDA 1IO2A 1HJRA 1VQ8F 1TV6A 4XTXA 5KE2A 4MZMA 2J6OA 1PM3A 2FZKB 3CCLA 1FKPA 2P9NB 4IO8A 4XH5A 1OH5A 1NGHA 2ZOVA 5CA0A 1T3SA 3VU3C 4O44A 3WJRA 4Q0BA 3ZYYX 4DLEA 4OO1J 3VS7A 3O85A 2KMTA 2RPIA 1RAAB 3O8VA 2HP3A 2HMAA 3OMGA 4B5CA 3I0RA 2RQTA 5DY9A 3B6PA 2DJZA 2ZQBA 2HQSC 3PO5A 1GZ0A 4CCHA 1FMWA 1VQKN 3OW2M 3M4GA 1RDWX 3LDTA 3G25A 4E7ZA 1IH7A 1TUCA 3OYKA 4JN4A 4JKEA 4M7DE 1KAXA 4MDAA 4JK9A 3UIQA 2HSEB 3ZEHA 4ZGDB 5M1PA 4CJTA 3C12A 1B92A 3CYMA 2BIVA 3G4SQ 2UYKA 3RE3A 4H03B 4BT6A 4PWTA 4QVDA 4FYWB 2AA4A 3IG1A 4KI4A 2HNZA 2E5QA 2K57A 4XU0A 3M3ZA 3KLEA 2V51B 3CCQA 1WYXA 5KYUA 3HTVA 2OTJF 4LF9K 5GAOp 4BI8B 5GAN3 3CC7A 2ASPA 4KFBA 3W0LA 2CHTA 1NK4A 3O9UA 1JQQA 1WPYA 3P8HA 2PMPA 4FLXA 2EYYA 3A8YA 4IJAA 3WJQA 4BT4A 2RHZA 4H5TA 4JHDA 3D0PA 3EH2A 1WGSA 4BG9A 1VQ9F 3VS0A 3CQXA 2YKMA 5KYXB 3VQBA 1VSIA 3G7ZA 3JCMb 1Q86H 3S3MA 1ZLMA 3JS6A 1HYVA 3OA6A 1ASUA 5KCHA 4EIAA 4I50A 6AT1B 5DLOA 4IG3A 3DRPA 2VQFK 2ATCB 4EAHD 5CB4A 3CYPB 1S6PA 4HA8A 1RT5A 2KR3A 3ZEUB 4Q5VA 1ZUKA 1SV5A 3NK6A 1VQMT 1VQ4A 3AV9A 3FRNA 1WN7A 5EU7A 5GANh 3HHTB 3EZWA 1WBDA 4BC5A 3SWNA 4F7UA 4BRGA 1UI9A 1Y7XA 5LY3A 1RACB 1WSGA 4JD2B 3U9DA 4BQZA 1VSDA 3THWA 1X3MA 5MLCQ 4JLIA 1NGCA 2QEXA 3AA3A 3EGDA 1Q82C 1RT7A 2CGHA 1QS4A 2ZE2A 3AO1A 3T7ZA 2RHUA 4HHTA 4DQRA 2N48A 4F6RB 2PUKB 3QEWA 1T3VA 2E3IA 5A0DA 2Q2RA 2L3QA 5AZJA 2UYJA 4C92A 4UQGA 2P5GA 2CGLA 2ESWA 4FSSA 4HTLA 3DOLA 4WQ5A 1PHTA 4O5VA 2XHCA 4AT1B 1TUUA 1VQMQ 1I5LA 3TSPA 4I55A 4O55A 2RH2A 1XQHA 2W8BC 3M8SA 4EHTA 5AQKA 5IJ9B 2OHWA 4W5TA 1K8KA 3OMCA 3QBWA 4H5VA 3VYTC 2H3GX 1QD9A 1B34B 5LJVA 2KFZA 3CCUQ 4HUFA 4O8KA 4M78B 2DFFA 1XI1A 1VK3A 2DVEA 1S3XA 1M1KH 3EORA 2VGMA 3CCLF 5FW9A 1KLMA 4A59A 4M7DG 4F9OA 3VCZA 4IBNA 1NKCA 4NS5A 1BISA 4LF7K 3LGLA 3L2ZA 4RCBA 1WSEA 2XRIA 5M1KA 2EGAA 4JKGA 3THXB 3OS2A 3KLFA 1JLQA 2E88A 3LANA 1WBBA 2RJDA 3HSBA 2DTIA 2YCHA 3IQLA 4K25A 3EAEA 5C2DA 1OOTA 1G3YA 2RPNA 4XU2A 4CC7A 3RRGA 2KZMA 2GVIA 5KRTA 1UJ0A 2H3EB 2R5MA 2X4JA 1Y96A 5J26A 1M90U 3FZMA 2G8VA 2KNBB 2H6LA 5GAN6 4M7DC 1U5SA 1W2BM 3VEZA 3TSQA 2M02A 3INZA 4AM6A 5I2SA 1X27A 2O4GA 4BGAA 1X3NA 3JATB 1Q7YC 3CCQF 2O8FB 3HRGA 1D9DA 5HXZA 3ZETA 3PO4A 2Z0WA 5J2UB 1KNJA 4MMKA 2M0YA 4JS5A 3NVKA 2JWKA 2A42A 3HFOA 1QKXA 5IAYA 1COMA 5JCOA 4IOXA 4CEDA 2BDPA 2BANA 3J7AR 3MCAB 4DB3A 1BKBA 3RBBB 2HBJA 1KD1O 4AQYK 4FJNA 5EYPA 3KWIA 4E1JA 4JRPA 3OS1A 5IT9E 1VQOA 1YUWA 1WFWA 3ZT3A 4BREA 5J1EA 1Q81O 1L3SA 3SQ2A 3HZ6A 2I7PA 3HKSA 2IG8A 2F2VA 3CCVA 2SEMA 4D6WA 1HKBA 3JVHA 4AFSC 4XCQA 4X9DA 2W6LA 4KHSA 3I55A 1X1PA 2P0KA 5HK3A 2CS7A 3CMAQ 1IG8A 2LT1A 4ZTJA 1V76A 1C0UA 2UYNB 1VQ4F 1GOAA 1JJ2M 3M4YA 1J7HA 4ID1A 3NGPA 4F7UF 5J2TB 3HJFA 1TG0A 4FT2A 4FJXA 1RAFB 2FGYA 2ECZA 1N8RO 1ACMB 4FLTA 3M0SA 4EP4A 4LE9A 1W1FA 3KVGA 2RN2A 1XQSC 2QEXF 2P9IB 1QHTA 2RK1A 3VS5A 2O4IA 1VIEA 4LDVA 3CB2A 2ZGYA 2AT1B 4O4JB 3QLHA 4W5OA 2DK3A 2EKOA 3REBB 4E7HA 1DT9A 3LZIA 2CHSA 2RQRA 4FL6A 3GP8A 1NJZA 2LCAA 4BT7A 2Q3SA 3ZSXA 1LCUA 3VEWA 4XH1A 4TV9A 3PE0A 1JFFA 2HL5C 1BOTO 3PIOA 4FVMA 2B4JA 1RTJA 1T44A 1HMVA 2KY9A 3F73A 5GAMj 2RB9A 3GNFB 5LJ5j 1T0JA 2KYBA 3VS2A 3CJBA 3JYTA 4PL7A 1KHCA 1SDSA 3V4IA 5AQGA 2F8SA 3QJYA 1WLPB 4VUBA 5DK5A 2UXDK 3VF4A 1UHFA 1JXMA 1SG5A 2HBWA 3L42A 2QWQA 3UA6A 4A62A 1NYGA 4I4TB 4NB4A 3OYCA 5EB1B 1H641 2GFUA 1YVNA 3E22A 2F9ZC 3O4NA 3U8XA 2KGWA 1OPKA 4ELVA 4YOXA 4O4IA 4LNUA 4LDWA 4XTUA 3K9KA 3DLHA 1OX8A 3WVDB 3PSFA 3QWXX 4IUQA 4BR4A 2G8KA 2K3XA 2L3SA 1VUBA 2RQWA 5FLXE 3CCRN 3KLGA 3JAMO 5FWCA 4Y91A 3DB4A 4O4GA 3VQEA 3FZLA 2CUBA 1T0KB 1XMOK 2RB6A 4MDBA 3GNGA 1NK5A 4JS4A 3GHZA 3I3FA 2DFHA 4JZ4A 2DA9A 3J7AF 3PX6A 1KLNA 4X34A 2CZ6B 5AQHA 2E2QA 3BP8A 3OA9A 4XU1A 2AKKA 3K58A 1HK9A 3VF2A 3DLLA 1WXUA 3KKRA 1NM7A 2NLXA 3LWPC 1VQOF 5I11A 2UUAK 2PVDB 3ZLJA 4M75B 2LT4A 3G4SA 4BR0A 2D5RA 1YFNA 4FYYB 4CZGA 1UFFA 3FE1A 4OMPA 4KTQA 3M1FA 3CCVF 2EQKA 4IFYA 1RFQA 2BO1A 3BY7A 2JXBA 4M7DD 4ZN3A 4DEYA 5AQXA 4A4GA 1IBMK 3OYAA 2O8CA 1BI0A 2DBKA 5GAMd 5K14A 4G4XA 3MDOA 1UWBA 4KV8A 3HKBA 5LJ5d 3SLCA 1WXBA 4ISEA 5EIBC 3V7RA 2XG8D 1BI2A 4LUDA 1BIBA 2MK5A 3V6DA 1HNZK 3CMEN 4FZZA 2HS3A 2UUBK 3HXMA 3S9HA 4PLIA 4X1IB 5GAN8 4A5AA 1K73O 3PVQA 1KC8R 3O4WA 3HOSA 2OZSA 1Y0MA 4EZ6A 1VQ8N 4OMOA 5LP6C 3J80M 1IKVA 3CJAA 3RVCA 1XV2A 4W5RA 3R3LA 2ZPEB 5D3GA 5KTQA 2HNDA 3P8BB 4GNIA 4FVUA 4CFAA 2X4YA 4EIKA 1EXQA 2E6LA 1OFUA 2I6DA 4BVTA 5DM7R 1N9RA 4CJRA 3FZKA 1FWZA 1XHXA 1D0ZA 2EGEA 5GMKh 3TCJA 3AVFA 3T69A 4X65K 3KBGA 5ITZB 4JKBA 3AO4A 2HSPA 4ZGEB 4CEOA 3CG7A 4JJBA 3D45A 2AIRB 4A4EA 5CAIA 4I7FA 1VQ6F 3CCJN 5AQMA 4K42A 2DVJA 5EZYB 5IYZA 3SYZA 1SKSA 4XU3A 3LP2A 1LVKA 3JARB 4BWJA 2F69A 2YRCA 5GMKi 4C92E 3DJCA 4PKCC 1QE1A 2YHTA 3T19A 4CHOA 3OTOK 3EY1A 2A41A 4L8RB 2VASA 2LQ8A 1VQMA 3ENHA 4DFMA 1M3AA 5HY0A 4A61A 2P4TA 2OTJN 1ZA2B 1ZBFA 2EIFA 4CE9A 2LDMA 1WLJA 1KQSM 5GINA 2YUPA 1ZBSA 3RWUA 1IKYA 2CH6A 1S1WA 3MO8A 3CCUA 1VAZA 3VF6A 1JU5C 4B9SA 5IT9M 3AVIA 1RBRA 1YNZA 2H8HA 1BCMA 2HQEA 3L4IA 3I8DA 3SUQA 1LJOA 3CCJT 2VWFA 3TVTA 2QWOA 4FWKA 1VQ9N 1N8RH 2RI3A 4ME7A 2Z1IA 2HS4A 4PJMA 5HY6A 3A8MB 3RESA 4F14A 2YLBA 2YT6A 4CRIA 2P9NA 3WNHA 4OPKA 8AT1B 3META 3LM2A 4JPBW 1BK2A 2HMPA 4B3TK 4B9UA 3H0IA 3DM2A 2HMIA 1RBSA 1X9JA 4WCEL 4BD3A 2EQUA 4BROA 2QQBA 4KBMB 2EWSA 3V8JA 2QWRA 3J81E 3U3GA 1RAHB 4PJLA 3QDKA 2HF4A 4ISGA 3VETA 2ASMA 1TGOA 1DTTA 2I0NA 2RM4A 3FJ5A 4X1VA 2OPQA 1J5OA 3RA6A 4IDKA 2HBLA 4BE2A 3VQDA 1I8FA 3CCJQ 1LWCA 3V7EA 3OB9A 1EX4A 2FPDA 3MP6A 4TVRA 4GVEA 4OP0A 3CQTA 3U9ZA 1M90O 2ZZDA 1Y57A 2HHTA 1VQ9T 5MN4A 2OZBA 4RW7A 3DLLL 1Q86R 2ZVYA 1QAHA 3F6MA 1HLUA 3SQ1A 4M3ZA 1NU0A 3UT1A 5BN8A 3EHQA 5ADXH 3TABA 2CP0A 3SMPA 2PU9B 4KH1B 4IUUA 3OJSA 4GLKA 1REVA 3O80A 3NVIB 1TL3A 1Q8RA 1ZYQA 4C0ZA 1NGBA 4OLAA 2CP5A 2XICA 1NGEA 4F7UG 3EYZA 1M3BA 3OYIA 1KVBA 5TKYA 3JB9J 3KJKA 4H0VB 1IHVA 3MJXA 5KYXA 2AIFA 3GBQA 4LF8K 3OW2F 1TXQA 2QI2A 3CCLN 5BRFA 2G8WA 4HCBA 1YJWQ 1NGFA 2BTTA 4DQQA 1M1GA 2CP3A 3FIFA 3H41A 3CMAA 8ATCB 3IDHA 4CIFA 3D54A 3DMJA 3S0HA 5HL7L 2LCLA 2K9GA 1W2BA 3QIPA 3ZEUA 4IHJB 4KULA 2RD1A 5DM7L 4EPCA 4DUZK 5M1NA 1YJ9Q 4JJNK 5AJ3K 2WOMA 3N4QA 3SWNC 1K8AH 4JLGA 2DL7A 4L6V5 4JD2A 1Q82U 1MMDA 2EW3A 5EX5A 2QTDA 3MMVA 3UKUB 4J5YA 4C8LA 4M8IA 5JLFA 1CSKA 1U3OA 5FLXM 3PMIA 1WHLA 2CGJA 2PZ1A 2F96A 2E1HA 2L3PA 4CVNE 3SPYA 3MDQA 4X66K 3KK1A 2BTUA 4C92C 2KYMA 4OMLA 1KQSP 4U7BA 2OTMA 3K57A 3CCQN 1VQMF 2EQIA 4WQ5C 2Z1UA 1ONIA 2KQWA 4PFZA 3AA2A 3SV3A 2KT1A 5IJ9A 4JKDA 1NNEA 2JTMA 1TK0A 3KK7A 5GAMg 1QSYA 3CCUF 2E6NA 1V1CA 3A5OC 1TK5A 3CD6A 1B34A 1ATSA 5LJ5g 1JJ2A 1KHIA 4M78A 4DF4A 1WNSA 1HYSA 4JI3K 5BR8K 1N9SA 5EB0A 1JB0E 4J6YA 1BQMA 1K73H 2BZYA 2ABLA 1YF5L 3X26B 1KCFA 5GONB 3THXA 2DILA 2FSJA 1JCGA 3UATA 4GV6A 3CC7T 1Q18A 1KQ1A 2PQWA 2V9YA 1VQ4N 2LNHB 5HOOA 4DS5A 3N4YA 3GBTA 1IV0A 4BY6B 5AQRA 3SAHA 4CZIA 4A54A 4BRNA 4FJ7A 4RTFD 5MN5A 4FL9A 2NUBA 1YQNA 2QEXN 4CIGA 4BC3A 1UGVA 4Z89A 5BPMA 1Q7YU 3E1SA 1M2OA 4BVSA 1LW2A 2EHGA 4UY8O 2WTUA 2FSKA 2P9SB 2GTDA 3JATA 3UE5A 2O8FA 2AZVA 2LP5A 1IJJA 2NLUA 3C6AA 4BGBA 5J2UA 3VEVA 3SIUA 2CZ0B 3CC7Q 4YDUA 5LL6S 3HAXD 1OX9A 4LDUA 3LWMA 4M77E 4GLMA 1JL1A 5AQYA 1W70A 5BRHA 1HUXA 3HT3A 2CT3A 3AT1B 3RR6A 5JCOC 3DI6A 4I9QA 3FZFA 2L0AA 1KIKA 1XNRK 5GJVB 1O13A 1I81A 3TTFA 1NPRA 1VHAA 1NG9A 1NGIA 2L3RA 2LCCA 4KREA 3FFIA 1K6YA 4CEFA 4AHVA 2QEXT 1U8RA 1K9MH 4GMJB 2GQIA 3OONA 5EG2A 4C5IA 4OB0B 1GLLO 3CMAF 1IREB 5C10A 3C8LA 2DF6A 4N41A 1W2BF 1TUDA 1W5BA 3JCMc 1C0FA 4CJ4A 4N76A 2UYNA 3CXCP 1UGSB 2GWKA 4E1NA 3OVNA 5J2TA 2CDTA 4IEEA 4B3MK 2O8DB 2X78A 3V7QA 2H8CA 4LXCA 5KYYB 1VQLT 4YOTA 2Z01A 4OVAA 5DMRA 4U39A 2P9IA 1HYZA 3KE1A 4FM2A 2QTVA 5CZ1A 3VERA 3HVRA 1RT6A 3DLGA 3BDPA 3LAMA 4FK0A 1E3MA 2FBYA 5JS2A 4O4JA 2EYZA 4JI8K 3THKA 1M90H 4G4YA 3MXIA 2Y1IA 4A5BA 2CT4A 3O1BA 1XC9A 3D2FB 2V8KA 2A08A 1HKGA 3THYB 3LL3A 4CZEA 3SQ4A 4ESRA 1VQLQ 1JJ2F 2KHOA 4IURA 4M78F 1VQ7T 5J2MA 2YXZA 5LA6B 4H0OA 1AWXA 1S1UA 2KRSA 4DF8A 3WVEB 2WUSA 3KIOA 3T1YK 1EP4A 2KRMA 3M0RA 3LDLA 4JI4K 1NOZA 4CD3A 5SZTA 1VQON 1MDUB 2HAXA 4OPHA 1XBIA 3CCVN 4OMNA 4YOVA 1N5YA 3I55N 1KG1A 3U23A 1JLBA 1KVCA 1D09B 2D1KA 4PHTX 4OKJA 5AZIB 1S1NA 2QKBA 4NYNA 1TUBB 1W57A 4MLHA 1SEMA 3MHXA 4ID5A 1NJIC 1BO5O 4I4TA 1YIJA 5L8RE 4O2AB 5FJ4C 4DQ2A 2DIQA 1VQ7Q 2MOXA 2VB6A 5HRSA 2FVUA 4AMCA 1W9HA 2JTFA 3T9NA 2VWJA 4EZ9A 1VSJA 3T1AA 3TU4K 4Z4IA 4KKOA 2HBPA 4PUOA 2QK9A 3RMSA 4FM4B 1JKHA 4KHPK 4FO0A 4BRKA 5CE3A 2DKGA 2HW3A 3QJ6A 2IOCA 3P4EA 5E26A 1G3TA 2MMPA 4YTLA 3I55T 2WSCE 4BRAA 5FU7C 3SI6A 1O1WA 2QAZA 5C8YB 1PD1A 2DM1A 4M77B 1W6XA 1CZ9A 4B1VA 3WXMB 4B45A 4M42A 1NE8A 3QUIA 4EDUA 4CEQA 3OYJA 1BI4B 1IV2A 1AHJB 2CZ1B 3E19A 3TAMA 2ZPFB 3W3DA 3DYAA 1FSZA 1VQ6N 1KQSA 4M75A 1YI2T 3LAKA 2AZSA 1S9EA 2IIRA 2VQEK 1R8OB 3I56Q 3VQ8A 3V9UA 3CYQA 1SHFA 5GAMe 1NWKA 3ZX2A 3EFOB 4DHYA 3P10A 1YP5A 1VYTA 4BC4A 4FLZA 3I55Q 3ULEA 5LJ5e 4BRPA 3JXUA 2UU9K 3IS9A 1QZ6A 3OSVA 1IB8A 3I7TA 1M30A 1G99A 2VG7A 3VIUA 1C1BA 5CKFA 4FJ9A 1KC8C 3D7EO 2D0CA 2DMOA 2ZPIB 2RJCA 1SS6A 1KQSS 2CUDA 2WSEE 4CJ7A 1V4SA 4X1IA 1YI2Q 2MCNA 3DLEA 2FG0A 3PX4A 2NUTB 1NJXA 4B46A 1VQ5T 1GRIA 4FYXB 2X6NA 4CGDA 2F9TA 4B8AB 5AQZA 4DR7K 1YJWA 4B9WA 2DY4A 1TUGB 3C0CA 2OZMA 1OULA 1DLOA 1LAWA 4LD0A 2O31A 3P39A 3G6ET 4IWVA 2EJ9A 2GZLA 1FX7A 4O4LB 5ITZA 1YJ9A 2RE2A 2YLCA 3NGYA 5IXBA 3FR0A 3ZT0A 1M2VB 2XY8A 4OX9K 2E3HA 4JKFA 3LFOA 3N2GB 2O01E 4IO9L 2ZPGB 2D0PA 1PD0A 1ARKA 4FLWA 3G10A 1VQ5Q 4CESA 1Q82O 3FBAA 3C6UA 5EZYA 3TANA 3ZO8A 4DEXA 2XDDA 3SEMA 2Q97A 3EKUA 3SAGA 3QXEB 3G4SN 2RF0A 2CZ7B 1ZHIA 3JARA 1IKXA 4M63C 4YHHK 3M8RA 3G6EQ 1GFDA 2D0BA 4MQ3A 1YWPA 4MLEA 2RHHA 2RI2A 2NRRA 1L3TA 5J2QA 3TSZA 4DFKA 1AZGB 4C8QB 2XDBA 1GFCA 2UYPA 5GINC 3TSWA 3PMTA 5J2NA 3QB0A 3RUXA 3R1XA 2K2VA 3PIPL 4EI7A 1GXIE 2W41A 4J2DA 3WJPA 3H6EA 5KE3A 1D9FA 2YDLA 4X1YB 4IIMA 3OS0A 3A1PA 2NYSA 3OYFA 3KJJA 3V8LA 3HK2A 4B62A 1MMNA 1UOCA 3CFPA 3BUZB 4IOCL 2J6FA 3G4ST 1UA1A 1QVFP 5FPNA 3KK3A 3FPIA 1WHGA 3LDOA 3FJPA 1VQNT 5GAOq 3DLRA 1TSFA 5A2QM 4BVQA 4BG8A 3CEYA 3M8PA 3FEOA 1M3CA 1VRTA 1W7AA 1Z5VA 4G1QA 4CGFA 2LQKA 4OMFB 4CHPA 2NUPB 2SRCA 4CC2A 1H1VA 3CCJF 4FWPA 1RT1A 2O9VA 5HWEA 2ROTA 3UPUA 3ZSVA 1K9MO 1KQSF 4M75F 3MEGA 4QQGA 3SDZA 5JVDB 2A28A 2A0FB 2PUOB 3OS5A 1X69A 3CXCS 5HLFA 3JASB 2YKNA 1VQNQ 4DV1K 3DB3A 1Q7YO 1C0TA 4KUDK 2L8DA 2P9PB 1RQ2A 4M3XA 3AAPA 1P92A 4FWLA 4WFAL 1VQMN 5C25A 1H48A 1JRIA 5DLQE 1IHWA 1BWFO 3ESJA 2GBQA 4C8EA 3MQWA 2HKNA 2R5AA 4ZHYB 4N0AA 5HP1A 4J83A 1OU8A 1K8AR 3QSUA 1G8XA 1MA9B 3CCUN 4CF8A 2E20A 5GAMf 1JBMA 1GX1A 5IN1A 2LQNA 4XQ3A 3VS4A 4BE0A 4DCHA 4CIEA 4I6MB 3JSMA 4ZI7B 5LJ5f 4KPYA 1TL1A 1BI3A 1WSJA 2B6AA 2KFNA 1JN1A 4ZK7A 2WSFE 1YJWF 3QZ5B 3JAKB 4K0KK 2CSLA 4DOVA 4AILC 1H3ZA 1I3AA 4EI8A 4RW4A 2FEIA 3SV4A 1YJ9F 4IHJA 2YUNA 4CEAA 2COZA 5D6XA 4TSXA 4DTPA 5LJ3j 3PT9A 3L6QA 2D0AA 3PV8A 1VYUA 2AMTA 5LJWA 3N2KB 4V2SA 2PVGB 1NGGA 2NRXA 3HSCA 4QS8A 5EAZA 3RYCB 1J9AA 3UKUA 4IIOA 3CCUT 4M78G 4KH0B 1S1VA 4BI4A 3QMLA 4J8FA 3EGXB 4CD1A 1X52A 1JLEA 1S6QA 4UC4A 1J53A 3ZSWA 4JI2K 1UG1A 1U49A 2AIZP 3M1XA 1K73R 1A5WA 4C1NI 1ZUYA 1QVGP 3C65A 1ZBJA 1UGPB 3U6FA 4CFCA 1RTDA 3C7NB 5EWRA 2EYWA 3I5SA 4CJSA 2MQEA 2QQSA 4X1YA 2A5XA 3V3TA 1UE9A 2EJGA 1VQLA 4P5NA 3VGKA 1RUWA 1M4ZA 3M9QA 5IXFA 2GUIA 3HBTA 1UHCA 3U3YA 1QSSA 1UFYA 2C0TA 1OKJA 4M78C 1G3SA 1XNIA 4X20B 5LYJB 1KNKA 3CCET 1BA1A 4AHSA 3CC2T 1OI1A 4AG2C 3LP3A 2I5JA 2DYBA 5GAOl 2QXFA 4CHZA 2OAUA 1VYVA 3J80E 3I0SA 1I1JA 3CJ9A 1AT1B 2DL8A 1BUPA 3TAEA 2CH4A 3CMAN 4WQ4A 3M84A 5GONA 4W5NA 5CCAA 2KVQG 1NOYA 2K5IA 5LL6Z 4U67L 1HNWK 3M5RA 2J06A 2DEQA 4AHCA 3PY8A 5HKCA 1VQ7A 4MDXA 3LWIA 2QA4A 2LBWA 4X64K 4RTWA 3VS1A 4H5WA 4XEIA 1L3VA 4O4HB 3CCEQ 2BKDN 4QOZB 3CC2Q 4CJWA 4R40B 1I5OB 2W40A 1JLAA 5J2PA 3BFMA 3CFOA 4JI5K 3BY5A 4PA1A 1PF5A 1RA4A 4RW8A 4XH4A 3WT0A 2ENMA 2YUOA 2IGIA 2DXCA 2OPRA 1K9MR 2YHAA 4O5BA 5HRRA 4TUYB 2P9SA 4PK4A 4LY7A 2I6RA 3BYQA 3ME9A 3VRZA 4C0DB 2JN0A 4JZ3A 4DTSA 5JMVA 3CC7F 1J3TA 1JL2A 1U2VB 3DLMA 4YDUC 3CMAT 4DR6K 5GANj 3NF9A 3D7SB 4DTUA 1K4US 1JY8A 5KQ8A 4NLCA 3M0QA 3NTKA 1ODEA 1AOJA 2HDAA 3A5LC 2GEMA 2DRKA 4A4KA 1SQKA 4H5RA 4LSNA 1I0CA 1VQVA 3RKWA 3CD6N 4M75E 3CJ1A 2GQVA 5GAMh 3IR9A 2O2OA 3UKRB 3U0OA 1OYXA 4ZGJB 1B3QA 3I56A 5AQSA 4ELUA 3CCMQ 2K5LA 1RDDA 1SL1A 1HNXK 2FRWA 3CIPA 5GAEP 4HUGA 4C5EA 3CJ7A 2HP0B 5BN9A 1M90R 4BVPA 3EKSA 1U1TA 2OX7A 3O5ZA 5GAOm 1DKGD 2WONA 4B1YB 5T7BA 4GV9A 1RCHA 1Q8IA 1UEBA 5I2MA 1KFZA 2XI9A 3VRYA 5AQJA 1X9MA 1WJSA 3KHYA 1UTIA 2OAWA 2O8DA 2O8EB 5CKEA 1UECA 1YI2A 5KYYA 3R6MA 2JM9A 3JB9F 1HPZA 3O9QA 2COYA 4DR3K 4AFUC 3CD6T 3CPWP 3QG1A 2DXTA 1VSKA 3HPOA 1GLCG 4DR5K 1GCPA 4QQ6A 5IHNA 3VEXA 3HKEB 1L5UA 2DD4A 1PKTA 3OYYA 3X24B 4C92F 1V29B 2RHYA 4RTTA 2KLAA 3VEYA 4M3WA 3JCMe 5HRNA 3FB9A 5BR9A 5FPMA 1MNDA 1X2KA 3D2FA 3MXMA 3I9QA 4I2QA 2HQHA 3RTVA 3MN6A 1XHOA 2IQQA 1B07A 1RABB 1QCFA 3X20B 3CC4Q 1VQLF 1CXUA 3UA7A 1CZAN 2BE2A 3WNGA 1QVFS 1NLPC 4E0DA 1G3WA 5LA6A 4IZ9A 1W97L 3CD6Q 1VQ5A 1YGYA 2PZSA 2VAPA 1BHLA 2YNGA 2E5KA 4ZOLB 5FRMA 1BGXT 4XIUA 4X1KB 4ZHQB 1BI1A 2EWNA 3PSIA 3WQUA 2HNIA 2YNFA 1ZBXA 1NZ9A 3NPFA 5JVGL 4KHWA 2NZTA 3G6EA 4LFCK 3DWLA 3MP8A 5A0LA 2AHJB 1NJIU 4H4OA 3RYFB 5CQYA 5AZIA 5BMVB 3GE1A 1TUBA 1TS9A 4OPAA 1OV3A 3S3OA 3MPUB 4O2AA 1VSFA 2A6AA 1VQ7F 3EZ5A 4E47A 1N33K 2FZCB 3SUOA 1GBRA 1TH7A 5C12A 1GBQA 3J7YP 1NJWA 4J9GA 5CIUA 4BVOA 2JNBA 1VSLA 2QWLA 2JVVA 1X01A 2KAFA 4DBHA 1GLFO 2YHWA 4NXNK 2Z1TA 4M75G 2VVKA 2W42A 4QT7A 2YHBA 3RYIB 1UGRB 1M5Q1 4OLBA 3IUCA 4M78D 2J05A 2V26A 5M9OA 2ZGWA 3QO9A 1D1BA 1RL2A 3E66A 3MK6A 3RSEB 2H3JA 3LM9A 5FLXO 1SKWA 2HHHK 4E7SA 4Q5WA 2IAFA 4E3SA 1CK2A 3V8KA 3G71T 2IPOB 3JCMW 4O8UA 4AHRA 3ZT2A 3RMBA 1NK6A 4NL2A 4CBXA 3ASMA 4F4KA 5C24A 5C8YA 4M77A 1NYFA 3L2VA 4X9CA 4FM0A 4Z0UA 1BI4A 4C81A 3RKXA 1HQEA 4Z4CA 3CPEA 1BYMA 2ED0A 2IVPA 3EG1A 4M75C 1QVGA 4EMHA 1AWOA 2HVHA 4B9LA 4XTYA 3MX2A 1YITA 1PRMC 1H47A 3QNOA 4WBNB 3C9SA 1VQNA 4BT5A 4LSLA 3I55F 4YJ3B 3KJVA 3EFOA 3JAME 5IWAK 2G8UA 2DTUA 4DRXB 4J7FA 3G71Q 2RI5A 3A5ZB 3MN7A 1U43A 2F5KA 5GAHP 4IUVA 2GELA 2HKQB 2QQ9A 3WXIA 1QQCA 5LOVB 3E9FA 1KC8U 2MIOA 1YIJN 3V9XA 1RADB 1ZSGA 1JLGA 3LPUA 4FFBB 4O0IA 4DUYK 2GFAA 1YI2F 4JEPA 1HXDA 1QVGS 5A0GA 4ORZA 3VYGA 1U3LA 1W5AA 3IRXA 3GLXA 2NUTA 2ZCFB 3OHRA 3HPGA 4CJFA 2CSIA 1XC3A 2MPXC 2VCPA 5C15A 1DBFA 1NLOC 4JI0K 4DSEA 3WPWA 2IVOA 2F8TA 2UZHA 4HT9A 4KWEA 1HSQA 3CI5A 5HP7A 4IIJB 1QW1A 1X7PA 4MMLA 2VWBA 4YORA 2KBTA 2GBZA 1GOBA 4AHUA 4FZXC 3V7CA 4JK7A 3A0IX 2PY5A 2FC0A 1WHMA 1ZSZB 4C8MA 3ER0A 4O4LA 3TD4A 4PJOB 5GJWB 2OYQA 3BGRA 1JCFA 1Z25A 3P31A 1SAZA 4CF2A 1M2VA 2DL3A 3N2GA 4ZOLA 4K41A 2EVRA 1YIJT 1PRLC 2M51A 4HVVA 4ANJA 3OYMA 1MNEA 1DGKN 4BR7A 4CJ3A 1NGDA 1VQ5F 3V1QA 3A5MC 3I5RA 4DV2K 1JCEA 4K8ZA 4G4WA 3NAEA 3LGFA 5FPEA 2E1ZA 1D3BB 2FXUA 4Y0WA 5JVHL 3ALYA 4CZHA 3C95A 2CREA 2A1SA 3GG4A 5HK0A 1KD1H 1F1BB 1MWMA 3G6EF 1Q81H 1N27A 2ETJA 1XHZA 3RYHA 4O5FA 4IEIA 1SKUB 5ECAA 3CERA 3LLRA 1RQ7A 2ZVZA 3B6NA 4U3JB 2FYKA 1QLYA 4C8QA 1U48A 4OB1B 1YIJQ 3SUNA 1EETA 4FWSA 3L2WA 1FXXA 1TYQB 1BB9A 2EPDA 2KSSA 2O8BB 2WALA 4Z02A 1RTIA 4FCYA 4B6MA 3VQ9A 4Z94A 3NDKA 1OVYA 4N4IA 5GAOr 4LH4A 5CHIA 3E9LA 4O2BB 4KHQA 3LDQA 4FIBA 1OH6A 4LNPA 1TOVA 4PLLA 2H8EA 1YJWN 3HKCB 4B08A 1RBTA 5AVMA 3F0EA 3HTRA 3ZX0A 1QTMA 4CF0A 2CGKA 2YJEA 1U45A 3E1YA 3J81O 2GX9A 3AVAA 2MF2A 4MDWA 3H6ZA 2HCKA 4M77F 1YJ9N 3K0TA 3TSUA 1N34K 3LMEA 1DJ7B 2NUPA 2AJQA 1KAYA 1NGAA 1RBVA 1PSFA 3S0YA 3CCEA 1Q86U 3CC2A 1RDUA 1ABOA 3D01A 4TV8B 4PNOA 5HP8A 1YCYA 4EFHA 3G4SF 1IBLK 3ZSQA 3K5OA 5JVDA 3M58A 4C5HA 1HPMA 2X4XA 3OBWA 4NWOB 1VQNF 2KXDA 3O6WA 2JTEA 5J39A 4LD9K 2E1YA 3HM9A 2ITGA 1JEGA 4M7YA 2LSNA 2CP6A 1W40A 2EYXA 2V1QA 1YJWT 2P9PA 3TAGA 3F9MA 4E6EA 1EFNA 4XTWA 1E7KA 3SK3A 5GMKj 4C82A 4DMNA 3CPWS 1K8AC 4RQOA 4FYDA 5HY1A 3KLIA 3NTHA 1D0XA 4N0AC 3QERA 4J9CA 1YJ9T 3S3NA 2QQRA 3QBYA 4M41A 2NRWA 4FPBA 4ZI7A 4JI6K 4H5NA 3ZOPA 4I6MA 1KRPA 3JB9G 3CCMA 3OYBA 1R1MA 1SL2A 3VQ5A 2UYTA 1J54A 4CEEA 5F0XA 3JAKA 4ZHVA 3M55A 2HHUA 4C8GA 1FYNA 5DM6L 4M75D 5GANK 4C92G 1TVRA 2DJQA 3TTCA 3NE6A 1YVUA 4NQ3A 3MCQA 2DERA 3IKFA 1TWBA 4YJ2B 4V19S 4PWDA 1HJOA 2PYLA 1FMKA 1U40A 1OZ2A 3IEQA 1NK7A 2VXEA 2B33A 4J9FA 4N47A 3N2KA 3LDPA 2DL5A 2K2MA 4HCCA 3CXCM 4KAZA 2BGGA 2KTQA 3RYCA 1M1KR 1GO0A 2KW4A 5CA1B 4ATOA 5F1XA 5EIBD 1K73C 4F6RA 2BTQB 3EGXA 4ILGB 4DR1K 2XY6A 4RCHA 3QFUA 4M7AE 4WE1A 4B9QA 4BACA 2DPNA 5H1SQ 1FFXB 4WFBL 3NBPA 2JMCA 1ITGA 3C7NA 5JQGB 3CC7N 3J7ZO 2Z1FA 2Z1EA 1OZ3A 2O9SA 4C8QF 2HZYA 3CC4A 5C0YA 1RI9A 2VXYA 4ZNXA 3GTZA 2HEQA 1VH8A 5EC7A 4M3YA 4LUEA 3IEWA 2NRHA 2V7ZA 3HO1A 3IKEA 3MBMA 3JRZA 4GW6A 3HPHA 1BIUA 4X20A 1RAIB 5LYJA 3JAMM 3M6GA 5AT1B 1WUAA 3CCST 2FSNA 4BY9C 4JI7K 2EJFA 3FGUA 2KTUA 3S0WA 4CHYA 1AWWA 4C0FA 1W3EX 1AWJA 2CVLA 2LZ6B 4CHQA 3LYBA 2NRVA 3K2XA 3JCMJ 5FROA 1QHAA 5AFUH 3EGUA 1BIZA 4WQ4C 2RHJA 3VI6A 1S1TA 2K7AA 2IS3A 2JJ9A 4EMKB 3LPTA 1NJIO 4B3RK 2E6ZA 3B8AX 5ELZA 4LDXA 1ESVA 2QWNA 3VPZA 3NH2A 3TEEA 3SB2A 1BU6O 4A2AA 4F2SA 3ASKA 3TREA 5CYQA 3T80A 3CCEF 4BY6C 2DEUA 3CC2F 5BREA 3TAQA 1QCNA 4O4HA 5FDLA 1YHQQ 3CCSQ 4KHUA 3A5NC 2X9HA 5LJ3e 1W0HA 3ZSOA 3JASA 3TAPA 4TUYA 2DXUA 5BRDA 3WGKA 5FU6B 4FOEA 2BE7D 4HXJA 1U2VA 2JMAA 2JM8A 3EG9B 3HPWA 2Y1JA 4FJLA 1B9FA 1CLQA 2G6FX 1MV0B 4KB0A 4CZLA 4NCAA 3R6OA 4FLVA 4HT8A 4J9IA 1VHXA 1VRUA 1VQLN 2V52B 5I42A 3VOVA 1AEYA 3HI0A 3Q7CA 2FBTA 5AQNA 3UKRA 1ZBLA 4HVJA 4DV7K 3CCMF 3VUZA 2V8IA 1ZA1B 3EEQA 5GIPA 5DCVA 4KB1A 1H8KA 1GL5A 1VQPA 4BRIA 2RQVA 3H1VX 2D1XA 3G71A 3VMFB 2HP0A 1RLPC 2Z1JA 2D6FA 4BRMA 3K5LA 3A98A 3QESA 3LZJA 2ZJQL
chains in the Genus database with same CATH topology
5A2QE 2Y4YA 1KC8O 1VQ7N 5FRNA 3DXKB 2B8AA 4KUIA 2RHKA 3BF3A 3NVMA 5AR0A 1GLAG 2QM1A 2D0QB 3AY9A 5AQWA 3HM8A 2WBNA 5EOYA 4M7AB 2E2PA 3CC4F 3JCMd 1KXPA 1Y71A 4HCZA 3CD6F 2A7YA 2E41A 2QA4T 3VJPA 5GANe 4C1NK 2J4RA 2JOYA 4PKIA 1W4SA 2BUDA 2YI1A 1MWKA 4BR2A 3I56N 3C6HA 4H0PA 4YOYA 3CCRA 4DA4A 5C6SA 3JB9D 1EIFA 3NMUA 3CHWA 1QZ5A 1XUPO 4IKFA 5BPLA 3PIPA 3C0BA 5I9EB 4C8QE 4C92D 2HD0A 5HXUA 3EFRA 1NPPA 1MGQA 2Q0RA 3MN9A 4M77G 2CZWA 3QFPA 3SAFA 5E84A 1YI2N 3O08A 3PLAA 4HKEA 4RG2A 3DXMB 3AARA 3I56T 2ZGZA 3WEEA 3RSEA 2K5FA 4BY9D 4OF1A 1EQYA 2A3ZA 1QVFM 4A53A 2GCXA 4JKHA 4M77C 3CMEA 2GLZA 4A4HA 1IPAA 3LX7A 1VQ5N 3GDQA 3H46O 4ILHA 3UB5A 2KG4A 2QWPA 5CR4A 1ZWZA 3G71F 1GLDG 4OB2B 3G6EN 2Q36A 5CKDA 1M8VA 2XDPA 1Z6RA 1S72T 2E2NA 1NJIH 2V7YA 3VKIA 5CK9A 3OYGA 4BDZA 2FL7A 2DZCA 3F2KA 5CQXA 5KH6A 2F9WA 1EO1A 3TTDA 4B1XB 4FSXA 5M1OA 1M9SA 4PJOA 3CQYA 2VUBA 3QHSA 4C8QG 3JCMP 1YAGA 2QWMA 4PL8A 4EMGA 4JK8A 3BDUA 1YJNT 3GF5A 1D3BA 3HL8A 2FHDA 1ILYA 3Q1JA 4JDSA 3ENOA 4IJNA 1YITN 5EY4A 1VQNN 4QS9A 3GL1A 3MEUA 1GLBG 2BH1A 3IKMA 3OYLA 2CKKA 3RERA 2FF3B 1YIJF 4JRKA 1E4FT 4C8QC 1QVGM 1GLJO 5AQIA 1TYQA 3OYEA 3KWGA 2O4XB 4L3QA 5AQQA 1KC8H 1BA0A 2E64A 2HF3A 4FWOA 1IZ6A 2HOEA 4N4HA 3CXCA 1Y64A 5ADXA 1YITT 2MAMA 1XOVA 3ON1A 3GIBA 2RHIA 3FLGA 4G9ZA 1WOQA 3LWOC 2KK4A 3I33A 5KCOA 1NLVA 4CI6A 5M1QA 3VTHA 3MX5A 3JCMg 2DD5A 3FC3A 1YHQA 3QBXA 3CCSA 5CKHA 4YOWA 4FU6A 2GF7A 1Q86C 2BUPA 4WFNL 3PFSA 4KH4A 3FDRA 1GLEG 3QDRB 2L5QA 4BB7A 1RLGA 1K8AU 3PAFA 3M5AA 1UB4A 1C0GA 4DOWA 5AQTA 3ENBA 3GOXA 4ILJA 2HQXA 3S6WA 4BR9A 4C4WC 3X28B 4C0GA 1HKCA 4M77D 4X3MA 5CR2A 3M59A 3SFMA 3OYDA 2OANA 4PJOF 4CZJA 2R57A 2G3RA 2LTOA 1M1KC 5KPTA 1VQKT 2Q31A 3CCEN 1K73U 3CC2N 4FWQA 4JKAA 4BRLA 1SSFA 2EYQA 2A3LA 4X3LA 5AFUA 3MN5A 1DEJA 3MP1A 3CPWM 2X35A 3N5BB 3TPQA 4FPAA 2OTLA 1XTDA 2D0OA 3WQTA 1BIAA 2VGNA 5GMKe 3KXTA 2KTVA 1KQ2A 3HFNA 3MEVA 3CCMN 3CXCF 2JNGA 4J7IA 1PSEA 2VV5A 3LYIA 3KZBA 4FWNA 4B1UB 2VYTA 1S22A 4B1WB 2P9UB 2ZJRL 3D6RA 3R8EA 1X7OA 4EMKA 1R59O 4J6XA 5KPZA 4H0TB 3VV0A 2ZF5O 1YHQF 2E65A 3CCSF 1K9MU 4C8QD 5AQVA 4BW0B 2DZ9A 4ELZC 3OYHA 2VYPA 3SMSA 5GAN7 2HBMA 2XD0A 1Q82H 3CCMT 5LJ3d 4C0DC 4OGCA 3L0QA 4BRHA 3HRUA 5GAGP 2GWJA 2R58A 1NM1A 3CC4N 4JRQA 4JRIA 1NBWA 4KH5A 2DO3A 5CKBA 1YBYA 5JICA 4M7DB 4CBWA 1QVPA 5LJ5h 5GIPC 2D9TA 4BE1A 4JNEA 5KQDA 2LVMA 3VTIA 4ISFA 3GPLA 1ZC6A 2FF6A 2QXLA 3A8OB 3EL2A 2MWPA 2CH5A 2Q1NA 4ZN1A 3CC4T 5AQOA 3CBMA 3ATVA 3O9RA 3DXKA 2QQAA 1H7MA 4H0YB 1QVFA 2HBKA 3CJCA 3D00A 2XIDA 2C06A 4NL3A 3WUHA 2PBDA 2M1HA 4RG8A 5AQPA 3UDCA 3QYHB 4M7AA 3E9GA 2M9UA 2XKOC 3LW5E 2P0PA 4PJOE 1Q7YH 1S72A 5GAN5 4IOAL 2OTLF 4QQDA 5D6WA 3J8AA 4LC9B 5GIOA 1WQWA 3C4SA 2RA2A 1MHNA 4RKUE 2RK2A 5GANd 3DAWA 5GAPK 2IVWA 3FFMA 3NMUC 2AP1A 1VQPN 4WYBA 2DIGA 3U4LA 3G71N 1WJQA 1Y07A 3F70A 4ELYC 4IXCA 3E9OA 3RMQA 3QO3A 3JB9I 2QA4F 1YJNA 4CZKA 4J6WA 2ZWHA 1VQ6A 2HVYD 3EN9A 1ZXOA 3PLAC 3DXMA 4QVZA 4BI3A 5G4VC 2RJEA 1VQPT 2F7TA 2YJFA 4J8OA 4EHUA 2KKZA 4FOIA 3E20B 2LC4A 2EQJA 3QYGB 4YOUA 1E4GT 4IDHA 1Z05A 3DKMA 4BDYA 1T6CA 3WXLA 3F5TA 2QDYB 2Y4XA 1NGJA 1LOJA 1N6AA 3L2RA 3LWQC 3MEWA 2P9KB 1K8AO 2XK0A 2DAQA 2EAYA 4PJOG 4RCCA 4R79A 2WC9A 2KDSA 4KT0E 4NLBA 1QVFF 2CYZB 3CPFA 3SBGA 1KD1C 1QQNA 1P90A 1Q81C 2ITMA 3BEXA 2QW9A 4M7AF 2E12A 3CCRT 3ULEB 2DTHA 3Q7BA 4TZZA 2E10A 5LJ3g 1S72F 2LBXA 4PJOC 3GYQA 2EFIA 3VGMA 2DXBA 2K4YA 3H1QA 3O1WA 1N8RC 2M0OA 3JCMf 3RIRA 5D6YA 3OW2A 3D2EB 4BUGA 3FLCO 4BVRA 2JZ2A 4PKHA 5I21A 4BC2A 4FWMA 4WF2A 4FT4A 2MWOA 4GY5A 2D4WA 3NTIA 4XK8E 4PL6A 3JCMV 4F7UE 1VQKA 4GV3A 1YJNF 2I2LA 2LRQA 2O4XA 3CMET 3OW2S 2ALEA 3PIOL 2RHXA 2PFUA 1VQ8T 1G5VA 2ZJPL 4E7KA 2RO0A 2PVOB 4R56A 2P9LB 1X6OA 1RI0A 3QZ9B 3OY9A 3CPWA 3ZFJA 1P8ZA 2BTFA 2JUFA 3A8HB 3C94A 3VENA 1QVGF 1YITF 3ATUA 3LWVC 4JAXA 4OB3B 3E9PA 3BDLA 5GANg 3AGKA 1GO1A 3HJWC 2OTJT 3EE9A 4CZFA 4C23A 1HX1A 2FLOA 3P4IA 1PXWA 4B1ZA 3VGLA 3N4ZA 2YHXA 5KPRA 3I8BA 3NVKE 3BW1A 1M1KU 3P38A 5M1FA 5C0MA 5GAN2 4JHDB 3FFKB 4CI0C 1YHQN 5HY2A 2VC8A 3CCSN 2YX6A 3CPQA 4QW2A 4XTZA 3PNWC 3JCMh 3URGA 1ATRA 3L2QA 3N4PA 1ZQ1A 3H45C 4KH6A 4A2BA 5TKWA 2FC3A 1LNXA 1VQKF 3L4QA 3SWNB 4F7UB 3MCPA 1BDGA 3OSSC 5EO3A 4PKGA 1NMDA 4PJOD 3TU5A 3WXJA 3UWNA 4KBOA 1YHQT 4E7JA 2A40A 3EO3A 3X25B 3OQ5A 5CVIA 3CCLT 2L89A 3LDNA 4IFEA 5F2RA 5AZJB 4C92B 1W2BS 3S41A 2P9UA 3A8GB 3VUBA 4O6JA 5JLHA 4EMKC 3H8ZA 3KUFA 3CPWF 1LOTB 4WF9L 5GAN4 1K8KB 3M54A 3O9SA 1K9MC 3ID8A 2LNVA 3GOIA 3LH0A 3JB9H 3O9TA 1KAZA 3EE8A 5FU6C 4LDYA 4JKGB 1CN7A 3CCQT 3O8MA 3EFSA 1X75C 5J3BA 1QP3A 2OTLN 2P0QA 2X4WA 1JJ2S 2FB7A 1Y96B 4M7DA 4E7IA 3LWHA 1M90C 1J6ZA 4FSVA 4Y28E 3H3NO 3QPHA 3ZETB 5HY4A 1T6DA 4NO7A 4M7AG 2IVNA 3MWTA 3M57A 1QQMA 2Y90A 4H0XB 4JUVA 2E2OA 3O5BA 5EXWA 1VQ4T 2QA4N 3M53A 1U1SA 2OTLT 4ZTFA 2YRVA 5EVZA 3QKJA 4XTVA 5AQLA 4L59A 3RKYA 4OGEA 1WJRA 4MO5A 2YHYA 4M7AC 4IUPA 3HRTA 5B8HA 2RJFA 4LCKA 3R9PA 2E8AA 2K3YA 3SD4A 4CZMA 3OBYA 5GIOC 5GAOn 5FPDA 3QICA 3JCMM 3BF1A 5C2FA 4DQ8A 3L1AA 3J81M 3HP9A 3HRSA 2E70A 4C5GA 3SJHA 5AQUA 5BPNA 1VIFA 2Q0UA 3WXKA 3A8LB 4MO4A 3CBOA 1QP2A 5GADP 4A57A 4K43A 4BR5A 2V8JA 2DPPB 3QIIA 3SIVA 5AQFA 3MWPA 4GY2B 3HOTA 2ZPBB 3M56A 3SBTA 1SZ2A 3ZBDA 3JCMQ 4BRDA 4MZTA 4DKWA 1S72N 5LJ3f 2IG0A 3PGGA 4MZPA 2NNWA 3NFCA 5GMKl 1V4TA 3H3OB 4NOYA 2HSTA 1Q86O 2EQMA 3MEAA 1VQ8A 4M7DF 2GUPA 3AHUA 1VQOT 1VQPF 4R55A 3NK7A 4LD6A 3CCVT 4AM7A 5G4UC 1NMUB 3OYNA 4BRCA 2P9KA 5FU7B 1I4K1 1TUYA 3CBPA 4QVCA 3V7SA 3CCJA 1KD1U 1YJNN 4M7XA 4NUTA 2F5TX 1Q81U 3JSCA 3VESA 1ATNA 2ASOA 4L5GA 3AGRA 2PAVA 1W42A 1O75A 1UGQB 4EI9A 3VYHB 2OTJA 2M16A 3CF5L 2NRTA 4BRFA 4CBUA 3CG6A 1M1KO 1RGIA 1N8RU 1YXQA 2I7NA 1W41A 3RA5A 3K9JA 1VQ9A 1BG3A 2QTXA 5GMKm 4JKCA 1VQ6T 2VXFA 2MI6A 3D2EA 3IMXA 3CCRF 1U6ZA 3IFRA 4FWRA 2XU8A 2LX9A 5CO7A 4AF1A 3ID6A 5AYFA 1QQOA 2DTOA 5GANf 3AAQA 4M7AD 4II1A 4XAXB 2NRZA 4A4FA 4HWIA 3ZX3A 3LWRC 1WQ7A 4RMOA 1M1FA 4RWTA 1O9SA 2ZPHB 3FZHA 3PTAA 4B9XA 3P8DA 4E7LA 3CETA 1WNLA 4BQLA 1D4XA 4QS7A 2P9LA 2WACA 4BRQA 4N4GA 3L2UA 4IUTA 3JCMX 2JWLA 3CMEF 3VEOA 4M78E 5LJ3h 2WFBA 1VQ8F 4XTXA 5KE2A 4MZMA 3CCLA 4IO8A 2P9NB 4XH5A 1NGHA 3VU3C 3ZYYX 4OO1J 3O85A 2KMTA 3O8VA 3OMGA 5DY9A 2DJZA 1GZ0A 1VQKN 3OW2M 3M4GA 1RDWX 3G25A 3OYKA 4JN4A 4JKEA 4M7DE 1KAXA 4MDAA 4JK9A 3ZEHA 5M1PA 4ZGDB 3C12A 2BIVA 4H03B 4QVDA 2AA4A 2E5QA 2K57A 4XU0A 3M3ZA 2V51B 3CCQA 3HTVA 2OTJF 5GAOp 4BI8B 5GAN3 3CC7A 2ASPA 3W0LA 3O9UA 1WPYA 3P8HA 3A8YA 4IJAA 2RHZA 4H5TA 4JHDA 1WGSA 4BG9A 1VQ9F 3CQXA 3G7ZA 3JCMb 1Q86H 3S3MA 3JS6A 3OA6A 4EIAA 5KCHA 5DLOA 4EAHD 4HA8A 3ZEUB 3NK6A 1VQMT 1VQ4A 3FRNA 5GANh 3HHTB 3EZWA 4BC5A 3SWNA 4F7UA 4BRGA 1Y7XA 5LY3A 4JD2B 3U9DA 4BQZA 1X3MA 5MLCQ 4JLIA 1NGCA 2QEXA 1Q82C 3T7ZA 2CGHA 2RHUA 2PUKB 1T3VA 5A0DA 2Q2RA 5AZJA 4C92A 2CGLA 4HTLA 4WQ5A 1TUUA 4O5VA 2XHCA 3TSPA 1I5LA 2RH2A 1XQHA 4EHTA 5AQKA 2OHWA 1K8KA 3OMCA 3QBWA 4H5VA 2H3GX 1B34B 5LJVA 4O8KA 4M78B 1M1KH 2DVEA 1S3XA 3CCLF 2VGMA 4A59A 4M7DG 4F9OA 4NS5A 3LGLA 3L2ZA 4RCBA 5M1KA 4JKGA 3OS2A 2E88A 2RJDA 3HSBA 2DTIA 2YCHA 4K25A 3EAEA 5C2DA 1G3YA 4XU2A 2R5MA 1Y96A 2X4JA 5J26A 1M90U 3FZMA 5GAN6 4M7DC 1W2BM 3VEZA 3TSQA 4AM6A 3INZA 5I2SA 4BGAA 1X3NA 3CCQF 1Q7YC 3HRGA 5HXZA 3ZETA 4MMKA 4JS5A 3NVKA 2JWKA 2A42A 3HFOA 5IAYA 4IOXA 3J7AR 3MCAB 4DB3A 1BKBA 2HBJA 1KD1O 3KWIA 4E1JA 4JRPA 5IT9E 1YUWA 3OS1A 1VQOA 1Q81O 4BREA 3HZ6A 2I7PA 3HKSA 3CCVA 1HKBA 4D6WA 4XCQA 4X9DA 3I55A 2P0KA 5HK3A 2CS7A 1IG8A 2LT1A 4ZTJA 1VQ4F 1JJ2M 3M4YA 4F7UF 4FT2A 2FGYA 1N8RO 3KVGA 1XQSC 2QEXF 2P9IB 2RK1A 1VIEA 4LDVA 2ZGYA 2DK3A 2EKOA 4E7HA 1DT9A 4FL6A 3GP8A 1LCUA 3VEWA 4XH1A 1BOTO 3PIOA 1T44A 2KY9A 5GAMj 3GNFB 5LJ5j 3CJBA 4PL7A 1KHCA 1SDSA 5AQGA 3QJYA 4VUBA 3VF4A 3L42A 2QWQA 4A62A 4NB4A 3OYCA 1H641 2GFUA 1YVNA 2F9ZC 3U8XA 4YOXA 4LDWA 4XTUA 3K9KA 3WVDB 4IUQA 4BR4A 2K3XA 1VUBA 5FLXE 3CCRN 4Y91A 3DB4A 1T0KB 3FZLA 2RB6A 4MDBA 3GNGA 4JS4A 3J7AF 4X34A 2CZ6B 5AQHA 2E2QA 3BP8A 3OA9A 4XU1A 1HK9A 3VF2A 3DLLA 2NLXA 3LWPC 1VQOF 2PVDB 4M75B 2LT4A 3G4SA 4BR0A 3CCVF 4CZGA 3FE1A 3M1FA 2EQKA 2BO1A 1RFQA 3BY7A 4M7DD 4ZN3A 5AQXA 4A4GA 3OYAA 1BI0A 5GAMd 5LJ5d 3SLCA 4ISEA 3V7RA 2XG8D 1BI2A 1BIBA 3CMEN 4PLIA 5GAN8 4A5AA 1K73O 3O4WA 3HOSA 3J80M 1VQ8N 3CJAA 3RVCA 3R3LA 2ZPEB 3P8BB 4GNIA 4FVUA 2I6DA 2X4YA 4BVTA 5DM7R 1N9RA 3FZKA 1FWZA 3T69A 5GMKh 3TCJA 3KBGA 4JKBA 4ZGEB 4A4EA 5CAIA 1VQ6F 3CCJN 5AQMA 4K42A 4XU3A 2F69A 5GMKi 4C92E 3DJCA 4PKCC 2YHTA 2A41A 2LQ8A 1VQMA 3ENHA 5HY0A 4A61A 2P4TA 2OTJN 2EIFA 2LDMA 1KQSM 5GINA 1ZBSA 2CH6A 3MO8A 3CCUA 1VAZA 3VF6A 5IT9M 1K9MO 2HQEA 3L4IA 1LJOA 3CCJT 4FWKA 2QWOA 1N8RH 1VQ9N 2RI3A 4ME7A 5HY6A 2P9NA 3A8MB 3RESA 2YLBA 4CRIA 3META 3LM2A 2HMPA 1X9JA 4WCEL 4BD3A 2EQUA 4BROA 2QQBA 4KBMB 2EWSA 3V8JA 2QWRA 3J81E 3QDKA 2HF4A 4ISGA 3VETA 2ASMA 3RA6A 2RM4A 2HBLA 4BE2A 1I8FA 3V7EA 3OB9A 3MP6A 4TVRA 4GVEA 4OP0A 1M90O 3U9ZA 2ZZDA 2OZBA 1VQ9T 3DLLL 1HLUA 3UT1A 5BN8A 5ADXH