4O4HB

Tubulin-laulimalide complex
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
430
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tubulin alpha-1B chain
publication title Structural basis of microtubule stabilization by laulimalide and peloruside a.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle/inhibitor
total genus 172
structure length 426
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4o4hB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4o4hB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4o4hB01
5IJ0A 1W581 5JQGA 3HKCA 5LYJA 3HKBB 5CB4A 3JAWA 5CA0A 3WGJA 5FNVA 1OFUA 3JAKB 4U39A 3RYHB 4ZI7A 5LP6A 5LXTA 5MN5A 4HNAA 3M8KA 2Q1XA 2BTQA 4O4HA 3RYFB 3ZIDA 5M7EA 3WGMA 5CB4B 5IJ0B 4FFBA 1FSZA 3HKCB 4WBNB 5LYJB 3WGKA 5EYPB 3JAWB 1RLUA 5CA0B 3JAKA 4IIJA 5FNVB 3WGLA 2Q1YA 5LP6B 3JATA 3N2GA 4HNAB 4XCQA 3RYFA 2VXYA 4O4HB 5JH7B 2GVIA 2RHLA 5IYZA 3HKEA 3JASA 3VOBA 4TV8A 4FFBB 4WBNA 3N2KB 5LP6C 5EYPA 5JCOA 4X1IA 3VPAA 5JVDA 4IIJB 4DXDA 3ZBQA 4B46A 3JALA 2VAMA 3JATB 3N2GB 3M89A 5IJ9A 5JH7A 1JFFA 4O2AA 3RYIA 4F6RA 2VAPA 4LNUB 5IYZB 5EIBD 4O4JA 4ZOLA 3HKEB 3JASB 5CA1A 4TV8B 3UT5A 3N2KA 1FFXA 5MN4A 4EI9A 1Z5WA 3VO9A 4X1KA 4O4IA 4X1IB 1TVKA 2RHOA 5JVDB 3CB2A 4B45A 4ZHQA 3JALB 4DRXA 5KMGA 5J2TA 5IJ9B 5C8YA 1W5FA 1JFFB 4LNUA 1W5EA 4O2AB 4X1YA 5J2UB 3RYIB 4F6RB 1W59A 5JCOC 1TUBA 4O4JB 4ZOLB 5CA1B 4O2BA 3UT5B 1FFXB 2R6R1 4I50A 2R751 4X1KB 4O4IB 2RHJA 1TVKB 4I55A 1RQ2A 3HKDB 4KWEA 5ITZB 4IHJB 4ZHQB 4DRXB 5KMGB 1Z5VA 5J2UA 5C8YB 5J2TB 4U3JA 4X1YB 3RYCA 2XKAA 1W5BA 3JARB 5BMVA 1TUBB 4X20A 4O2BB 4TUYB 4YJ3A 4M8IA 4I50B 3WGNA 3R4VA 3V3TA 4I55B 3HKDA 5ITZA 1SA0A 4IHJA 2BTOA 5GONA 5EIBC 5KX5A 4U3JB 5LA6A 5MN6A 3JARA 4EB6A 3RYCB 3ZBPA 4O4LA 5BMVB 4I4TA 4EI8A 4TV9A 5LOVA 4TUYA 4X20B 5EZYB 3E22B 4YJ3B 2VAWA 4YJ2A 3VO8A 3C8LA 4E6EA 1SA0B 2RHHA 5JQGB 1W5AA 2XKBA 3VOAA 5GONB 3RB8A 3HKBA 1RQ7A 5KX5B 5LA6B 4EB6B 3RYHA 4O4LB 4I4TB 4ZI7B 5LXTB 5EZYA 4EI7A 4TV9B 5LOVB 3E22A 2BTQB 4YJ2B
chains in the Genus database with same CATH superfamily
2Y6UA 2ONZA 4YTEA 4L4XA 1V16A 2NUAB 4INPA 4Z4CA 1J49A 2ZSKA 3VYSC 2FG5A 2FSFA 1EX1A 1XTBA 4RXUA 4KO2S 1U8CB 2ZR2A 4BNKA 3LU1A 1AZTA 3N5CA 3W4IA 1C3LA 1ZGJA 3KQTA 3R7WB 4KQ2A 2RNBA 3TR5A 4AQDA 3NH9A 2AUTA 3V4DA 1Q11A 4RQEA 3ED1A 3GD7A 2GASA 5EC1C 5FNVF 2RHDA 2ADPA 5GIOE 4CVNA 1W59A 4MAAA 4Y6PA 4RU1A 1B00A 4FKBA 1T3TA 1AILA 1GZ6A 3E8SA 4CM8A 3CW9A 1SXQA 1V4VA 2PJUA 4ND3A 3OJCA 3WK9A 1NLUA 4R6ZA 5K3FB 5BXYA 4DV5O 2B94A 4P86A 4NENA 4KYTA 1CZOA 2RARA 3K0KA 2VC2B 4Q4HB 4Y0AA 4PZLA 5JZ9A 4U0KA 3OA2A 5LIPA 3OURA 1B14A 2Y76A 4CW7A 4ND4A 2GGSA 1C1HA 1ECLA 3OLQA 3Q2IA 1N6NA 2C97A 2RGGA 2A0FA 1WL8A 2GK3A 4OKSA 4A5UB 4LFCB 3CR7A 1L4FA 5JPIA 1BXKA 4JJKA 3OIUA 1R6DA 3DNPA 4Q5IA 1S72F 5IU6A 2Z2IA 3EGXA 5DEOA 1Q95A 3JYOA 2HM7A 4JDUA 1AKMA 1QF9A 4MW7A 3TNJA 4XDLA 2ODNA 2ZRKA 1QYXA 1AGXA 3L7AA 4JLSA 5IKXA 3PUXA 2ID8A 2WLIB 3MHSC 3WWOA 4YDHB 3BTUA 4X66B 4QYXA 3MZ0A 1KI4A 4DARA 2FP3A 1BDBA 521PA 3PPYA 3UMSA 2ZBDA 2FPLA 3OBBA 2VATA 4XWYA 2JKYA 3ENNA 1W2HA 2OWOA 1XJ5A 3AUYA 3DMTC 5LNK1 3ZRVA 3MJRA 2WUGA 5ALZA 1YFJA 1QH1B 2CBZA 2B37A 2BELA 3G9ZA 4AXBA 4LRUA 1Q20A 1TLTA 4EB6B 4XYMA 2X4IA 2JRLA 3PENA 2V59A 4QYIA 1PV0A 5F1YA 2SCUB 2VZ9A 1VE9A 1HDEA 4LIPD 2P2ZA 2I62A 4TTQA 1PJ4A 3N2ZB 4CR8A 1V9CA 4TWIA 4FM1A 2QJRA 5IG2A 4RTQA 2R3SA 2YW9A 1KY4A 1PQWA 3NM6B 3TRDA 2F8SA 5EXDA 1CZKA 1IJEA 1EZ4A 4KAJA 5E4FA 4X1YA 1KMIZ 1I5YA 1BE1A 4YV2A 3SG0A 4EGQA 3OO1A 4YUYA 2YOGA 3OJLA 3G8YA 3WLNA 3ZD9A 5DGIA 1JOYA 2XUJA 2ZIXB 1JPVA 2I2CA 3D64A 3FLEA 3TZLA 2F1HA 4MW9A 1HV8A 4PDVA 4L0CA 1ZTEA 3M9WA 4YR9A 5I7EA 2A59A 3T2MA 2KG7B 4E03A 4D99A 2OCBA 4LAFA 5E3JA 2FLWA 4RNDB 5DF1A 4FYJA 2P6RA 4AZTA 2GARA 3LY7A 1U40A 1E3LA 3SZMA 2W83A 2JBWA 4LP8A 4WUTA 4UZEA 3P32A 5HW0A 2P6PA 3BWBA 2D6FA 2G28A 1KC8W 4ZICA 5A2QN 6PFKA 1JQEA 1HNZB 3ST7A 4LXGA 2IPXA 3EFBA 5K5EA 5CFZA 3D4OA 2ILVA 1AGPA 3DVSX 4QOJA 3PUKA 1XOUA 1KVTA 3VM6A 2NQ8A 3W3ZB 4HOYA 1CNMA 4OMFG 3O92A 4D98A 1S9DA 1I3OA 4M3NA 2BEVB 2BN4A 4GVLA 2H3EA 4KNVA 2QJOA 2P41A 1EBBA 2Z1UA 4PONA 4IMJB 4P3XA 4DAEA 4U4AA 4HQNA 3OESA 2XZDA 4MS2A 4MA5A 2VYVD 3C15C 4BZPA 3O1IC 2C2MA 3ZIAA 1NUTA 3RIMA 2A0UA 3D3QA 4N12A 1SCDA 3ROKA 4ZJZA 4LF7O 2WU0A 3CCLF 2O1EA 1HE4A 2OM2A 3LWNA 1E3DA 1OBCA 3A27A 4QM7A 4ZOQI 1QO7A 4ROTA 5LZ2A 2Z8YA 1OB5A 3C48A 1GOTA 1M76A 5DNUA 3ZIUA 3DBRB 5H3LA 2PYJA 3ZIAG 3ULKA 5G1PA 3D2BA 5CLQA 4ZAVA 4PAWA 1K2WA 4WUVA 1GCUA 5JVDB 2FW9A 3U2QA 2YICA 3I1JA 2D4AA 1WUJS 4FNMA 3PUJA 3OQ1A 1OU4A 5AXBA 2YIVX 1GILA 3QP9A 1P6UA 3BCSA 2YXEA 2PQ0A 4RC9A 4BR6A 1XZAA 3V2HA 1YQNA 4J1TC 3JARA 1JEYB 4EGCB 4L0DA 2ZSFA 3AY0A 1IQ0A 1MTOA 2X7JA 3DWGA 1FXKA 4C43A 4E12A 5I9IA 3O47A 3T35A 1V2HE 1QORA 5KWJA 4G6ZA 4BASA 1QCCA 1L7NA 1LC0A 2C7GA 1T5HX 3DUWA 1ULTA 2CSUA 1I4DD 3UH0A 2JHAA 5EMMA 3F5FA 1ZUQA 3KQYA 3M3DA 2FPIB 2HHLA 1CUJA 3D31A 1CEQA 5KPDA 5EIAA 3TO5A 2BMJA 3DDNA 5U9CA 5AIAA 4LC0A 3VCZA 1NNEA 2Q46A 2ZUUA 3CVXA 1H94A 5GOTA 1A7AA 1TCVA 1SJ9A 2HJWA 2HJHA 4WEOA 3QPUA 4GSKA 4TMTA 1J0BA 5D7NA 2E9SA 1CDOA 2Z5UA 4NPCA 5A02A 4GVPA 4BFCA 2RKBA 1GAJA 3GT3A 1EK2A 5ALIA 1EVLA 3PNKA 1GTL1 4D4LA 2GERA 4MUBA 4D79A 4CM3A 1S0UA 1VCMA 2A78A 4N23A 3DULA 3Q3IA 3QSYA 3ASOC 4B35A 1IQUA 4NJOA 2BI8A 1T0PA 4K3VA 5KSPA 2QR4A 1NUUA 4YV1A 5C8YF 3A1UA 2ACEA 4HAOA 2XW6A 3OM1A 2JG3A 3B6KA 2O57A 3ZDCA 1OFUX 4M0DA 3BD8A 2IWRA 1XO1A 4JOSA 3S2SA 1AQNA 5LGTA 5CTJA 2FPMA 1JH8A 1OCZB 4G0OA 4MUAA 1JIQA 2IH4A 4XIFA 3D5TA 1ND6A 1Q21A 5TSDA 1M0TA 4IIHA 4B81A 1IJKA 1AGNA 1EMDA 2FSVC 1DINA 3LPDA 4JYBA 2C42A 1EUYA 3Q40A 3G80A 5HIAA 1J2UA 3ZY3A 3K53A 3CURA 3OC6A 2N48A 4L5IA 5LLDA 4YH1A 3O93A 1CK4A 1BE0A 1RXIA 3FN4A 3S28A 1IZ9A 1NXSA 2D1RA 3KBBA 3CLTC 1V55B 2G63A 3MTBA 4C07A 1ZZGA 3BF7A 3PQ5A 2BCGY 4R1NA 1R4AA 1Z2OX 2IYQA 4AKTA 2GK4A 4OLJA 3UQYS 1XT6A 4G97A 1UBNA 3IC5A 4J9ZB 2JK1A 1E1CA 2JGLA 1J0DA 3KHKA 3B8HA 4EYQA 4OATA 4QLAA 3HNOA 4V0SA 4EI2A 1D2MA 4B7UA 3G0HA 4MJLA 2PCJA 3RM3A 4CLHA 4DEVA 3MPUA 3GNLA 4I2VA 3I9JA 5UKDA 4MSWC 3N2KB 2J5QA 1Y66A 1IK4A 3OT1B 1RXWA 1Y37A 3BJEA 2RHCA 4PI0A 2WV9A 2ENUA 3QEMA 2BFAA 4NI5A 1XAIA 2ITCC 2DJVA 4RWZA 5F2EA 3WG9A 2UUPA 3DEIA 3NATA 3EBOA 3M6LA 4IJWA 3NWPA 2TRSB 2GYVA 2GCOB 1MJGM 1JBEA 3V3KA 1IDOA 3L07A 1BXRA 2FUKA 2XNJA 4CU2A 3SDBA 4ZHQB 1GTVA 2JLRA 4J0DA 2WTBA 1KUQA 3C2QA 1F6WA 5IXSA 4TL7A 1RYMA 3UMVA 4HATA 2WFAA 3AVUA 5LJIA 2D2XA 5AW5A 1G7CA 1VDZA 5KJ1A 4DJDC 1NU6A 5IK2A 5KNDH 4YDRA 4NYKA 2NLJC 3KNZA 1PU2A 4BLOA 2WAMA 3D6AA 3ETQA 4JDPA 2CVFA 1H3FA 3WGUA 3LYBA 4WKOA 3FBGA 1DZ3A 3RVOA 2H92A 2XBLA 4PPFA 2O3JA 4NS4A 3IIKA 3GLHA 3AFMA 4YYZA 1DC5A 4DLZA 2CCKA 3HADA 3Q8MA 3ZE1B 3VR5D 2C0CA 2DETA 1CQJB 1ORWA 5BO5A 4IHQA 4LS3A 2VAMA 3LFOA 3E9RA 1XA0A 3HXLA 2CMHA 1JA1A 4FW9A 2JI8A 4K05A 3A0HZ 4E14A 3L18A 2DWEC 4O4JB 3ETHA 3WRYA 4S1WA 1WP9A 3KTOA 3I1YA 3FROA 1W88A 3CNEA 1JWAB 5EHZA 4BX9A 3WNZA 4XDKA 1YXBA 4U7NA 4P3OA 1U1DA 2EWWA 2WM8A 4LJAA 1ADCA 3RSHA 3IA2A 1GN9A 3K71B 1O89A 3ZRSA 1SCQA 3BN3A 3H1FA 5EC2C 2WSLA 1LBHA 5GM1A 3FGPA 2Q4EA 4IIBA 3TFWA 4ZK7A 1N6PA 3DE0X 1KO1A 1NI8A 2ZTHA 4GQBA 3UB3A 3X3HA 3H5RA 1HNXB 2R1VA 4A2CA 1JKMA 5IEBA 4Q05A 2KE5A 1JJIA 4KPFC 3IIIA 4QPJC 3RDPA 3KL4A 3X1DA 3O1HB 4JSTA 4RE6A 3LY9A 5SZIA 3RK0A 2I7XA 1T43A 2BOVA 3CX3A 3H04A 4KI7A 3UIEA 3SEFA 1CEEA 2OCHA 4FBGA 3TUJC 1SQXH 5K9ZA 1TM2A 1NXWA 4L50A 5EJ8A 2DZDA 2GBFA 1KAHA 4LBWA 3BUSA 3OCJA 2FX5A 1NWHA 3PV0A 1RAIA 4YX9A 3W5BA 1YBHA 2WICA 3OO0A 3G5MA 3E0QA 1PGNA 2FF7A 4W9NC 2BGMA 4IJQA 2O2JA 1X3SA 4JT8A 3IEWA 1PW7A 1FSZA 1EI9A 2V7UA 5FBHA 3CIFA 4OI1A 4B87A 5M29A 4F56A 2Y48A 1QSGA 5ALOA 4QE7A 4LSGA 4L8JA 2DHRA 4CMBA 1X70A 2EW2A 4KQCA 2PD6A 1JR2A 4I9NA 4QU5A 2AHZA 5GY7A 5CMUA 1EWYA 1E3TA 5C1DA 4IIDA 3LWQC 3QTTA 5EWMB 1DWUA 4DLYA 4MR8B 2R87A 3HCCA 3LFUA 4ID9A 4ERXA 4OYLA 2BLLA 5HILA 1CN7A 2PKEA 1Z8NA 1KNXA 5JHHB 4RLSA 2R8YA 4LWOA 3DHYA 5D2CA 3I92A 1QNFA 1K9MH 1UBLS 1DG1G 3OIDA 5LYJA 2C96A 2LXNA 2CK3A 2JHPA 2IZ5A 4OREX 4KHPB 4HNAA 2F67A 4GE0A 3PGKA 3AVVA 3BHMA 2EEZA 1FCJA 4HWPA 3G0DA 3KZNA 4C4AA 4HDRA 3W7SA 2EBHX 2CDNA 1I8TA 4QBTA 3EZFA 2C54A 1V48A 4YIKA 4PQEA 4N0PA 3WWZA 2NACA 4JVOA 4MCAA 3V34A 1Y5MA 3EVGA 4EA8A 4X1KA 2CK3G 2H2GA 4AP5A 5DTEA 3CB2A 2ZCJA 1P4RA 3TQOA 4F4DA 3MJSA 2F17A 2RAUA 4LF9O 2KPOA 3S81A 1Y3HA 3NEJA 3DDOA 5CLLA 1TKAA 3DVAA 3IA7A 1Q84A 3HJGA 2KGWA 4CM7A 1DXYA 2UZ1A 2UXCO 1B3BA 3FXAA 2VQEB 3GVIA 3J80N 2G07A 2Y1CA 3G0IA 2JGKA 4XR4A 4YUVA 5LDGA 5KNBA 5LGUA 4WOBA 3Q15C 3OHPA 4OGFA 1I94O 1JQDA 2R7LA 2X7XA 1XOIA 5KQRA 1MSDA 2WC1A 4LBEC 3UN1A 1E2NA 2UUAO 1Q0RA 3CNLA 3EGIA 1ZU5A 2B78A 3C1TA 3SMQA 2EBOA 4MRPA 3OU6A 1K73W 1OXUA 3PSAA 4JTDB 4WZBA 5JMWA 1QGUA 2YVAA 4D57A 3L7NA 2IQIA 5ULLA 1PT7A 4JBHA 3IPLA 1XI2A 2BHSA 1RMQA 4Q4JA 4CPDA 4EEZA 4DMRA 1S3SA 5IXJA 3VAZA 1YZLA 2C2BA 1RQPA 3VV3A 1XBTA 3EEYA 3A6ZA 3WLHA 1WS6A 5J4KA 4CIBA 1QH8B 3MTDA 4D1YA 2H2DA 4JLBA 1QU9A 1XMVA 1DWQA 1GYRA 1UP7A 5IM4F 4JBGA 4F2DA 2XDWA 3EJ6A 4PWTA 3BYZA 1UDRA 3VA7A 1W5SA 1EFRD 2JLUA 4B75A 1N32O 2XQVA 1FX0B 4R16A 5I7AA 4NK4A 5KOJB 4IGEA 3HLYA 2GLZA 2PU7A 1IY1A 3FYUB 3X1WA 4Q3EA 5AW6A 4B83A 5EBMC 1JPXA 2ZIUB 4IQ8A 4DMLA 5KZMB 1KZ7B 3ITEA 5A6VA 1H6BA 3EG9A 4LGCA 3DBLA 3HN6A 4M9UA 5BMVA 2G0AA 4D0SA 2GCNA 2J87A 4A36A 4RXTA 2A35A 1SKMA 4DLAA 5FWAA 3OTHA 3ZXUB 2J32A 3C6YA 4AN1A 1NTZH 4RVHA 5KC9A 1H9CA 4C78A 4XI9A 1Z0DA 1Z0KA 2WINI 2VLIA 5IH7A 4XBFA 1A8PA 1C7EA 4PAMA 3C8UA 3ZJTA 3CZ5A 4PSUA 2PHNA 1UM9A 2RDMA 2IQQA 4B40A 2XYPA 4EHIA 1IY2A 3LCMA 4DLVA 1OGIA 1GZ0A 2XMQA 2ZRHA 3OPMA 4CBVA 3M6WA 3S0JA 1XA4A 1NJIW 3DSRA 2I6TA 4RHAA 1CQIB 2PH7A 2RCYA 3I09A 4GYKA 5HIJA 2NXNA 1U1EA 2CUZA 2AF4C 1ZWZA 1SK9A 3INRA 1WRBA 3GELA 3HB7A 2RH4A 2YMMA 1EZJA 2A3NA 1R16A 4DV6O 1ENOA 2NUBA 4D81A 1ZGBA 4BVRA 3LRPA 1HEYA 5AHOA 2FE1A 1KMHA 1SA0B 1H0KA 3J81k 3E0XA 3CCSV 3R0QA 4BWAA 1VYHA 4UCUA 3ZU6A 1M5UA 4QLBA 1FUYB 1ES9A 3E1KA 1OTXA 3OU2A 3KR0A 4YRDA 3P97A 4FW8A 4JH0A 3N4ZA 3QXSA 5A5DA 1F12A 1TA8A 4RPHA 2Z98A 1ZQ1A 4GMHA 2QZ9A 2WTMA 2GVZC 4LY6A 3GEIA 2BYTA 2WLLB 2CFTA 3PEUA 5EVJA 3F3KA 4B85A 4YV7A 5TT0A 4C3VA 2BM9A 5JAIA 4URHA 2BR4A 3H8SA 1GPBA 2MR5A 4DC9A 5L6MB 2PZGA 1EVEA 4GCZA 2MYNA 4XSHA 4TWBA 1GITA 3RYIB 2FP4B 1QIIA 3CCVV 1H4TA 1M1XB 4J7XA 3OTFA 2HI0A 2YOFA 3E7WA 2Z95A 4P81A 3DFUA 4AWBA 1ESZA 2WJGA 3OT7A 3FE2A 5EA2A 3TECE 2H06A 4QHSA 1HTWA 3F6SA 1ZRNA 5CYGA 4ITRC 2Y68A 2V3VA 5JWRA 2KSQA 2W2LD 3MT7A 4EVIA 5IWAB 5JLJA 1RRKA 4OF4A 2II6A 4ERNA 2NNWB 1W44A 1IG0A 1JAHA 3RUCA 5H82A 3ZU4A 5KJEA 3AY3A 1II9A 2JC3A 1S2NA 2AX3A 4MS1B 3R7AA 2Y4TA 3PLRA 3H75A 3DONA 2JHFA 1OWLA 2ORIA 1MZPA 2FVYA 1SHJA 4N7JA 3GOQA 4BEVA 4EZBA 4Z54A 2DW4A 1MR3F 3K4PA 1MXHA 4MICA 3CISA 2PWBA 3OJOA 3TPZA 3WYEA 2HX1A 1JLLB 3Q5GA 2Q0AA 4HGYA 1CX9B 4NZZA 2YFKA 3ADCA 5B3LA 1H2BA 1EQAA 1H85A 4BTEA 2R96A 1U28C 2J07A 3LDHA 3VGPA 4E6PA 4IFIA 3QVLA 2C7BA 3MT0A 3RKRA 2Z1MA 4R4JA 1C4KA 1IHXA 2R8XA 3P2KA 3REOA 1DZIA 3B53X 4AWAA 1QRUA 2WUEA 5GWXA 1Q12A 1U0GA 3CGGA 5BYJA 4TTPA 3TIVA 3OOHA 3G49A 3TSWA 2W2PA 2ZD9A 1YVDA 2DBVO 1IZZA 1HZZC 4DV4O 1U9JA 1X14A 1IUPA 1IMOA 1FRQA 3HYRA 3OT5A 3SIUA 4JAAA 1J07A 2GVNA 5F2KA 1PT8A 2VT6A 3M6FA 1QHXA 3IOEA 2OCIA 3I6MA 3ZXSA 3UAVA 2PT5A 2JLBA 3NOVA 2GNOA 3I7TA 1SBIA 4OFXA 2W00A 2O2EA 1V7PC 1TLFA 2FSPA 2VP6A 3H5NA 5AM3A 1ENZA 1XPRA 4JTCB 1U02A 1W85B 4NARA 2QPAA 4ARVA 3GH3A 2I76A 3JASB 4L85A 1E3WA 1YJ8A 3RT3C 4EUNA 1RYBA 2EJBA 5JD5A 4RY0A 3MD9A 4EG4A 3ESDA 2YDEA 1RXUA 3QXHA 4DLLA 1CVIA 4C0WA 2ZVJA 1UJWB 1NQVA 4ZXFA 3WU2Z 2CVZA 1FTGA 3GJ0A 5FOXA 4PIPA 4KLZA 1B73A 1VKZA 3LDGA 1G5TA 1PWYE 5K1ZA 3SVZA 3UPTA 4KFTA 1MT0A 3FHLA 3T1TA 2BH2A 4ZD6A 5AJUA 2AN1A 4JR1A 3Q85A 4JXJA 1JR3A 3MYRA 3ND9A 5FULA 1Q74A 1DT5A 4DCUA 4IZ6A 3B1FA 4MUEA 1Q19A 2Q1UA 4BW9A 4F0JA 4OYHA 1F4NA 1ZLZA 3EGCA 3OQJA 2HP8A 4RF5A 4KACA 1U3CA 4EDFA 4A0QA 3UFXA 1OA0A 4F96A 3ZZTA 2YDXA 3C4JA 3FHJA 1RKBA 3GB9A 4KRGA 2HCJB 5TQ0B 1KJQA 1IUOA 5ALGA 3CUWA 1XVIA 3Q2OA 1IBSA 3LHFA 1BCSB 3GVXA 3IEUA 2UZHA 2IX9A 4OHMA 3QVNA 5CA1F 2H94A 1UPTA 1HQDA 4GLBA 3LWVC 2Z2YA 4N7MA 4E51A 2BF7A 1L3IA 1VI2A 4URVR 3NHYA 1XDDA 3N9IA 2HFEC 4BU0A 1KI9A 3BE8A 3VNQA 1Y7IA 1NUAA 1IH8A 3IT3A 3LLMA 4RABA 5I7WA 4NB5A 1SXJC 5CVVA 2I6QA 2QMQA 5TV2A 4PYLA 1RM0A 2F3RA 2QEXF 4M9SA 1QQ5A 4EY8A 1QU7A 5K1PA 4L4SA 1VG9B 3VV2A 1RS0A 2BW0A 3G6BA 2W6IG 1K68A 4UBIA 1RT9A 1XHLA 4UVGA 2PT7A 3N2LA 5KDLA 2AXNA 3FH0A 1FXVA 4UHDA 4YRLA 1YO6A 1T5EA 2G5TA 5K3DA 4KUMA 5KTOA 3KOYA 2FK8A 3K2EA 4J0IA 4X71A 4BMOB 2FPGB 2VGMA 1Y4UA 3OAAD 1V3UA 2GN0A 3F8SA 4QNHB 4MJ3A 2O1SA 3WBFA 1U3GA 1GDDA 3NU1A 5DX1A 4Q66C 4LOAA 4HQFA 1LBIA 2QQGA 3FSGD 4BVAA 1EB8A 1ZNZA 4BFZA 1MG0A 2N75A 3TTTA 3JAWA 3DZKA 3G6EV 1T9GR 3ANYB 1FDUA 2QMOA 4KXYA 5IE9A 5FRDA 4BZXA 4H7IA 3BWDD 4ITVA 1JLKA 4S04A 621PA 1EGHA 1IXSB 3LY8A 2XWSA 4H44B 4V38A 1LK7A 3B8NA 1G8GA 3B6ZA 4W5NA 2NV0A 2GTHA 3KAPA 1YB5A 4D43A 2ZAGA 3JQGB 4J0KA 4Y6LA 1OE0A 1WDMA 1ZRHA 3L1IA 4B3SB 1QHHB 3REQA 5INTA 5BWNA 5F76A 1G5HA 2IS4A 4MQEA 3KOZA 5BT9A 1E1QA 1RIFA 3SJAC 2JS7A 1YDEA 2XHEA 1RLJA 3GWOA 4YHHO 1VLHA 4ZYUA 3IILA 4KFCA 4S1TA 3V48A 5C7OO 1VARA 2I2DA 4ALJA 1AQ6A 4LC1A 1VLJA 2O20A 3EXG2 4GM1A 4BMNA 4GPZA 3PQ6A 1I7SB 3LC0A 1FP7A 1WVIA 4CFSA 1QK3A 4UNNA 1WX1A 1DKLA 4CMJA 1E1QG 2LBTA 1D7OA 4P8RA 1DRWA 1RYEA 4G5SA 1SQVH 2CUTA 3FCSB 1N0VC 1L9KA 2AI3A 1J6UA 2O6LA 5D00A 3EVNA 4ZTUB 3H7AA 3WFZA 3JS5A 3H11B 3LWOC 1HL3A 4GUAA 1DKNA 2XKJE 5CFMA 1NKVA 3PCXA 2GI4A 3H17A 2Z04A 2K87A 4B44A 2HNAA 4KL1A 3GCXA 4JI8B 3E20B 3WC4A 1XZFA 1N6KA 4P82A 2HHJA 3ICQB 1AUPA 4R1MA 2WIKA 3BCCH 3ROTA 2Z5FA 2EFCB 4DBLE 2A6PA 1PYGA 3HWSA 3L6DA 3ZCPA 4YAFA 2JLVA 1TU4A 1ST2A 3SGLA 3T7JA 3MJFA 4ONEA 1JG6A 1TF5A 4GWLA 3F73A 1OXVA 4DSOA 4Y1EA 3HKBB 3QHQA 1A9XA 2EL7A 5A4JA 2E89A 2PYLA 2OR3A 4ZCTA 2XCRB 4MTOA 2D2FA 2QENA 3IAHA 2HIGA 1YKFA 3S06A 2WHQA 2AE2A 3ZMVA 2JLXA 2NOAA 1PEDA 2WUDA 3A3YA 4A3SA 3DOOA 1JMVA 4GM4A 5KTTA 3RE3A 5TVGA 3RVQA 2XIQA 2FWRA 1NBMD 1Z8HA 3H5WA 3N74A 2O8DB 4OM8A 4PSKA 1EA7A 1J8QA 4I50A 4QPNA 3KHNA 4E2XA 1Y6RA 3IQIX 3FAVA 2NQTA 4IHJB 5E3IA 5GGYA 8AT1A 4I9GA 1RHJA 2XUIA 3TAXA 3T7CA 13PKA 4QTXA 3I0MA 1NUQA 4L4UA 4XIIA 2PZEA 3OOEA 2E18A 2LBPA 5CIQA 4C76A 1AS0A 1SK8A 2HF8A 5CVJA 2RAVA 2FOLA 4Q1BA 4FFOA 5MFPA 1DAPA 4PNZA 4KXWA 2WTEA 1MSWD 1H2AS 4QPDA 4R7GA 2O8CB 5B1BC 3F0FA 2X13A 4GKVA 5C1OA 3MCVA 1FUUA 2QPOA 4FNGA 1CY7A 2YKGA 1WN7A 1V43A 2UV8A 3RIHA 2MINA 1EM1A 2Q3LA 2IL1A 1CR4A 4Z49A 2DMRA 4PQRA 1V9SA 5EJ2A 3TXYA 4AT1A 2IEZA 3AG2C 4JI5B 3PPWA 2N42A 2PX8A 3V1NA 1DCFA 5FV7A 4KLNA 1XR3A 1D8TA 4ISCA 5I7HA 5E8JA 3EODA 3U5TA 4KFRA 4ZU6X 1CUAA 1GM9A 1X7YA 2PAAA 4L16A 5B5SA 4RORA 5JEEA 1XV5A 4R8VA 3F0EA 1DSSG 4O2AF 3UAZA 4A6XA 4TLMB 1AKNA 1PK9A 2Q3JA 2X41A 2B4RO 1FS6A 3BA1A 1H3NA 4MV1A 4TMKA 4RK4A 1YQTA 2IJGX 3O0DA 4OK6A 3K08A 1NBME 4GR9A 4QYTA 5CM2Z 3S2UA 2OVBA 3FPSA 3D8TA 1CFZA 3ZU3A 3NKVA 4HVAA 4M6WA 2QRKA 2VJPA 2R4UA 4OQXA 1CUEA 4MV8A 5EWJB 2DXIA 5I5EA 2OZKA 5IH3A 5JCOA 2YFHA 4FM2A 1UFVA 3I23A 5A4IS 2L82A 3S2ZA 3I30X 3OPVA 1NF2A 3DV0B 4CN9A 5CAEA 5HPYB 1WXFA 1ADYA 1MRNA 2QM4A 5FPKA 1OH8A 3X1KA 5P8WA 3HDGA 5EUBA 4OXIA 4G65A 4GXRA 1FY2A 2E85A 2DFKB 2VRZA 1ODKA 1HP8A 4BIMA 5AI6A 4QHYA 1CNFA 4PXSA 5LOVA 4L3VA 1Y34E 1LLQA 3Q9UA 4R41A 4ZCPA 3E6AA 3RKUA 3EIWA 3TSAA 2NO4A 1GZDA 2O07A 1LRLA 1ZS9A 2OOKA 2ODQA 1E7YA 4RSGA 3AUUA 3CEIA 5AI5A 2ZIVB 4J9YB 4E4TA 4KIGA 2IUUA 2VJNA 1YRQA 2V4MA 2JDIA 2KMLA 1GO3F 3M49A 2RHBA 4QUAA 3OUTA 2HFKA 3KQMA 2RD2A 2QKAA 1J4AA 3WL3A 4HYYA 2AXTZ 3ICOA 2GUGA 4FQ5A 1Z45A 4JUCA 1A9OA 1HDRA 3O94A 2HR1A 1TYAE 2ZT5A 1ZC4A 1ZD3A 4ZQHA 3TLBA 1R4NA 4YFVA 2JDIG 3E1SA 4CV3A 3FB5C 5SV2A 4JYCA 3U1TA 1VXOA 2E5WA 3RANA 5IVHA 1DG9A 1RPOA 1UBSB 2ZJ0A 1ZSNA 3SQMA 4Q7QA 1MHPA 2OZLB 2FN7A 2Q6VA 4JASB 2CLDX 3STTA 2D62A 3NHRA 4WESA 5HIIA 4EYEA 1DWOA 4HDQB 5LBTA 3QVJA 5B3JA 3OM8A 1RZVA 4X93A 5DNYB 4JKYA 1ZCAA 4AI6A 1YCHA 4OTZA 1J70A 2H4WA 2QYSA 1N75A 2HS4A 1EDOA 4U9UA 3K1TA 4XWWA 4A9AA 1OT5A 1TVKA 4WCFB 3VC3A 5JXWA 3KOUA 3FTNA 2QTGA 3CLUD 1MA3A 1N3BA 1B2LA 1GH6A 4YMTA 2QRJA 1VF6A 3V1YA 1AGRA 2JZNA 1SUEA 3UQ8A 3MBOA 2NZ2A 4FE4A 4MSUA 4JVLA 4BAUA 5TMPA 4C0KA 3DD1A 4I4CA 3FUCA 3CNBA 2R7AA 5L3CA 3T4PA 5EEHA 3E22B 2CXTA 3N27A 3ECSA 2V74B 4HX9A 2E6KA 3Q0IA 4MPJA 2OQIA 4ILEA 2H7CA 3H8VA 1X94A 4TTSA 1VQLV 5G4UC 4LSWA 3WIBA 5LFAA 4N5LA 1H4SA 4BNDB 4RIHA 1SD1A 3EXHB 3VPSA 2WM9B 3O8BA 4MO2A 4BT4A 3K0TA 4H3SA 4JI3B 1SZCA 1RZRA 2JD1A 3W3AD 2IYOA 5JD4A 2GRJA 2WI8A 4UBJA 1Q0TA 4F3RA 1I13A 1RJGA 3L7LA 4GUDA 1YNOA 2B82A 5A9RA 4QL3A 5FKJA 4HP8A 1FDIA 4Q93A 4ND1A 1XLVA 1OLUA 4PHHA 1LS6A 3G5TA 3MLEA 4D9EA 3CF4A 3BFVA 2LQTA 1XZ8A 2X8LA 1TECE 5E6UB 3MEQA 1ZOIA 2OXIA 1D1QA 3OEWA 3FFMA 5DWVA 4Q3LA 3ME5A 4GLLA 5BVGA 6NULA 5KEIA 3IP6A 4DZRA 4QWWA 4DJFC 1DFHA 3AHHA 1QJ4A 1QR9A 1X7OA 3UK7A 5L9AA 1DC3A 3GA5A 4TT3D 1AS3A 3CF4G 5I47A 4TL6A 5H80A 4NXNB 3AF0A 4F4FA 3G59A 5DNWA 4J4TA 5BR4A 5JQGA 1MO2A 4KTVE 2X0IA 1EFVA 2O0MA 2P5UA 4G5OA 2PUFA 3FTFA 3ZCXA 4G1EB 1NC1A 2YN2A 5KTRA 3TCKA 2PKQO 5BVHA 1P2BA 3QVUA 4CIVA 3PZBA 3UK6A 1SRQA 4HFNA 3A6EA 1BJRE 1U3TA 1UFIA 4KXMA 1W7AA 2QTRA 4RDXA 5JANA 1BHQ1 3BL6A 4WXEA 1K8XB 4DWJA 2BMAA 4MWBA 3V97A 2PBZA 4R0MA 4DDHA 3O4FA 4K8OA 2WWTA 1F51A 4RCVA 4DN6A 1D2HA 1NVVR 1KU0A 2NTNA 4BMVA 1Z8DA 1OB2A 2RC6A 3VAAA 1Z0JA 2C2KA 1JNYA 4K40A 4D0LB 4QELA 1TQHA 1IY8A 1FLDA 2CVOA 3I39X 3B70A 4GYJA 1SKBA 1P9NA 2NZXA 2VDQB 3AEUA 1JYFA 2P4UA 2FWPA 4KDCA 5F12A 1Z08A 5AW8A 1M1KH 3JVHA 1JRLA 1RHMA 5E0KB 3ODGA 2H8CA 4W63A 1YE5A 4MR9A 4FSHA 4KGZA 1Z07A 5FLYA 4CN8A 2PUJA 4ESOA 4B17A 5IBPA 4XFJA 4JKIA 4HDAA 3M6VA 1BN7A 5AM4A 1KE2A 4GAEA 4Z8YA 4FOLA 3KZCA 1EXVA 2ZT9B 1LK5A 1WPRA 2AHRA 3G2NA 5LZ8A 4Y67A 1TD9A 3ZW7A 4TM8A 4I6EA 2HHHB 2XPCA 1DGSA 4EFBA 1LNSA 3JV7A 1P84F 3AUXA 2E3CA 4B0OA 1MUUA 4BB6A 3CF2A 2FLKA 4K87A 4P9OA 4KXNA 3RRNA 2CXXA 1IM5A 1EJ6A 3WL8A 1EGVB 3FCOA 2O3UA 3IODA 4XYLA 4N5NA 1AB3A 3LWRC 1S3GA 1CD5A 4DQKA 5CNKA 4C2BA 4MWGA 1NJ6A 1TYEB 1NVKA 1QIFA 3C3EA 2YEVA 4IOJA 1ZY2A 1CUCA 2P35A 2GF2A 1OFTA 1QR6A 1T1JA 3I56V 2C5FA 1XNGA 2O8EB 3IQHX 4MS3B 4V1CB 2QQ5A 4R40A 4UUBA 4RJKA 1KK3A 4NU0A 4G4GA 3HJHA 1YQDA 4ADSG 4UHCA 4ZRDA 4ND2A 5JW6A 1PD3A 4G0PA 4L7QA 4INJA 2GRAA 4F5WA 1BD4A 4FD3A 2G3YA 2WK1A 4OHRA 1AA6A 1SD5A 3MS7A 3D3KA 4ZP1A 3ESXA 1KPHA 3QUTA 5DM60 2HD4A 4V03A 4BDTA 1ZFNA 1QVFF 1RYDA 4KFUA 2WNSA 1Y1RA 3D3WB 3UYLA 3M3HA 4KJXA 4Y6QA 3IP7A 1SQ6A 1RQ7A 2UXDO 2YYYA 4L8LA 3AG4B 4ARAA 5DEIA 2Y2UA 3GI1A 1J23A 4EVRA 1OYWA 4K6FA 1Y9JA 1D9ZA 3DGEA 1XL0A 3G5AA 1ZYUA 5JXGA 3AEZA 3JYPA 3TEFA 2ZBEA 3V4VB 2CDCA 5EKDA 3B85A 3LKDA 4LQDA 4O6VA 3FJYA 3DZFA 1OAAA 3BMNB 4JZ2A 2Q1YA 4URWR 5KWSA 1E18A 4WNAA 2NZUG 4RF4A 1LDNA 1EUDA 3N0VA 3VR4H 5ALNA 3WJ1A 4WDQA 5F2VO 2P4VA 5IMBA 1JXOA 4C0HA 3OZGA 3QELB 2VA8A 3EFFK 3WX0A 2F1JA 4OIMA 4N9QA 5LYJF 5DYYA 3REGA 4ZQIA 4FC6A 2EKLA 1PV4A 3AOEC 3BTOA 2ZSUA 2V0CA 2BZ0A 5EB0A 2EJCA 1CY6A 4UZFA 4M0CA 4LYGA 3GN1A 4EO7A 4EX7A 1G6OA 4R1PA 3DKIA 3A2NA 2Q68A 1UK6A 4LX8A 3TLXA 4TMYA 3F1KA 4TPKA 4YXFA 4ZDJA 4OJYA 4YJHB 3FVVA 4MCJA 4JS0A 1O96A 1L5WA 1S3JA 3L49A 4XVRA 2ZQZA 1GN8A 1NJFA 1VBFA 1AO0A 2K5UA 1M7HA 3E9YA 3ZX6A 1Y7LA 3ZR4B 1JLRA 3EEBA 2JBAA 3HL0A 2HU7A 1T2VA 2YINC 4LDJA 1UUFA 4HSEA 3ZGNA 4U7DA 1KO8A 2UZ0A 2QN7A 2HVJC 1SG6A 5AHKA 3D02A 5IUKC 4KVGA 4GOXA 3SF8A 2Q28A 5E79Z 1TAEA 1N1DA 3BMQB 2E3JA 4XSVA 1ULZA 3GJ3A 1FSFA 2ZJ4A 5BPFA 1GQSA 3W1WA 3GFOA 1J24A 2YBEA 5GQSA 3L0DA 3KKQA 2WSBA 3RRZA 2ZB7A 1MC5A 3PN1A 3EFEA 3OH8A 1U31A 2WM2A 3RJ9A 4N7RA 1PLLA 4MEBA 2HZ7A 2Q73A 3KZ1E 1C7JA 4MYTA 4CCWA 1JWBB 3R5TA 3U49A 1JI0A 4E5PA 1AUOA 3RHTA 1FXWF 2YRWA 2JVIA 1SXIA 3F78A 1QVGU 1O08A 4ZAFA 3E84A 4P32A 3QWHA 3DL0A 1AKUA 4BV2A 4O4HB 1T26A 1O97C 1NC3A 2FUCA 4ESHA 4J7ZA 2HSJA 1RJFA 3PDHA 1UKVY 1BMDA 1EGAA 4C7JA 4CH4A 3RO7A 3PC4A 2JEYA 2HBZA 2GBLA 5FWXB 1XLTA 2FN8A 2EP8A 4ROSA 3WR5A 1EESA 2Z30A 1ZNYA 3TEMA 1N8TA 3JAMM 1PNTA 4IGFA 3GLVA 2FVXA 3ITDA 2XRZA 3GCZA 3K2IA 4A1OA 1CHNA 3EGDB 3W7VA 2Q1WA 3V2GA 2CE7A 3MWDA 4NCKA 1XRLA 3A4YA 1CFJA 1VJ1A 4P4SA 3CX7A 3DFIA 4NAUA 1SCBA 5CB4A 2A9OA 1QVRA 1WB6A 4GKKO 3CMCO 4MVWA 3VR2D 3U3JA 3UQZA 3T7KA 4X62O 1JEDA 1KI6B 4JK3A 4ZWNA 1LPNA 4BVQA 3OT4A 4UPVA 4MGEA 3Q4GA 5BMVF 2I6XA 3T5GA 1T6ZA 1WCIA 3S2GA 3H1TA 3NAQA 4WGFA 4ZI7F 2WDPA 1M6HA 4E3ZA 4FDAA 3O82A 4JBIA 1E1YA 4G26A 3B6NA 1E2DA 1P1JA 1RAGA 1ZIPA 3HYLA 2WJ6A 3GJZA 4MEJA 2GCIA 1X8KA 1PT6A 2Y1KA 3GLIB 2VTVA 4MKRA 3V33A 4ZAXA 2PWYA 1XRJA 3ZD7A 2ZJYA 2XE6A 5CBGA 4FI3F 4QA9A 4CQLB 5H9WA 3TTXA 5KYXB 3MJVA 3BJMA 3IBFA 3V4RA 3OBWA 1M83A 3SX2A 1PF7E 2I6GA 5CLJA 4E7PA 2XUPA 1NOKA 1AMOA 2OESA 2VCYA 3ESAA 4MIYA 2Z01A 3H6KA 4N0QA 3KL2A 2CSXA 4E7OA 2QNRA 2Z56A 4CF6A 3H42B 1T10A 4GI3A 1Q5PA 3FZQA 4RLQA 221PA 2W4IA 3IEVA 3GP3A 3U3RA 3I6IA 4NU5A 3OQVA 4UDOA 4WZ6A 4YCLA 4RMHA 1IPEA 4IUYA 3TKYA 5KKAA 5COAA 4OQQA 2ZZKA 3NRJA 1MGPA 5GADl 1HYEA 1MC4A 5DBHX 3GU3A 1H42A 1A7KA 2F1IA 5LA6A 2H0QA 1PRYA 4MRMA 2WMOB 1PXWA 2Z3VA 1GZ3A 1AS2A 3VOTA 3GRYA 3WGTA 5KUTA 1TOAA 3T1QA 1G20A 3UXMA 2X6BA 5CHEA 5H16A 4QEZA 4QFDA 2PRIA 2DSNA 5JCJA 4B5CA 5LMNB 2FWMX 2A9JA 3SQDA 2PBRA 3WGKA 3NLLA 5KS2A 1VGRA 3CYQA 3VH3A 3LYUA 4GU5A 3VOBA 1OBFO 1MA1A 1Z25A 4EHAA 5K3OA 4K3AA 1OAKA 7GPBA 5K05A 3IAM1 1V3VA 3OQIA 1A97A 2NZYA 1AQUA 1QJCA 2B5VA 3N7TA 2VZLA 3BCUA 4MROA 5KSWB 2FY8A 4A8PA 4DBVO 4HB0A 3PG5A 1N5KA 5J4VA 3P0FA 3CZ9A 3QUCA 1YJXA 1V8OA 3E8MA 1IEQA 4NATA 1OX4A 1MOSA 4KMSA 4IPTA 1WHTB 3I9V6 2OG1A 3C5WP 2ANBA 3EB9A 4H0CA 1I14A 2WJIA 3N8KA 4R1LA 5DN6A 3LRXA 2PV0A 1A8HA 3K58A 4X54A 2Y0PA 2IDMA 3N2YA 5EHXA 2D74A 3P9IA 3BWCA 3QVKA 1EVJA 1Y3FE 3UK0A 1UC9A 4E1BA 4NMXB 1ODCA 5K01A 2AF3C 1ZUHA 2O5VA 1IM8A 3OG9A 1YIJF 1JGTA 1UODA 5DN6G 1ZVQA 4F2HA 1Z12A 3M84A 2AEMA 1P7CA 3WGVA 4EEXA 4WSOA 2BGGA 4I1OA 2CDAA 2F9FA 3BIOA 1O0BA 3PLAE 5C46F 5ITVA 1T9BA 4K9SA 1LJUA 2WLMA 2F00A 3MGKA 2CLEB 1PJ3A 4X85A 1L8AA 1SCAA 3E81A 4QOIA 6Q21A 1I4TD 3ILXA 1SQSA 2VSFA 2Q5OA 1X80A 1AR4A 3UBMA 3HCDA 3WNBA 2FEAA 3OZUA 3DC7A 4MQUA 5A03A 1SOMA 3BPSA 2DWPA 1E6WA 3ER6A 3K70B 2VF2A 4V0RA 3MS2A 2NXWA 4ZARA 3C8DA 2PX6A 3MCWA 4R50A 4Z7OB 3I73A 1J0XO 4DS3A 1M90H 2G38A 2UUCO 1Y89A 1U3WA 2G7MC 1XTPA 5AKGA 3WMEA 2WAXA 4UCTA 5HY4A 5IWCA 4TYYA 1GU1A 1K0UA 2I2XB 3QVWA 3LNMB 3M89A 1INLA 5CU7A 2IYNA 2P2CA 4TXJA 2YI8A 3MK31 4LNUA 4LCUC 5DO9A 2WLJA 1DHTA 2Z1FA 2IM9A 4CTOA 4ED9A 2CYCA 1M54A 3D0RA 4AO8A 5FWDA 2KTUA 2UYNB 1I51A 4RHYA 2VEOA 1JKJA 3KEQA 1KJ8A 2QTOA 2NSJA 2H0AA 3KQPA 1XHOA 4R2IA 1WPBA 1WPGA 4YMGA 4F3KA 3EFOA 1VHJA 1VKRA 2HSEA 4CL8A 4I9WA 1THTA 2G17A 1UBGA 5LVAA 1XUQA 3G68A 1NYLA 4O2BF 1SIOA 2CB9A 1SZJG 3BXHA 3NBMA 3HRIA 5EZQA 4JLJA 4TWRA 2VF5X 3TMYA 1DTEA 2ZJAA 2N46A 5M7EA 3WNVA 5BSUA 2X9LA 2Z6AA 3AVQA 3I2KA 5J5AA 1W94A 4R7TA 5ETJA 1QV6A 3Q12A 1KHHA 2ERCA 1OIVA 2J5RA 4BQNA 2PGJA 3PKIA 2Z2ZA 1U9IC 4HH4A 1MABA 2Q50A 3EVFA 3IJPA 3ND7A 1WLYA 4GL2A 2AFIA 4OGQB 1TZJA 4LXXA 3FB7C 3OM3B 3LK6A 3F2VA 4Y9TA 3IERA 4JNKA 1QB8A 1YQ9A 3AG7A 3B6JA 1ZITA 1HETA 1YS2X 1AQLA 1SG9A 4QPZA 1MABG 3CMAV 2APJA 1F8FA 3B2NA 4LXIA 3ZI4A 4BPRA 1KQOA 2H4ZA 1C3OA 2HQRA 5K0CA 3WP0A 1I0LA 3ANXA 4IXDA 4IXTA 1IXYA 2G6TA 3CS3A 1HTBA 4HDOB 1TF2A 4P0PB 3Q7IA 5IAAA 1Q3TA 4X6XA 1E8NA 2BJHA 4PM4A 3M5DA 3EVEA 3UV7A 3V5NA 1JBQA 2Q1SA 2GXSA 1NONA 2GR9A 4YN3A 4AX8A 3KT0A 4XOIA 4JI2O 3EDCA 1RJ9A 3JSLA 4J16A 3UCEA 2P8SA 2WRZA 3IHWA 3NOQA 4RIEA 4FYMA 3OHSX 1WMDA 1IB0A 1ADBA 2O6HA 3OX1A 5HMMA 3JALB 2X4LA 2P68A 1SZDA 1PZHA 5GJWC 2J7PA 4GSLA 2NSDA 2ALEA 1E98A 1CS0B 2B99A 4PXYA 2W2XA 4JAUA 1U90A 4REOA 1S76D 5AW1A 1WDKA 1N7JA 1AN9A 3TB4A 3AR7A 4NHOA 1KBHA 1H22A 4CG1A 5LMUB 5J9PC 4L3OA 5EZYA 3P9NA 2VZEA 1GM7A 5FO1A 1DKMA 1G21A 1Z6TA 4YXWD 1JW9B 4TZ0A 3RV3A 3DLAA 3EVBA 2CWWA 1FSPA 4E4YA 2BEWB 3LQ1A 1N6OA 4ASUD 3HJAA 4OHVA 2HRCA 4PIMA 2VR1A 1XVLA 4BJ1A 4RZHA 3RLIA 4MJXA 4G81A 2ZXFA 1QO0A 2REQA 4P58A 3FPGA 1X6VA 4L5BA 4DPKA 3D0OA 1EM6A 4UCVA 4OG2A 1TGOA 3M2PA 3B89A 1RKXA 1J56A 2P9ZA 5K6AC 2ZGVA 3NNDA 1V3TA 4FJ0A 4RVCA 3F3MA 2P65A 3HDYA 1QF6A 2AGVA 3MCZA 3U4MA 3N8NA 3EJWA 3H4VA 4EENA 1KD1H 4ZU3A 4NYJQ 5FH9A 2HMUA 1YJAA 4RIIA 2Z2KA 4H1HA 1XALA 5HY0A 4F5EA 2O14A 4WXYB 4JP8A 1KERA 4CQMA 1E9FA 1N3IA 3QNWA 4DR3B 3KJXA 3JRWA 2D3TA 4NEQA 2CLOB 4YUXA 1NAHA 3VU1A 2W8ZA 3STWA 2EZTA 5JDIA 4B32A 2N74A 1X1CA 4YQFA 1GGVA 1EQ2A 3CZQA 3IUSA 3DMFA 1KAEA 2EYQA 4HB2A 4D9JA 1ZSPA 3KHUA 4ZJUA 1C3VA 2IH1C 1E59A 1ORDA 4FP9A 2O0KA 1D7AA 1VE6A 2B20A 1KC1A 2E7ZA 2J1LA 3FR7A 1N9KA 5D6NA 1R5JA 2W5UA 2RHJA 4FHZA 1KF0A 3HY4A 1SUIA 5BN5A 4Q3NA 4OU4A 4HD8A 4GE3A 5HZGA 1W0JD 4MWZA 4JLOA 4XD7D 4O4IF 1Q14A 3ER8A 2XRFA 1IN7A 5EVCA 3ZKWB 4QQ8A 1R3KC 3BXPA 2P3QA 1DBQA 2C00A 3VPXA 1ZA2A 2Y4NA 4CLRA 2FMKA 2PKYX 1Z36A 5JTTA 4V0QA 1C2YA 2I2WA 4GLJA 4PVDA 1SVKA 2WWGA 1C9YA 2GRUA 3H2SA 2J3IA 5P21A 4X3OA 4W1SA 3TIIA 1T3GA 5BV0A 4M55A 4YT4A 4YUWA 5ESDA 3RG8A 3TX6A 1Q0SA 1VKNA 4PLCA 1KR2A 5FBWB 5IJZA 3AR4A 3NX4A 2XQGA 4EVQA 3D8BA 4UTZA 1Q91A 1H3EA 3AL0C 2PM8A 3JQ8A 3RFVA 2IRWA 5FAXA 2O1XA 3UKOA 3KB8A 5IABA 4E09A 1P73A 2B34A 2OWEA 3L04A 4C7XA 2J0QA 2I7CA 2UVDA 4YP9A 3C98A 5JFGA 4KRXA 2QAGC 2B1JA 4ALMA 3TXQA 1A77A 5JFTA 4CM4A 1PYDA 2JIBA 4Q48A 1USWA 4JP3A 5CIYA 4AF6A 1C41A 2A5JA 4DUGD 1C3XA 1HQYE 5HKBA 2YXYA 1PWZA 5LBIA 1JTFA 1ZBQA 1MP0A 1DAGA 4PLWA 4BFUA 2J9YB 3COSA 1YBVA 4E4RA 4RY9A 1F38A 1TCUA 3VZSA 4A8JA 1N36B 1SCKA 3DAGA 1ZH6A 4XQCA 4Q15A 3I3FA 5B2EA 4N39A 3ZD6A 4ABTA 1H0SA 5TMDA 3ZDQA 2BE7A 4HUQB 4XDGA 3GEGA 3EEQA 2CHTA 3GHYA 2ZWAA 3MSCA 1TW2A 3LQFA 2XNSA 2WF6A 3N0TA 3ECAA 2I2AA 1IU9A 1J8FA 1T2AA 2FW6A 4CMIB 3D3NA 2HP0A 3CRAA 1OZAA 5BQOA 3CEMA 4WQMA 4BAGA 4C8IA 2C59A 3BH6A 5J2TF 1Q0HA 2AKAB 2XA9A 2ZCUA 4EB3A 2Y1XA 4HWOA 1SH7A 3B5EA 1T8SA 5IZCA 4U2BA 2GEVA 4EWLA 1U94A 4TQAA 3VSCA 3PX3A 5HCNA 3A6GA 1SIWA 1BH6A 2AR0A 1PSWA 3DXYA 3EEFA 4DZZA 1GZHB 2REXB 2CXHA 1YUMA 5JMOA 4XLLA 3IHTA 1GRCA 4YJDA 2P69A 5KYTA 3O90A 3RF7A 1HNNA 2F2TA 4LVOA 2NTYC 2VTKA 1LVHA 2W6JA 2NU8A 1HC7A 4I55A 4O29A 1IBMO 1T13A 5AVXA 1JIKA 1JBKA 1S2GA 5DYTA 3RSLA 3DP7A 4WZAA 1GPAA 2YR0A 2J0SA 3NTXA 3MBIA 2WZDA 3CG6A 2J67A 4N41A 1AURA 4TUYA 1ORIA 5JY6A 1P2VA 4KFMA 2Q3BA 3GLFA 4DY4A 4PG5A 4HVCA 2XDYA 4TVOA 3BKWA 4ZYYA 4O4LB 4DR7O 1QNMA 3GMDA 1QCZA 1JDZA 4NAVA 3TW0A 1U43A 2XD4A 5LP6A 4FU0A 2HOQA 5FPYA 1GTSA 3SZRA 5LIRA 2GDJA 2VJBA 1A3CA 1JS1X 3KQHA 4FLUA 4E5YA 1BZYA 2CNLA 1YHNA 3DLPX 3PTAA 3GUVA 4TTVA 4X97A 4B74A 5FAKA 1ARZA 1NJ8A 3MCQA 3PIIA 3KB6A 1NT2A 4XM0A 3TXAA 2PS1A 9MHTA 4PYOA 4R2JA 1T6XA 4FK5C 1ZVVA 1KQSU 3ZG6A 1BQEA 5HFLA 1YJCA 3LDAA 3VKHA 1Q7GA 1X7WB 2OM6A 1NBOA 1I6WA 3ZCSA 1XHXA 1D1SA 1RRMA 4LOIA 1XTIA 1E4YA 2ZWOA 2FLVA 5BUZA 1K8YB 3K5NA 2WP0A 2EAUA 1IWPB 2H57A 2H65A 1LLFA 3OIYA 3TLGB 4Y2UA 3VI6A 1RWOA 4FYPA 1I3LA 1YD7A 1WSDA 2X4DA 1NJSA 4XUDA 3QPDA 2BKAA 2H11A 4M9RA 3U48A 3QG5A 2XE4A 3WB9A 5IVPA 2DRIA 4F93B 4L07A 3UNXA 1N7GA 2TMYA 4FLYA 5ALUA 3WMGA 2C2WA 4FX2A 2C1EA 1J97A 4AQ7A 2H2HA 4A8TA 3UWOA 3P45A 3C6XA 3DEJA 1Z22A 3SXJA 4WLFA 3WISA 3ZWAA 1I2CA 2XNDD 5KOHB 3IAEA 3GLUA 5LWHA 3MW8A 1EWKA 5DWDA 4KN8A 4YWJA 1VSVA 4TLLB 1YJ9F 5G0SA 4NZ9A 3D6JA 1AJPA 4ETNA 2DUMA 1KAMA 4Y6SA 5A3QA 2AG5A 2GJ9A 4J94A 1AXEA 4JOQA 1YR8A 5HMLA 1FU8A 3P9XA 4IIUA 3VH4A 3GLKA 4GECA 3PRJA 4LI0A 4K9RA 3HBMA 2ZFUA 3B1XA 4P4TA 3TBFA 1NM5C 3EZGA 4MGHA 4B76A 3CMEV 3TL2A 1ZL8A 1FC0A 4NY1A 4B2YA 3DW3X 1Z88A 1GTRA 4YMLA 2BV3A 1UMDB 1D4AA 2PBFA 3UBTA 4UNIA 1I9GA 5K3SA 4WWHA 5FFMA 1QR8A 2BZ1A 1KIFA 3J81N 1AKQA 2N0SA 1TL7C 5HK9A 1FMJA 4JJEA 2PTMA 3FPHA 5AI9A 1QVVA 3MC1A 2A0WA 5DRTA 5KYWB 4G5HA 1EE2A 4DRXA 2WOJA 1DXQA 4LECA 1PZFA 3DBVO 1G2OA 1YR9A 4YB8A 1QDLB 2D54A 1YS4A 2ZIMA 2JVKA 1WR8A 2JGDA 2QXUA 1ZNXA 2HMVA 4OJNA 3RFUA 1YU9A 1XNQB 1JG1A 1PJRA 5KVCA 3IP9A 3KYJB 4YRIA 3U7HB 2HYIC 1D4ZA 4DSAA 1YJBA 5K0ZA 4DUYB 1P4HA 5L3QA 3P94A 3AL3A 4CDMA 1UKAA 3RASA 1SZTA 2C61A 2FXVA 4XWGA 3W6OA 3DDWA 2LZ0A 5I4KA 6ABPA 1GNQA 2XUQA 2WNHA 1VG8A 3B1JA 4A0SA 5GJBA 3IO3A 1PG2A 4JQZA 1G6UA 3ENWA 1ZD9A 5BT8A 3IALA 3DEFA 5KQPA 2LCAA 2AQKA 4EG3A 2CY0A 3AHEA 4DNFA 4J2TA 3ILHA 1M56B 1WMAA 5E2AA 2AHYA 4CGYA 5DECA 5ICEA 4C7OA 4MCIA 4J0EA 4I5SA 4BZZA 2WM3A 2WSSD 2X1LA 2I6UA 5TF0A 2OMEA 4Q02A 1W2GA 4LE0A 5J5CA 3PTZA 5DT2A 3LO8A 1VIMA 2Q0QA 3LXMA 5HZHA 3J7TA 4WD3A 5KNBH 1QIGA 5K3AA 2WQZA 2QW8A 3QLVA 3ESYA 1KJJA 5K3EA 2E5FA 2BL4A 3ANSA 5FBKA 3C41J 1XE3A 4X00A 4NE9A 3R9XB 5GONB 5LLTA 1FBTA 3R3VA 3VKWA 1FJHA 1E2UA 1V1RB 3CVYA 5A2QM 4GPD1 3HUFA 2ZSDA 4RJJA 2X8JA 4R9SA 2WJPA 1WJZA 2IZ0A 1NMYA 5BW8A 5LB2A 1EX9A 5B3SC 4TTAA 2VHJA 2LVBA 1ZM7A 3OKAA 1WLEA 4JP1A 4WK2B 3C1AA 2EBFX 3PYXA 4K03A 4L15A 1YR7A 4AJ1A 1PWXA 4PXAA 3L46A 2HEGA 4GLOA 2WSIA 3W2EA 1ADGA 2IYVA 1F17A 4QUDA 3PKZA 3LLSA 1M72A 4B82A 4FHEA 2IG8A 2HK7A 2ZR0A 1JHYA 2WKRA 2WYVA 2IYLD 3HJCA 3MT8A 2EW1A 2BEJA 4WHMA 4TV9A 3RD5A 1IY0A 3ROEA 3CUTA 4YK7A 4ZVKA 4IIFA 3TSYA 2BSKA 5JQWA 3G0GA 5TS2A 1Y8RB 5JV5A 4PBRA 4GO1A 3QXCA 5EIWA 1Q5OA 5AJVB 4E1AA 3MILA 3OETA 1V54C 3ITKA 3NWOA 4MA0A 4QDOA 6REQA 2ZRMA 5J5VA 4AYTA 5AW7A 3KUDA 3GRCA 4J0CA 3GFVA 2DGDA 2VWGA 4WH0A 1GPWB 2O54A 2A0KA 5KC8A 4CRWB 5IUJC 4LWSB 5FBQB 3ZEIA 1JEAA 3VQYA 3EVZA 1FDWA 3KQVA 2HDNB 2ZDIA 2OECA 2AJLI 2V7PA 3AEIA 3PFGA 5IJWA 3T99A 1O5OA 3GK3A 3IAS6 5DOVA 2VZ0A 3MMNA 5IDXA 3EYAA 1XQ6A 4IG4A 3UO3A 4OJKA 4MKHA 4ON9A 4RK1A 3BABA 1U2ZA 4KR9A 1Q1BA 3S29A 4WFEA 1Z4NA 3CXCU 2JKVA 5I51A 4EI8A 3CCEV 3JQFC 3VNSA 4EO4A 3WS7A 2WVAA 2NAPA 4LHSA 4I4TB 2TSYB 4XB1A 3A4MA 4K9PA 4KE9A 2V7TA 4UOEA 2JZCA 1XJQA 4IYRA 3CPWU 2PRYA 3IE2A 4GX0A 2OZVA 4DV2B 2YL2A 3PUIA 1SR8A 2G5PA 4ZO7A 4H1TA 3IFSA 3P19A 1VQ9V 1L7DA 3PJFA 3BERA 4HRYA 4XPIB 3I3SR 4HNTA 1BYUA 2VPYA 2HLNA 2ZUDA 5DM6V 3G2IA 2AXQA 1ZR4A 4B5LA 3QO8A 1U7OA 3TBHA 4XLZA 3GZJA 1ZM4A 2WT8A 2HQSC 4BNMA 4OUDA 5EWRA 1R5BA 1XJCA 2JNBA 3TRFA 3R7LA 4X9QA 3V8RA 3WKEA 4XUGB 1JEOA 5JYBA 2ZCVA 2EZPA 4MVRA 3JQAB 3LZDA 1QV7A 2B9VA 4D6PA 4UBMA 2NLOA 5KTNA 1W5AA 3PHGA 4B8ZA 1KK0A 4PG4A 2G1KA 2L35A 4PCLA 5ECGC 1FS5A 4AKIA 1WEKA 4BMDA 1G9SA 1KNKA 1CE8A 4AG6A 3HZRA 2Y4OA 4IM7A 5DXAA 5E1MA 4LPKA 1YR1A 1Z39A 2O2SA 1V9PA 4J75A 3T1HO 2IHJA 3FPJA 2QA5A 3ZZUA 4FT4A 4GWGA 3AEKA 3ASVA 3RAFC 4X1OA 3T0GA 1NMEA 2PT9A 3FFAA 4KOEC 4DV7B 2BKXA 4Z53A 3I8OA 4M7RA 1QLHA 2UYPA 1QZZA 3AQIA 4AJIA 3DH0A 3LP6A 2ADMA 5KYNA 1C8LA 1S89A 2CZWA 3MGBA 5H83A 4J91A 1RHKA 1CRZA 1RBMA 1LK0A 4FYVA 4QKQA 4L9AA 1CVLA 2PR7A 1YV9A 3WL4A 3RGGA 3S3TA 1G3QA 3QNUA 3PITA 2EG5A 1THMA 3L8EA 1DUIA 3OZRA 1MPXA 4IDPA 2FWNA 3I5DA 1Z83A 3DQZA 3FHOA 1RMTA 1VQPF 3KOOA 2OL4A 4INZA 2MK3A 1WCXA 2R48A 3VQXA 1YB7A 4TKMA 4IXMA 2XV1A 4RWEA 3BIWA 1KEKA 1LRJA 1R9MA 2W8BA 2NZWA 1E64A 1K4CC 4AW9A 2FA9A 3KQKA 3RU7A 1U4NA 2AB0A 1OBHA 4WCVA 3GVCA 3S1AA 2VHXA 3S1SA 2B8NA 1SO8A 1TUBA 1G64A 2HH9A 1HR0B 3ON1A 2Q3FA 2IPLA 1UZAA 2ZWPA 2H51A 4Q3CA 4PRKA 3CSUA 2PL1A 5D3MA 4RMNA 1ISSA 1NE7A 4QUJA 3ZQ6A 5B7PA 2VJKA 3HGMA 1N5RA 1J06A 5H5JA 5IN5A 1BSMA 2Z58A 3G8DA 1Y9DA 4KQ9A 5AT1A 4KI0A 1YK0A 2OXEA 3CKLA 4NJMB 4LOJA 3SZUA 5AOCA 2CZGA 1QRAA 2GZ3A 3W6UA 2JFNA 1EJ2A 3D2CA 1UZLA 3AUKA 4U7OA 1E6EA 4DWOA 4Q7MB 1U1CA 3WOHA 2ZRDA 1NHGA 5AVKA 4QG7A 4QGAA 3PE3A 1DMRA 4F4CA 1SMKA 5HNKA 1EBUA 2IXBA 2PLNA 3K0AB 4L87A 4CEIB 3C5HA 2X6RA 4MB2A 3DOCA 3QMVA 2CMFA 1VC2A 3RNLA 4D82A 1NS1A 1KYXA 1I1HA 3L7KA 1BMTA 3RYCA 4BO9A 4F2WA 1E2EA 2OC9A 5FOUA 2DVMA 1T2DA 2XVZA 1Z5GA 3MHPA 1ULAA 1V4NA 4J8PA 1AKRA 5FORA 3DL2A 1TXGA 2CFCA 2DM6A 4C89A 3RIGA 3EEOA 3CINA 4Z99A 1RD4A 1QG6A 3SPIA 1QFMA 1CUUA 1E9EA 3QQ5A 1NSTA 3HKCA 2QVYX 2AFVA 2BHRA 1N2EA 2CXSA 2WWIA 2GBIA 3OFJA 1YVWA 2E4VA 5FYQA 3KQOA 1Q7TA 2VYVA 4OGWA 3MT9A 2BLNA 4K46A 2LJ2A 4ZC1A 3S2YA 1U6KA 2ZSAA 1GTOA 3CXUA 4DR2O 3PU6A 3RSZA 4EH1A 3T5TA 1NL3A 3VTKA 3TNYA 2DU8A 3KKPA 5K51A 4FDMA 1L5GB 1CUHA 2CUKA 2CUGA 2BTUA 3H4TA 1K0FA 1QCEA 2YJ5A 1H2FA 4HYEA 3TD5A 3OX2A 3JQ7B 3U19A 3PNSA 4YUAA 2M9MA 2I22A 3FB1A 1YTFB 1I5OA 4Q1VA 1MVLA 1N0WA 3F9CA 3MCUA 4PA7A 1FVFA 1R1DA 5CIWA 4FVTA 3OKCA 4D02A 1A4XA 1AROP 4IJUA 1O5TA 5K0JA 4K0KB 2CJYA 3KYCB 4EMUA 4ZEMA 4OP1A 1QLJA 4RGQA 1QLEB 2ZM6B 4HGOA 1F6BA 1XK6A 4F5DA 3OQPA 2G9UA 3GRUA 2WMYA 2FQYA 3L1JA 2R44A 3ZHCA 2A0YA 3H16A 1YCIA 1W8DA 1TRKA 3PQFA 1AVTA 5E2IA 5AW9A 3WJQA 2WJWA 3CPHA 4H6XA 4GQAA 3HKEB 1NE2A 2RGAA 3AGKA 4E2WA 1JHMA 4WOCA 2RHWA 2WLIA 3FCUB 5ITZB 1PFUA 1BHO1 4M60A 1DAKA 3R5FA 1LR1A 3WV4A 3IC7A 4V0KA 1UOQA 1K33A 2VDWA 2Q7EA 1TTTA 4X91A 4X20B 3ICCA 4TSFD 1I2ZA 2IF0A 4L1KA 2AG8A 3HN7A 5JT1A 2KQXA 4N0MA 4PBSA 5DNAA 3ZWQA 4QU0A 1BRMA 2RB9A 1CRWG 4JGIA 2ZSIA 1R2QA 5G40A 1IPAA 3JAKB 2WJZB 3X1YA 5JI2E 4B3RO 3EEIA 2V1DA 3R3UA 1KEWA 1NBIA 2B2CA 4KQJA 2KKWA 5AESA 1UK8A 3AM5A 4RMJA 3TAUA 2O2IA 1CY8A 1D9XA 1NQOA 2ILMA 1AK1A 3MQ2A 1V5FA 1HT2E 4XEUA 1VF5B 3A26A 5DASA 1EX6A 4ZVVA 3R5HA 4ENUA 2KTVA 2YHIB 3E2IA 3NAMA 2DLDA 4RE5A 5G02A 3ZHRA 1XAHA 3AO0B 3QPAA 2G1UA 1QUFA 3V9PA 4DRYA 5JBIA 2ZCEA 5FA8A 3WDMA 2NUTB 3J80M 3WYNA 4KC0A 3TEJA 4M1OA 1NTKH 1FA9A 4PJ0Z 1YFKA 3NIGB 3T3GA 4ND7A 1D0SA 4MP8A 2YNMC 3F7TA 1J7KA 3KIZA 2QW0X 1AUVA 3PA6A 4GGMX 2R8EA 2H1CA 3WGYA 4UE6A 2EWVA 2QMZA 1ZAKA 1VQ6V 3L1HA 4MVJD 2G9VA 4CKZA 3VZCA 4FPXA 2AMTA 4FGSA 3E8HA 1PM9A 5BSTA 3OSUA 1V5GA 2R1UA 2I0FA 3GA7A 2Z6VA 4P36A 4IIJB 4UV9A 4G56A 4YONB 2JGUA 1Z4QA 1EXDA 2QWXA 2MMGA 3K30A 1KETA 1PBTA 3ZHXA 1ZM9A 1T1RA 3Q1LA 4G0NA 4LF8B 1LW6E 2Z3YA 2XTMA 1UADA 4L5AA 3GVPA 4Y9SA 2E75B 5F2NA 1II8A 4F6CA 4QHTA 3GZNB 3ASYA 3S8MA 1UDWA 4Q7KA 4PFQA 3ZCUA 4LF5O 2IXEA 8ABPA 1RTKA 2BEVA 4ZCRA 5BY1A 3GQBB 3O2NA 4H0LB 3E8BA 3VMFA 1CY1A 4XYGA 3R0ZA 4OB6A 3FIJA 1IATA 5DI3B 4B9AA 5FLEX 1DJQA 4EJSC 1Z8FA 4IVRA 4J2HA 3NT2A 421PA 1O6ZA 5CW2A 3UWDA 2RK4A 3EXEB 3G8BA 3OTOO 3W7AA 1EVIA 3A0UA 2ZJ2A 3KUKA 2CDRA 2WIFA 2XUAA 3SX0A 5CDTA 3O03A 3UENA 4B3DA 3VR5A 3B8EA 3F98A 1CP9A 2Y67A 2ZTUA 3U3MA 2XRYA 3R3HA 4KCGA 5DX0A 4YUZA 5BRNA 2FKXA 2YFQA 3EZXA 1XD2B 1D6NA 3FTDA 5DYIA 4MVJE 2QR2A 4JVSB 5TQVA 1N1EA 1YTFD 3U4QB 5GINC 4IFBA 5CT8A 4RDCA 2C8VA 4ZCLA 4F7WA 3HVKA 3X1XA 4WTOA 3OTGA 1YVRA 4YECA 3G9QA 1QS0A 1WXGA 5B1AB 1JEYA 1BU8A 1BOFA 2OHWA 4M87A 4UM5A 4ZI3A 4ND8A 4BLUA 3LS2A 1U1GA 1YDGA 2WT4A 4M8LA 2GKSA 1XKTA 4MIKA 1V71A 1VBMA 4CLOA 4RKFA 3S55A 1TAQA 4EPRA 2ECPA 1VB3A 4WA8A 2X58A 3RU3A 2QI9F 2NPFA 3OCWA 1E6LA 4DLWA 2HYDA 4L9SA 3NIWA 4O1IA 3E70C 4CHGA 1NZDA 4MLZA 1SU6A 3B20A 3T7RA 2AR9A 3K6KA 4M86A 3DC6A 1RWBA 3OX4A 3V2IA 5LNK6 1AR5A 4P2BA 4LCEA 5GM2A 5A7HA 1NSYA 2VPTA 4PAQA 5A4MS 3ZWBA 3BZUA 4I1SA 2Q0SA 3RFTA 3ZWOA 1WZCA 4MHTA 1PNMA 1R5OA 2YWCA 3EVAA 4YJ3B 2ZEJA 4FSXA 2IV7A 4D74A 1YDWA 1AUXA 5ED4A 3Q10A 2BTQB 2WUVA 3RUHA 3CWZA 3OBYA 3OICA 2B1RA 2IZOA 2BFCA 1FNMA 3P27A 4NBTA 2YIBA 3MAJA 4NOJA 3LT1A 3CF6R 1ZK2A 2GPJA 1YQQA 1GTZA 2F7SA 3Q7RA 4ENWA 3CY6A 4J3FA 5CM9C 4L8FA 1B15A 1ATIA 4AKSA 4KR2A 3M4SA 4DV3O 1LQUA 1NXOA 1M6YA 2PL5A 4ZVTA 3UHOA 4BIZA 4A0GA 2FYUH 2QA4V 4A0RA 5EI5A 1R73A 5BURA 4WINA 3BWMA 4Q9LA 1XQYA 2JJ2D 2DPGA 2YJZA 4LHWA 3ZWVA 4BT7A 3E5MA 3ZE8A 1QH9A 1Y1KE 2Z1DA 4FHFA 1GNPA 1B6TA 3UV3A 1UDCA 1VQOF 5KX5B 4IMIB 5I8ZA 4LMRA 3P0JA 2XLBA 4G01B 3L7CA 1XHEA 1A9QA 3ZLUA 5E3HA 4MT8A 1SQFA 1VHAA 2ZM5A 4K9OA 4BBPA 3OOSA 2NXEA 1O94D 2ZROA 1CETA 5AOBA 4H3HB 3N2KA 1L0LH 4R8KA 4B6GA 5L7WA 1PD1A 1HXHA 3Q72A 3VRHA 3FBWA 2A5LA 1U2DC 4HG2A 2AJCA 4Q3KA 2WSYB 1KRXA 4TXLA 3HDQA 3IT1A 5T8KA 1YMVA 2ZR7A 3HBAA 3ZOKA 3L77A 1C9DB 2ZULA 8OHMA 3DHEA 3U60B 3N2EA 2OIEA 1R6TA 1TO2E 1ZR2A 3H5LA 4II2A 1C3EA 1SB9A 1U0JA 1FU4A 1WNSA 1GSOA 1CRLA 4AU1A 2HPZA 5IDQA 2OKCA 4ER6A 1L4EA 4JJFA 4RD4A 4DJJA 4F2GA 4W5QA 4QODA 3L8DA 3BZBA 3MJTA 3WGIA 1ZJ4A 1P4AA 4LZZA 4JWTA 1XQ1A 6ADHA 4GIBA 2J5BA 3TTVA 5FUYA 4P3NA 2RGDA 5PGMA 1XNHA 2VYQA 5JECA 1AK2A 2ISQA 4R69A 2IUFA 4A0FA 3FMFA 1J7JA 3CCQV 4H59A 4DFDA 4QFBA 4JFRA 1OILA 3GPIA 4BX3A 2Z8XA 1Q7YH 1ZGCA 3TIXB 2QZPA 1BX1A 5SZHB 2NV2B 3IPXA 2MSDB 2AOTB 1U7ZA 4OM7A 1W1UA 2JFWA 2R47A 4ICIA 5KYYB 5HEKA 3HA7A 4Q1CA 3MINB 1Y4SA 2IUSA 3BGVA 3CYPB 3GC6A 2NU9A 2NADA 4LCJA 2ZP1A 3O8OB 3OF2A 3Q11A 1LX7A 2UXNA 5FPOA 1JQLB 4LJSA 2FG6C 3B77A 4RM3A 2WW8A 3FKSD 4YCBA 2Z2JA 4DL9A 1EK5A 5CT6A 2A58A 4ZKDA 2B9ZA 1G18A 3FMOB 3FD5A 2X3YA 1D04A 3PC2A 1PJCA 3G2PA 5CFPA 2A7QA 3IIEA 4KBYA 4UEOA 2CLLB 4HAYA 2EATA 3F67A 4BRWA 1O4WA 2D1FA 3GNQA 3WSTA 2B4YA 1WWKA 3ZXXA 3FWNA 2HX0A 2Q9CA 1RPTA 1M34A 2UXBB 4MQFA 4J3NA 4F84A 4DXWA 4V1CI 3W6ZA 4I4IA 5ELMA 2WLTA 2WHPA 5I8WA 2XQKA 2PWPA 1B6SA 1WV1A 4YRTA 5FTJA 2R8BA 5MGNA 1GQFA 2J3LA 3ZRXA 4LJLA 2JA1A 1EINA 3RC8A 3KUXA 4PSCA 3ZGZA 2RAPA 3PDIA 2IFTA 4HGQA 4REQA 3T1YB 5L3GA 3LRTA 4PGMA 1GZVA 4AN0A 2LKCA 3U26A 4GOOD 2G5CA 4D9FA 4FFNA 1LNZA 2AHOA 3WLQA 1L3BA 1B8UA 1NAIA 4S2UA 1GQYA 1G60A 2XUHA 4XGQA 2JIPA 4FMDB 4E5KA 3QU2A 3G02A 1BGYH 2Q0HA 3N8DA 4IWYA 5GTHZ 1EGMB 4LOLA 1ZG3A 4ECEA 3P26A 3OVMA 2PGOA 2QKYA 2XAAA 3PUZA 1QFSA 2ZZNA 2F55A 2BJVA 4OQYA 3UT6A 3W34A 1WZEA 5E7IA 4MR8A 2ZQYA 4LI3X 5F7ZA 3A32A 1IXRC 2WKQA 2CL0X 3GJ6A 3GLIE 3UHAA 3WNCA 3RADC 2MU1A 2B1GA 3PGLA 1WNTA 4AHCA 4EJFA 1USVA 5F5LA 1UPCA 3HMKA 1I7NA 4BVJA 1F4MA 3MSXA 1SKVA 4LYEA 4C8EA 1RI4A 3MA0A 1G8KA 4NE2A 1LJ8A 3KKZA 1WIWA 4BX8A 3UGKA 3NCTA 5EAZA 4IJ6A 1VRWA 3FHCB 2FW8A 1WB4A 2X1VA 2NVUB 5IFKA 2QX4A 4DUZO 4J7CA 2IITA 2HL6A 4FVMA 5K8TA 4MPDA 5J2UB 1PK8A 2D3WA 1WW3A 3PCRB 4Q4AA 1L4HA 1SVUA 1VJCA 5KYUA 1MO4A 1A7JA 1GGMA 2R8PA 4U2KA 3I9LA 5KOYA 3BXXA 4DLUA 3CUKA 1EZZA 5JDCC 4DG9A 3USZA 4BLSA 4P38A 3AEYA 1ZM3A 2IJJA 5I9SA 5GJCA 1UXKA 3UUFA 5IAOA 1UXJA 4QQNA 4RXMA 4EHHA 2AZ4A 1AT1A 3FFTA 2RGCA 2QY6A 1HT0A 4K0RA 1M4UA 2W2LA 2VP4A 4CTKA 1RYZA 3J7AU 1STOA 3WAJA 3GEPA 3D0QA 1ST3A 1JHOA 1Z4KA 3ZDYB 1I36A 1BHAA 2G09A 4IEIA 3SQNA 1SWVA 3LPNA 3ZGOA 2XMPA 3I01A 4K81B 3NV7A 4K2AA 4M0KA 2DQ4A 4KZKA 1K5PA 1UKEA 3AJ8A 2IBSA 1CR0A 4FZJA 3H18A 4TVSA 4LF6B 4QBHA 3LDEA 2GCPA 3AR6A 3V1MA 3UT5B 4WNIA 4WIAA 3QVTA 1VP7A 4PEVA 1R0WA 3K70D 1RRPA 2RI0A 1S5HC 4D9IA 4KR0A 2XQIA 3CZRA 3L0ZA 3RC1A 4EL5A 4G3XA 4N3NA 1Y0BA 4FEYA 5CRIA 2HK9A 4KGDA 4B62A 4EW6A 2GWRA 1URPA 1SVOA 2I9KA 3TFOA 4XASA 3JY6A 4Q20A 2H52A 3QMMA 4YQEA 4PC1A 2VF7A 2O2XA 2GHRA 2P78A 2V7WA 3IJ5A 1DPGA 4IQGA 3NRCA 1MV5A 2OZBA 1WW8A 1U2RA 1Y5IA 3EDOA 4DR1O 3GVHA 4JENA 4FFBA 2I3ZA 1FTWA 4ZA2A 4YRQA 4E2YA 2FWJA 1XVAA 2Q21A 4QO7A 1HSOA 4UTVA 4FIDA 2VVTA 3L0IB 3L1UA 4MWSA 3TLYA 5IHPA 5LD2C 5KVSA 3CEJA 1S9HA 2JAUA 2XXAA 1U8TA 3R0JA 5B1YA 5KOJA 1PUXA 4K1LA 5DBIA 3PC7A 3Q4HA 3IAM6 4CL2A 5EZ6B 4N5IX 4TLBA 2Q5JA 4MUGA 3ABLB 1M1UA 2FU5C 4UC0A 2HBYA 3O9MA 1U8FO 3WADA 4JY7A 3M81A 4UAJA 5D3ZA 4B8WA 1OAOC 1H69A 1R8XA 3AR5A 3I6YA 4HXEB 2BBTA 3LL7A 5HY1A 4JNCA 5AKJA 3G71F 3X1MA 4ODIA 2AX4A 4HGPA 4KWHA 1T9DA 4DIDA 1LDMA 1Y9AA 1LVGA 4EGSA 2PJZA 2XAUA 1XU7A 4I50F 3QGMA 3WRYC 3T12A 4Q37A 5JC8A 4FZ3A 4ENPA 1Z13A 3QUQA 5EE5B 4LGMA 4Q4DA 4IP0A 3HA2A 4LVNA 1C1XA 2ISSD 1ILWA 4X44A 5T4HA 4C87A 1SC9A 3V4FA 3OECA 2EEPA 1E79D 4NLLA 1BA2A 5EQDA 2JFQA 3F3YA 4M1YA 4NOMA 3C3AA 1U63A 2A5DA 1I1QB 2I1WA 3H2ZA 3O7MA 1YITF 4OKIA 2D5BA 1A04A 1GG2A 1JHXA 3HY3A 5T57A 5KMGB 2C7QA 2CDYA 3Q7EA 3CG0A 1G41A 1V7ZA 3PEFA 4H6VA 5GIPC 2ZJBA 1D2EA 2ZUFA 3PDJA 3QRWA 1L7AA 1A8SA 2PPVA 1ZI9A 4RH3A 2YIJA 1U65A 4YALA 4HQLA 1EB9A 2UYQA 1Y9ZA 2WG2A 1AHIA 2O8FA 2ASVA 1JYSA 4XXHA 5DBFA 1FMCA 2W98A 4P4UA 1SBZA 5DCYA 1OREA 3S2EA 4DY6A 1FDTA 1KY3A 1RLMA 3UC9A 3VR5H 1U7PA 3H2HA 4ZYWA 3F9IA 4QM6A 3DTYA 5C37A 5FO0A 3C9SA 1K7EB 2QPLA 1S5LZ 3BCRA 3RS9A 4HGZA 5BYBA 3R09A 4R5MA 3QVGA 1K75A 1XCJA 1RFLA 1D5WA 3S68A 4BWFB 2WF8A 4QYSA 4GICA 3LX8A 4F92B 4P80A 3NYIA 2XXJA 1KZ4A 4JKOA 1VMAA 4TQUS 4ZYZA 4OFZA 2EQBA 1KTVA 1X8LA 1YR6A 1GL9B 1OCOC 5F5NA 3ZQKA 3B3AA 1OZGA 3RT7A 3WPWA 3GX1A 3OAAA 4PWZA 3SPHA 1EIZA 1K5QA 3JZFA 3UAXA 1KO7A 1W57A 4BL5A 4M4SA 1XQXA 2V6BA 4M0UA 2RH9B 3MCAB 3WFVA 1VLVA 1JVBA 2PF4E 3L8GA 3FSGA 4D8UA 1N6HA 1T9GS 1T8WA 2BRUA 3KFLA 4HZ3A 1GVNB 2HNKA 1AZSC 2FXIA 3C7TA 5LOVF 3OLCX 1Z2NX 3QE4A 3OAAG 2CLHB 1J2JA 2Z4RA 1QVWA 1TEVA 1V5WA 3D6TB 3IJEB 1NVWQ 4ARZA 5AKYA 1AN0A 2QTCA 1C4WA 1RRCA 4U5QA 1ZHHA 3N0RA 3CRVA 2W0FC 5IC5A 1KMMA 2FJPA 4JGBA 3QEKA 3U4HA 2CCJA 1YKGA 4RVOA 4KO4S 1FFYA 1XMJA 1JLLA 4OLAA 1HEIA 3NHSA 2W6JG 2D1QA 4GDFA 2BZSA 4BEWA 3AG3C 1P4JA 4RKQA 3AM1A 2C8JA 1R6NA 1XRNA 1ZRMA 4PG6A 1T5TA 4TSRA 1R6XA 1M8JA 2E76B 2W2NA 1TEHA 4CCYA 1B8NA 1IRIA 5FTMA 1NUPA 2GYUA 2J09A 1MMMA 3LO5A 3CJHB 3ZBHA 3EXIA 1P6QA 5KYVA 1PVVA 1CJKC 2Z8YM 3W79A 1KZHA 2HWXA 4EATA 3CCRV 1RYHA 2V5VA 2ZTVA 2Q0XA 1GLVA 3AG1B 4QNMA 3PJSK 4E15A 4AZVA 1AI4A 1LF5A 3TD3A 3SC3A 1LI7A 3IBYA 3CVVA 1L6IA 1W85A 2J4CA 3F5WC 1Z4PX 2FKAA 4NU6A 5B30A 5CH8A 4JBXA 2E21A 2R72A 3MUOA 2QD4A 1W6UA 4TMZA 4CMCA 1IONA 1ZXXA 5E9JA 5JSFA 1YMUA 4ZT5A 2ONCA 2A88A 3O3NB 4EVSA 4HEA1 3TRJA 2YHAA 1EK6A 1C9NA 2Y1LA 5EJAA 1VJ0A 1Y3DE 1R3DA 5DYGA 2EBUA 3FYCA 1FKAO 4GSYA 1J5PA 2W42A 1WMBA 1M74A 3KLMX 5F9HA 2OQVA 4ZAYA 4B33A 1Z9BA 2RJZA 4JC0A 4E31A 3P2MA 3LUFA 2GLXA 4C0AC 1KH3A 4IX1A 3RUFA 2IYPA 4ZVNA 1SFRA 3FYHA 2QN1A 4LMBA 1T9CA 1NF9A 4UVBA 5B4UA 1K06A 2Q8NA 1L5HB 3OJXA 1TGYA 1V8PA 3KQSA 4MH0R 1XYVA 4YCDA 1OLSA 3A0RB 4J7UA 1SUAA 3E5RA 3S5JA 4LBZA 5IKEA 1VQ5V 5IY5B 1BH2A 1QYWA 1NBMA 1NZJA 2IBTA 4Q9JA 4MVCA 4HRVA 3HB9A 5BNWA 2X2FA 3TR0A 3UAGA 1G4UR 4FMBB 3WRXC 3WB1A