4O4HB

Tubulin-laulimalide complex
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
430
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of microtubule stabilization by laulimalide and peloruside a.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle/inhibitor
molecule keywords Tubulin alpha-1B chain
total genus 172
structure length 426
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4o4hB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4o4hB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4o4hB01
5J2UA 4KWEA 3JATB 1W5BA 3HKBA 4ZI7B 5LOVA 1RLUA 2VXYA 4ZOLA 1TUBA 1Z5VA 4IIJB 3JAKA 5BMVB 4O4LA 3JASB 4O4LB 1Z5WA 4TUYA 3UT5B 4O4HA 5LXTB 4O2AA 5EZYA 5J2TB 3VOBA 3JATA 4X1IB 4TV9A 2BTOA 5LA6A 1RQ7A 5LOVB 3HKCB 4O2BB 3HKEB 5JVDA 1TVKA 5CA1B 4EI7A 4EB6B 2VAMA 3WGJA 4O4IA 5IYZB 3JASA 1W5AA 5IYZA 5CA0A 5IJ0B 2R751 3HKDB 4HNAA 3HKDA 4IHJA 1FFXA 5JCOA 4DRXA 5LA6B 3VO8A 5C8YA 4TV9B 4X1KB 3JARB 5MN6A 4O2BA 3HKCA 5EYPB 3ZBPA 4X20A 3WGLA 4EB6A 4DXDA 3RYHA 5JQGA 4YJ2A 2R6R1 5JCOC 3JAWA 4WBNA 1FFXB 4IHJB 4O4HB 5EIBC 5LP6C 4M8IA 5LYJB 5EIBD 3RYIB 3N2KB 4I4TA 3JARA 4YJ3A 5JVDB 1TUBB 5IJ9B 5MN4A 3R4VA 2RHOA 2BTQA 4X1YA 2Q1YA 5CB4B 3JAWB 5CB4A 5LXTA 1OFUA 3M89A 5LYJA 4U3JA 4X1IA 3RYCA 3N2KA 3CB2A 4YJ3B 5IJ9A 2VAPA 4X20B 3HKEA 3N2GB 5EYPA 3E22B 4ZHQA 1FSZA 1JFFB 3JAKB 5BMVA 1JFFA 1W59A 3VOAA 2GVIA 4XCQA 3UT5A 1RQ2A 3VO9A 4WBNB 5EZYB 5ITZB 5LP6A 1W581 4LNUA 2XKBA 3RYCB 3ZIDA 5C8YB 4ZOLB 5M7EA 4TV8A 5JH7B 1TVKB 5CA1A 5KMGB 4FFBB 4B45A 5GONA 4F6RA 4HNAB 2VAWA 4I50A 4I50B 4EI9A 1SA0B 5J2TA 5FNVB 5LP6B 4O2AB 1W5EA 3JALA 3M8KA 3WGNA 4I4TB 4X1KA 3RYFB 5KX5B 5JH7A 4ZHQB 3ZBQA 4FFBA 3N2GA 5JQGB 4EI8A 5IJ0A 2RHHA 5CA0B 4I55A 3C8LA 1SA0A 5J2UB 4U3JB 4LNUB 3JALB 5ITZA 4DRXB 3RYIA 3HKBB 4ZI7A 4B46A 5MN5A 3RB8A 3RYFA 4IIJA 5KX5A 1W5FA 3WGKA 4E6EA 4TV8B 4O4JA 4O4JB 2RHJA 3E22A 4O4IB 5KMGA 4YJ2B 2RHLA 2BTQB 4X1YB 3RYHB 3V3TA 4TUYB 3VPAA 4F6RB 4I55B 5GONB 2Q1XA 4U39A 3WGMA 5FNVA 2XKAA
chains in the Genus database with same CATH superfamily
3D0QA 5CYGA 2QTAA 2HS3A 4N5IX 5LOVA 1CZNA 2IY7A 3PPWA 2NU6A 3S03A 4WE3A 1P3Y1 5DHRA 3DUFA 3E7DA 1LR1A 2YXHA 1VYTA 2CNWD 3OCWA 4G2TA 1KE2A 3N74A 1S8NA 1OCRC 2P4UA 4BKRA 5BN3B 5FBWB 1TLFA 1IBMB 1KGSA 4Q7KA 4QJFB 3QBDA 5CAEB 3V55A 3W5SA 4EG7A 1AHPA 3AK2A 2VBFA 2W6IA 4GLBA 1TYAE 4DAEA 5I7UA 1L4BA 3DOCA 1LS1A 2J9FB 3OZSA 1YZUA 2BEWB 3RQSA 4FUQA 3CC7F 2JGFA 1OILA 4C88A 1J2JA 3AR4A 5KCZA 4ITVA 1TVEA 2ISSD 1CDDA 1QH8A 3G13A 4GQIA 4MUIA 3TBHA 1JRLA 4DJAA 3AF2A 2ZANA 1EDDA 2VCYA 2UYJA 1NTZH 1L0NH 4G0YA 3ZYZA 4Q9NA 3G8CA 1NXOA 3PC6A 1I30A 1V8OA 2G4LA 1H2WA 2QDOA 2EIKB 1UPTA 2F1IA 2OK8A 4G1BA 4NP6A 3VYWA 4PX9A 1IDSA 2BRUC 5SZHB 1VBFA 4DMLA 5ALKA 4D1YA 2J5BA 4UNQA 1TI7A 3TB6A 4EYQA 3MTQA 1P17A 3T5TA 1QS0A 3KK0A 4FLXA 1RFGE 4LKOA 1IN4A 4DMFA 4F6LA 1YAHA 5HOEA 1GD1O 2CLFB 3L7JA 4J0JA 4MS4B 2VLIA 4MUEA 3V2HA 5HY1A 5E6UB 2M6RA 5A05A 1Q0SA 4JDPA 1OH6A 2ZAUA 3S2YA 3JQAD 1MFZA 1QP4A 1W2WB 2FDRA 2ZUTA 3H01A 3VI4B 4BO9A 4JOQA 2R8YA 5FCDA 2A9FA 4JYMA 1KMMA 1PZXA 2A5LA 2JASA 3KV1A 3LIPA 4MWGA 5BSUA 1TA4A 4YX9A 3HU2A 3RJZA 3MQWA 3S99A 2GN6A 2QSYA 3COWA 3PG5A 1DLBA 3LW7A 3KL4A 1DGQA 4MAFA 4TLLB 2K9PA 1WG8A 1ZD1A 2VF7A 2I55A 2XOKG 2VDUE 3DO8A 4YMVA 5K6TA 1PS8A 4FYIA 1T0KB 1HNZO 4WNYA 3B51X 4IQ4A 1U8UA 3ZUPA 1N0JA 4O4LF 3UW3A 1Q3KA 1JE1A 2Z5GA 2Q2OA 3IS3A 5HIMA 3NVIB 3UHPA 4DXAA 3B2EA 1TYBE 1GO1A 2VS1A 4W9NA 3SIRA 4B6FA 5CA1F 2VDWB 5ALUA 3FTCA 1NI3A 1U0OC 3E1GA 1W36B 4TXNA 2QLBA 4U6QA 1GLGA 2FPGB 5FV4A 4WFBV 1D4OA 4KJXA 3M6IA 3CJQA 3F7NA 3FB5C 1JFTA 5LP6B 3EY9A 1I36A 3A70A 3QUCA 4QNMA 3X2EA 1T6ZA 4JHLA 3MPUA 3ZD8A 4DZRA 1B93A 2AHZA 2RKWA 4FXPA 1T4CB 2BGMA 1RWOA 5G0WA 2X6CA 3DMHA 4S12A 2BZ0A 1RWPA 3KXIA 4IJ6A 3D4PA 3RC8A 3LCMA 2AHYA 4OGQB 2CLMB 3K70D 1IY9A 3NYRA 4ETMA 4I2VA 1D5WA 1VXRA 1UBEA 2PMEA 4DSAA 2Z9BA 4BEBA 3QPAA 4DRXB 1G5IA 2OAP1 4GMKA 4EG3A 5DNUA 1QTNA 3RAPR 4N7RA 2AIFA 1KUQA 1FNSA 2QM4A 1G16A 2C1EA 2QUKA 2VLBA 5IKOA 5TQ2B 3UVEA 1VCMA 4ZICA 3V6MA 3SZUA 1FK8A 1E94E 1ZA2A 3A9SA 3I3OA 3KT8A 3WNQA 5LUBA 2YIMA 4HYEA 1C9NA 4EMSA 2QGNA 1TADA 5AO9A 3ZCPA 3CISA 1SHKA 2PFGA 2WKRA 3CZ5A 5JG7A 8ADHA 2V5UA 1X7OA 2RMKB 3OIYA 2QPOA 3KKNA 1PR6A 4BPRA 4J90A 1SCKA 3BIXA 1CQIB 1CFJA 3I76A 5K3AA 4IV8A 3RI3A 3V7FA 2HP3A 4FBMA 3LBAA 3WOVA 4JLOA 2O3JA 2RGAA 5E7QA 3UWOA 4B2LA 1BG6A 2G06A 2CGOA 2V7GA 1EGAA 2I3ZA 2X0NA 4DM7A 3MIIA 1Q7YW 3DC2A 3C7TA 2HT1A 2IYFA 3NVKI 3KVOA 1I5YA 2KS6A 4V03A 1GRVA 3TFQA 3ADKA 4IHAA 5M2QA 1YQGA 1L1RA 2QE6A 3VM6A 4AF7A 3PLAC 3CF2A 2ZTVA 3AEUB 1E77A 4RHTA 4C5AA 1OU4A 1YB2A 1JLRA 5IVHA 5FYDA 1BN6A 1O97C 2VTVA 4NBRA 4ZCLA 3QYPA 4IHJA 3NALA 2NU8A 1Z8NA 2QTVA 5LQAA 4D7TA 5FR2A 1NF8A 1U2GC 4CM4A 1KQSF 3FNFA 2DCMA 2ZDQA 1H93A 1VH8A 1NSFA 3CNBA 1PTKA 3I2GA 4F60A 1L5GB 1JH9A 2YV5A 1UH5A 1N7HA 3TR5A 1P45A 2R6R1 3GXOA 4KC0A 2QE7G 4FINA 2CLLB 1DEAA 4LQ4A 2A2ZA 2OK7A 4W7IA 1N5MA 3BHPA 1XL0A 4FI3F 3OTOB 1G9TA 1XMOB 1E9FA 1EFDN 1I1HA 2GPYA 2W0SA 4J3JA 3TTWA 5AVUA 3UIEA 3AHEA 1NNSA 3ZV7A 5AYVA 2C7GA 1H6BA 1SERA 2BCCH 1F6DA 4EY6A 4RUKA 1Q77A 2HSWA 5TPZD 3W2EA 1O94D 1ZRSA 3FOAA 2TMYA 3PJEA 4TS4A 2VJMA 3IP6A 2JVIA 3SPGA 4WK2B 3B6IA 4OXQA 4MVOA 2A0FA 2IV3A 5B6JA 2XE8A 2J5XA 1WTCA 4BDTA 3ZRWB 1KC8H 4P4LA 4MPJA 9ATCA 2NTVA 3VR3A 4JLDA 2Y1DA 1WZEA 4CE6A 4F72A 1JN0A 4A6XA 1A4XA 4Q15A 2PO7A 4ASUA 2C2HA 3R7AA 1E4YA 3B7GA 2VKTA 1T13A 4IOKA 5KWIA 1W34A 1YA4A 2JGNA 1E92A 4WJZA 5FLKA 1AH2A 1C2TA 1O4WA 3AUSA 4N0MA 3VJKA 1Y74A 4HLCA 4ER5A 2PV0A 4MPRA 1E1QG 1ENOA 2LRHA 1JJOA 5DMHA 5E3HA 1IQUA 4MQ5A 3RC9A 3AHIA 1MQ8B 3L49A 4MV3A 1NU6A 2XWQA 4NFLA 2PL9A 1W0KD 3LUBA 2AIZP 2FN3A 2O3UA 4KP4A 3A28A 1KD1W 1M0SA 3GNQA 4E5NA 4V39A 4OPAA 1Q7CA 2NXEA 1WBJB 4J1TC 3TI9A 1S01A 1W1UA 1JG1A 2EBWA 3TSCA 2X5OA 3ENQA 3HCRA 4BQPA 2WUGA 1WDMA 2IFTA 3IAXA 3NS7A 1PD3A 3FZNA 3MCAA 4PR3A 3V7UA 3ZCQA 3LOQA 1FS5A 4C06A 3ZBQA 3G8DA 1I5OA 4P4SA 4DILA 2QQGA 1Z33A 3COPA 3QYFA 1Y6RA 4MJ7A 1P1RA 1ZWKA 4AILC 2WVJA 4WT7A 4CU2A 4YRMA 5HKAA 2HFEC 1TYCA 2P5UA 1Z0DA 3K0EA 3T3PB 3U56A 3BBPA 1HDXA 3SYOA 2OB2A 4RJKA 2QU8A 3TGPA 4KV9A 1NBOA 4PO3X 2ZWOA 4DNOA 3IBCA 3HFSA 3EEOA 3TEJA 4NXMO 5CT5A 2Y2VA 4LHXA 1YJ9V 4GL2A 4OHUA 5GONB 2FWPA 2NLOA 3H05A 4MYDA 1QQ6A 2DWUA 4ITRC 3IDFA 4TSKA 4UDXX 4ZEXA 2WIDA 4C7BA 4YAWA 1YO6A 2TSYB 1N92A 1LBIA 4R2IA 1IV3A 5AVRA 4HAZA 3X2QB 5JJJB 4QKQA 4HDMB 3WI7A 2ZJ3A 1F4PA 1KIAA 5E2BA 5EWLB 3CWZA 3RSHA 3FBTA 4HQFA 2F4VB 3N4YA 2X7JA 2ORVA 3T9AA 1VGRA 5JATA 3MRTA 1D1SA 2YY5A 3KSDO 3LUGA 2AFHB 2HA6A 4LXGA 4OHOA 3UJNA 1OCRB 1KS2A 1W49A 4RTPA 4BNZA 1N34B 1OA0A 2FMFA 3NR2A 1C5KA 3N0TA 5LOVB 1U2TA 4BQIA 1Z5OA 1MXHA 3HPQA 1LPMA 5EJ8A 2WB4A 2Y1LA 1UT5A 5EIHA 5L3DA 3EGXA 5FBKA 1E9CA 1KYWA 3W05A 3HWX1 3MDOA 1W88B 1PWYE 2D4AA 3E9MA 1RXCA 3OOYA 4DJEC 1CNMA 2GFHA 1VQLV 4NV1A 3K58A 3WSVA 1RJ9A 3LWBA 4BMSA 3ENZA 3PSAA 3N0XA 1WS6A 2X86A 3UOGA 2Q0SA 4F5YA 3O2NA 5KTSA 1FDIA 3QSYA 1JEYB 1DOZA 1N5DA 1G3UA 3RAJA 3GLUA 4TKUB 1A7JA 3L8HA 5DOVA 4BT5A 1P62B 3U3JA 4JI2B 4UMDA 5EIBC 2JFUA 5BQXA 3AY0A 3VOUA 2QQFA 3PP8A 3E61A 1H5NA 2IEAA 4G97A 3D4LA 4UEOA 5HUJA 1PPJH 1G2QA 5LQMA 2QZJA 4CS3A 3E8MA 4QUEA 1U97A 1IBMO 1DLIA 4X60A 5J5AA 2J9RA 3GA7A 5L3SA 1CUBA 1IXKA 2YFKA 3STHA 3FFXA 1OZFA 1GSIA 3M2TA 2AG1A 3U4MA 1P1JA 4Z51A 2VP9A 4J1TA 4P3OA 3K2XA 2MR5A 4TMTA 2R68A 3VIUA 2ZUDA 4KQJA 4Y18A 2VPYA 5CU7A 3G6EF 4JJEA 3ZK8A 1I8TA 4OLAA 2H00A 3NZEA 5HKKA 1DT3A 1K8RA 3N2GB 3BRWA 5L3ZA 4QUAA 1VOTA 4MTFA 3H1GA 4M4SA 5I7HA 1BFKA 1I4LD 2QF7A 1NH2B 3BIJA 4QO8A 1CCWA 1NM5C 2ZRDA 3CCBA 2MW2B 1OXMA 3TJRA 1MC8A 4QGHA 4QEKA 3TRIA 1RTTA 1W87A 2GCEA 3WG7C 2OMEA 4MPTA 4JI8B 4GYJA 1SKYB 3JRXA 4JLMA 3EH2A 3IILA 5EQDA 3RK0A 3SKYA 4IICA 1K88A 2V7WA 4F9FA 1KKDA 4DR6O 1TVKB 1E3QA 2GPSA 3DOJA 4HDOB 3EXHA 3REQB 3GFBA 4W8HA 1FU8A 1M2FA 2AEMA 5KCMA 3HVHA 3D6HA 4OQMA 2E37A 3Q5GA 3KQOA 1HTTA 4DR7O 1W5EA 2ESRA 4P08A 4UVDA 1DU4A 5HNKA 3ODPA 1YVDA 3V8VA 2HVJC 1NQAO 5ITWA 2PS9A 3K9NA 4PX5A 3EZ2A 3WIVA 4KN8A 4BAGA 4AJ9A 3C1OA 3X1YA 3T1TA 3ZMTA 1NI4B 2WF8A 2WYVA 3HGQA 3QJ5A 4G0XA 4NCNA 5EK0A 5JE8A 5AVXA 4XDHA 4CLRB 1G42A 2A94A 4NZOA 4QXAA 1X9GA 2INGX 5SV2A 3JALB 3WGGA 1NVVQ 3QE4A 4NZ9A 2RK6A 2JGEA 3DTYA 1AB6A 1XBTA 1LBTA 1X7ZB 1E63A 2JC3A 3UK2A 4F2DA 4LCUC 2P30A 2FGYA 3R66A 3IIMA 4NJMB 4ZD6A 1DP4A 1FLAA 1I24A 2BGGA 1D9XA 1E4VA 3Q2OA 3W9SA 3D64A 1YSCA 3ASVA 5H3CA 5HG0A 3TNFA 1F8GA 2EQ5A 3ZW9A 3HCPA 3K16A 5HQ3B 1DAHA 1QFMA 4F3CA 4G36A 1AR5A 1UDAA 4LSZA 1W44A 4DV7O 2IEYA 5FBHA 2V9PA 5CXQA 2W98A 2F17A 3KR2A 5PNTA 1U65A 1QB7A 2QVZX 3LC2O 2ID7A 4M7RA 2QIPA 3C4VA 1BHQ1 2Z09A 4XDKA 1OY1A 3MEQA 1QFJA 4ONEA 4Z1MA 3E9ZA 1QV7A 1TQ4A 1XZHA 3M83A 3EWAA 3ZX5A 1MQSA 3QFRA 4OUDB 3WSTA 3TI7A 4ZZIA 2QVLA 1CJVC 4XQEA 3H1LH 2VFAA 3PCTA 2IPXA 3JQBC 3W9BA 4FN5A 3RHFA 1USVA 1KETA 1AVTA 2ZE6A 3QTYA 4CGYA 3D7KA 4E4RA 1XREA 3UJDA 2UXBO 3WRXA 3AUAA 3B52X 4MS3A 2AEEA 5ESWA 4CTJA 3RS2A 1U7XA 4N1AA 2P8SA 2C2AA 4Q93A 2FSIA 1G2IA 2SICE 4B4WA 3ETLA 4ZO4A 5DU2A 4WF9V 3IV7A 1QHHB 1YU6A 2C9DA 4MUMA 2JK5C 2RB5A 1ZIYA 2PG3A 4HGPA 3FZYA 2WYHA 3FGNA 4OKSA 4TRNA 3N76A 4JAVC 2MYTA 3W77A 3LQKA 4AZTA 1K8AH 1P2TA 5DT2A 1JVMA 1H6CA 2Q5CA 4J0IA 2ZYUX 4M9XA 3J81N 3CCVF 1V45E 3CRZA 3CUVA 3N2KB 3DTNA 3FR8A 3HC7A 1BS9A 5A0FA 2WLMA 4I4TA 2Z9CA 3RUPA 3CF4A 3VKWA 4K3VA 3DCYA 4PZPA 2C83A 4YFYA 5D6NA 1XZKA 3RBAA 3AKYA 1Z62A 3ZGOA 4NR1A 4NQZA 4OLBA 1CVRA 2NTJA 1ZG3A 4UDNA 3MAGA 3Q7TA 4OQEA 3ZXXA 1S2MA 4NULA 5KOHB 3VA7A 1M56B 1GTSA 3ZD6A 3Q7QA 2QZSA 1KARA 1SCJA 4R98A 5IAGA 4W82A 1R5NA 3ZWAA 4CFZA 1YKSA 1O8BA 2Q3HA 5DTRA 2QTNA 1BMQA 1SVUA 1NSTA 2F1JA 1XZCA 2JI6A 2MJLA 1MW8X 4X20B 4BVSA 2LZ0A 3IMEA 3ROZA 5LZ9A 2HA7A 3GLGA 2CYBA 1VQ7V 4TGLA 2IM9A 5KYYB 3DEAA 2QIOA 1F1BA 3U7JA 1CP3A 3Q5EA 3UO8B 2HADA 3T3EA 4AURA 5FWYA 3FPCA 1XQXA 4KQXA 1A98A 3G6KA 3ZTYA 4JFRA 4UU1A 3TD6A 5DP1A 3V8QA 1Z4MA 3OM9A 4LPKA 4OJYA 1UOQA 4N0DA 2J5RA 4B8YA 2XBMA 3FYUC 3WIOA 3WZMA 1L5FA 5H70A 3RS4A 3UK0A 4EFKA 4S05A 1Q12A 3GWZA 4AMUA 4NKRA 3P97A 1KBHA 4BCBA 2RGCA 5EJMA 4Z6KA 4B43A 5B7QA 3L8EA 1M2VB 1X9HA 1QC5B 1Z17A 4WZZA 1HLFA 2YS8A 3BA9A 1U5BA 2OAQ1 2OXTA 4C30A 1S7CA 4OP2A 4X1KA 2DJVA 1VYUA 5HJ2A 1KAHA 4NY1A 3T3IA 2XMDA 3VC7A 1KBQA 3BSSA 5FAXA 3LWOC 2C77A 2V6FA 2FMIA 5HSGA 1J42A 3GC6A 5H9WA 1OTHA 4KBYA 2C2WA 4A5UB 4L75A 1TUIA 4LRYA 4MV6A 3ND5A 4WCFA 3MWGA 2AHRA 1UKYA 2JL1A 2XUDA 2B7CA 3ICEA 4E03A 1YJQA 3RFVA 7ABPA 3GLRA 4S1VA 1LDBA 4DR3B 1VXOA 3E7FA 2H0QA 1HNWB 3W3AD 1NJ2A 3AM5A 5ICMA 1QHYA 3IAM6 4JMLA 4HD8A 5J23A 1V0JA 3M6VA 4RBNA 2JEOA 5ES4B 3EXEA 3MJDA 3OLYA 2VNHA 2E87A 3N3BC 4HUJA 4YV1A 5JHHB 2DFNA 4ENPA 2CXQA 2Z0AA 1BXGA 2PGAA 1TF2A 2G76A 5TF0A 3WMWA 4BO7A 4MCIA 2PHZA 4GOMD 2K4MA 2H5LA 4MMYB 1SBHA 3F46A 4COOA 1UFRA 1BKDR 1BAPA 2EGUA 1JDVA 4M60A 1PP9H 3KHNA 5K0NA 1Q81H 3MOIA 1NM5A 1ZN7A 1FFSA 3I6QA 1QGUB 4ICIA 3OESA 4KYVA 3VNQA 4R0MA 3AG7A 2OECA 2GCOA 3OZIA 2W6QA 2QN3A 2ZT7A 4QUDA 5TX7A 4CKCB 1WXXA 3AIKA 3DKKA 1OWOA 2YMMA 1HSZA 3I8XA 3O1HB 1M0WA 3PPXA 4RZ2A 4AT1A 5A4DA 3U60B 4HWOA 1T5SA 4LVOA 4QG7A 3BMCA 1PJQA 1RXSA 2GEUA 3L7YA 4TQFA 3PUXA 4JUFA 4LYJA 3TRHA 3U4HA 2JHPA 4RZ3A 4I66A 2XNDG 1A77A 1VI6A 4MPDA 1PU2A 1WNTA 2FUCA 4KR6A 3HB5X 3SNKA 4FZVA 4QPKA 5GQSA 1L9KA 3G79A 1JA0A 3HK2A 3ZN1A 1FNMA 1NRXA 3OGIB 4G0OA 4HCJA 2ZJYA 3AUJB 1WXIA 1T3ZA 2H1VA 3KPWA 3T7RA 1SVMA 2G0AA 1C7EA 2VUUA 2I78A 4ZEMA 3PQCA 3NHJA 4MVCA 1GFIA 1BOFA 4H7HA 2DUJA 4JI2O 1RW4A 1NUSA 1FYEA 1RQXA 2HA3A 3NNNA 3A36A 1ZIXA 4QPNA 1D0SA 1GQSA 3E7XA 1MO6A 3RAGA 5DWVA 1IHDA 3LY8A 4CKYA 2YHSA 1SXJC 1ZISA 2BBWA 3Q0TA 3ASNB 2FV8A 3OTQA 4L85A 4UM9B 3T5DA 4WLUA 1LBEA 1XG5A 2WLHA 2VT3A 1L5MA 3ESBA 4J7JA 1ATZA 4LC0A 5G1NA 3SF0A 3VH3A 2QJRA 3SHTA 1TKCA 1FNCA 3FNQA 3HGTA 2WPDG 4AKSA 3B53X 3NR7A 3SJCC 1BHJA 1IVYA 3IUYA 4M8SA 4L72A 1VQ4F 1POWA 3QX9A 3FMOB 4D4GA 3P94A 3SLGA 3ZDXB 1IJFA 1CRLA 1SXJE 3H7AA 4FLEA 3VYTB 1E9VA 2X6BA 2XTJA 3IRUA 5K8UA 3ZOZA 4IEFB 3F5QA 1YS9A 4EA7A 3PRJA 4ARIA 3TLGB 1LWOA 3V8PA 2ZETA 1AZWA 2JDID 5D5PA 3AHFA 3DC6A 3NBFA 1U3TA 3F9RA 3OZWA 3E2IA 3F0TA 4IX1A 5EJEA 3M3DA 4IUCS 3K6JA 3KM0A 3T7AA 1Q1GA 4HAWA 4E5YA 1II8A 1JVNA 3C14C 2QWXA 3LYLA 1HI9A 3S5JA 4KQGA 5LYYA 5I47A 5JSQA 3VR0A 3SPIA 4G2KA 2KSQA 1G38A 4OXNA 4HPJB 1SD5A 2Y4TA 3I37X 1VJGA 3IKFA 2YJ6A 4AIRA 2BFNA 1PT5A 2YZKA 4KI7A 4KI0A 5DISB 3H4IA 1Y4MA 4F97A 5LYJF 1AA6A 1XP5A 4YQYA 3SHVA 3QE9Y 5K01A 2PWAA 5B1DA 1EXDA 1HWYA 2J08A 2XSZD 2IS1A 1DUIA 1RBQA 2HFJA 3I8SA 3QLUC 1SVKA 3QW2A 3V46A 3VZDA 1PL4A 2CXPA 4BQOA 1GY8A 1ZIDA 3DVLA 4B8WA 4BP8A 2PLWA 4HT3B 3LNNA 5C1OA 3FWHA 3ZDEA 1AB5A 2AWNA 2LFSA 1JQEA 2J3HA 4UNIA 2R72A 2GBGA 4R84A 2A3QA 1OTYA 1PDOA 2DPXA 2NUBA 2OHGA 2Z58A 3GUHA 3MT0A 3SF8B 1NBIA 2GILA 2IVZA 1X1SA 2OHHA 3PKZA 3ZXYA 1V7CA 4ZI7B 5J1TB 3FNIA 1VE9A 3UMMA 1H9AA 2HQ1A 1N1GA 1OD6A 2OGSA 3LUDA 2YWEA 3NP7A 3TLXA 3JSXA 4CQMB 2ISCA 2W2LD 4TZ6A 3R8XA 1YC5A 2P6UA 1KY5A 1D2GA 3T54A 1F0YA 1ZJWA 1UWKA 1U8FO 1TUEA 1F5SA 1LFDB 3VYSB 1MSDA 3EE6A 4MGZR 1W2HA 1EUDA 1M2WA 1GV1A 1MQAA 2ZBEA 4HAXA 4PW0A 3FFBA 4NV3A 4F2GA 4ENQA 1ID1A 3BCUA 3FKSD 1YR1A 3GLHB 4IS3A 2FJPA 2ODQA 4YY3B 4K9MA 5KA6A 4X3CA 4PX3A 2J33A 3V2GA 1CJCA 4MUXA 3OHMA 2B8JA 2A30A 2H7XA 4QGBA 1DAGA 2H0AA 1JSCA 1KYYA 1BMTA 3RE1A 2F6RA 1DT5A 3A14A 2LW7A 3J80M 3RFFA 3C8DA 4MARA 4C3UA 3QKRB 2CFOA 3H8VA 3DMTA 3GGOA 4LTDA 4D82A 1REQA 3NG1A 1K8ZB 3EEBA 4MW1A 3T3MB 5JDIC 2YWGA 1BU5A 4NECA 4PLCA 3DYIA 1BS1A 5BR8O 1LPOA 2WKQA 3NKLA 3PNQA 5SYNA 3T6KA 4WOCA 2BE3A 1RZ3A 3ZN2A 3EFBA 3R0IA 1WSAA 1QR9A 2OV2A 4MV5A 5GTDA 1V16A 4D9JA 3BQ9A 2W42A 2IF2A 1YCGA 2C8LA 3KTOA 3L7MA 2XYQA 1NJ8A 1Q57A 4B4OA 4B7UA 5C32A 5C9ZA 1SKBA 2JNWA 5JAQA 2O2DA 3S2GA 1YQNA 1W3EX 1MMFB 1SOMA 2C5AA 2ZBRA 4H7FA 4HB2A 1WUIS 1S0VA 1N2IA 4AS3A 4LDZA 4O4IF 4R54A 3GJ4A 5G02A 2RGDA 3RT7A 10MHA 4IT5A 4JJAA 1XHXA 3OIUA 3TQHA 2YXZA 3K1AA 4BN4A 3KUXA 4B3HA 1HX7A 2PMWB 5BQOA 3TGUH 5IJ9A 3J7TA 5AW5A 3UCFA 3GNLA 5BW8A 1E5QA 3E5MA 4GOJA 3K6SB 3N0RA 2C57A 4ZHWA 1A1SA 2W6MA 4J3NA 1AP6A 1KJYA 2OXEA 3P2KA 4HH1A 1PZFA 3U3DA 3ZY2A 4KQ6A 1I3CA 4NEGA 1Y42X 4CDNA 2QA4V 3CYFA 2DMRA 2H54A 3LC7O 4XDZA 5AQ1A 3OQBA 1G20E 4HGOA 5IYBO 5LXTF 2IHJA 4NCHA 1UFIA 4MVRA 4FKMA 1PDWA 2GM4A 4JXXA 2RB9A 1HQKA 1EAMA 4MUBA 2GRJA 3E7PA 1RP1A 3CCCA 1HH4A 1RZRA 1YDXA 2EZ8A 3EJWA 2J46A 2A79B 2ZM6B 3HJGA 5BQFA 1YZ3A 3HVJA 4AVYA 4ATNA 2J8ZA 1MX1A 3ZIAD 1GARA 5BWMA 3R5TA 2OPBA 1PSDA 2JIBA 2QTFA 1RPAA 5AIAA 2BE9A 1VKHA 5HWEA 2EILC 1OT3A 4AMGA 2QWOB 2UXBB 2DUMA 2JLRA 4YJHA 3SY8A 4BDSA 3I5AA 3DPUA 3EDMA 4ZRMA 2WWWA 3PRHA 4DV2B 3JD2A 4JUIA 3MWLA 3NASA 3RSLA 4G0MA 5MHTA 2EDAA 5CR9A 1R0RE 1HE1C 1IY8A 1IONA 4BNDB 2DYKA 3BDIA 3KWLA 4LZZA 2DR2A 1KF0A 1RRVA 2AUNA 2FRVA 1VCOA 2B33A 3EXFA 4KZPA 3W6NA 5DKFA 5MFZA 1XL4A 3CCFA 1EGMB 2HMAA 1Y7IA 2A59A 2PT7A 4M22A 1C8LA 4FMDB 5BYJA 1N2CB 3MUNA 1N6KA 2J9FA 4WLNA 4MI3A 4BNNA 3GHZA 1YF2A 3PR3A 4CL2A 4I1SA 5IJWA 1T1RA 2ATIA 1Z5UA 1R8SA 4WX2B 3VKGA 1EZVH 4XCVA 1JWLA 3BQNB 3FX7A 2O8EA 2XZOA 3DMFA 4OXIA 1K27A 1IK4A 1N7JA 4X00A 4YEDA 4C2AA 2QSUA 1OFTA 4IZHA 3ZXSA 1L2TA 5JD6A 4AP6A 4L4SA 1JI3A 3T0FA 3RLFA 4MWTA 3I12A 3TG2A 2VDPB 3BF8A 1QYDA 5ALLA 1PF7E 1F2UA 1J24A 2W0FC 1NQXA 1Z6ZA 2D0OB 4MULA 4ERHA 2Y48A 2DTDA 4MLPA 3RW9A 3CD6V 5L3SB 3JASA 4PG6A 2R6GA 3NCTA 4U2KA 5EMLA 3ZHZA 3CIFA 2A0LA 3INNA 1GDTA 2KKWA 1UDWA 2X41A 4WKGA 4BLTA 4YJ3F 3RV4A 1KYQA 3IPRA 5DK6A 2W2QA 1KQSU 1HGXA 4JGIA 4P7KA 2HHHO 2OSBA 1D6NA 5KS2A 1QVVA 3PWZA 3QEOA 1KFCB 2AX3A 3C3MA 3O8QA 4NDNE 4OU4A 1Y7TA 5EWLA 2OZKA 2YNMC 4LIPD 4S35A 2LKDA 4Y0NA 1KGDA 2WIJA 3WWCA 3KB2A 4BUCA 3HHPA 1CUZA 4AF8A 1EBOA 3L6EA 5K6RA 5FLXA 1EWKA 1NX9A 3THWA 1JG2A 1PJZA 1TQDA 3A9TA 4ND1A 2IOQA 3BSYA 5AKHA 4O5AA 4B3CA 4ZKIA 1SQXH 2EC5A 2Q5OA 2ATKC 1V8ZA 4IGFA 4TM7A 3NHWA 3RWBA 2LP7A 5CVJA 3S40A 2FPUA 3ZY4A 1XZBA 1XROA 3N58A 2VJKA 1J99A 5K8TA 4WD3A 4CC6A 1X77A 4MVJE 2OP0A 2ZBGA 3QX7A 4RF5A 2CVPA 1ND6A 1P1HA 2ZT9B 1SD1A 2E1PA 2QI9C 3AG3C 2HK8A 2HSZA 2FUEA 3RUAA 3W04A 2BP7B 1O94A 4A6EA 2UUCO 4AW9A 4C4XA 5BMVF 4QXMA 2Q7DA 3U40A 5CDUA 2QR4A 2W9XA 3HNOA 1T9KA 1U7OA 1W59A 3NIBA 1QHNA 3Q3VA 4N8DA 2P1ZA 3H84A 4NBNA 4Y2VA 3DXXA 2B8TA 2CZQA 3FUXA 1AR1B 5LLDA 1FTGA 2O2YA 5JPDA 3RYCB 5B5EZ 3HU1A 1NVXQ 4TMWA 4OHCA 4QHSA 1CZLA 3HJWC 4Q00A 4IIBA 2GHIA 1ZOIA 2JIZD 1X80A 5F2VO 2ITDC 1NW3A 1Y1KE 1YKFA 2B3DA 3F5MA 4JEMA 4JZKA 1VQKF 3AM3A 2VRNA 3FYSA 4IY1A 3V32A 1WZ2A 2PUSA 1DUSA 4XYLA 3ESRA 3NBKA 4Y2SA 3VR5H 2XUQA 1F4VA 1Z06A 4HEA1 5J2TA 4E6PA 4KZKA 2WV9A 4EW1A 5CP8A 4GI1A 1A72A 4RH0A 1IY2A 2M6YA 3B8HA 4DPLA 5HKKD 1A2BA 4AZ0B 2H9AA 1Y3DE 1W4RA 2A14A 2HHAA 2BT4A 1V6CA 3I0NA 5B58C 3KQTA 2O7NA 4J2TA 4D9NA 1U02A 1RYYA 4PYMA 3OX2A 4G89A 1P44A 2HJSA 3FNGA 3Q72A 4PTYA 4DUGD 5ALOA 1Z4OA 2B1JA 2R6AA 4G4SP 1PL7A 5JAMA 1WABA 2XCTB 2FWJA 2DJIA 1JT9A 3QKTA 4Z7OB 3W90A 1D1TA 3HO6A 4R2HA 4UD6A 2H07A 3OCYA 1ZD9A 2Q8NA 2C3UA 1GRCA 2C7PA 2YIDA 4JYYA 3UJ8A 3DF9A 1XNGA 3L8FA 2UUAB 2DTEA 5IPFA 1X8KA 3WV4A 4C0XA 1HA3A 3AG4B 2RMKA 2VDKB 3S1AA 8ATCA 4RQAA 1OCZB 2BI4A 3QUTA 3ENKA 2V6BA 4UXJA 3ZKWA 1G5QA 2XNHA 4XSVA 1ZGJA 4GCZA 3AWIA 3L1KA 4MHSA 4J1NA 2NTEA 2VPQA 1Z2AA 1ENVA 3CRW1 1TLLA 1W2BF 4Y1RB 3U26A 1KKCA 2H8GA 2OR3A 2ZRGA 4Q47A 4XQCA 4KR2A 4JN6B 3UWKA 1O3YA 1N2OA 1T2FA 4PZ9A 2GAOA 4TKVB 4OLHA 3WO0A 4HPXB 4TN5A 4RKQA 4A8JC 4DJJA 2BRUA 3QTBA 4P82A 1AHHA 6PFKA 5BOVA 3TOVA 3AHCA 3NV9A 3D4NA 4JU9A 4YRSA 5EXPA 1QP0A 1XKTA 4YK7A 5IRCD 3HCWA 4XDLA 3L1JA 4HDQB 4AD8A 3W0LB 3ANYB 3IPXA 1FRQA 1PWHA 4NU5A 2Z3ZA 3F5SA 4IS2A 3EGDB 3JTEA 3WYCA 3GCGA 5B4TA 1JPNA 3FYCA 3JAMA 2EYQA 1RRFA 2EWVA 4K6MA 4JEIA 1HEYA 2GBFA 4TLEA 1P60A 1OHHG 1H4VB 3IDOA 4XM0A 4HFRA 4B73A 3U9TA 4E1BA 4DC9A 2I29A 1VIVA 5KOHA 2I99A 4CR7A 3R7DA 4M8IA 1XYVA 2X7RB 1SU6A 4OHRA 1OV4A 4Y6RA 1MCZA 3QKUA 3VSEA 1U6JA 3BD7A 3RROA 2UVDA 3T7EA 4ND3A 5MDHA 2I4OA 3HZOA 1EFAA 1XZLA 2P2NA 3LPDA 4IDDA 5GJBA 1YI1A 3FPHA 3HBAA 1UFQA 1GAJA 3S0YA 4DR1O 3QUWA 2HJRA 3K2EA 3PXXA 4I2NA 4KXNA 5JSHA 3IVCA 1D4ZA 3EFOA 3JPWA 4EY8A 1I3LA 1PR5A 2IP2A 4KXVA 2QW8A 3CZRA 1PEDA 3GNSA 3B8MA 3MM4A 2PX5A 5DI9A 5E3IA 1UAAA 1P49A 2WG2A 3DM5A 3ZDQA 5HIKA 2PGDA 4A2QA 2PZSA 4OEHA 4H08A 4BNLA 2HF9A 3UQZA 1KTIA 1P2VA 3QUAA 2JI8A 5AVYA 5JTTA 1S77D 4LZLA 3UPTA 3K79A 2JHAA 4ESVA 4AYXA 1CS4C 2C5LA 3G2IA 4QYWA 1DQZA 2P3OA 4OGWA 1W0KA 1I33A 3M6UA 4IL6Z 1T9DA 1JWAB 3VPCA 3L6OO 3FCEA 1U94A 4QAJA 5AVMA 5AJZA 3W4KA 2A4KA 5IE9A 1JKFA 1S5JA 2KG7B 3P0IA 4ZQHA 2KPOA 3QMPA 2B7BA 5CCEA 1XEQA 3EC1A 4Y2YA 3MWFA 4TMKA 1FP1D 3FWKA 2OCHA 4ZVRA 4O2LA 4HVLA 1Q5OA 3TLEA 4K3AA 1TAHA 1X87A 4OQFA 2I76A 3ANXA 2VRWA 4NBLA 3OTHA 5F2KA 3VGJA 2ZKIA 2GF2A 5JZBA 1J9ZA 2NSHA 2W8BB 2UUAO 1I4TD 3O3OB 3ICWA 2ILTA 1F0KA 3WJQA 4OHBA 2C4NA 4D5EA 3MCTA 2VK2A 3KCNA 2PGGA 4M1MA 1CR0A 4K6FA 3SQMA 1H2GA 3H9UA 4RY0A 2R2AA 3ZE6A 5BNWA 2RCVA 1T3SA 1T36A 4QU0A 5A9SA 3ON5A 3N2YA 1ZNWA 2Q6AA 3OU7A 1PKEA 4M7OA 1QHFA 5T6MA 5IF9A 4FGZA 2J3LA 2ZQYA 5F3WB 5ALHA 4M0MA 3C9UA 2IVFA 2P06A 1SZCA 2DKFA 2OV1A 1Y5IA 2PKQO 3KB6A 3QVMA 4PLYA 4S2UA 3UJ3X 4BL5A 5BP7A 2Y0IA 1OA1A 3FR7A 4TSFA 5ERYA 3DB2A 2ZWMA 4ZO7A 5DZSA 2QW0X 3CU5A 2XUIA 1XJ0A 3AY6A 3IALA 3O95A 3SBDA 5CMUA 1XDBA 2J3KA 4CMIB 3KSAC 4KIGA 4F2HA 1SZXA 4P7FA 1LPNA 1N32B 4JV5O 3GZNA 1PGQA 4R8MA 3RG2A 2H1OA 1UXGA 4YHHB 3JAKA 3AVPA 1G0OA 2Q27A 3OY7A 1CUWA 2CT8A 1YR8A 2FZVA 1QPZA 2IT1A 1Q22A 3AUUA 3GJ5A 1BX1A 3SIVA 3UJ6A 3RTGA 1CE8B 4HEQA 4FLWA 4HDKB 5FA8A 4BAZA 5TS3A 3B3JA 5DX8A 4BVGA 4U2GA 1PYOA 1KKMA 1R9NA 4Q4AA 4CUJA 1JDBC 2AFIE 1ZL8A 3FWZA 4MMZB 4UCQA 4ARZB 3ILXA 4QYMA 4DIUA 4WLEA 4EHLA 1K4CC 1M2HA 3AVYA 2G1UA 1SQGA 1T5EA 3QEKA 5BWNA 2V9ZA 3OCJA 2PV7A 2HMTA 2R5FA 5FNVF 1TJNA 4P92A 5AJVB 1J21A 1A3CA 1PF5A 4PWTA 1XOIA 2WSBA 3LDUA 4Y98A 2PE5A 2P90A 1S3FA 3T94A 5LKRA 3ZGZA 4TMFA 2J59A 2IOYA 5CM8B 5GINE 3DNFA 4IIUA 4YV7A 2CBGA 5I7OA 1MABA 2R87A 1S9DA 5CNJA 1U7ZA 2B0CA 2XH8A 2Z83A 5HILA 5B1EA 3ZD9A 2FN4A 3OLQA 1L7RA 3G85A 5CPFA 1IEXA 1L7QA 1OFIA 1WHSB 3OD1A 3DXRB 4NBUA 2B4KA 4TQ9A 3VCZA 4Y0AA 5CT6A 4DDMA 5F2OA 3ZNQA 2HF8A 5ICGA 1QRSA 4JI8O 1Y6JA 1O03A 2VJOA 2GA9A 3TLAA 1U4NA 1U1CA 2WMDA 5EZ6B 3MGKA 1IN5A 2HG5C 4BKMA 1TKBA 1Y3FE 1YZLA 3FHCB 3K2BA 4L02A 1IXSB 1R10A 1IJKA 3UT0A 3CLSD 3ZK7A 1T5IA 1M6VA 2IJGX 2V6MA 3EW7A 2IYSA 3PX2A 3FVRA 3CC7V 2I6DA 2AGVA 3E8FA 4P5PA 4FGLA 4QOEA 5DGDA 4N9WA 4AJOA 4G5FA 1Q1AA 5BXYA 3T1YO 2DYSB 2AR0A 1QG6A 3LNMB 2X77A 5TPWA 3K31A 2G40A 3SJBA 3TD3A 3UB2A 4HB3A 4JT2A 3WXBA 2EARA 1J7JA 2KQXA 1B2LA 1LXCA 2DPGA 2NAPA 3CX5F 5FH9A 3IR9A 2ISQA 2W4MA 4LK3A 1VMKA 2D0DA 4FE4A 4YVFA 2OLJA 2JATA 2IYUA 1XLTC 4KN9S 1N57A 1XQ8A 1BN7A 5EINA 3VI3B 3O9OA 2WTAA 4ZYUA 3L0YA 2CK3A 4ZOLB 1TU0A 2CD7A 3HNPA 2QA4F 3NEJA 2A0YA 4BFCA 1J8YF 3GUVA 3MT8A 2KTVA 3C41J 1XVTA 3Q7PA 3SGLA 2ZXEA 3LVFO 5LM3A 3DZHA 3MGGA 4Y6SA 2IUUA 3SNHA 5AOBA 5IW8A 4HX9A 3V4LA 1QNLA 4HV4A 5KYVA 4NFSA 3AR7A 4O08A 4UNPA 4FYMA 3H2ZA 1JQKA 4GI2A 3EOAI 2ZJ1A 4OXRA 2BSXA 2ODMA 2C3YA 3ROXA 1LBQA 5IC5A 1IN6A 4BVFA 2QVBA 2PUEA 4JQCA 3R6GA 1ULAA 1QOZA 4H13B 4X94A 1JPJA 3QXGA 5EUQB 5FTKA 4JBHA 3QE0A 4G1MB 4UUBA 4BTVA 1X7DA 1ODFA 5K1ZA 1LC0A 2XOXA 4AS2A 1P18A 3ZVRA 4U5QA 3K0AB 1N8RH 1W93A 1U63A 1GQ2A 1UIMA 4DCJA 3ACCA 3AGPA 2NLJC 3PXCX 3KT6A 1XTPA 1CJUC 3RDPA 4Q9JA 3ZLBA 2FR0A 4GX2A 2Q21A 3B1KA 9GPBA 2CFCA 5IM4F 4DR2O 1XDDA 2EKBA 2XAAA 4FNGA 3MFQA 5GZ6A 3ETQA 2PGOA 4H0LB 4BNGA 1Z47A 1P4AA 2BEUB 4CVNA 4QUJA 4Q6WA 1M8PA 2NO9A 3IOEA 3QV2A 4RMHA 1KEZA 2OGWA 3MCAB 1PGPA 1VF5B 4OI1A 5C81A 1T5OA 3QFFA 4Z7QB 4I4IA 4QLOA 4EGCB 3U37A 2CLDX 2VRBA 4UM5A 1HSOA 1B23P 5HBRA 4TM8A 1OCZC 1C4KA 4DR3O 4W4KA 1G5PA 2IYWA 4OAPA 4INJA 3DR3A 4JODA 4MA0A 4G4XA 2PX8A 1EG7A 2ZS9A 5CX4A 4RPCA 2O7VA 5FDFA 4QFDA 5HDBB 4J41A 1SURA 3W1WA 2BSKA 1RXEA 4TVOA 2C5EA 4U7TB 3GZTB 1DIAA 2AIRA 3EQ7A 4S1TA 3PGJA 3STXA 1YOVB 1ECCA 2Y4OA 3WK9A 3PUVA 3MT7A 4W9NC 621PA 1YASA 2ZRFA 3KG2A 4DV3O 3KZOA 4ZN6A 1P1BA 5GIPE 1VL1A 1MVOA 3U31A 3V8RA 4RFVA 3BCCH 1U28C 3K30A 3OOSA 2VF2A 5FWAA 1B8UA 1EB8A 3FTPA 5CX1A 4BJ6A 1YS1X 3C3EA 4R8KA 1GU7A 1ZNZA 3LPNA 2AXNA 3JVVA 4MUKA 5JEDA 3VZBA 1GG8A 5K0ZA 1RP3B 5FTNA 3RIXA 4BFZA 3C5EA 2JEXA 5A9GA 1MFPA 2PYJA 2VZ0A 4KIWA 3GUUA 2QX4A 4W4TA 4L5CA 1XUOA 5SY4A 2O2XA 2ZR9A 2G17A 1FE8A 2CUGA 4B6SA 2GD2A 2IBZH 2CUZA 5G1OA 4RY2A 5JBIA 3I73A 3D6AA 2JB9A 4YASA 3JSNA 2ZOSA 1ZGGA 3EXFB 5T8KA 3X2QC 1K97A 4RIIA 4DLKA 1UM9A 4ZCTA 2C94A 1PJ3A 3TOXA 3W7WA 2HPHA 4F4FA 2BFCB 1OCCB 4D8WA 5AW1A 3W7XA 1XU9A 2YEVB 2HTEA 1LK5A 2AMLA 3JYNA 2WHPA 5ED4A 4LYHA 1WOMA 3E70C 3U3OA 3G6BA 2IZ6A 4RSGA 1TPYA 4PPQA 1G3MA 1JFFB 1AK2A 2GVZC 3F71A 5DTIA 4C7VA 4E46A 4DDTA 5ARCA 1RQPA 2XTNA 4CQJA 4BN0A 1S4QA 3AERA 1GN4A 4YDRA 2YR0A 3HYCA 4MDYA 4RTNA 3AHDA 4R9UC 2Q1WA 2ERXA 4Y67A 3SP1A 2DWDC 1IBRA 5LL6P 2VPIA 4DLAA 5JY6A 2VF4X 4Q9LA 4N3AA 4RWEA 4PVDA 1QVRA 2GCNA 2V58A 4R1TA 2VQEB 2I6XA 1GPMA 3B1JA 4IZOA 4QBGB 4Y3UA 1CPYA 3GAZA 1R15A 1YRAA 3R40A 4B17A 3E18A 4Q4LA 4FB5A 1TUEB 4P2BA 3GFOA 3NORA 3D6UA 4H2DA 1H23A 2XTMA 4H0CA 5JV5A 3GJZA 3V48A 5E7IA 5LC1A 5I3CA 4DR1B 1Q82W 4N40A 4CM1A 3TEMA 3SR2C 2PS1A 2FP4A 3A1NA 3IESA 3D8TA 4M6WA 5AKGA 1UWLA 3WIUA 4BO0A 2H2FA 4UOEA 2P75A 5B4UA 1YQUA 3TNLA 3OJXA 5LU8A 3KBBA 6LDHA 1LUAA 2ZB3A 3A11A 3GN1A 1FFHA 5KPJA 1IH8A 1XXHB 1AUXA 1Y48E 1P81A 1JDSA 3EHBB 2BKLA 4OAQA 2OD9A 3FVVA 4Y1FA 2CUTA 1O57A 1MEOA 1OAOA 2P9HA 1IHXA 2YWCA 4WEQA 2RHJA 3GAMA 1PV0A 2C0CA 5C2JB 4Z9FA 3IP3A 4I5IA 2NV2B 3RRFA 1BGYH 1GT6A 3P9YA 4OJMX 2AZMA 3QVNA 3KEQA 3CB4A 5C80A 4B8ZA 3C3PA 4QLAA 3D3JA 3SYPA 1DAPA 1JJFA 1GZ0A 2XJ4A 2HJVA 3E2MA 3OX1A 1KHTA 4LRSB 4REOA 3OFKA 4AKEA 2ONZA 1E7QA 2GAFA 2P4EA 2VK8A 3EXG2 3JW8A 3LBYA 3NGLA 1VF6A 2HM7A 3PDUA 4Y0VA 3WAJA 1I80A 1DC5A 1KC3A 1MJHA 1YQQA 2IQQA 2WAOA 1XMPA 4ER3A 1TM2A 3FMGA 4G5RA 4TXHA 3CLTD 1AURA 2X5JO 1UMDA 2WU8A 2JS3A 3ABOB 1C8BA 2CDYA 3LQQA 4M0FA 4DNFA 3FF4A 3OH8A 2NVWA 3UJHA 2WSIA 1DKLA 4V3CA 1K4MA 4TSRA 2C7BA 1OGJA 2EQBA 3FSRA 5CK5A 1D7OA 1MP0A 1PW7A 3N75A 3K7EA 4RU1A 3V4VB 5ALZA 5FV7A 4HQNA 3LY5A 2ZSKA 3PYXA 4ALLA 1UZNA 4DSZA 3RA5A 1FRVA 5HM8A 4MR7A 4ARSA 3SFZA 4D79A 5CUQA 5FTLA 2GESA 4GGOA 4KMOA 3EWIA 4U63A 2ALJA 3ZS8A 4EYGA 2GD6A 1KWGA 1XRJA 3MF4A 3FPIA 2WWVD 2UYNB 4JEHA 4DWVA 3K32A 5LYJB 4GRDA 4A9AA 4W7SA 2X9LA 3IURA 3SYTA 1EU1A 4BKUA 3FY4A 3OCXA 2ZIOA 4B08A 2RQ6A 2ZRPA 4FN4A 4F93B 3E9CA 3ETGA 1L7VC 2O8CA 1SRRA 3WMXA 2HC9A 3D02A 3JX9A 1GDDA 3V7EA 1YB5A 3I05A 1ADCA 1L3CA 2X6AA 4WUTA 5K05A 1N2BA 1DKQA 4OXSA 2REQB 1ZJ6A 3HP4A 3H0KA 4ZV9A 1ZNXA 2HJWA 4PCLA 1EWRA 2GN2A 4DA8A 1Z0JA 2G38A 5KQPA 2P2SA 2DUUA 1CB0A 1MR3F 1TM5E 2FPIB 2IDJA 3L43A 3NAMA 4OYRA 4BO4A 1UL1X 5AW7A 2LR0A 4NXNO 4XCQA 4HAMA 4FZ0A 1WN7A 2HS0A 1RQ2A 3CKYA 3QY9A 3PFBA 3H8WA 5IM4A 4K87A 2PRJA 3HXLA 1NP6A 3UFXB 2IQIA 3IQWA 4S3MA 3LRPA 2QI2A 2AQ8A 4ZAWA 3BTSA 1VIBA 1MGOA 3PE4A 1KK0A 3K0DA 1LDYA 4R8VA 5G53C 1EMDA 1EPUA 1NNUA 2LWIA 2MINA 3IE0A 3DOUA 3O9MA 4N39A 5HVNA 1CEZA 3O2JA 3PLRA 1R4AA 1Q1QA 3DW1X 2OE2A 2OVBA 4L95C 3YASA 1LPAB 4AMVA 5KNDD 3LP6A 1KZ6A 3KHTA 4WKBA 1LK0A 2OHJA 5JD4A 5C1PA 1VCNA 2FH5B 2H1FA 3SXUA 2MMCA 3H5IA 4XVHA 4LFCB 4EARA 3RR2A 5H7XA 3K1YA 3RRXA 3T1NA 2AMFA 4NYMR 2NU6B 2XXJA 3PX3A 3I56V 3WFIA 3ZWMA 1I5EA 1ZSVA 4D5GA 2ORIA 2JZCA 1V48A 4PY2A 5JZMA 4C0JA 3L4KA 3CCLF 2BFEB 1O6BA 2F4NA 2XVYA 2WHRA 3PNYA 3ANNA 2HCFA 1OKKA 2XA9A 3ZLUA 2WLIB 2DEUA 2HCRA 4MZDA 4O6VA 2IJHA 1V3TA 3D3QA 1KSHA 3KCQA 5E9WA 5EUMA 2HSGA 3KYBA 1B6TA 4UHBA 1NTOA 4DWWA 5L7WA 1KPGA 1LI5A 3PRKE 3MDSA 2REBA 1T43A 3U5ZB 1ZGHA 1T3GA 3KHKA 1CYDA 4PAGA 3EUFA 4Z4IA 3BIWA 4H9GA 1GN3A 1ODSA 4L74A 3M6AA 3ZWBA 1UBSB 1DTWB 1Q6UA 3IUJA 1LC3A 5HJ5A 1GKIA 1HE5A 2DM6A 1ZNQO 2D1FA 2GXUA 1J5PA 1OI7A 1RFYA 2JJ2A 3TZQA 2GTPA 1ZJJA 1Y3AA 4W1SA 4RF4A 5EKUA 3VX3A 4BFXA 4JZGA 1NVMB 4OQYA 1ZI6A 1T1EA 3CM0A 1NUAA 1RHJA 1X2EA 3D2AA 3P9IA 2VATA 4GC9A 2VRCD 1G8SA 1O5TA 3KELA 4TTJA 3QFTA 1JQ5A 4OX9O 4X85A 4UQPA 3CMEV 3KEMA 4ND6A 3PLAE 5GWXA 4MHOA 3G0HA 4JZ2A 4IGEA 1KAOA 2AG0A 3RSSA 2OCBA 5K0TA 5J2TB 1UOOA 3WJAA 4CLOB 1EM8B 2Q3FA 2J07A 1E98A 3JQCA 2AYZA 4QG3A 4Q1AA 1WD5A 2WQZA 2ZYTX 3J80A 5JVDA 1OI3A 3SYCA 4NJOA 5TT1A 4OGKA 1G6Q1 4BO8A 3PFKA 1Q3EA 4QU5A 1I2BA 5C46F 5K0SA 2O8EB 5B1AC 5IJ0B 1P1IA 1R2QA 1U2RA 1G55A 4BLVA 4BWYA 3IVRA 3PITA 4NBVA 2FSSA 1CR4A 1Q19A 4LC9A 4H60A 4AK9A 2KW5A 1KO7A 4F9EA 4ZCIA 1EE2A 5TGTA 1J8FA 1TU3A 2E5WA 2GNOA 2NO1A 4C6TB 5JALA 1ZR4A 1T5DX 1VTKA 1E0DA 1TGOA 1J8QA 2VH2A 3F0GA 1SB8A 2ZJ2A 2UUBB 2FKNA 3R3SA 1K5QA 3DEIA 4HAUA 3CVVA 4HGQA 2M6SA 2JA1A 4DSTA 4Y6OA 3VU1A 3Q8KA 4UTPA 3CZMA 4OJKA 4DL9A 2VSOA 3J80N 4IXTA 1PGOA 4ZVQA 2P91A 2YYSA 4B47A 1XIVA 4XWWA 2WE7A 4BC1A 1E2NA 5K4HA 3HR7A 3BDVA 2I6UA 1H8HA 2A88A 4R2WA 2R1VA 3U4IA 4YI5A 3U0VA 3W5JA 1DI0A 5EJ5A 4X64O 1GZ3A 2Z4TA 3INGA 3LFUA 4IIDA 3VPGA 1H4TA 2R11A 2WG0A 4AZ3B 4ZTZB 3VYTC 2V0GA 1ISHA 2I8CA 3AV3A 4B5LA 2GHQA 4X1IA 3THYA 1XNRB 2FSFA 5TPWB 2PMDA 3LCRA 4F91B 5JC1A 3F7OA 2R85A 1ILWA 1O9BA 2WAXA 3LVRE 3LOUA 4HB4A 4DA4A 4IJQA 5JTUA 1OB2A 2L17A 3R3ZA 3K05A 1Y5RA 3T7CA 1C7FA 4IR7A 4ENRA 5EZYB 1Z88A 3PPYA 4ZCQA 3U3ZA 4Y7DA 1S96A 1GO3F 2XAGA 2H59A 1MUUA 3VZRA 1BE6A 4PM4A 3WL3A 4AO8A 4Z7NB 1KI2A 1P80A 3GWKC 1XD8A 2VJYA 4K1LA 4MW6A 3SR3A 1YGPA 1D09A 4JLUA 4TYYA 4DUZB 3M4ZA 3PFGA 4XFDA 3U49A 2FXIA 5E8RA 1UPUA 3U7RA 1B6SA 2J31A 1SD2A 3CCJF 1OFVA 1R4ZA 2XI4A 3IFSA 4DW1A 3N8IA 1JGTA 4WESB 3AK1A 3ANTA 2RGYA 3B1VA 3UUWA 3VISA 3WK6A 1A4UA 2PGNA 2RJOA 3WPWA 5E2IA 3ZWOA 1MF7A 2DPMA 2WICA 4BLSA 2FHPA 1UBUS 2IEDA 3OQHA 5I9SA 3LX6A 1NA5A 1H38A 3GHYA 3MCZA 4GECA 4X88A 1ZJZA 4WH0A 1CNFA 3C8LA 4URXR 5IF3A 2OCXA 1Z73A 1LH0A 5F9FA 1SUPA 1P2DA 2VOEA 1AKUA 1V16B 1XMXA 3MSXA 2UXXA 1KSGA 2V7TA 1P7VA 2XMGA 1X7ZA 3EUAA 3S70A 2R4QA 2NQ8A 3E1KA 4BNDA 2NOAA 4X9XA 1KS9A 4BQQA 4K9OA 5JVDF 4GG1A 1J6UA 5T4EA 1L0BA 4R1OA 3O75A 4X93A 3FYIB 1HDCA 5BR8B 3TZCA 1QR8A 3OCUA 4DM4A 4H44B 5B3JA 1L5SA 2Q7OE 3OZAA 1Q7BA 4CM9A 1PEYA 4CBCA 2Y0EA 5FOXA 4A26A 2F1HA 3OTIA 3PPVA 5AVJA 1X92A 5C3MA 5KOIA 4KWIA 4M1QA 1AKYA 2H0RA 2ZBUA 4H7JA 1CY4A 5EMMA 1KEEB 2X23A 2V4UA 3GR6A 3KKZA 4H7EA 4J7XA 4L22A 3WP0A 2BM8A 3MCVA 1S3JA 3ROQA 5CDTA 4UAUA 1R0CA 2DN9A 2IOHA 1ETHA 4EGQA 1IQ0A 3F6YA 2OCLA 2W0MA 3NW9A 2CCKA 4YB8A 2PUBA 2BTEA 4MSWC 2NNLD 3VO2A 1XKLA 1Z2GA 4GR5A 5L3RA 2EULA 3S2SA 2Y1EA 2FRDA 3QOWA 4DMGA 5KSOA 2ZD9A 3M6MD 1K98A 4RV5A 2WIGA 3HA7A 4F5ZA 1AKNA 2XZDA 5DGCA 3TRFA 5L3GA 2QROA 1CG6A 4KBGA 3F90A 3FPJA 2ZVPX 4QDOA 5JI2E 2QWQB 1MORA 4B33A 5H83A 3JARB 1M6NA 5KA5A 2BLNA 4A6PA 1UFKA 4MVSA 1C8KA 3WYAA 4AB1A 4D4LA 2R7AA 3UWPA 4XRGA 2YXYA 3MINB 4PEVA 4FWIB 4LF6O 3B9QA 4Q3EA 4BT2A 2X9GA 4TYQA 5FRDA 4X44A 5EAZA 4R40A 2RD2A 1V71A 5LZ7A 1P2BA 2FNAA 5K3OA 1JHQA 3L7CA 5KNDA 1IN1A 3LP8A 2ZSUA 1AKMA 4RIGA 1V96A 2FEOA 1DO8A 4A3SA 4B6OA 1RAEA 1B1AA 4ZV4A 1KQFA 4LHYA 3HFRA 4PGFA 4UPDA 5CEJA 1CR2A 1V4NA 5J63A 4B3TB 6REQB 3E3AA 4YIOA 3VYSC 1YBAA 1NBEA 1ABEA 4GHWA 3L0CA 5JU6A 3O8CA 1OIWA 4EHFA 1ZAYA 1G2OA 1WETA 2XHEA 5B1AB 3H2KA 1VYHA 4LTNA 5B2EA 1JEYA 1W55A 1VQ6F 1R0ZA 2QWNB 4YAKA 4XM1A 4UTXA 5I8PA 1SMKA 5B1YA 2EJUA 4GLOA 2NYAA 5NLLA 3CVYA 4F0JA 1NI4A 4D9IA 1ZMTA 4P33A 5EUCA 1K8QA 3L77A 4Y6LA 2WLIA 3H1AA 3W6ZA 3VQXA 3WB9A 4EI2A 4ZU1X 2QUBA 4QX6A 7AT1A 1I4OA 4CEJB 1V41E 3I45A 4L8GA 4O4HF 1Y80A 3L05A 4P7GA 3EXEB 3GLFE 4HN9A 3C5CA 2KE5A 5I7WA 3BN3A 3FDIA 4ESOA 1GAXA 3Q2KA 4L7VA 3LT2A 5CEFA 1GN9A 3EGOA 3EW9A 5G1PA 3OQOA 1MIHA 4NK4A 4YCJA 4HNAB 1CIJA 4C4PA 4D3DA 3JSLA 1T4GA 4DARA 5FYQA 4TZ0A 1T4DA 1V55B 1NH2D 1XNQB 1QIHA 2IZ1A 3OT7A 1TRHA 3BC1A 3L0SA 3W8DA 4MX8A 1ZAUA 4ZU6X 5JH7A 2P2CA 1X42A 4OB7A 3ZK9A 3AHGA 5BUCA 1XA0A 5H3HA 2PS3A 4M36A 4Q03A 2C8VA 3HZRA 4XJXA 4FDTA 4B9AA 1V54C 5IJ0A 1D2CA 4Q4HB 4TTAA 3TX6A 4V1CB 1K63A 2KB1A 1D2NA 1Z8FA 2ENUA 1WL8A 3EF3A 4YRKA 1QV6A 3GJ8A 5IDVA 2Z5UA 4B46A 3I9MA 4EF5A 1VA4A 2I4TA 3GPLA 1Z68A 4HX5A 2WWGA 3RM3A 3WGKA 5KYUB 4NF2A 3DQZA 1RCUA 1F6BA 1O6FA 2VDJA 2ZZKA 2OB1A 1EN5A 3LGSA 3D8NA 3N0WA 4WADA 3AO0B 4Y1RA 4AY4A 2DW4A 4GPD1 4I1RA 2QENA 4NABA 4ZVOA 4ENUA 3U4QB 4DUYB 3G4SV 2IH4A 1BGXT 2L82A 3M7IA 3PZBA 2QMHA 2YNMA 4CDRA 5L7TA 3BTUA 5DJ5A 1RM1C 4GZMA 1JAXA 1JQBA 2Q0OC 2BKUA 2FMKA 3BL6A 3EF0A 3KXDA 1PJLA 4TWIA 3TTUA 4YPVA 4LZJA 1QVGF 4KXQA 5C7YA 4D25A 3FB7C 4G4YA 2Y4NA 5FR1A 4TKUA 1OCOB 1L5HB 1MVLA 1ONBA 2H65A 2PKEA 3TTSA 3L8DA 2OP1A 3N7UA 4G0WA 2B4YA 4TLMB 2WU0A 5DFAA 4QQKA 4OHKA 1Z7YA 2UYKA 2A0UA 2ZG6A 3HV2A 2WWXA 4QBKA 3SZRA 4CG3A 5AI5A 3WKEA 1OZGA 4Z9BA 4HUTA 3LPCA 1D2AA 1IPAA 4MR7B 1NR7A 4G88A 1PEKE 1X3LA 3A3NA 3ND9A 4J7AA 4N6OA 5CNIA 1JEQB 1Z37A 3ZGXA 5IJXA 3PD7A 1XWFA 2Q5QA 5EIXA 2G0NA 3IT3A 4CETA 1K8YB 3QXCA 1XTUA 3ZE1B 2PH7A 3N9IA 4HTAA 3RU9A 1N5IA 2J9XB 4BVLA 4HDAA 5ALDA 4UASA 3IUNA 3E9YA 3NUZA 4J49A 3KZ1E 1N2EA 1QCCA 4O1IA 1AQIA 1C9MA 1U1IA 5JFTA 4LE1A 4EG0A 2EGGA 3DMNA 4B76A 4L3VA 1R6VA 3C3JA 2Z2ZA 1R1MA 2JVKA 1U7PA 4Q7JB 1ZTEA 2DF8A 3ZVMA 1LJLA 3SC2A 3UZUA 2NW6A 1RYDA 3I55F 1IWBB 4CMHA 2WNSA 4CT4B 2XBLA 3VHQA 1YBHA 1B00A 3G9ZA 3P9KA 1EJ6A 3QPVA 4ZANA 9LDBA 4CL8A 1X7YA 3D8HA 1K0UA 2H6EA 1CQPA 1Y37A 3FUTA 2NTYC 2W2TA 3PWSA 4I55F 5C3UA 3RIEA 3ABKC 1KMNA 3V80A 3W8FA 3UBMA 2YDXA 1QO7A 1D6MA 2OWEA 4UAGA 4YBZA 3QEBZ 3KO8A 4S2EA 5G4VC 1OLOA 3WK8A 5JDCA 1IPHA 2DQSA 4K81B 1NUUA 2NN4A 3EIQA 1XOUA 4WZBB 4XH9B 4BEVA 4BQSA 1JAYA 1SU8A 3X1DA 5I45A 4IJWA 3KFLA 3EGCA 3TYXA 3LUTB 1X0VA 2WWHA 2CV0A 4IGAA 4JY7A 2MYPA 2GEJA 1ZGBA 2B5OA 2HK7A 2OBXA 2O7QA 3DBHA 3PI7A 3C9TA 3QSGA 4OOEA 5FPSA 3SXPA 4DCPA 3I9LA 5TV2A 3ZJ4A 1DJPA 1YJNF 4ZVKA 4DQXA 4RVOA 4TTSA 3JVUA 3GFPA 3EVBA 4CM5A 3UGJA 4FD3A 5GADl 3AVOA 2X4DA 3OM3B 1POXA 4FK5C 4O2AB 4TLCA 5F64A 1SXQA 5JMWA 1RRGA 4ZPJA 3FD6A 1N32O 1W29A 1OC2A 2FG6C 2AFVA 2J30A 3M8KA 3MILA 4P84A 4RTMA 3WLRA 1MD9A 4LI0A 4WXEA 5DCYA 2QE7D 3EXIA 3MJVA 2LO1A 2BUAA 4WASA 3A1UA 4LMBA 1NKDA 1JEAA 2ZTMA 3IUPA 4AY6A 4JMPA 1NKVA 4QRHA 3VFDA 4ZT6A 4OTZA 4KFMA 4U7OA 4L8FA 3TDNA 3M9LA 1CF9A 1SBZA 2ANBA 4YP0A 2YBDA 4DV5O 2OFWA 2RGNC 4L5AA 4LJ9A 3AF5A 4RMJA 4A8JA 2O59A 1CEYA 3FWNA 1E20A 3H6HA 1KQNA 3GGJA 2QW1A 1H0SA 3GFTA 3RASA 5CYPA 1ZZEA 1A4RA 3UWSA 2YXBA 5CDGA 3IQXA 1C8VB 3KFVA 2DBVO 4NI5A 3I01M 4AJ1A 1T34A 4GP7A 1EESA 1US8A 1VSBA 1JDNA 1IFXA 3TZKA 2GEVA 1W5BA 5CB6A 1AF4A 1V1MB 1YE5A 2VGNA 2XB2A 2B6NA 4JQYA 2E48A 1EP1B 1FTYA 3OSZA 4TRRA 2FEAA 5DYIA 3RS7A 2QRZA 5JNVA 3GLTA 2JFQA 4LV5B 4JPRA 4MLDA 4LWSB 2Q0XA 2YWHA 3QELA 3FZQA 3N86A 4YGXB 5LZ8A 2HOQA 3KZNA 1KMIY 2X6RA 3QITA 1XWWA 1LRKA 4OUDA 2GN1A 1C3VA 3E27A 1GZDA 5A3JA 2D5AA 5IH3A 2JARA 1SC3A 1REQB 3CKKA 1WA8A 3UYLA 1I4EB 2L35A 5IT9M 4S1NA 1SXHA 2GI4A 1RMQA 1SKAA 2A1UA 3DMTC 2AZTA 3H97A 5EBLC 4TMYA 2IU6A 3HADA 4WN9B 2OXCA 1HDRA 1FMLA 3O47A 1PWEA 5AM4A 1OWLA 1A32A 1BE0A 3QENA 4OYYA 4AQYB 1E2PA 1RU3A 3H2HA 4MB0A 1Y3HA 3NIFB 4J2HA 4DV6B 4X20A 1E79A 2CL6X 2OFOA 1WQ3A 2PLAA 2D2XA 3AZQA 3GQVA 4P4UA 4RPHA 4XLTA 2AA3A 4AECA 4BBZA 3N7TA 3SCZA 3L0IB 2D8MA 3NLLA 4KUGA 3MJCA 2O14A 1I3KA 5AWFC 2W6JD 2A9PA 2QG6A 2W8BC 1BTOA 2GYVA 5E6RA 3GO4A 5D2CA 1FU4A 4YJ3A 3CJTA 1JQJC 4CIWA 3D8SA 3SDBA 3VJRA 1U3GA 1XJWA 2G6BA 5HXUA 1FEZA 2WOOA 2JJ1G 5B7NA 3S5UA 3SZOA 1HR0B 3FCCA 4U7WA 5T67A 3SYRA 3G7UA 5M04A 1HQYE 3G9QA 3KKKA 3UUFA 4C0LA 4UE3S 1NQ5A 4REQB 5KJCA 4G4IA 3GUZA 1P73A 4FS3A 4Y2GA 5EFZA 1VC2A 3QV1A 5K3FB 3K0FA 1GR0A 5DXAA 2GBLC 3A1WA 3B78A 1BO6A 2DP4E 3TN7A 3UT5A 1N3YA 1JKJA 3GVIA 3PC8C 4MR8A 2I22A 1JPXA 5HQ3A 3JR3A 5DHFA 1XDZA 5EOVA 5LJIA 3NHYA 4UM9D 1M1NB 2CNDA 5FWDA 2IHZA 4C6TA 2BVNA 2IXGA 2XUFA 3DFZA 2BEWA 1EFRD 1XZFA 4GU5A 4OD0A 4WOKA 4ZO8A 2YW2A 2YIBA 3ZNOA 1OXBB 3KVNA 1CRPA 4RHYA 3DKVA 1JALA 1JKMA 1U0RA 1BMFA 4ND8B 2HS4A 1EGHA 2PYLA 1PS9A 3T7SA 3Q3IA 3WL6A 4PO1A 2VBCA 3MTDA 4WESA 5AHOA 2OYSA 2Q29A 2QL6A 1C9EA 4CZZA 4CV3A 1THZA 1INLA 3F7MA 4WXHA 1GP2A 3CF0A 3TSYA 1JH8A 3WP1B 3EIHA 2JIDA 1AGRA 1RWKA 1R9JA 2IGTA 2PZJA 1FTQA 2B5VA 1E1KA 1KIFA 1J5EO 2COEA 3PXEA 1VSQA 4L51A 1WQ1R 3TTYA 5TPZA 2YIAA 3IQIX 4I6EA 3ZQUA 1WPXA 4IIHA 2ZB2A 4LSMA 4KN5A 1VQ9F 3EWNA 4IOMA 1EUDB 4ZVMA 4CF7A 5TVKA 4BZPA 2Z8ZA 2PY6A 3WLOA 2QRLA 5HKLA 3VMFB 2OV8A 1C7RA 2KLHA 1SQ5A 2BUCA 4P38A 3GV0A 3OY2A 2I7DA 1NW5A 2AX4A 4Q1VA 5AOVA 3JQFA 4AMZA 2OGUA 4BRSA 3ET5A 3SZLA 2P1RA 2P41A 3B1ZA 1BD3A 1CUVA 2G83A 3F5TA 1F7YA 1Z4LA 1H2SB 2VK4A 3KQYA 1XNQO 3HBNA 2Y1XA 2QMYA 1AUOA 1EDEA 3K6SA 2OHFA 2HD4A 3GEHA 3EGXB 3R23A 4JAAA 2BFEA 1U9JA 3E5RA 1MHTA 4XPIB 4MI6A 1OI2A 3AG4C 1TXGA 4WXRA 5KNCA 1KDPA 1BQZA 2P6NA 4FMCF 4UUMA 5TE9A 2DYRB 1JIKA 1HT2E 2EX4A 4RABA 2VJQA 2QLTA 3TWOA 2A9VA 4AN4A 1JA9A 4R1NA 1H42A 1J20A 3VH4A 1T3LA 2ZLBA 4NRDA 4BVJA 4CF6A 4L87A 4YN3A 3ZWVA 4LF6B 1X38A 2HLDA 3I9FA 1TCVA 4QODA 4G0VA 3A1DA 1IWPB 1T1SA 4L0MA 4ZT7A 2UZ4A 1RYHA 1QP7A 1P1KA 3CC2F 1HNZB 3O4IA 5TMDA 1X86B 5K0JA 4YHHO 1KC8W 2F9FA 3NDIA 1CULC 1PNVA 1N75A 1RZRD 3OR6C 2UKDA 3H4MA 1EBFA 5GJCA 3TSWA 4EWLA 3GFFA 1GAEO 2GLUA 1E69A 3OICA 1XBLA 2AR9A 4LZAA 4Q3KA 1HNXB 2HWKA 1J8VA 3QLJA 2HJ9A 3DHVA 4MS1A 3A2LA 1CT9A 2EINC 3OZ7A 4X5OA 5IXSA 1Y67A 2HLDG 1EVEA 4NE7A 4CNBA 4ENTA 1CE8A 1IATA 1KYOF 2FYTA 4NPHA 1SEVA 2ZIGA 1PFQA 3KZKA 4MJLA 2M2IA 4RESA 2FR8A 4BU1A 4F8EA 2XWPA 1GFWA 4RS3A 2NIPA 4BE4A 5D5QA 1AVMA 3M49A 2PPVA 2R6ZA 3X2FA 2GLTA 2V8BA 1U04A 2BFDA 5HFNA 1KD1H 2G09A 3ONDA 4EIWA 2LCIA 1R5OA 2DE0X 3L6CA 3QVGA 4NZNA 3UA4A 5L9AA 4RTKA 1E1RD 3BWBA 4O0LA 4OMCA 3AM1A 1Y6XA 2CSLA 3EVDA 3F2IA 4D02A 4KL8S 3NHKA 4A8HA 1BDMA 3LX4A 1YK0A 2XCRB 2H94A 5D85A 3H2BA 3O4JA 4WFJA 3LA6A 2HWXA 4KP7A 4UJ5A 2ACKA 2AF4C 1SQ0A 4KLAA 4Q3OA 3KOXA 2XGOA 2VAXA 5DYGA 3F74A 5BYAA 1S9HA 2JAXA 5DCWA 4EJ2A 1Z8DA 1Y6QA 3KZIZ 1K92A 3ZY5A 2IP1A 1K7EB 1NRJB 3O6VA 1PW5A 2ZJ6A 4LRWA 4DA7A 2IXBA 4R3NA 1GVHA 2G4VA 3TXSA 4NK5A 3BFXA 3TPFA 2HX0A 3FAVB 2R84A 3CVWA 4ENWA 4JWTA 2W0XA 4CIBA 1GN6A 4EZIA 3DA8A 3E2PA 3T9CA 5CVVA 1T0JB 1F48A 2XXAB 4I50B 2GKSA 1MV5A 3LW8A 4O3FA 5E4TA 1JU3A 1GV0A 1W0JA 4JASB 4UAVA 3IR5A 4KACA 5HW0A 4PSVA 3P3NA 4H15A 1FRFS 1NVKA 1ZICA 3D9QX 4X7PA 1CUYA 1M5RA 3JQQA 1NONA 1KJIA 2PUCA 4C2UA 1QUFA 2YYZA 3WYBA 1I94B 2X40A 3R74A 1VQ7F 2HEGA 3PF8A 4TWJA 2IODA 2N3ZA 3I3SR 3SHOA 1FFYA 1H9CA 4J7KA 1LW6E 4DK0A 3QI2A 2SHKA 3KKQA 3GEBA 1EX9A 5MN5A 1RACA 3P9SA 4KLNA 1F2TB 3ELYA 5AJYA 1UP7A 2XMBA 5KX5A 3A6FA 1V1RA 1Y7HA 1U2SA 3NYIA 4EYKA 3KR1A 1RLTA 2R6HA 3TB4A 1F38A 1W4BA 4ZQIA 3VJLA 4EL0A 3AP3A 1QDLB 1R3LC 1Z82A 4DCVA 4I3HA 3IA7A 4PHZA 3NC1C 2CFRA 4Z1MD 5ISMA 1XEXA 1NAHA 3I9KA 2O6HA 3GCXA 3OPYB 3WFVA 4NS1A 5CT4A 4DRYA 2HJGA 2XYGA 1C7ZA 3P45A 1IURA 3CVJA 4EHJA 1DKMA 1FXWA 3GLVA 3KJHA 3H75A 1E8MA 2UVPB 1ZUWA 2WIFA 2IY8A 3NB0A 1XMSA 3N5KA 3M6WA 3K5PA 1GO0A 1EK0A 3FB8C 3QU9A 3P9CA 4BN5A 3PIDA 2Q5LA 1A8QA 4E0BA 3PEFA 1VQ9V 1PIWA 3G0IA 1FVHA 3OPNA 1Z4QA 2P4KA 2AOXA 2GNPA 3ZU2A 4PZZA 1NMSA 4BW9A 2MIIA 4LV8B 1FVFA 1WCV1 3ROPA 4MV9A 4GZRB 4E5PA 2X9NA 3H86A 3GEEA 4S24A 1GA1A 5CXUA 1U0LA 4QUHA 5C4GB 1QMGA 2YI8A 1BMDA 2O52A 1BD4A 1WVMA 1S2OA 1IL0A 2IW3A 3TPZA 1KPIA 1E6UA 3KAJA 3QJGA 1GGHA 2VI5A 4K05A 1F0NA 3GAAA 2I6GA 4LXYA 1Z7WA 1KYTA 2C82A 1RLMA 2PGLA 3F6PA 1AY0A 3C6YA 2W58A 1EN6A 2CK3D 2R8BA 3GVXA 1NU1H 2LUOA 4E70A 8AT1A 1CLEA 1VE5A 3IT0A 3EY4A 4NZPA 3HN7A 4RA9A 3VYRB 4EPTA 3M3HA 3FJ1A 1X70A 1NJIW 5G0TA 1DELA 2F9LA 5JJLA 1KI8A 3H9QA 2RJ3A 3DV2A 4GXQA 5KWJA 1BS3A 5FJIA 3FOWA 2F9MA 2CFSA 2PGIA 1QH8B 3LDFA 1WCXA 5CIWA 4F9TA 4TXJA 4QBIA 5B6IA 1R73A 2OIGA 2C2YA 3JZDA 1V9CA 1YZTA 3G9XA 3GD5A 4LWPA 4RD1A 2WUFA 2I54A 4YP1A 1T9GS 5AR1A 1U3DA 4D99A 1DC7A 1ZOSA 4B87A 4Z54A 4LJLA 4UU8A 4TVBA 1TJ3A 2I1VB 4W7HA 1JQ0A 4EYOA 4AJEA 4CKBA 1S8FA 4P8RA 1W9MA 1QU3A 4WVLA 4EHBA 3JAKB 2NR5A 1R0LA 3LKDA 4N01A 2YICA 3D36C 1OOEA 4LHSA 4TWAA 1TMGE 1VP9A 2XCLA 3D54D 1CR6A 2UVPA 2DYSC 5DCVA 1L4YA 1K9MW 2IXTA 1WU7A 3IV6A 2J09A 3BF7A 4UXNA 1SUDA 4H0NA 2QV0A 4PI0A 1UMDB 3ABMC 3PGKA 2MCFA 4FDUA 3AVXA 1E1RG 3MD0A 3W2TA 2FF7A 1DIHA 5KUMA 1LZLA 3W7UA 5GIOC 2EEPA 2X6QA 4UHJA 3SC2B 1YS2X 3OT4A 3HWUA 4U8GA 3ZW8A 3ONEA 1IZ3A 5GTIZ 2K1SA 1WXFA 4ODIA 4CFYA 3W6OA 3TS1A 3EGDA 5KX5B 3W5BA 1CF2O 1Q11A 1T8YA 1SESA 4BW0B 1CR1A 2CHTA 3IUMA 4L5BA 1B6GA 2H5IA 2WT8A 4RLFA 3H11A 4LHVA 1Q2XA 3REOA 4PQYA 2GASA 2ZRCA 1QG4A 1FJ2A 3WY9A 4GMFA 1RT9A 3UHAA 1EM1A 2DT5A 3F9CA 3L4SO 3LQ4A 3U0BA 2BMAA 3H9JA 2HL6A 5A03A 1HBJA 3PC8A 5I9LA 3VNVA 2FMLA 3ASYA 4XUEA 2OBLA 2XODA 4M9RA 1OHHD 1UFYA 3DDSA 1BYUA 2WSSA 4DXWA 5IFLA 1FJXA 1QGED 3AYZB 4FT2A 5H80A 4ZQGA 4ZQBA 6CHYA 3UJ7A 3CCSF 2ZUFA 1IBKO 5J1SB 4DY4A 2VCHA 1YAJA 1SOVA 4HXFB 1IEQA 4AHCA 3TQCA 2XWSA 5CCBA 2JANA 4EJ0A 3HKBA 3QLTA 1C30A 4RM2A 2PUJA 1PV1A 3CW8X 3KSRA 3FYUB 3X1WA 4QJ3A 1FSPA 2ZUEA 5ESXA 2FPLA 2H63A 4UOZA 7REQB 1HUQA 1WW8A 2EJRA 1R4NB 2YDEA 5HY2A 3K53A 1JKXA 3PQ3A 3GAFA 3QY0A 4BTEA 1NASA 3VAZA 2R70A 4L0CA 4C08A 4UQLA 4MCHA 2A1TS 3K35A 4GM4A 1LSSA 1Q0LA 3EODA 4LEIA 4WFAV 1YRYE 2X3FA 4HAOA 4MVJM 4FLFA 3D4BA 1QWSA 2X7HA 4FHZA 2WOJA 4JB3A 3QPUA 3QPWA 1E3EA 3VR4D 1N6LA 1AHIA 1Z83A 3VVLA 1HYHA 1VFNA 1FYVA 1I5RA 4PHFA 5IKPA 3ZMSA 1P0FA 3LWQC 1I7QB 4NWOB 2CNNA 4BRUA 4RKRA 4A0FA 5A6VA 3D36A 4ICGA 3UK6A 5LA6B 2YZGA 1SPBS 3PTLA 3E1YA 4KXWA 1GYPA 4URWR 1P0IA 2TECE 2APJA 1ZKMA 2Y0DA 3H17A 2VZ8A 4C22A 4H7IA 4JB8A 1U4OA 1ZH0A 2H48A 4B3RO 3QO7A 1UINA 2FK7A 5KOJA 2P35A 1C29B 1VQNV 4PE5B 5FLEX 3CRNA 4ZOBA 3GRRA 4JR1A 2YUTA 1R88A 3TL6A 2D8AA 1TTPB 5SZIA 3S8EA 2EINB 2VTBA 4ZXPA 4ZV7A 1BYIA 1K7SN 3GVHA 2ID9A 2R86A 3PGMA 3CRCA 4FHDA 5MFPA 3HJTA 1G8JA 2ZP1A 1SXGA 3L0OA 3SQDA 3WGQA 3CSSA 4ZYWA 4Q37A 3FMVA 3IB3A 4QPPA 3H3JA 4YWJA 4HHEA 2FUKA 4M1KA 2ZBPA 1T6YA 1EXWA 1STOA 3OIVA 2YZMA 3UXEA 5I7VA 3PQ2A 4DV0O 1H2LA 3AK4A 1SXJA 4XR4A 3EJ6A 3DUFB 4RD0A 3H5RA 3DVAA 4MUGA 2X7XA 5HPYB 1SCBA 5HKBA 3UH1A 2N47A 2Y27A 2J4CA 1T4BA 2JFFA 1BWSA 2HP8A 2P9BA 3PNPA 1SXIA 5H9CA 3FUWA 3A32A 2XKBA 4MQFA 1Q3TA 1RP7A 4XRRA 3T52A 4BGDA 5ETJA 5I4KA 3GL9A 3TUZC 1EAYA 3NBZC 1U7HA 1L5VA 2GJSA 2I2XB 1W0CA 2C7OA 4IO0A 4JBGA 5HK9A 4BFSA 3OP4A 1K4YA 3HJUA 4OXXA 5A5DA 5F51A 3KVVA 3PDHA 3WGZA 4B3MB 1UODA 2A3RA 5J5VA 5BV2P 1IIRA 3H1FA 2HCBA 5KVAA 2NVUB 2Z3WA 1WNFA 4B09A 4BBAA 4EBBA 2CLHB 1XGKA 4NYIR 3UXYA 1ZX1A 1XO1A 5THXA 1HURA 4IILA 3N2EA 3RNOA 3T1QA 1DEHA 1FP2A 2HXYA 5LQNA 4ALNA 2BTUA 1E66A 3EA5A 4JP2A 1TQ6A 1PQUA 2RI6A 1GGMA 3KU4A 4KIFA 4MK4A 4YJKA 4ZVVA 1R66A 2PUGA 1QIEA 1DC3A 2AUMA 5D3KA 3B89A 1MBZA 3BXOA 2OORA 4OFBA 2OXIA 1WPGA 4RV9A 2ZXWC 1TFUA 4B3TO 1MA1A 4I0XB 3DEFA 4INZA 1TEVA 1AE1A 3TD4A 3DGEC 5FEMA 3GRPA 4HAIA 4LDNA 2AMTA 3A6EA 2LCAA 3K2QA 1O7JA 4U7DA 4IYIA 4YQEA 4BVQA 1ABFA 4K7JA 3K71B 2PXCA 2A58A 5DM0A 1HNXO 1HE3A 2BTQB 4RQOA 2MSKA 5F73A 1O97D 2FZ4A 2P68A 5TS2A 2XA1A 3FWYA 2HVYD 1GNQA 1IZYA 4XFKA 3EHEA 4C89A 1AO0A 2WLNA 1UXJA 3MRSA 5TMEA 3ZLJA 3CYPB 2VUIB 4GUAA 1T8SA 4LBVA 4HRAA 4LZPA 2XWBF 1RPTA 1S5HC 2QRQA 3UT5B 4UBIA 3U3KA 1WF6A 4A4DA 5K0CA 4GLXA 4MW0A 4YRDA 4BGIA 1Q0RA 3MBMA 3SPXA 1JEJA 3D5TA 2PSSA 3JXEA 4YQZA 5E4JA 5EHNA 5KHAA 4EY7A 2H1CA 4Q02A 3WJPA 1MMMA 3L6DA 3NC4A 1M6YA 4MWBA 3NONA 2VJBA 4HAVA 3IBYA 3BM5A 5L40A 2XB8A 1OW3B 2QD2A 5ELLA 2C00A 3OCZA 1J90A 1XLWA 2LD4A 3PEWA 3P0ZA 1N5JA 1E99A 1R0BA 4CXMA 4JLSA 4N0EA 5A5FA 2JBAA 3MB8A 4Q19A 4TMXA 5CYOA 1MB3A 3UAXA 1GG9A 2J0UA 3OI7A 1CIPA