4O4HB

Tubulin-laulimalide complex
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
430
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of microtubule stabilization by laulimalide and peloruside a.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle/inhibitor
molecule keywords Tubulin alpha-1B chain
total genus 172
structure length 426
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4o4hB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4o4hB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4o4hB01
3RYFB 3WGLA 1FSZA 2VAWA 5CA0A 2VAMA 5EZYA 3VOBA 4B45A 3JATA 3N2GA 4O2BB 3C8LA 4I4TB 5KX5A 5FNVB 5JQGA 3HKCA 4F6RB 5LOVA 5C8YB 5GONB 4O4HB 5LXTA 3JAWB 3WGNA 3JAKA 1FFXA 5LYJA 4O4IB 3E22B 4ZHQA 5IYZA 3VO9A 5EYPB 4X1YA 2BTOA 5CA1B 3V3TA 1W5FA 4O4LB 1W581 3RYCB 1W5AA 3RYHA 4X1IA 4TV9A 3UT5A 5CB4A 3N2KB 3WGJA 4O4HA 2Q1YA 3JAKB 5CA0B 1OFUA 3JASB 3JATB 3N2GB 2GVIA 3ZBPA 4YJ3B 4IIJA 3HKCB 4I55A 3ZBQA 1W5BA 5C8YA 3VOAA 4X20B 4TV8B 1TUBA 4TUYA 5JH7A 1JFFA 1TVKB 4LNUA 3JARA 4TV9B 3UT5B 4U3JB 4M8IA 3HKBB 5EZYB 4HNAA 4FFBB 3CB2A 5JVDA 4I4TA 5KX5B 4DRXA 5MN6A 3R4VA 3JALB 2BTQA 5BMVB 5LP6B 4WBNA 5JCOC 3RYFA 3VPAA 5IJ9A 3RYIA 4EB6B 4YJ2A 1FFXB 5J2UA 4X1KB 4O4IA 4DXDA 1TUBB 4TUYB 4EI9A 4I50B 5JH7B 5MN5A 5MN4A 4O4JA 3HKDB 3JARB 3RB8A 5JCOA 5CA1A 5KMGB 5LP6C 4FFBA 5J2TA 5EIBC 4O4LA 4KWEA 3JALA 3RYCA 3E22A 2XKAA 1JFFB 1SA0A 4ZOLA 1TVKA 5LA6A 5GONA 1RLUA 4X1YB 3RYIB 4EB6A 4ZI7A 5LXTB 4B46A 3JASA 4HNAB 4ZHQB 3WGMA 4EI7A 4I50A 4IHJB 1RQ7A 4E6EA 5FNVA 3HKEB 4IIJB 2RHHA 3RYHB 3M89A 4F6RA 4O2AB 2R6R1 4U39A 3N2KA 5IJ0A 5J2UB 2XKBA 4X1IB 5M7EA 4YJ3A 5EIBD 3HKBA 3HKDA 2RHOA 4ZI7B 5KMGA 1Z5WA 4DRXB 5J2TB 5JQGB 5ITZB 2RHLA 4IHJA 4TV8A 5LOVB 4EI8A 4WBNB 4I55B 4O2AA 1SA0B 5LA6B 4YJ2B 5LYJB 4XCQA 4X20A 1W5EA 3ZIDA 5IJ0B 4O2BA 5JVDB 1W59A 4O4JB 1Z5VA 4LNUB 5EYPA 2R751 2VXYA 4U3JA 3HKEA 2VAPA 3WGKA 5IJ9B 3JAWA 5ITZA 4X1KA 1RQ2A 2BTQB 5BMVA 5LP6A 3VO8A 3M8KA 5IYZB 2RHJA 2Q1XA 4ZOLB 5CB4B
chains in the Genus database with same CATH superfamily
1J9GA 4N0DA 4EG7A 3TTYA 4GP6A 4AZVA 2FN7A 4CL8A 4UEQA 4NU5A 1AS0A 1RJWA 3HXMA 2XJ4A 3B2EE 2HP8A 1AF7A 1UJ4A 2GD1O 4TV9F 5KHAA 2I2FA 1K6JA 3W4JA 4ZMBA 3L8GA 4OM8A 1CR6A 3AG7A 1R3IC 3RU3A 1RWBA 2EULA 2AOVA 2BMAA 2NV2B 3DBRA 3PITA 4RAIA 3QUTA 1CY0A 3ZBTA 1VZ3A 2OVFA 3MPUA 5L6MB 4RJ2A 3VKWA 3H01A 1AO0A 2DWDC 4U02A 4HPJB 3WLHA 3CCCA 2GZ3A 3PGLA 2V7VA 1JR3D 2HUNA 4YDRA 3B6MA 5LQAA 1K33A 4PCLA 3B85A 1ZLYA 1DQRA 4Z4FA 2I33A 2IZ6A 3LRPA 4MVJM 1FNNA 5GJCA 5C5IA 2P7IA 3GZNA 4MA0A 2DPGA 4AZ0A 4F5DA 1HDJA 4YIOA 1N6HA 5D2CA 4UVAA 2R8EA 4LSWA 5AKYA 3VR5A 2YFQA 2ARHA 1ZN8A 2JIZD 1KQOA 2LBXA 1UR5A 4M9ZA 1KMMA 3VMFA 2PX6A 4HY3A 4IYRA 1F0YA 3PPXA 3B77A 3F1LA 5E6UB 4AMBA 1NJSA 2VNSA 2NYUA 1ZCZA 3B7GA 4CKYA 4HAIA 1P0IA 2HMWA 1DJPA 2GZAA 2PNJA 2ZM6O 1GQFA 3RS9A 2CD7A 1Y7HA 1FY2A 2WJHA 3KT0A 4LWPA 1NMYA 3ETGA 4NBSA 4XJXA 5ECYA 3LWNA 3DCIA 2C1EA 2QEQA 3OEEA 1N5KA 1Y3DE 4V0ME 3T1OA 4D4IA 5AH0A 1F7YA 2GAOA 3ONFA 4EA8A 3UJ3X 1GUAA 3ICQB 2AD5A 4GLBA 2PUSA 3USZA 2FJUA 2ZVJA 3SJBC 2W4IA 4AJIA 4ITUA 4CV2A 4CIAA 2WTBA 2R86A 2IH2A 4L0QA 1NQ3A 4NYMR 1XA4A 2NYVA 2YINC 2X5OA 5EWJB 4ZVQA 1ZM4A 5CNKA 3VTFA 4F45A 2OXIA 2AC4A 3FAZA 5CD9A 2LW1A 3RT1A 5JARA 3O2JA 2PVCA 4J9YB 2ZDIA 1VJ0A 3GFQA 4FJ1A 5LCXA 4C4RA 5LLDA 1QUEA 1SRRA 1YZVA 1DO8A 2ZXWB 2FFAA 3PHGA 4H6WA 2MOKA 4N7RA 4IGKA 4YMSA 1UOPA 4YJFB 1IZ8A 4DK1A 2R6HA 2REQB 3IC5A 3P9RA 4BN0A 2FUG6 1P1BA 2V0NA 5E2IA 3ANMA 1DTWA 4FT4A 5KVVA 1YZBA 2I4LA 4CKCA 4B3DA 1GARA 3HWX1 4DUGD 1Q5PA 4S1NA 4ZO4A 5LWQA 5J5VA 3V55A 4I50A 2QP3A 2VAXA 3BRWD 1LS6A 2O2EA 3HB9A 2XZOA 1HK7A 1R12A 2PBRA 2CTQA 3RYHB 1QQ6A 5K01A 3G2LA 1CUVA 4V38A 3OEHG 3HL4A 4F6EA 3TNJA 5LZ5A 3U1VA 4IVRA 4TVKA 1KEEA 3H5LA 3AI1A 1X9HA 2J5RA 5JYEA 5ICSA 5LZ9A 4DUZB 4MXDA 1DAEA 3IELA 4ZU1X 5CA0F 2QE6A 3WG7C 1QYRA 1XAHA 3CINA 3E48A 4OOEA 3M5WA 4XX0B 1BOFA 3IAS1 4U2KA 1LW6E 3M6VA 5A05A 2OSBA 1WQ1R 3T1CA 3A7DA 3IUPA 3QVOA 3HJWC 3D2BA 4AMGA 4B32A 4ZYYA 3M34A 4LBYA 1J8QA 3ABLC 5CGQB 4PN3A 4PLWA 2AXEA 1A27A 1VI5A 3K70C 2D8AA 3VNBA 2OQRA 4HN2A 1N32O 4C4XA 1F8FA 5FHQA 3FETA 4BBAA 3PNLA 1BS3A 1RSOA 1NXQA 2O8CB 2V45A 4XYGA 2VQFB 2V5AA 2H1RA 4JZYA 4WKNA 5C32A 4NS4A 1EM6A 3DFFA 4BWGA 1S76D 4ZTUB 4Q03A 1CCWA 2HS3A 2CBXA 4RE6A 4ZJYA 5B7NA 4M0LA 2WTAA 4IKOA 5FXMA 4EZEA 4I4TB 3I01M 1WULS 3ROGA 4FFVA 1BJTA 3ZE6A 1SOUA 3LT5A 1ZSNA 1HNWB 5LXTA 3A6FA 1CY2A 1MB2A 3A04A 3KLNA 1FFWA 1JFSA 3FPLA 3GUHA 3GLIA 3NAZA 4PZUA 5CXUA 2YY5A 5J4KA 4JBLA 4XWYA 1NYTA 13PKA 1AP6A 2RG1A 3K1AA 2ZAMA 1NLZA 4E5MA 4MP6A 1T9ZA 3N0XA 3MGCA 1QK3A 5KC8A 1E7KA 5HF6A 1DTOA 1MJNA 1L7XA 2XOKG 1E3JA 2VDWA 3KQPA 5JPCA 3NWEA 5GVSA 3FB7C 3FHOA 1ZH6A 1CUAA 2ZIEA 3O8OA 1FVOA 3PDIA 3LX5A 1M7HA 2P2LA 4LY3A 3QVGB 1ISMA 1W0KG 1KDRA 1PYDA 1VBFA 2UVPB 4YRAA 3CPHA 2EINB 3CPWF 3A6EA 1MORA 4Z4GA 1JHQA 1PZGA 3SYLA 4FHCA 4D0LB 3H17A 3QV1A 1KEWA 2OUIA 1YZHA 1YZTA 1U8ZA 2QR2A 1HE4A 2W43A 2QD5A 3N2ZB 2QMYA 5E6SB 5BR1A 5I47A 1HV8A 3HKBB 3DEAA 3R7AA 2HG5C 5B1AB 1NN0A 4FFBB 4QEDA 1IQPA 2JFPA 3HU1A 1Q83A 1VGVA 1EFVA 2B61A 4Q1EA 4A15A 1TMOA 4OG2A 3K15A 4CU2A 1BW9A 1H4QA 1EE1A 2FR1A 2HFKA 2QLLA 4FC7A 4HGOA 1J6UA 2A9RA 1IQRA 2IY9A 3NVIB 5FIUA 8LDHA 3SZMA 2V0GA 4B4OA 2J8ZA 3KKMA 5JW6A 5FI5A 1XMPA 1HFJA 1SUSA 2ETVA 3AKCA 3BMQA 3SXUB 2ZD9A 4E2YA 3R6DA 2E5LO 5KQLA 2H1LA 4PA3A 2EKPA 3Q9NA 4O4JF 3K6RA 2B25A 1XMOO 1OTYA 1LI4A 1SCIA 2XF8A 3IRUA 3Q1KA 3Q87B 3KOMA 4IM7A 1RZUA 2G1UA 3UB4A 1NMZA 2PHZA 5IDWA 1G5PA 3OIGA 3OMXA 3B38A 2NU9B 4UDOA 3D4OA 4H77A 3CRVA 5CLQA 2CW5A 3P3PA 2BM0A 3LO5A 5ER6A 1VDMA 2P5TB 3S3XA 3D4IA 5F21A 2XUJA 2XUKA 2ECOA 1FNBA 3ZZTA 3FD6A 4A0GA 4EHHA 5AUNB 2Q45A 4KK3A 3NOVA 2BSQA 2TMKA 3WADA 2ZYHA 2RH8A 2C5HA 5JSYA 2WUFA 2B8JA 1J25A 1NF3A 1WDMA 4NESA 1GLVA 1P81A 1F38A 4NZYA 4XWAA 1XKXA 1HYEA 3LSYA 1Z33A 3FTFA 1YB6A 1YC2A 1A8HA 3JQ8A 4HP8A 2J3EA 4IIEA 5E9AA 4BZQA 5HR5A 3OQHA 1JDPA 2LBWA 2P6MA 3TIGA 3X2SA 3TLJA 2DX7A 3PHCA 5D7NA 3CR8A 3NTOA 2EJBA 4X8HA 1XTTA 4AECA 4EY7A 2ZYUX 1SC5B 3H1AA 2L2QA 3VH2A 1T36B 2ZUSA 2BGGA 3DUWA 1BDJA 3PL5A 1VBKA 2HJHA 3ELUA 3IQEA 4IV5A 5IBQA 3NONA 5BRNA 3TL6A 1TKAA 3BWCA 4XRRA 4C7JA 2ZZNA 3QLUC 3GELA 3VBEA 1EP3B 1AGRA 3T4UA 3F7NA 3U16A 4FJCC 2R85A 3I4CA 3ZHZA 1LPBB 2F17A 4C7KA 1DXOA 1KFKB 3KQKA 4RTNA 1RWKA 4Z3KA 4RUKA 1YBHA 2WSLA 2YJ4A 1YJCA 3BMXA 2HT1A 1E3SA 2C57A 3H1FA 4G8DA 4HBZA 1IIRA 3O9VA 1GL3A 4MINA 4TL7A 3G82C 1H66A 3RSZA 4C29A 3CMAV 3EIOA 5H16A 4C76A 3CLKA 4BFYA 1Z73A 4NKGB 2EIMB 1KK1A 5DHRA 3SHTA 1T8UA 2QMHA 3JQGB 3QBJA 2E1RA 3EDMA 1VIBA 3KVNA 4WY8A 1E5QA 2ZIWB 2PKRA 2IYQA 2X19A 1P1KA 3ICWA 4RMJA 3JSXA 5H3CA 3OO0A 4BT5A 3FSJX 4BLUA 5JTUA 1BQ4A 4JOQA 4J4HA 1SQ5A 4QG3A 5G1NA 3ADBA 4WNAA 2IUTA 1Y67A 1WXHA 5GGXA 4LV6A 2FG5A 1BU8A 1L1EA 1QLHA 1R3DA 2XA9A 4WW0A 5DF1A 5ALSA 1TJYA 5EZ6B 2ZRFA 2JGRA 4ER5A 4ZIBA 1P7PA 3IRVA 3G1WA 4CEJB 4G86A 2ET6A 3AETB 2LFSA 4HK4A 3SBXA 3E7DA 3VYTB 4LXTA 1GKYA 1ZN9A 1N3BA 2FRXA 4Q3DA 2A9VA 2I80A 4WNCA 5TPZD 3T5BA 5SY4A 2VO1A 2QJ1A 5T57A 4FMPA 3LSQA 2X8JA 4OPHA 3IVXA 1CX9B 3KUUA 5BXZA 4L9SA 2UUPA 4MWOA 4XPIB 4B3IA 1RBYA 4ZRDA 2XSZA 3IUJA 1XPRA 6CHYA 4DDUA 2I2BA 3NYIA 3A4VA 1XDBA 3GK3A 4UDYX 1IEXA 4J1QA 3SDSA 3FYIB 4C87A 1ZFNA 1C3EA 2I3ZA 3DYIA 4RVCA 3PFHA 3P97A 2EL9A 4M3NA 1BXRA 3VJKA 3DEJA 3CF2A 3W9SA 1DO2A 4B83A 4F5YA 3SQWA 4HF7A 1I08A 2O8VA 4CKCB 3THWB 5EIAA 3BRSA 3I55F 3JVHA 1KEPA 1N8NA 3OCWA 5B3JC 4KSCA 2BEVB 1GA1A 4GPZA 2PMCA 5DBEX 3OWOA 1TIBA 1DOZA 2Z8XA 3C6QA 4CMIA 3JARB 4UCOA 3VH3A 1G8SA 3EIQA 4IDFA 4S0ZA 4KWTA 3ZD9A 1G42A 2XGSA 3STXA 3SHFA 1NTOA 4MEAA 3C3CA 3EEIA 3H19A 1N3YA 1NI3A 4D0RA 1UBLS 3HBLA 4B62A 1GXSA 3F6CA 4RDHA 4XJSA 3BTOA 2H0AA 2HZ7A 2R6JA 1NBMD 4TKVA 4UTVA 3H6KA 4ND4A 4Z3DA 1I7QB 5ERYA 2QRVA 1KVSA 1DTSA 1UPUA 1LC3A 3C6XA 2EHDA 3QYAA 3FI0A 2ZR9A 2PM8A 3SYKA 4BVLA 4FWBA 4YHHB 3EZFA 3L4BC 4NENB 3P1JA 3K53A 3CR7A 4HGPA 3ZGYA 4DJ5X 3IAS6 5BWOA 10MHA 4DV6O 1HPLA 1UBEA 1I5XA 4MQ6A 2YYYA 4RTMA 4Y2YA 2C7OA 5AKGA 2ZS9A 4DXHA 4D3XA 1G8HA 1PR4A 2C4NA 1GM9A 1YCIA 1D07A 1J70A 1ORIA 3FLAA 1FXKC 3BB3A 1B04A 4W4LA 3FTDA 4JLJA 2NUAB 1T9CA 3V8RA 4CQNA 1ZUIA 4GRDA 5AI4A 3VNAA 5BV8A 2AT1A 2XAAA 3WMRA 2J5BA 2C9DA 3QVVA 4BNUA 4C4SA 5E3IA 3H05A 4WZAE 3TXYA 3X1DA 3DB2A 1X7ZA 1W59A 1A7AA 3A05A 2OK7A 1TYAE 2EFDB 3CS3A 3IBCA 3WK6A 1J2JA 3ERNA 3ZV3A 1H6CA 4YK7A 4J0HA 3QELB 4HZUB 4Z5XA 3ORRA 1B26A 4OHUA 1AQ6A 2AOTB 3I83A 4AKTA 1JDSA 3GLGB 3UW1A 5DZSA 5TQ0A 3COYA 1ZCFA 4Q7MB 2FZ4A 4QGBA 3VO8A 3RSHA 1K5HA 3DLTA 3KJNA 4GSYA 5E4JA 1V1RB 1H2EA 1QD9A 1B6TA 1YS4A 1ZX1A 5A3QA 4BVRA 1MHPA 1XLUA 2E1PA 3OTQA 1UP7A 4YMUA 1QONA 3ZZUA 4J11A 3C8LA 1P8JA 3NIBA 4EJSC 5KTTA 1Z13A 2QL9A 3L7OA 3DCNA 2GPAA 4ZZ3A 3FCSB 3ANLA 1TQ6A 5FEUA 3WAJA 3Q3JB 2Q6AA 3PNVA 1WB7A 3I9FA 4JR2A 4OATA 3ROFA 2D2VA 5DKFA 3WXBA 1JEAA 1CY8A 4CN9A 3KALA 1ECJA 3C3BA 2V55B 1EUCB 3U3ZA 1LRLA 2V54A 1XTJA 2FPRA 1MIOB 3H4IA 4LXGA 2CNLA 5FV7A 5HRAA 3ZDAA 4N8EA 2ZJOA 4B3SO 5KIAA 1Q15A 3ZPXA 5BSUA 4LNAA 5TMEA 3UBMA 1NT2B 3MBOA 4J16A 1XTIA 4HS9A 1GPYA 4B4VA 4QA9A 3L02A 4RZSA 2PMEA 2GFQA 3D0KA 2WMNB 1XRPA 3KQTA 1TT7A 3NOQA 4FOPA 4ZVKA 4P2BA 1RI3A 4PC3A 2K7FA 1TMKA 2P9BA 2PWZA 5I8ZA 1O89A 2BUCA 4B0PA 5A5EA 3TE6A 3ESRA 3DEKA 2OHFA 3GJYA 4AN1A 3PN1A 5BV7A 4TT3D 1US6A 2M1ZA 4YQFA 1KJWA 3E81A 5TQ2A 2ZYRA 4ZKEA 3CLRD 2X8WA 3L7CA 1VLZA 1L8QA 3ZDEA 4EUSA 5A0TA 3CUSA 3ZWVA 1G4YB 2R8YA 2Y1GA 3AP1A 4KIGA 3VTZA 5I4IA 1X7ZB 1TPYA 3GPDG 3ZP4A 1DINA 1P2SA 4C7MA 1CEXA 5FPPA 2HWXA 5JAOA 3R66A 4JVNA 2GNAA 4LW8A 4PZAA 5KDOA 1QRSA 4F5ZA 1AUVA 1YCHA 4BW5A 4AJKA 4DMKA 1JG4A 2A8YA 4CMBA 3ZW9A 1XZLA 4RPCA 3CEMA 1H1DA 1XE3A 4NCJA 2WP8J 1A77A 3O4IA 5A0FA 4X95A 4FR2A 5TSDA 3VAAA 1YQDA 3BEHA 1W42A 4XYMA 1WXQA 3ZD6A 4WA8A 1KUQA 1JHXA 1BGVA 1T1JA 1JHDA 3L84A 2OY0A 3UOAB 4B6JA 1RDFA 1D6MA 1NWCA 2XY4A 1QVFU 1WHSA 5H2FZ 1DLIA 3INTA 4U1RA 2NPFA 4ZV9A 1C4OA 2DWEC 5L3QB 2ZJYA 2LGJA 4HOYA 4BNDB 1V8ZA 1R9NA 2H2IA 1KJ8A 3KCNA 4H1UA 5KCMA 1CE8B 3I55V 2DR2A 1VCNA 1X42A 4Q21A 1VYVA 1VBNA 4LHXA 3NCTA 1DAFA 2PZ8A 1GCAA 3V8MA 5CFNA 2NO1A 3FTCA 3CNBA 3NPAA 3G1TA 4J4BA 4RSMA 1P1CA 3VH4A 3I5YA 1FRNA 1N0VC 5I7VA 2J4CA 5HY4A 1MENA 2OO5C 2ACKA 1AXRA 2PXAA 1KPIA 1XP8A 2CZGA 4KYVA 4ZHSA 1AZLA 4KAJA 1AN0A 3RRJA 1A7JA 4F2PA 2JH3A 3L1KA 4MGEA 1VQ8F 5ADVA 3QO7A 3JVUA 1J0CA 4GL4A 2G0NA 3OQVA 4IHJA 1Z4MA 3R7SA 4BVQA 3HJGA 3ZEAA 2EEZA 1CNFA 3EOAI 5AXCA 3GO4A 1G20B 2SBTA 1C1HA 5HFMA 3LG2A 4MS1B 1L8LA 3NG1A 4REOA 4RO0A 4GF5A 4ZARA 3TW0A 1U7XA 3UUFA 2QDXA 2C2AA 2AG0A 3WICA 4CFSA 1JX6A 1YDMA 4XIGS 1LTHR 5LA6F 1M6NA 4II7A 4BIMA 4US2R 1VXOA 3S99A 3PQ8A 1UZMA 3OM3B 1CB0A 2J09A 2E87A 3HVJA 1SQ0A 2Y67A 2A58A 3CJRA 5C8VA 4IIUA 4FM2A 2CBZA 2I54A 2JVDA 1P7WA 1ZXXA 3PQ6A 2Q8VA 2OQIA 5IK2D 1P45A 2CZWA 3CLRC 3PFBA 3MK31 4KDFA 3PJSK 1GPMA 2FF7A 2FX3A 3UMSA 3VZQA 2FN9A 2GMWA 5H7XA 4KN5A 2AHOA 2B8TA 2Z1FA 2A5JA 4ARSA 4J29A 1KFJB 4K9QA 5ESXA 2XB9A 3WMFA 3FFQA 4ZCLA 5CFZA 2Q0OC 1ABFA 2D62A 1Z4PX 5A6SB 1E6EA 2Z5UA 1NSFA 1VIDA 2X0NA 1EVKA 2WF9A 1Q14A 3IIEA 4XDZA 4J7AA 3Q3EA 1WHSB 2X41A 2ERYA 4AJ4A 1OF1A 1QYCA 4C7BA 1FDTA 2RC6A 3EOZA 3NLLA 3IP1A 3TNYA 3H0EA 2BY4A 3ZJYA 4DPLA 4OHYA 2X2OA 1IZ9A 3V4DA 2ZUWA 4KYTA 4MUIA 2J41A 4ZDWA 3KQYA 5IPFA 3R75A 2F6RA 1CULC 2VDKB 5AJVB 2OYQA 1BD3A 4XFDA 4OGGA 4UBJA 3ECCA 4EHFA 3UT5A 2WYOA 2BDEA 2J0VA 2QLBA 4PINA 2WLHA 4YYZA 3C3YA 3F3SA 5KS2A 1U98A 5ENDA 4FT2A 2DCMA 3KG2A 3BS4A 1IJFA 4H18A 2Z8ZA 4OLFA 1QB8A 4JJIA 1I24A 3EC1A 2PSFA 4QO8A 3GYQA 2BKVA 3N4YA 2IZ5A 2EZUA 5I7HA 2IP4A 3EB9A 1ND6A 3C2QA 3EQZA 1BQ0A 2W2TA 2PIDA 3F6BX 3N3BC 4IIDA 2YV4A 1OLSB 4RTOA 2PKWA 2EIHA 5KO2A 2BFDA 1GQYA 2EG9A 2OGWA 2PZBA 4NYJR 4EFLA 4OXQA 1K98A 3BMOA 3FTQA 4X44A 1LI7A 2ATIA 1V55C 2Y0BA 5E1BA 1ZAKA 3IBYA 4Y2VA 3MWGA 2I5PO 5IT9A 8MHTA 1JDBB 1WXWA 5CBFA 3R4VA 4F84A 4UVGA 4ZIRB 5A4FS 5KLVH 4FGSA 2R8OA 3UV3A 5AW5A 3EMDA 4HQNA 2R4QA 5L7TA 1DC5A 5IWAO 2G82A 3PHIA 3QX7A 5EC2C 1XVVA 4BAZA 3A0RB 1GCOA 3CNLA 4QEKA 2G8NA 3G23A 4IDBA 1ZSYA 5LBQA 1JHZA 2GASA 3CU5A 4FSHA 4PRYA 2J08A 1P1FA 4MHSA 1PGNA 5CEJA 5E1MA 8AT1A 4AG6A 2DMXA 5B1BB 1I3KA 4MDHA 1HQKA 5K8LA 4V0NA 3R6LA 2F4NA 4X88A 4QASA 1KMHA 3ZTTA 4TWBA 4J7XA 4KQFA 4B46A 5EKDA 2ZI3A 5K3SA 2IYOA 4JJ8A 2WNHA 2VHUA 4YAOA 3TSZA 2D1SA 2FGYA 1GSOA 4OHRA 4WECA 2NP7A 1QKJA 3P7MA 1S3GA 5A3VA 3T1YO 2AN1A 4OHVA 3Q98A 3ANNA 4HNHA 1RSOB 1EZJA 3TO5A 1GK9A 3N2KA 3ABKB 2XT9A 1IBLO 1XWIA 2OHHA 2VP4A 4NMLA 4YP9A 1Y6FA 2X7RB 4DV1B 3VIUA 4P4NA 2R6GA 2VTBB 2JD1A 4KO2S 3VSAA 3RIYA 3I9V1 1JHMA 3E2PA 3M3HA 3ZDBA 2RB9A 1BTOA 2BO1A 1VKNA 2ODWA 5IT9M 2ZATA 3PNKA 1FLNA 3B1XA 3W6ZA 4LVOA 3KJQA 2ZIUB 5FLEX 2F23A 4MZXA 2AL7A 3GJTA 2JJMA 4HPXB 1AV6A 4KRYA 1NU8A 3IEWA 2PT6A 4LF9O 3GGPA 1HXHA 2ZIXB 2PRYA 1OI4A 1D7OA 4DUZO 1WZCA 1GZ5A 1OILA 3F5FA 2GI4A 1SVNA 3UNXA 3K05A 2PUEA 2JBWA 3A6GA 3OUUA 4OL9A 2JAOA 1Q3HA 4CCWA 3AINA 3LDEA 1N0NA 3CCQV 4LJYA 2BBOA 2WHQA 5A71A 4P31A 1CHNA 1N3IA 3DQQA 2QVCA 3L79A 5HX7A 9GPBA 1V7QA 2A5YB 3T3GA 1UK8A 2IYVA 1SNYA 2XUIA 1DBVO 2ZROA 4JWTA 4LRTB 1FKAO 5GVRA 2NSHA 4YCBA 2JGAA 1NBIA 1AN9A 4BLVA 5JAPA 1CHDA 2YFKA 1LBSA 3P9IA 2OVBA 1XWFA 1EFPA 1YRLA 3EFOA 3FR7A 3MQ2A 4WOPA 2QT0A 1PJCA 2YFHA 3IP9A 1U7HA 3LHIA 4Q7EA 5G4LA 2H2AA 2WW8A 2YXPX 4EPWA 2GF9A 4I7ZB 1S7GA 2HU8A 4A0QA 3E22B 3KHUA 2IUFA 2HRUA 1RCUA 3MJRA 4IWYA 2X0DA 4DA4A 2Y1LA 5C7OO 2IOFA 1PM9A 1O58A 3IEIA 3U0ZA 2EEPA 2YJNA 3DAFA 3F0DA 2XMDA 1KWKA 3R8FA 2HGZA 4BU0A 1EXMA 4INZA 1W581 3VM6A 3S03A 1TEXA 1WABA 2Q4BA 3H04A 4AU1A 1C8VB 2P3LA 2XYHA 3B12A 2WD7B 3N2KB 5GTIZ 1X0XA 1WCWA 2OAP1 1Y66A 4ND7A 2ZI5A 4FN5A 4Z0PA 3WP0A 4CCYA 2FUNB 4GECA 4ETWA 3OQOA 3IB6A 3KQMA 3P52A 3WLSA 3R41A 4PDRA 4X84A 1H2AS 3N8DA 2QSUA 2XD4A 3R0ZA 4YUAA 1NX6A 3UY4A 1O5IA 4X66O 3KDPA 2N46A 3WX0A 4M22A 1SQPH 1RI5A 3IVCA 4NE9A 3RBZA 1IOWA 2UV8A 2AIZP 1D09A 2VTEA 1XALA 4KGZA 1RJEA 3PNYA 5D7BA 2CXQA 4MDFA 4RJIA 3QX8A 3NJ4A 4JT8A 2A06H 1P9OA 2QN9A 2QZSA 3L7MA 1BSVA 4MQ5A 4BNVA 3ODGA 4E08A 4UQLA 2ZIVB 2GDSA 2F1RA 3AC0A 3GJRA 1R1MA 4YXWA 4RK5A 5A9SA 4MWTA 3WKBA 4MVJD 3E53A 3TQQA 4V0KA 3V42A 2ZR7A 5MN5A 1N34B 1IV2A 3OJFA 1T43A 3TGPA 4J0QA 4S12A 3VX3A 4TQFA 1LZLA 4R8SA 2QM0A 2GHQA 5LP6C 1Q1QA 1W48A 2J9RA 1WZIA 3PA6A 4TRMA 2O0KA 4QYWA 4BB6A 1W4RA 2WPDD 2QRZA 1XU9A 2EGGA 3TQIA 8ATCA 2XKKA 4AKHA 3BFPA 1FU7A 4B7XA 4OH7A 2GAFA 3RQIA 3GI1A 1E0SA 1O1YA 1SIBE 1OU0A 3FGOA 2C96A 2WABA 4C0WA 3A6HA 2OMKA 3AESA 2A9KA 2X8LA 5JE8A 3NBUA 1YFJA 3QVSA 5ECWA 2R6R1 3T7DA 1E8MA 4I9NA 3U1BA 3UGJA 1YL6A 2HCRA 3F7VC 5KUMA 3E23A 4L16A 2AV6A 4UBMA 3V1TC 2QP9X 3DMGA 4UHHA 1OREA 2BSKB 1XVIA 4Q01A 1AI7A 2V0CA 2C07A 3SYCA 1ENOA 1GTSA 1DSSG 1Y4UA 2GLUA 3OR6C 4ZV7A 1V8BA 3ESZA 3CISA 2ISSD 1QFJA 2WI8A 1X7DA 1XUOA 2BT4A 3AXTA 3N8KA 3OCYA 4IJKA 3CW8X 4QDJA 1JIVA 4BMDA 5CEEA 9LDTA 1G59A 1BH2A 3RA6A 1NP7A 2HMTA 5ES4B 2OWDA 1TVCA 3AJDA 4A1OA 1P49A 2I6TA 1FJ2A 3PGXA 3R3HA 3L49A 3ORHA 1AKEA 4I5DA 4Z1OA 1YF3A 3TZLA 3JQ8B 2E5FA 2B1IA 2I1LA 3VSEA 4FEAA 5JAMA 4C1NA 1MEJA 4LFCB 1UJ2A 1T4DA 1W9MA 2XA2A 3BK1A 3DMFA 3TJMA 1GCGA 3RUHA 5FEMA 3V7WA 3FJOA 4KPFC 4Z9FA 1WQ4A 4UCQA 1Z56C 1DKUA 3LDGA 2X4IA 5JJJB 2EW1A 1MGPA 3OPYA 1BO6A 1NN5A 2CH7B 5DECA 1FFSA 4B3RO 1G2IA 1UC9A 4Y7CA 3V1MA 4EEKA 3K9QO 1G2PA 1JPJA 3R3ZA 1ZXBA 4GYJA 4FLXA 4LF8O 3WGQA 1UWKA 4RVSA 1LDNA 2J3QA 4JBGA 3IILA 4GR9A 4OGKA 4PS1A 5CVJA 4MYTA 1SXJC 3WGZA 1H2YA 3JCMM 1HT1E 1RNLA 5SZJA 3GVIA 1NBAA 1NJ8A 5EYPB 1SUPA 1EVLA 1T4GA 3T4DA 1XZAA 2PZLA 1LQUA 5CA1B 5DT9A 5B5EZ 3O75A 5JXIA 1CIPA 3KZKA 3GFFA 1C1DB 2GCOA 3WLIA 2PXHA 4Y1RB 4EL0A 4ZU3A 4GGPA 2C9CA 1ZRHA 4DM4A 4J0DA 1QGOA 3LXXA 1N4DA 3K32A 4GX2A 1O9GA 1RYEA 2HFJA 3IAHA 4YIKA 1RLMA 3DHWC 4I1OA 2C99A 1KZ4A 4NYIQ 4RM3A 4YV7A 2AW5A 2Z9DA 2GJ4A 1WCIA 3ADPA 2AOUB 4YI5A 4BQPA 3AVVA 3MJDA 4QNHB 3D8UA 2B4TO 1SDSA 3TD5A 1P6UA 2VPXA 2YJTD 1CQIB 1O4VA 2WINI 3L46A 5T6BA 3CE9A 3RRZA 3S1LA 4B6OA 3MCTA 1DQPA 1EUZA 4YCJA 4FDVA 5YASA 3F5MA 3J7AR 3L0OA 2R7NA 3KXLA 1GRCA 2A2ZA 5IDQA 3HRHA 4IDPA 4RK1A 1T15A 3X2QB 1A88A 1XV5A 1Y8RB 1CVLA 2MCFA 1QU2A 2WU4A 4AY4A 3TLBA 4I81A 4D5GA 2VCHA 3OZFA 4MCIA 2BCEA 2IQQA 2JF0A 4AUKA 3RS2A 4JI7B 1LSJA 3OM1A 4M86A 1N2EA 4M38A 1CUUA 3CE2A 1Q43A 1JVBA 2EAUA 3PXXA 4JLAA 1V48A 3HADA 5IUNC 1QYXA 3FFMA 4W8OA 1CXZB 3LUDA 1NSTA 2I6FA 4IF4A 1JUDA 2AE1A 3ABKC 5AHOA 3OLZA 4BWAA 5LHGA 3GVHA 3PEFA 4V1CI 4ZQIA 2WF6A 3I8SA 5EY5B 1YQ9A 2GBLC 3AY7A 3IT3A 3NNDA 2BPOA 1TZMA 5EINA 2LCQA 2GXAA 3EFFK 4KR0A 5MDHA 4IIJB 3CCUF 2HRYA 3WIUA 2QTSA 1EPUA 1Z82A 3PC8C 2X4LA 4TV8F 1PKXA 5TQ0B 2GUZB 1QRRA 5TPWA 1E6KA 3O8OB 4UNSA 4FFLA 1T9GS 5JJNB 3MRVA 5IC6A 1YF2A 1KJYA 2CXPA 3D5TA 4E3ZA 1RI1A 1MV8A 4WN9A 1R8SA 5JJEB 2JI6A 3PYMA 4O4IF 3H0CA 2AGVA 4IH1A 2NO7A 1AKUA 1JAXA 1ECGA 1GNSA 2C1XA 2CLEB 2YUTA 2ZXFA 4TSRA 3QWHA 4JLOA 5C0OE 3HYTA 5IUJC 5HP4A 3CX8A 2PMFA 1AMUA 3K0KA 3GVPA 1WG8A 1NVEA 3NIGB 1N8TA 3GAZA 4KOAA 1MNAA 3ZWYA 4D4KA 4C3OB 4DARA 3WRYC 5BSVA 3AR6A 5F3DA 3AZPA 1PR5A 5C7YA 4DAOA 3AF1A 4ZGBA 2VUTA 4HAZA 4QGFA 5C1IA 5B4TA 2L82A 5B58T 5GJWC 1G8PA 1JN1A 2WF8A 3UGTA 1DADA 2WD8A 4HH1A 2QWNB 4CIVA 4BO0A 1NJIH 4EH1A 3HACA 2QGZA 2DKFA 4JQCA 4MB0A 4HBNA 1ZOLA 2Q1TA 3E1GA 4UQOA 5U4XA 4E11A 1KO1A 3FD8A 2JAQA 4LJ5A 2AEMA 5G0WA 3E2IA 3EXEB 4Z2YA 3PVSA 2HSGA 4DV3B 1QZXA 3CC8A 1S2DA 2WSSD 4LJ6A 4KV9A 4C88A 8OHMA 4UVCA 3EIXA 3F49S 4LPKA 3CCJV 2GKGA 1T5BA 4BAGA 3ER6A 2HYIC 1K3UB 1DAIA 4F4JA 5JJKA 4XTCS 3LSUA 5J9PC 1FRVA 1SUBA 2HPHA 2JCSA 3GQBB 1GPDG 1GRVA 1NF2A 2W2KA 4CM4A 4CEHB 3HVIA 5FADA 1P4JA 5IWAB 2Y92A 4YMIA 1KY4A 3L8ZA 3AR3A 2LKCA 4N7JA 3KDSE 1BKDR 4NJEA 2JGFA 3RFRA 3EXG1 3ZDYB 4DG9A 2JHCA 2O2JA 5L4LA 4EJMA 1EHYA 4M9XA 4X1IA 2XGMA 2IV3A 4Q6WA 4D42A 1CPYA 2GYYA 2RH4A 1HNZO 3ZIAG 1JDZA 4M54A 3IBFA 4HMPA 3ORYA 1DBIA 2OT3B 2V7XA 4N7BA 5EP2A 4ZT5A 4DIOA 3JVVA 2JFUA 3HJAA 1FMCA 1M1KH 2OKGA 2G72A 4NVRA 4P3XA 3TLGA 5KYGA 4D9FA 1UJMA 1FMJA 2VF4X 3Q6NA 1QYDA 4QATA 3AF4A 3ICPA 4KCGA 5FQNA 2PY6A 3WK8A 5IXYA 3G5LA 3F9IA 4F4IA 5EAIA 3HN7A 1G98A 5AW8A 2H3OA 4ASUD 1LY1A 3C1AA 4B2IA 4PNEA 3KPUA 1G6OA 1LRJA 5CCEA 1IULA 1II8B 1ZD8A 4ER0A 4L85A 3SKYA 1H8HG 1Y5MA 5D1NA 1PL0A 1ETUA 3B3AA 4YXWG 3PIRA 3VJMA 3OEYA 3P9QA 4URXR 4KUMA 2FSUA 2XGGA 3FZEA 1J2TA 3KOUA 4IS3A 4XAQA 5EHIA 1GM7A 3VXKA 1FL9A 5K0ZA 2FCRA 2G40A 2HA5A 2WSBA 2ZBGA 4LVNA 4DDKA 4HD8A 4W5RA 3QPCA 1WHTB 5FTNA 4XDGA 4R8RA 2Q50A 3G2MA 1QQAA 2CWWA 1ZKDA 3ZQ4A 2X23A 3FPGA 3PCRB 2IKQA 4YQZA 4MIEA 3UMRA 1WBDA 3RHFA 3RU7A 3EG5A 1TTQB 4R8KA 3E2EA 4PNPA 4E07A 5BUCA 5JI3E 2VHZA 1QGDA 1B0PA 5AJYA 1L4EA 3P9ZA 3VZCA 3GRYA 5AO9A 4JLVA 1QV7A 2DHQA 3SF0A 1XAJA 2XAGA 3MCUA 1JA0A 3IE1A 3NT5A 4Z4HA 3WGUA 4X93A 2Z6UA 3DZIA 1JXQA 2R8ZA 4RH3A 2BHSA 2FSPA 5F33A 4KUHA 4IW3B 5LQKA 4PC1A 3V8PA 3ERCA 1EFRG 2DYRC 2VK8A 2QJRA 2O0HA 3IPYA 3L5OA 4LCBA 4I1VA 5FPHA 4EI8A 5K3CA 1SBHA 3RDPA 3K9CA 1GUYA 3LLMA 3LFHA 4KIWA 3FF4A 4O2AA 1SA0B 5K3FA 3RJZA 1E0JA 4DPMA 4BEWA 3GPBA 4QYXA 2IV2X 1U0EA 2LDXA 4P08A 4JTCB 1RKUA 4K9SA 1H0SA 3DZJA 4J1NA 4WVFA 3CMAF 1UEXC 4Z1MA 3ZEDA 4EL5A 3W05A 4OI0A 3OX3A 1ZD1A 4JX9A 3V32A 2ZINA 1A7UA 2QPTA 3GWOA 5HBRA 5TJ9A 3ZCRA 4AYXA 5DGHA 3EXIB 4NBWA 1X19A 4J3NA 4WCFA 2ZIFA 3WTCA 1KQNA 4LSMA 4NK4A 3S2UA 2C03A 3EPKA 5D5QA 4FFSA 2CK3D 3AB8A 1O4WA 3E86A 4BW0B 2F90A 3MDOA 3L0BA 4X92A 4QLBA 2A92A 2WPDA 3QV2A 3W7BA 3BDAA 1VQOF 3EUFA 3IIKA 5B6PA 1QG2A 3S1AA 4TQGA 1XDGA 4HVCA 3MVEA 3UMBA 2D5IA 1KEEB 1AK1A 2Z95A 2PZKA 3DLPX 3LK6A 3ZN1A 1FP6A 1XNHA 3IH5A 3OSZA 4M21A 4PSAA 3K70D 1ORVA 3VR0A 1CZKA 3IUEA 4IQGA 3ZXYA 1JEDA 3CCLV 4DWJA 3DXXA 2FMUA 3QFSA 1VFNA 4HWKA 3ZNOA 5I8PA 3DXRB 2A0UA 2QRGA 4TOIA 3GAFA 2HOQA 1BG6A 2VQEO 4KRXA 1FX0B 1ZH8A 1GSAA 1QOPB 2R2AA 4FEGA 1LS1A 3CX4A 4W8GA 1PZNA 1V6SA 4CQJA 4BNMA 4GZMA 2PH7A 2LUOA 2W42A 2AXQA 1N6PA 4H6VA 1Y4SA 5TMDA 1TQDA 3QVKA 1ZWLA 2ZAIA 4IXWA 4MS2A 1HDEA 4QD3A 4M0PA 3SQXA 4LNUA 1HYQA 4EZBA 2ID9A 4MHOA 2AZDA 3ZI0A 3PEWA 1EUYA 3DVRX 5EZYB 1P60A 3FOCA 1S6YA 4ERHA 3KVOA 3PVZA 2L6LA 3CNHA 3Q10A 2ZPAA 5E8RA 2I7CA 1R1DA 4D1YA 3FDFA 3GD7A 1IZ3A 4JI7O 3OTFA 2NXNA 2Q5JA 4QTTB 2V4DA 4F2GA 3RM3A 4DV7O 5DGDA 4UZSA 1ZX3A 1SCAA 5AESA 4I14A 4FFPA 3PXEA 4L07A 4U9IS 2X0FA 1NDQA 2YMPA 3UJ6A 3KDAA 4J6EA 4K3VA 4JH0A 3KPYA 4C04A 2UXXA 4RS3A 5FWYB 3WBJA 4PX2A 3GB7C 1EUDB 5L53A 1J97A 4R8VA 1YS7A 1MQ8B 5AVVA 5H02A 1GDTA 3P26A 3HYNA 4MPPA 4ES6A 5IHXA 3A0HZ 1W34A 1JQ3A 4KLAA 4FE7A 4MVOA 4DLBA 5K8TA 1GGMA 3CSDA 4HDKB 1WUTA 5IABA 3KR0A 4ZO6A 3PNPA 1HEUA 3UA3A 2Q41A 1FNSA 1MB9A 1V0JA 2H1VA 3WJPA 4BIZA 1BMDA 2F2TA 2NAFA 2PBLA 2Q21A 2ST1A 2XBUA 4FX2A 1EIWA 2I6SA 4F6RA 4C6TB 5IE9A 1GDHA 3ZRWA 2PGAA 1COWD 3DCJA 1S4MA 3F96A 2ILMA 4UHCA 2DFDA 3C3AA 1P1IA 3W2FA 2EXXA 5JSFA 2UZ4A 4WUVA 3AG3C 4G89A 4QGAA 1U3TA 3U09A 2QN6A 3FVRA 1CK2A 1E63A 4I8IA 4GMXA 4JITA 3NDRA 4NCIA 4S2UA 1DPGA 4PAWA 4CM5A 4GL2A 4HUQB 3HZRA 1V6AA 2YBDA 4X65B 1I8TA 3C70A 4CGZA 4X97A 4PLTA 4WBNB 1M2WA 4M1MA 2X7JA 1Z18A 2P41A 4QBFA 4BX9A 3JYHA 4FDUA 1HO3A 1XDDA 1LVGA 2JH9A 2CVHA 3TI9A 2FVXA 2PWPA 1RWPA 4RTRA 4DV3O 2HGSA 3C5EA 1JEYA 3DZDA 1G5FA 2B5WA 2EBFX 4ARIA 3CRNA 3FVWA 3RE1A 2EC5A 1AP5A 4P4LA 5AOVA 4ZVMA 3HY6A 4JN6B 2H85A 1UMDA 2XUZA 2X0EA 2CE7A 3T4EA 4B84A 1IXRC 2FEXA 3VPDA 4D3SA 1U9IA 2FPGA 2OCCB 3DS8A 4H7JA 4MMXB 4MWEA 5IDVA 4CLRB 4WKCA 4DL9A 3WLAA 3A6KA 3CTPA 2ETXA 4BB5A 1IPEA 2VNAA 3WWEA 1Q20A 4WDRA 2A4MA 2GHRA 2X15A 3QBVA 3IPXA 3LRXA 3MUNA 3NGXA 3SIVA 1C7ZA 3MFQA 1XXHE 1DB3A 4YYEA 1L5WA 4OX9B 4XLZA 5BOSA 5JMTA 3LGXA 3K9AA 3WGNA 3WG7B 4UM5A 5CNMA 2JFOA 2PX8A 4W5HA 4BJ3A 3AILA 1Q50A 1M1NA 1Z83A 2R7LA 2IQ5A 1GTG1 4L87A 3FCEA 2YV5A 3BH6A 3DMYA 4B6RA 4QBTA 3QU9A 2NVWA 3D6NB 1XCBA 3RAFC 1Y5RA 3REFA 5A0VA 1AF4A 1NBHA 2OOSA 4PEVA 4UNPA 3ZLVA 4LHWA 4RJJA 4QU9A 1Z4QA 3E1YA 2IE0A 1TCUA 2QZJA 4LYDA 4QREA 3TGWA 3WNQA 2J1LA 1E1QA 3WGJA 4B7KA 1Y7IA 2GVDC 2QX6A 3HA7A 3WVNA 4JBHA 4RY2A 3ZNNA 1EJBA 2IIBA 3KJZA 1FC0A 2AYZA 5CT4A 4QPPA 1H69A 3SBEA 1OWNA 3H16A 1OR8A 2VWPA 3VOAA 2R44A 3OWXA 3VR5H 2IHNA 3LDAA 4P1ZA 2ZE5A 1OD6A 2ZNJA 1QGUA 1QV9A 2DCUA 3JY6A 4RANA 3OX4A 4XM2A 4FIZA 4E1AA 2GZ2A 3N5KA 5KINB 5LYJF 3ZDDA 4UUBA 2JLYA 5GGYA 4DJJA 2IW5A 4ZREA 1VEWA 3STZC 2I2WA 3CF4G 5IBRA 1QS0B 3AYZB 3MT8A 1YV9A 4QG7A 4HUTA 2AI1A 4PYJA 1RM5A 2Y1FA 1Q77A 4RK0A 1LX7A 4IQ0A 4L0MA 5A2QN 4TUYF 1QVZA 4POOA 3EDOA 3LUGA 4HWOA 1NR7A 1NM5A 1Z6AA 5E3JA 1JA9A 5MN4A 2HXSA 2I78A 3RQSA 1GGKA 4CJXA 4X1OA 3HKDB 2F3PA 3HYSA 4GZ5A 4IYJA 4ENQA 5ULLA 4U0JA 3HABA 3K9GA 1Q7TA 1BDBA 2IBMA 4UTPA 3KZMA 1E1RD 2FRDA 3H9UA 4ER6A 4KQKA 2JBHA 2YV3A 3IP5A 5DSTA 1T6BY 3E89A 2XNKA 3AEQA 1A72A 1VH8A 1Z0AA 2QDKA 4MJ3A 4C05A 1I7LA 1NP3A 1ZM2A 3LOPA 4FEYA 4LI0A 4BT3A 3TZQA 3TQTA 3ZH2A 5IJXA 1WD7A 3ISTA 4BNLA 4C0KA 4X3CA 1R3LC 3C16C 3RBXA 3KTAB 4LISA 3I5AA 3GBSA 4J80A 2V98A 3A1DA 3NBYC 3ZJ4A 4ZYUA 2OTLF 4LHVA 1D5WA 1LV8A 4Y1FA 2Q7OE 5KAIZ 3W2TA 1Y63A 3FNIA 3PE3A 1SC9A 1VE1A 1JZSA 4W1PA 3U7HB 1UXGA 2CVOA 1QX3A 3R3XA 2JIZA 4J1SA 4PFKA 1S8OA 2IXTA 2UUCB 4CH6A 1R74A 5CT9A 4A0SA 5A5DA 3AHCA 2JFVA 1H2MA 3EVFA 3WFVA 2RGRA 4ZT2A 1DO0A 3LQ1A 5FBLB 2SKDA 3DV2A 4A23A 3Q9LA 3GUUA 2IX9A 2JRLA 4KFTA 4L74A 1R6UA 1AY0A 1GM5A 2DERA 4YRFA 4PRZA 1E4YA 3SYQA 2CJWA 2GVZC 4XB2A 4ARAA 1YR9A 2V58A 4IV8A 1GU1A 3HFRA 3WNBA 3L2OB 4BKOA 4XPZA 1JPVA 1QIIA 3KAJA 1CY4A 1VLVA 2CMDA 4GBJA 4R2KA 1KNQA 1PZXA 4TS3A 1XZIA 1X52A 1V2HE 3L7JA 5KVQA 3CX7A 4IYIA 2EP5A 4K6CA 5EHGA 4YAIA 1TQ2A 2ZW9A 4G4SP 3O5AA 3EA5A 3R5HA 2ZWAA 3GZTB 3K20A 2OXRA 4M0EA 4D0NA 5KTNA 4KR7A 1XHFA 4YGXB 4S04A 3AI3A 1PK8A 5LGUA 1HZJA 3CLSC 3C1OA 3HCEA 4HQFA 4IWXA 1RR6A 4TTPA 3ZQKA 2J0SA 1NXPA 4JASA 1H2HA 3AERB 3EC7A 2JIBA 4CNQA 3DFIA 4X54A 1EP9A 5I5GA 1PWHA 1WX1A 2R6DA 1EQ2A 2FR8A 4H1TA 1L4UA 2W2OA 5BT9A 2N0SA 1UBUS 4JGIA 4DEYA 5KNDH 4PWTA 2BJWA 3PXGA 5ERGB 2PI5A 4BQNA 1EHIA 1XX6A 5G02A 5IKPA 1XDZA 1T5OA 3C3KA 1QF9A 1SKUA 3UAOA 1W0JD 1U2SA 4CTKA 2IBTA 1JDNA 1RD4A 3V7YA 1NW6A 1J7KA 2O06A 4LXIA 2WAXA 2BOCC 4IJ5A 4LC0A 3ND8A 4NBLA 2P4EA 1GPJA 3CCFA 1XAGA 1UEIA 4PDVA 1ZLXA 3GFVA 2Z57A 3Q2OA 1MZFA 4WNYA 4M8LA 2DOKA 2YSUB 1T3HA 1NUHA 3LRTA 3LAWA 4P2GA 2Q6OA 3BK2A 1GUZA 1LVUA 2B2NA 1JTEA 3OM8A 3R5FA 4TSFA 3DMTA 3EISA 3L7NA 3CC2F 1IUNA 4RZQA 4Y8VA 4JBIA 2GZHA 5DNDA 4ZVNA 1R0SA 3AOEA 1V1MB 1Y9EA 1ZW6A 3NDPA 2PCJA 1W46A 1KDPA 2EIKC 4JJKA 1E89A 3TB6A 4ITVA 4CIBA 2FN4A 2VRWA 5CLFA 1WDLA 1VQNV 3L7BA 2ODMA 4HAOA 3VVLA 3RYFA 1QP8A 1M8PA 3IT2A 2VPWA 3HB0A 3WS7A 1IN6A 4KHPO 3CMEF 1GGJA 3GRVA 4MKRA 2COKA 4RACA 3TCKA 4QVIA 3EVKA 2AOUA 3J81A 2AB0A 1TU4A 2OK8A 5E2BA 1YTFD 1IN7A 3H9BA 2HU7A 1CY6A 2AG1A 3KKNA 3WSTA 4O59O 1WEHA 2IBSA 3BZWA 3PNSA 1K7FB 4G24A 4WWHA 1A4RA 4DKJA 5TC4A 3EMVA 3WE7A 2VP9A 3KEFA 2ZSHA 4TTRA 1JLSA 1GR1A 5IT0A 4H31A 3ZBUA 2C5EA 3T5AA 1BWQA 4K9NA 3ZOZA 4OXXA 1A95A 1YE5A 3NW9A 1IH8A 1VCHA 3VBBA 4MV1A 1NW7A 1AS3A 4CM1A 4CGYA 1Z36A 3FYUA 4CUJA 3NIDB 3NBXX 5I9TA 1MUUA 2WC1A 3HMKA 4X85A 2O8CA 4WDQA 2JEUA 4RUEA 2PLWA 1NA5A 1XRMA 2W6MA 4H27A 2YYZA 3R7FA 1AJNA 2NG1A 3QM1A 3OC0A 3F0EA 4AQDA 1IDN1 3FYSA 5L3VA 4URHA 5LHHA 1YRYE 3KV3O 4C7VA 2C84A 5JZ9A 3SPCA 2NADA 4DLXA 1H2WA 1PFGA 3QRWA 3K0CC 3NXKA 5TVGA 2D0PB 1JZTA 3AKZA 4P98A 1LGYA 3BX1A 4Y18A 3HI6A 5FUMA 1KNJA 3EWSA 4YUVA 4O2BA 3I2YX 1R8YA 3R7WA 1YIJV 4A26A 2LCIA 1CD5A 3A27A 3GLHB 1FZQA 1VSTA 3IAAA 4QL3A 3U61B 4ZVRA 1NIJA 3O2QB 2VUHB 3LNTA 1QOQB 4CKBA 2I1WA 2B7LA 3IIMA 4K9DA 4ARCA 2FEWB 2HEPA 1ZOPA 1SC6A 3K1JA 1TF2A 2B9EA 2YWGA 4DABA 2FK7A 4ME6A 1RBQA 2VEDA 3EQ7A 5HXZA 4DLZA 1H3FA 4QYMA 3T99A 2D1YA 2WIAA 4O2RA 4AKEA 4UD6A 1QHTA 2QAGB 1CF9A 4CUZA 2R3SA 1IZZA 4ND8B 5C1OA 5HKOA 1HY3A 3T5DA 4CTJA 1KAQA 1A76A 1OQAA 1MX9A 1KI3A 2CNDA 2M1XA 1OT5A 2PH1A 4ZOQI 2CK3A 2ZJAA 1EBUA 4OUDA 3DWIA 3RF6A 3SZOA 4KLCA 1R64A 1N2ZA 1FTNA 4KXMA 2IU3A 2FQ1A 3I56F 1PNOA 2Q2NA 3P9YA 3S3TA 3U5ZB 2ZZMA 2IYAA 4MVJP 1COWA 1EFVB 1UMKA 3ED5A 4ZQBA 3U4GA 3WSVA 2QE7G 1XHLA 3NPMA 2HV8A 3H9EO 4NJOA 3SOPA 2WVJA 2XMRA 2CKMA 3KFXA 4ZDJA 1QGUB 4X45A 3WQSB 3OQNA 4AQYB 2KE5A 3FNBA 4I5IA 1ZH2A 4IV0A 1J9EA 2QXTA 3QEAZ 4PD4F 4UPVA 2HK7A 4JF3A 3ILVA 4R8CA 4QQKA 5JS6A 4JYBA 5CBHA 1J1IA 1J7JA 1E18A 1VQOV 1JHUA 2JGEA 2YJ6A 4NPAA 2PPVA 4Z2AA 3MQWA 1ID8A 1XCGB 2YZKA 3OJOA 2LFRA 3RT3C 1Q1ZA 4DWOA 1E7SA 3S2YA 3TBHA 3ZJUA 4GOMD 2OXTA 4JI1O 1PUJA 4AMVA 3B1ZA 3EGDA 3WSWA 1ZTEA 2BGNA 1HDYA 4FGUA 4LNHA 1ESMA 4M53A 3X1KA 2C78A 6REQB 2QGFA 2VUIB 1NVFA 3N2EA 2PAFA 3W6UA 2HQBA 3Q41A 4C07A 1S3FA 5HFLA 2YXDA 4L5CA 2QA4F 2FJPA 2GN4A 3VC3A 3ZLBA 3JRNA 4AP5A 1ONBA 3SX4A 2DQSA 3DGEA 5J2UA 1Y9AA 3K1ZA 4FNAA 2Z09A 3K0FB 2GJAA 1EVEA 4F71A 5KYYB 4HB2A 1SD2A 2Y9PB 4UM7A 4B73A 1L7QA 3GV0A 4XSVA 1N5MA 1W0CA 3T9BA 3ZV5A 1K9VF 1JQJC 5BQOA 1PNQA 1HTWA 5LQRA 4LOAA 2HR3A 4OPMA 4QAQA 5F51A 2B33A 1SXJE 4IDDA 4K1LA 2ZYWX 3RWRD 2YMLA 5JADA 1MAAA 1Z2PX 2DFTA 4KACA 4LTNA 5FA6A 4RETA 3ELWA 3SF8A 4KHZA 4Y3UA 3EPJA 4O3MA 3MAGA 2ZUUA 1UM8A 2AOWA 2I4OA 1U0TA 2WJZB 3OI7A 3HO1A 4Q1BA 4XCXA 4E7PA 3JR7A 2Q5EA 2JGNA 4OMUA 5A9SB 3B3FA 4E14A 2XH8A 2YXHA 1CN7A 1D9ZA 1G8YA 3LD9A 4LN1A 4MAFA 4MYSA 2JASA 3RU9A 3DGFC 2B4QA 4EO7A 3PTAA 3ND6A 1U80A 3SPXA 5B58C 4HDRB 5KJFA 3FMVA 3HC7A 3MRTA 4D8XA 1W36D 1LLUA 5K3EA 3H2YA 1KAOA 4AJHA 3KK0A 4KTTE 4GE3A 4BWYA 5DM6V 2AZXA 5JWPA 3SHOA 3G80A 2VJOA 1KRWA 1D1SA 2VCEA 4HV4A 4RSHA 3DLBA 2WE7A 2O8EB 4FCVA 2NSDA 4MKHA 3MINA 3I1YA 4MKFA 5JMWA 2X6TA 1GN8A 1XZ8A 1N5RA 2G09A 1WP9A 1S2LA 1V41E 5IVIA 2IAFA 1OPXA 3CM0A 4KJXA 4NEHB 4Y6PA 4YP1A 5EERA 4P4TA 3BFXA 1AUPA 3TIVA 3T3HA 3MS7A 2JNWA 3RKRA 4IUBS 5CN0A 2ZJ2A 1E6WA 1JG7A 1Y7TA 2FVYA 2XEDA 1BCCH 1YEWA 2Q29A 2CLIB 3ECAA 3K9LA 4IMPA 5IN5A 5K03A 4MVCA 2UZ1B 1Y9JA 3RVBA 4TYPA 4BBZA 3MXOA 4MJLA 5EQTA 2IZZA 3NHRA 4TM8A 1R0BA 3VYSB 2CLMB 1XEWY 3HU2A 1AKQA 4D3ZA 2X0LA 1DJQA 1NVKA 5G3YA 3QO8A 1I9CA 2HF8A 3KYCA 1L5MA 3RWOA 4V0QA 3E1SA 3DOEA 4FYJA 2BE9A 3IKMB 4DTIA 1YR8A 2OKCA 2R72A 1CYEA 3I6BA 4TWAA 3MHSC 4BO8A 3KD3A 2HX0A 4FYIA 1W5FA 2DLNA 4LGCA 5EHZA 3C3MA 4P7KA 4XGRA 2Y0EA 3J80M 3K8ZA 3OE4A 4TV9A 2IHZA 2JJ8A 3Q3HA 4S2EA 3L6OO 4DEXA 5I4BA 1EFAA 3K4HA 1KY2A 2X2PA 1GG8A 2VG8A 5DRYA 3F8TA 3OPYB 2N1BA 4Y0NA 5IXSA 3K0AB 4G0VA 1UINA 4ZODA 3VNSA 1T8PA 2IYYA 3VAZA 3BPSA 5IH3A 4EVSA 4WTOA 2GUZA 2HMYB 3I2GA 3FPJA 4FLMA 1ULAA 1CUZA 4PI2A 1RWWA 1JR2A 3DF7A 1AZWA 5G4KB 2FZVA 4LFBO 2WLKA 1M1UA 4BP9A 1ZXLA 2IQIA 5IBCA 1JEYB 1Q2UA 4YRZA 3ONVA 4JHLA 1QH9A 3OPNA 5ALTA 5F64A 4EKNB 2ORIA 1KYTA 1RCTE 1Z5GA 4UBLA 4CQMA 2JATA 4TKMA 4CKEA 4NJMA 4QTXA 4TYMA 3IQFA 3OQBA 3QHQA 2PMWB 4C22A 4MPJA 4RL6A 1ROPA 4J7KA 2JLCA 4R54A 3QLVC 3UJDA 4E4TA 3FDZA 5JZBA 2Z56A 4L4RA 4F4FA 2Z3VA 4EARA 2GAJA 1VYTA 2Z9BA 2NQ8A 1PWXA 3GT4A 4GLLA 3A32A 5F3WB 3B6NA 5KMGB 2EW8A 2JARA 4BLOA 3S8EA 1U6JA 4RHYA 1XPJA 2UYHA 5D3MB 1YNOA 4AS2A 3DL0A 4E3WA 3FMOB 4P7BA 5AVTA 1UL1X 1E1KA 3BSFA 3P96A 4HWSA 3OOEA 1NJ1A 1FXWF 3F4BA 1IOVA 2X86A 4WXEA 3AEUA 3D4LA 4H7FA 5KNDD 2O6HA 1R3KC 4NJEB 3AIMA 5ALGA 2VDVE 1RQ7A 1V4VA 2HVKC 3PNOA 4OYRA 2FYTA 3TXSA 2ATCA 3QOXA 3VC7A 2NU7A 3ZUPA 5JTTA 4BKRA 1JJ2U 1S2IA 1X1QA 1IEVA 1P75A 1DU4A 2EF0A 2XVMA 3A9RA 4NARA 4Q9NA 2AIFA 2X6QA 2C3UA 1P1JA 3RVJA 3ZXSA 1YI8A 2AIRA 3C3EA 5EIBD 5FQOA 3WIBA 4ZTZB 1PD0A 3KCYA 5HRUA 4FGWA 3RRXA 3RLFA 3NHZA 4J49A 4X6XA 1TAGA 4XX1A 1Q6HA 1PDWA 5K0SA 4TV8A 1DRUA 4BRZA 1LX6A 4XGIA 3H18A 4OD0A 4DSOA 4E51A 2HBZA 4DY4A 5DMHA 2WLIB 5AVUA 4DW0A 3BDVA 3LF2A 3CH7A 1MOFA 4LH6A 3QVUA 4PZLA 4QPJA 5JZOA 3FKSA 5KYXB 5K4GA 5EKUA 1KK3A 1TO6A 5J3JA 3A6JA 1H9AA 4LBWA 1DMRA 5BNFA 1U0JA 4MTCA 3S2FA 2KX7A 2CLCX 3SC2B 1A9SA 3QUQA 1L0LH 1FLVA 1C8KA 1M93A 3E82A 4XOIA 4AUNA 1F14A 4ZZ0A 3K57A 1SC1A 2BHLA 2DUNA 4Y9TA 2P6RA 1NBME 1LNQA 1V16B 3E9NA 5AKHA 5ECDA 4FXOA 2CHTA 1USIA 4UAVA 2B69A 2ZBUA 3I9KA 3P2OA 4WPGA 5HYVA 2QEXF 3V8QA 4ZHWA 2PLFA 1DCFA 3UJBA 5MGNA 1YQNA 3R6GA 4XR9A 1MFPA 1XCLA 1JBQA 3ECSA 1IMOA 4C43A 3IAUA 3CZ4A 5EKSA 1BS1A 4ZHQA 4RY9A 1OVMA 1IBRA 1M6WA 4TL9A 1ZUNA 3SMVA 2H7YA 3Q5DA 5CYOA 2LW7A 4MR7A 3LSSA 1SEVA 3I2JA 3JQFC 4IOKA 1YIDA 5EUCA 2O59A 4A6PA 3W9UA 3JD1A 3VDQA 3N2YA 4KE8A 3FH0A 5B1SA 1TYDE 4OHFA 1UQUA 4D8YA 1PBTA 1W4ZA 1YDHA 2GCIA 3AESB 4LK2A 4RAOA 1QKKA 1K86A 5ALDA 5AM3A 4QWMA 2GXQA 1KVUA 1EZ4A 1QC5A 1H4TA 1U2QA 4MJ7A 1UFIA 1RXYA 1I0HA 1V2GA 3G2QA 1K7YA 2GYVA 1EGHA 4U7GA 5INTA 1NVTA 1QWSA 3GP5A 5JHGB 2BSKA 1IRIA 2DT8A 3L7LA 3O1LA 3PGVA 3SQNA 1U2RA 3RFTA 4CDGA 1XNRO 4NDAA 1SHLA 2QLNA 4N82A 2V7EA 3OA2A 4TV8B 2DT5A 4UARA 4BQIA 5FBHA 5B5SA 1WMEA 3C7KA 3C90A 3SJ7A 5C52B 3JYNA 4N9QA 1I3MA 3C5CA 2VSQA 4OSEA 4PX3A 1FPOA 4S3MA 3A11A 3HUFA 2FQQA 5EMMA 2XAQA 3RREA 2G9QA 2PKXA 5B53A 4JVMA 2D00A 2QX9A 1W4CA 3TLYA 4JI4O 2ZAYA 2O9JA 4DNPA 2HP0A 1YU9A 2PEYA 3WDKA 5CDYA 1UMCB 4JL6A 3BJEA 2UXDO 5KTMA 3PJGA 3NK7A 3H2ZA 2AJ8A 1AROP 4GHWA 3D3KA 1TM7E 5CYGA 5JFOA 5IAEA 2G9IA 3LWDA 4ZOEA 1RQLA 1DIRA 3GQVA 1U1EA 1X6VA 2OCHA 5FWAA 5CA1A 1QK4A 1SU8A 1JW9B 2MSWA 2EHJA 4M0MA 5CVVA 1C0IA 2P5SA 4KWEA 2RAVA 1KE2A 3JPWA 1VMAA 2HHAA 2R25B 2SHKA 1IXMA 4GI1A 1TVKA 4ICIA 2EBUA 4NZOA 5T6MA 1G4HA 1QTRA 2Z6VA 3RRBA 4ZI7A 3PC7A 4KWIA 3T15A 4INAA 2L69A 4GSLA 1B1AA 4C20A 4BVEA 1E8NA 3E9EA 2V5UA 4PYKA 4XFKA 4MVJI 1V5IA 4WFQA 1E2LA 4IRUB 3V4VB 1G8FA 1SKBA 2JJYA 3SSAA 1MAUA 4KKVA 1J33A 3LSTA 3M1YA 2H4FA 2FMKA 2CDBA 2X1MA 3RT9A 2WTMA 2F93B 1Z7YA 3AY3A 4GOJA 3SR4A 3AEQB 2ZXWC 4I1PA 4KMOA 3BA6A 5KX5F 2L26A 4WA7A 2F55A 3R40A 2AFVA 3EASA 2WV7A 4WESB 3UAWA 1YS9A 5E6RA 1D4ZA 3U44B 2MMCA 4X61A 4WXMA 3E9ZA 1EDZA 1IHXA 2BGKA 2VJMA 2W70A 5GZ3A 2IEDA 1IHYA 2KG4A 1L2TA 2QMQA 1Z4LA 1ZQ9A 2SECE 4J4TA 4GPAA 2O54A 4W7IA 1ZOSA 3CMCO 3UWPA 5KYTA 2VBGA 1AE1A 3UAYA 3KZNA 1E61A 4DFDA 3H84A 5B1HA 1XBTA 2BFBA 5FORA 1HBJA 3GBPA 1R73A 4LE0A 5HMLA 2BSAA 2FEMA 3I32A 1ISIA 2GERA 1HKHA 3AFNA 1F1BA 4QJ4A 5FOWA 2HU5A 3IL2A 2A5DA 2C0CA 1GJRA 3FIUA 3O7MA 3ZCXA 2CFCA 3C7CB 4JXXA 1NYRA 1U9CA 1F23A 1SKAA 4ACAA 2J6HA 1OAKA 2AJCA 2HZBA 2Q9UA 5K5EA 2ECQA 3ZDZB 3OAAG 2NTJA 2ZANA 3IVRA 3OF3A 2A0KA 3HYRA 1NJIW 3MMPA 1HI9A 3CKKA 3JAKA 1D1QA 2ZNIA 2OBXA 4MLCA 4C4WC 4MW7A 5K3FB 1E96A 1I10A 3KQWA 5DI9A 1FYWA 2BGTA 3CUUA 4TLEA 4YR7A 3HB1A 3Q3IA 1V3VA 3SAJA 2I34A 2I4TA 2IRWA 3I6YA 3TFQA 3I01A 3U7FB 3WK4A 2D74A 5A04A 2ZI4A 2MW2B 4EJ6A 2MU1A 1DDOA 4IG9A 1ZN7A 3DMPA 3HRKA 4PZ9A 5IBPA 3W8EA 3TEMA 4KRGA 5BSFA 2NZ8A 4FYVA 1NURA 2VDMB 4CMKA 2R1VA 3NHPA 2BEWA 1V8DA 4OH1A 1WDWB 3BBLA 2QJWA 1NE7A 5TXGA 1PJBA 2AX4A 3E83A 4X62O 1IV3A 1W6RA 3HUDA 3MGGA 4FLEA 4QQ8A 4WESA 4G4JA 2NYRA 2BKLA 2YS7A 3JQGA 2QDOA 1O9BA 2PL5A 1ST3A 2FMHA 1TOAA 3B60A 2OXEA 2ZUCA 3CCBA 2QY6A 1IVYA 3IAEA 3K96A 4W63A 1ML4A 1ZKMA 5AJXA 2EZ8A 5LZ7A 4MITA 1CFJA 4CDNA 5KWEA 1D04A 3DVSX 4BFXA 4FZ0A 4L8VA 2ZCJA 1V6CA 4I5FA 3W5VA 3E4DA 3PCXA 3QEMA 4MUYA 2NR5A 1S5HC 2E5LB 5KYKA 1WPXA 2GAIA 4YCDA 5DLEA 2A59A 1QU9A 2GN6A 3EXG2 2A67A 2WIDA 2KTVA 1NVBA 3ZNPA 2BRUC 3EBOA 1KOLA 3RTAA 3WO0A 1TFRA 1DZIA 2XIQA 2E4XA 3L01A 1ONSA 3BB1A 3W3AD 1ZY2A 2B34A 1O57A 3HI4A 4Q3EA 5IAOA 4IDQA 4W5JA 2J6CA 1H6AA 1JSCA 2UXCO 1XB2A 3QF4B 4UVHA 2H5JA 2Q62A 1KNXA 4PHHA 4Q4LA 5J1TB 4DC0A 3TK1A 1JKMA 2IXEA 3KAKA 3MIIA 2C88A 4KQ9A 2IXGA 1UKAA 4PG5A 2M6KA 4YPFA 3GNTA 1VPLA 1I32A 3EGCA 4UHDA 3BMNB 2P6JA 2A9QA 1VC2A 4RM2A 3I58A 2X8BA 2J48A 4KQ2A 5DGCA 4F9FA 2Q46A 4G09A 4ABMA 2E9SA 1SXQA 1Q7RA 4IIYA 2G4LA 2XLCA 1MIHA 1XYYA 5L3ZA 3ZDFA 2RMKB 2BFFA 1KARA 1VMDA 2CYAA 4NE2A 1GNLA 5FHRA 1UK6A 2VDWB 4K81B 3R24A 5JRZA 5KKAA 3EPPA 3AF0A 2KG7A 2QD4A 2B7BA 3RGGA 4AO7A 1I01A 4KWCA 2JNBA 3M9WA 5COQA 2NN3C 3EDCA 4W1SA 5M3BA 5L3BA 4R8LA 4DLTA 4CS2A 4ZHYB 2ADFA 4DV1O 1VOTA 1BYUA 3Q12A 2J3IA 1N9GB 3PUVA 2ZRIA 3V7NA 3C1UA 4B3GA 4LX0A 4GI3A 1U9JA 4FLUA 5CCDA 1G38A 1GYRA 3HHPA 2YASA 4ZAGA 2O14A 1FVFA 3BXFA 5KTRA 1LDYA 2AFHA 3LBHA 1IQ0A 2NSJA 1IB0A 5LUAA 2ZVPX 1NDHA 2DKOA 2EDCA 2GKSA 2VWGA 3G2HA 4U6SA 3PHLA 1CKEA 2F43B 3JZAA 5EK0A 3CH6A 2H11A 3P4UA 4FNOA 3GJZA 2C31A 1J39A 1TQHA 3QA3E 4NEGA 4ZI5A 4Z51A 2OYRA 4MVMA 2J3LA 3DZGA 4OFWA 4PGGA 5I3CA 1T5HX 3QP9A 2HLDG 3ORFA 1DKRA 4FGKA 1YQGA 4GLJA 3L3BA 3VZSA 1EDBA 3LYBA 3DQPA 3UHAA 2EKDA 3WMGA 4JSTA 2OCLA 1SBQA 5L40A 1Y42X 5CG1A 1QP4A 1W9HA 1Q1BA 3NRJA 1B16A 1DRWA 3GG9A 4IQ8A 3COWA 1GCIA 5K6AC 1Y3HA 2XHBA 1LR1A 1JBKA 1H2BA 2ZRCA 3EE6A 1WMBA 4P53A 5ALJA 3FTNA 5KEIA 3IT0A 3KD2A 1YOVA 1TO1E 2WE8A 1JAZA 5G1OA 2LD4A 1NC3A 4MWBA 3IJ4A 3FWHA 3Q8HA 1FXKB 1PGPA 2CLOB 2GJ9A 1I5EA 2MYUA 3FFAA 3CH5A 1E6LA 3HNRA 3CV3A 3OOYA 3R44A 3PJRA 2PUAA 5BQFA 2OG1A 1HG1A 1YJ5A 2FSFA 5AK4A 4PZDA 4BNWA 2YXLA 3VI4B 3QGMA 1IUPA 5ANRB 1VP9A 4LHZA 2XOKA 4JPRA 2DWQA 4G81A 3ASOB 2YIJA 2QWPB 2QWRB 5AVQA 1L3BA 1OASA 2H57A 2I62A 3AFIA 4AQ7A 4URWR 4Z9AA 3N53A 5FLYA 1RIIA 2N1MA 5IDYA 3O9ZA 4NOMA 4Z7JA 5C1BA 3UAZA 2BMEA 3KXKA 2OWOA 3A4MA 2PTMA 4RELA 3F46A 3BRQA 4ZD6A 3ZWOA 4F86A 4AUMA 4F9GA 4ZJZA 2XCTB 3NV7A 2WOOA 2H08A 5CBKA 3WB0A 1L1QA 4DZZA 1GTL1 2WIKA 1W76A 3HXOA 2QUZA 3GAAA 1I1NA 1TT5B 4G8CA 4W7SA 1UADA 2G88A 1O3YA 2AI2A 2BKAA 3K6JA 2G80A 3T5CA 5JRDS 2YOHA 3S1SA 1WPQA 1UC5B 2IYXA 1UPTA 2JDID 1SRQA 3QPAA 1I7FA 1UKZA 4TXLA 4ASUA 2DOSA 4CQMD 1C9EA 1RBMA 5FNZA 3RVDA 4W1RA 1EVZA 1YC5A 3IAXA 3H2KA 3E6AA 5E6SA 3KB1A 2X76A 1DT3A 4GYKA 1AKWA 1Q3EA 3DE7X 5K20A 2X5XA 4RVOA 3AF6A 5LZ8A 1K7DA 3LQ4A 3O85A 4QGGA 4Y9UA 1E4EB 1U3VA 4GP7A 3QEBZ 3OZ7A 3JQBC 1BQEA 3Q3CA 2H0QA 3LQ2A 4GOLD 3MOIA 4M87A 1UQTA 2FUCA 3T7TA 4RD4A 1CP3A 3BC1A 3RJ9A 3UJNA 4O63O 3QLJA 4D9CA 3H8WA 4DIMA 2BGMA 4B7AA 1PZEA 2W6IA 2PZMA 5BSWA 5ADWA 1L7RA 1HTTA 5C37A 3QA9A 1DEXA 5EA2A 1FXKA 2DHEA 4FI3C 3RE3A 4JUIA 4K87A 1X7HA 4ZVOA 3AB3A 4DYDA 3MT0A 1VQLF 2QRHA 2OZPA 2Q7EA 4RQEA 3MERA 3KSAC 1OWLA 2XRYA 3JTEA 3MJFA 4PG6A 1JPUA 2DFKB 3JQCA 3HEMA 1MFZA 1FDSA 3RBVA 1A5ZA 2QTVB 4OV6B 3OC6A 5ES3A 1WW3A 1CUWA 2PSJA 3PWKA 4XCQA 1F48A 3E8MA 3Q88A 3TW8B 1A2QA 1CRQA 1MO3A 2CVFA 2H48A 3FG9A 3GLTA 3K94A 4HXGA 4X0EA 4B3HA 1YFLA 2JGUA 1JEQA 4R1NA 3TF5A 4MUAA 3N4ZA 3OZXA 4CKZA 2JAPA 1HEIA 3A8TA 3GT0A 4N8DA 3SEQA 2I6QA 3TVYA 1U02A 3OQMA 3IDQA 3KV1A 3WNZA 5JNLA 3AVXA 1EK1A 4NMHA 1QR9A 4Y7DA 5FLXA 1VPEA 2AW3A 1VP3A 4JT2A 3LH5A 1F8UA 1WWKA 1X77A 3NEAA 3PYLA 1ZPDA 2GHTA 1T2EA 4G8BA 4KXNA 3AONB 1J4AA 4FZJA 2LCFA 1C9YA 1N6RA 1YQTA 4BC1A 1I7NA 2ZULA 1I7PA 3AL3A 5KYUB 1K2WA 4LHSA 1AV7A 1FTQA 2BRUA 2FP4A 2H7CA 5L9AA 5CVCA 2M2IA 2ZSAA 3QKRA 2ENWA 3KBOA 2FETA 4B8YA 2WILA 4CM3A 1G7TA 1MVNA 2BHTA 3PXAA 1X2EA 4O4IB 1E4EA 1U04A 2J46A 2XDAA 4YCNA 1QQ5A 5KJEA 1UT5A 4K9KA 1L8DA 5LMCA 1U43A 1DFGA 1N0JA 5EN4A 2AN4A 4Q82A 4MTXA 4H1HA 4LGMA 3ZX4A 1ORTA 3CF4A 3CXUA 2RHCA 3KETA 3GEGA 2DSTA 3C41J 2WMDA 4MYUA 2P1DA 3DL4A 3GPIA 3I0ZA 1LDEA 1SCUB 3N2LA 1ULTA 2WM8A 5MHTA 1KZYC 2P5UA 3BULA 2G04A 2QVZX 3R7WB 1KMHB 1I5RA 1YDWA 2PGDA 3IUMA 3O3OB 3EHBB 5EZYF 2BHRA 5BW6B 4EDFA 3GOHA 2FW1A 1FP2A 2B94A 3GRPA 1KEUA 1N5JA 2XZTA 2CXTA 4OAOA 4HZIA 5HY1A 1AU9A 1I33A 2OWEA 1VL5A 1RRVA 3NASA 4YY3O 2FR0A 2K1EA 5DHQA 5JEEA 3L8EA 3LVFO 1NP6A 2A30A 1XA3A 1KRXA 3OD1A 4CF3A 3G9TA 1NJGA 4LRQA 1RYDA 3G7UA 1OV6A 1XLWA 2PMKA 4Q4AB 4IJ6A 3OT7A 4P3YA 2P77A 3HVUA 4LF4B 1XTUA 2XE8A 1N5IA 3CYFA 4LDPA 3WLPA 4E5PA 1H6DA 1GP2A 2EJVA 4MTFA 3EA0A 3FDIA 3FPBA 4W4TA 4WACA 1YIJF 4LJAA 4YROA 1AXGA 1EGVB 3IDZA 5F9FA 4HQRA 2IOHA 1VE6A 2HHHO 3H9GA 1RPZA 2AFIA 2VXCA 4YWJA 3RTBA 1TIKA 1PT9A 4BUCA 5KTOA 2WB2A 1WZNA 3CNQS 3RB8A 3QLTA 2FPGB 4FOOA 1K68A 5ILQA 2QROA 2YIVX 4WFIA 3L8YA 3KR2A 3ON5A 3VPFA 4B33A 2D3TA 3IUYA 2IZ7A 2QG6A 4MGHA 1AR4A 2NO9A 4TYWA 1XTBA 4NWIA 3SYMA 5BWBA 1EJ0A 5GM2A 3NTXA 3IFXA 3H3XA 1SETA 3UMVA 1Z8FA 1GQRA 3CCRF 3DBLA 3NR2A 3G0CA 3OHPA 1H8HD 3BF8A 5I45A 2K7ZA 4Q4HB 1W19A 2W37A 3BMCB 3OLQA 4D99A 4A4DA 4A0FA 3ZWBA 5DH9A 1KQSU 1U2TA 5D86A 5LL6Y 1HEYA 1XZEA 4RWEA 5IH7A 1HDOA 1JCHA 1GTZA 2WJ4A 3OU6A 1NATA 1G66A 2Z5FA 3T0GA 2PX3A 5L3SB 5I9BA 1KDZA 3TLAA 4GR4A 5CCXA 3VNRA 2IBZH 2YXZA 2B4YA 2Q5OA 2W2QA 2VYCA 1ZJ6A 1FD9A 4MRSA 1HC7A 5HMMA 1WZUA 1MO6A 1KDYA 2P0AA 4KSYA 1DAPA 4XXHA 1X7OA 1ZO8A 4DIBA 4P7GA 3Q7TA 2DVMA 2XECA 4LECA 4Y6GB 4R9UC 2YW2A 1DX4A 3V6MA 2VNIA 2I99A 5IJ0B 5EIWA 5BNZA 3K5OA 3LLSA 2RKBA 4BZWA 4F11A 2H4YA 2ZJZA 3VGPA 1KU0A 5DRTA 2VI5A 1Y8CA 4AXXA 3UO3A 2VRBA 1WSDA 3QUBA 3M4SA 3L7KA 1HNZB 3MJCA 1RSZA 1F8YA 1XRQA 1BMFG 1G3IA 2QLJA 4BZPA 1F6DA 1MRSA 4CG3A 3WL6A 4EVIA 3HL0A 3MEQA 5JD3A 3PDHA 4KGXA 1DEKA 5FDFA 2AR9A 3FFXA 1J1UA 1AKTA 1PD3A 1VQKV 1CERA 2Q8PA 4YUZA 3ZWAA 1P7VA 5CA0A 1H2GA 5D3KA 1DBQA 2CYBA 4XIYA 4A2CA 5LM3A 5GMOA 5CBPB 1K6IA 3OZEA 3MMSA 4BE9A 5CXQA 4QLOA 2F9LA 3BZBA 4IIXA 3T1TA 2Z4RA 3U39A 1SVMA 5BN5A 5KHJA 5IJWA 3W90A 3EPHA 2QEXV 1OI2A 4G84A 3ELDA 1XN1A 4XD7D 1VCOA 2IKSA 2IYNA 3AVOA 2CB0A 4TM7A 4IT5A 5TISZ 1CEQA 5IYZA 2K5UA 2D5AA 4HZGA 3HGTA 3URKA 4C0QC 4W82A 1EAYA 4X65O 3S0HA 3HM2A 2ONYA 2W6ZA 1T2NA 4KE7A 1AZSC 4QU0A 3LK7A 2CXSA 5JDCC 4PGFA 4AVYA 2Y71A 2O50A 2D54A 3O8QA 1OC4A 5EWLB 2UYNA 1EFLA 2KPOA 3GVCA 3ZBHA 1NQUA 4PR3A 2OV1A 2JFYA 2K9PA 3ICXA 2W58A 3PDCA 6LDHA 3KJFA 1PDVA 5KHOC 4FSDA 1ZK3A 4X91A 1T0AA 1KECA 1A8SA 2RCVA 2XT0A 3C7DB 1JKJA 1DG3A 2DUWA 4CXMA 5GIOC 4AIIA 5HBGA 3T06B 1ISSA 1M34A 2D1FA 4MV5A 3WRXC 3TD3A 2HIHA 3CEPB 3H4MA 4EP1A 3HV0A 3QVNA 1FP4A 5JSZB 1B6SA 2VF7A 4IL6Z 2C9YA 1WXIA 1QYIA 4PPQA 2F4VB 3B1WA 3EEQA 3EW7A 4QDZA 1AUQA 1Z2DA 3A1WA 3JRXA 2UYJA 2QVBA 3H99A 3TDKA 1FPMA 4YCCA 2NZWA 4OJNA 3L40A 1Y6QA 3Q0IA 3NFYA 4H17A 3MPOA 2EDAA 4XJVA 3L1JA 3P0ZA 2HPAA 1A5BB 1IONA 1E77A 3EGXB 1DEOA 1Z4IA 2VSFA 1N75A 4FD2A 4UUPA 2HWUA 1JTFA 2WTXA 1DAOA 5A62A 4GX0A 3IAM1 3IALA 4BVHA 3LCRA 4JYZA 1E66A 1P0MA 1PEYA 4MUJA 4B80A 2QM4A 5LQDA 3B8HA 3TSWA 4DV4B 2C9BA 1OE0A 2NSLA 1OH6A 3ZHTA 1AZTA 3Q6IA 4LYHA 4WAUA 2UZ1A 4OQDA 1GNRA 2J5XA 1RAEA 2HNBA 2X4DA 2KW5A 3F7MA 4RKFA 4Y67A 1C3JA 5HE8A 3TIFA 3GIWA 3I1IA 3I3FA 4YFVA 4Z49A 3FPSA 4GAEA 2QWQB 3MTDA 3WGVA 5F7XA 4FLVA 4XGNA 3H1TA 5KYVA 3RUPA 1Z38A 2QJFA 2R2GA 5BYAA 3QNEA 1TFUA 5K1ZA 3FLBA 1M2VA 2EERA 4P4GA 1I80A 3C4QA 1ZHFA 3DLAA 4L6AA 3GFPA 3Q7QA 4BNTA 4IZ6A 1RFYA 3OECA 2JAXA 5AIBA 1G8AA 1LEHA 1GPUA 2J5QA 3D6AA 1XD2A 3HK2A 3OM9A 4Q1VA 5EXEA 4KU4A 4GO1A 4TT3A 1OFUX 2FWPA 1MQAA 5HK8A 3FKSD 3OURA 2WU0A 4OF4A 3OPXA 3UCFA 3OCCA 3Q7SA 4QHYA 1XROA 1V54C 1DDGA 1XELA 3FCXA 4GKBA 3TXQA 2WHEA 4KNWA 4P4SA 3RIMA 1SR8A 2XZLA 4Y2RA 5JCJD 1I13A 4XDKA 2BFDB 4V03A 4ED9A 1MT3A 3AOGA 2RK3A 2ADOA 3HKEA 3F0FA 2Q4OA 2Y4NA 4AB1A 2QE7A 4JI5B 1U6KA 3R0JA 3ZXUB 4BBPA 1PW7A 1NX9A 2ODBA 2PWYA 3KEMA 1EE9A 4Y2TA 4HYYA 4DDHA 2C4HA 1QK5A 4IX9A 1E2GA 5DOZA 1D2MA 1CS0A 2IHYA 1WTAA 4MUEA 3QHDA 3WFIA 3QU5A 5M5BA 4GX1A 3BGIA 4LDQA 2QXYA 2ZJFA 2HK9A 1NW5A 2X9LA 4KEAA 3HKCA 3BTSA 4NCAA 1Z4OA 5B64A 2TS1A 2JLUA 1FSGA 3HR4A 4YHBA 5AJZA 1C30A 2J0EA 3LXMA 4E4YA 5A7FA 5AM2A 5JY1A 1YFZA 4Q9KA 5D6OA 4FXPA 4MVSA 1AGYA 4WEOA 5H3LA 4J41A 3O38A 5FH9A 2YVLA 3BEDA 1U7TA 4FHFA 5H80A 5KOIA 2V59A 1O08A 2P65A 3LPAA 3QEMB 3IVAA 3OQPA 4RCZA 4O4LB 1VQMF 4HVAA 4Q18A 5TQ2B 2HREA 3PVCA 4LGYA 2EBOA 4D96A 1M2HA 3LZDA 4CV0A 1GNVA 2BTEA 4F4HA 2QI2A 3KSDO 1UUFA 4O4HA 1K4KA 1M2VB 3C8ZA 1LWOA 3FDJA 3KM0A 3N5CA 1Z0FA 2P2GA 3H2GA 4NPHA 3N2GB 2FDCA 2HIAA 3NVDA 2OYCA 2VBCA 3N74A 2YH2A 1LK0A 1U7DA 4B4UA 1V9PA 5A2QM 1QDLB 3K9NA 2C4WA 4CETA 1IDOA 2X3YA 5KCZA 3OIFA 4C08A 3NBQA 3PX2A 2DBZA 2P6YA 3RTCA 5L8VA 1V43A