4O4HB

Tubulin-laulimalide complex
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
430
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tubulin alpha-1B chain
publication title Structural basis of microtubule stabilization by laulimalide and peloruside a.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle/inhibitor
total genus 172
structure length 426
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4o4hB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4o4hB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4o4hB01
4X1IA 3WGMA 5JCOC 5KX5B 3RYCB 4F6RA 4LNUB 3VO8A 1SA0A 4EI8A 5JVDB 5ITZB 5LOVA 4EB6B 4B45A 1W5BA 2RHOA 4X1IB 4O4JA 3RYIB 2R6R1 4DXDA 4F6RB 3JAWA 4IIJA 5LXTA 3HKDB 4TV9A 5LOVB 3HKCA 1JFFA 2BTQA 3JALA 3UT5A 1TVKA 4O4JB 5JH7B 4I55A 5KMGB 5J2TB 2VAPA 4IIJB 5MN4A 4X1KB 5LXTB 4TV9B 1W5AA 3JASA 3HKCB 3VO9A 3ZBQA 1JFFB 5KX5A 3JALB 3VOBA 5M7EA 3N2GA 3UT5B 1TVKB 1Z5WA 2BTOA 5CA0A 4EB6A 4FFBB 4TV8A 4X20B 4HNAA 3JARA 3JASB 3RYFA 3V3TA 1RLUA 3RYIA 3RB8A 4O4IA 3N2GB 3JAKA 3HKBA 5CA0B 2RHJA 3M89A 3HKDA 5IYZB 4TV8B 4HNAB 3JARB 3RYFB 3WGKA 4M8IA 4O4LA 5LA6A 5JH7A 5KMGA 4O4IB 2XKBA 3JAKB 5J2TA 4E6EA 3HKBB 5EZYB 4X1KA 5LP6B 5CB4A 5JQGA 4U39A 5J2UA 1W581 5FNVA 4O4LB 5LA6B 3ZBPA 5MN5A 4FFBA 5MN6A 4X20A 5CB4B 5JQGB 5LYJB 3RYHA 5IJ9A 5CA1A 3WGNA 3CB2A 5J2UB 4I50A 5FNVB 4ZI7B 5IYZA 2VXYA 4KWEA 3RYHB 5IJ9B 4O4HB 5CA1B 3R4VA 5C8YA 4I50B 5EZYA 3VPAA 5LP6A 5LP6C 1W5FA 2XKAA 5IJ0A 1W5EA 3C8LA 5C8YB 4I4TA 1W59A 5LYJA 4B46A 5EIBD 3N2KB 5GONB 4ZI7A 5IJ0B 2Q1XA 4EI9A 3JATB 4I4TB 4ZOLA 5BMVA 4DRXB 4O4HA 5JCOA 4O2AA 2GVIA 4U3JA 4ZHQA 3E22A 1TUBA 2RHHA 4ZOLB 5BMVB 2Q1YA 5EIBC 4WBNB 1FFXB 4IHJA 2VAMA 3WGLA 4EI7A 3WGJA 4YJ2B 4O2AB 3HKEA 3ZIDA 4U3JB 4ZHQB 1OFUA 3E22B 1TUBB 2RHLA 4O2BA 4YJ3A 1SA0B 5EYPA 4X1YA 3N2KA 4IHJB 5GONA 1FSZA 2VAWA 1RQ2A 4XCQA 3HKEB 3JATA 3VOAA 3JAWB 4O2BB 4YJ3B 1RQ7A 4DRXA 5EYPB 4TUYA 4X1YB 3M8KA 2BTQB 3RYCA 4LNUA 5JVDA 4I55B 5ITZA 4WBNA 1FFXA 1Z5VA 4YJ2A 4TUYB 2R751
chains in the Genus database with same CATH superfamily
1XVLA 5K6RA 3S7ZA 1BWRA 5IJXA 3KM0A 4C9BA 1OI2A 1BDMA 3ICOA 4MR7A 2IZOA 4Y9TA 5JXHA 4TS4A 4G97A 1WQ3A 5AP9A 3P2EA 3Q3VA 4LJAA 2VNKA 2ZYIA 2NQ8A 5C7OO 3AEYA 3U5TA 3IE0A 4AWAA 4JB0A 1TT5B 4R69A 1E96A 3A0UA 2CBGA 4PF1A 5GJVC 4GBJA 2PY5A 4IBOA 4MQLA 1A97A 4IVQA 4ETNA 2W11A 1B8UA 1BE0A 4MUIA 2AE1A 3P9CA 1MJGA 3NXSA 1BEUB 3JZAA 4MQFB 2YVLA 3JQ7A 3SEZA 4YAJA 2F43G 2YY6A 3WKAA 2ZK7A 4WXEA 1R8JA 1S2MA 2ZITA 2RHHA 1ESNA 3OHMA 2BBTA 2E4WA 1H22A 1JCHA 2R2GA 3VA7A 1NA5A 5KYWA 4IG4A 5A6SB 1L3BA 4YQYA 4LSZA 5HK8A 2X7JA 2Y93A 4P98A 3S1AA 2YXDA 4Q48A 2YZGA 3TVDA 3CS5A 1W9HA 1OHHG 2QX6A 3IAM1 1K75A 5FOVA 5KYXA 5A02A 5HJ7A 4H1WA 3HMKA 3K5OA 3EVBA 2WLJA 1IDSA 2FEMA 1Z13A 1GPWB 4ZOCA 2EJBA 1L3CA 2VSOA 1S72V 3L72H 1OLOA 4LHVA 4NEHB 4QOFA 2UYHA 4BUJA 1R0BA 5B57C 1AGPA 4L5IA 2G4CA 4G63A 4WBNF 1J21A 4NICA 5JTTA 4ND5A 3JQAA 4JLWA 2C7BA 4Z0NA 2A35A 3DAOA 5SICE 5KJ1A 2Z6AA 1KMHA 4YO7A 5GTIZ 3MLBA 1GCOA 2QR2A 3NTVA 4ZYWA 4TMXA 3PWZA 4OI2A 4LXXA 4R1SA 5L7WA 5EIBC 3EYWA 2HDNB 5HKOA 4RAOA 1E7SA 3IL2A 1XZIA 2XUZA 2VQ6A 2OESA 3JWPA 5KYYB 2AIRA 3MTEA 4K35A 2BGLA 3LXMA 5CJPA 4J7CA 4JC4A 4BFYA 2Q6IA 5I7RA 4KFCA 1BJKA 1NLYA 2PRKA 3FNGA 5LKAA 2GBLA 1K8AH 5ENZA 3HVJA 2WJ3A 1WZIA 5KINB 4NMHA 2QU7A 1YTLA 2AL7A 1E20A 2PLNA 3HR8A 4B7ZA 3RHSA 4MX8A 3MHTA 1O6FA 3C6MA 3DZJA 3VRHA 1LDMA 1QF6A 3JAKA 2D1YA 2X1VA 1RE0A 5HJ5A 2F93B 4Z2AA 4X41A 1XUOA 1UH5A 1SUEA 1BSVA 5PGMA 1GA6A 1R6BX 3RT1A 4LXIA 5JNVA 2WQZA 3WGYA 2BEWA 3O75A 5B8FA 2RB5A 1IB6A 5AI0A 5ESRA 4EG1A 2ZT9B 1ISPA 2GESA 2PH1A 1QLNA 4UBLA 5B4VA 3GVPA 2OHIA 1EM8A 4H37A 1DQNA 1VQNF 1G21E 4A0HA 4PONA 3CR7A 1L5ZA 3ZVMA 2YZKA 4J90A 3DOOA 3G9UA 3NBZC 3QKRB 4Y67A 3MT9A 1QYIA 3CCSV 2W6ZA 1OASA 1QR8A 621PA 1SKUA 4HBGA 5H68A 3SLRA 2GHIA 4F71A 5CEEA 5IT5A 4CKBB 1GDDA 4V0KA 3QUTA 1UP7A 1YCHA 4F2HA 1TM1E 1JR6A 2Y2VA 1ZOLA 4WRRA 4DDKA 3M1LA 4EVIA 3ZS9A 2I6QA 2X76A 1OPXA 4W8HA 3MFYA 2WILA 3LQQA 3SZGA 4DGSA 3AEZA 4PAQA 1ZOPA 2ATKC 4GYCB 2I3ZA 1F4VA 3LHIA 4H59A 4XXHA 2A5DA 1GGFA 2R7AA 4RHTA 5CDSA 3H5OA 5CJJA 5M04A 5K1XA 5CFMA 3QQ5A 3ZHYA 3SX4A 3E2PA 1MMFB 1ULSA 1UDAA 3TOSA 2JJQA 2BI4A 2PXCA 1Z7YA 2C83A 4F5EA 4NZPA 3PDCA 2OV2A 1CSEE 2V55B 1IUKA 4HPJB 3UAOA 2BE3A 1Q95A 1R00A 1AQ6A 4PC3A 5CG1A 1P7WA 3NJ8A 1RHJA 2NO5A 4MR9A 2OXTA 2WQ7A 2QYOA 1BYUA 2L35A 1F0KA 1PR1A 3RSFA 2JGFA 5KAFZ 3JALA 3F3KA 4Q9LA 1JKJA 3QVSA 1IX9A 3STXA 4D9JA 3G8CA 3M3PA 1B8OA 5JXJA 2XUKA 2PYLA 2XT0A 4YCCA 1KO4A 4BLSA 3R8XA 2R5NA 4F6EA 3BJRA 3IS3A 3C6YA 3FHLA 3U1TA 5ALTA 3LY7A 2E5FA 4DA9A 1TM5E 3GLQA 3W1EA 3ESAA 2I3DA 4BVAA 3TL6A 1AKNA 3W3ZB 4C6TB 1KSHA 3DOJA 3AVYA 1SCJA 1CUGA 3HUDA 2QWPB 2DR3A 2CZCA 1MHTA 4F4DA 3G6EV 1KFCB 1FQJA 1CHNA 3DAFA 2CLEB 4F4UA 3M99B 1GZDA 1H4VB 4XW2A 1GG5A 3KPWA 5F73A 5L9AA 4TUYB 1HGXA 1V2GA 4Z51A 2NUPA 3G1TA 3H5RA 3L71H 3ETHA 5LOVB 4BMVA 3GY0A 3RC9A 2R5WA 3I55F 4AZ3A 1JU4A 1JH8A 4O5AA 3GR6A 3NHAA 5JE8A 1W49A 3KXDA 4LCUC 1GP2A 3PV0A 5EHIA 1J8FA 3JYLA 3I53A 1ZRHA 4BX2A 2H63A 4TQ9A 1TAEA 1ONBA 4M1OA 2WD7B 3FOFC 3R4VA 3IVCA 3HB4X 4F72A 1YIJV 3RVNA 2GMWA 4U7FA 2I6TA 3DA8A 2NGRA 1VSTA 3I9KA 2J0UA 2QRZA 4UEKA 3E7DA 4ZODA 4DJAA 4MTGA 1E7YA 3NR2A 2C5FA 1M5IA 4MW3A 2R97A 4IDDA 4KUHA 2ZVZA 1LS1A 5D7BA 2HM7A 4NAHA 1VQPF 5HY4A 4RVOA 4YP1A 3BTUA 5EP1A 4HH4A 2ODEA 2JD0A 2J3HA 3G0DA 4EYOA 3LMEA 1HDRA 4GX5A 4MIEA 5KHOC 4S1VA 5EQDA 3WGGA 3U4QA 4OLJA 4UB8Z 1PJ8A 1I2DA 3CHYA 3Q7IA 1SUWA 4KTVE 1D0SA 1HDGO 5JWOA 3C9SA 2VF2A 1LF5A 4AY6A 1G2OA 5ALDA 3WG7C 3K3PA 2FQQA 3HPRA 4GMHA 4L3VA 1NH2D 1XZNA 3KBOA 1ONNA 3PNQA 3HYCA 4Q6BA 3GLVA 3MQFA 1AT1A 2BI8A 1AE1A 1HI9A 1D6NA 1A5ZA 4QPDA 3LBNA 1ODFA 4GOXA 3ZZNA 3K8QA 2JHAA 2PUVA 3MMXA 1ULHA 2SCUA 1S2DA 1UPGA 5IY5C 1V4VA 4D82A 1TU0A 4YHHO 5K8UA 4MV8A 4OHYA 2BSXA 3EVCA 1JVBA 3UT5A 3R5KA 3GPBA 4PRKA 4XUCA 1QBZA 4QODA 1WD5A 2ZM6O 1VIVA 2Y1WA 4EB6A 3LRPA 1GRJA 1K08A 1H6AA 3DTUB 1NJ6A 3KOYA 3MBOA 1FW8A 1RWPA 4BQSA 1WPQA 2C9MA 5E9QA 2WAXA 5A2QA 1FYJA 1U2DC 2DT4A 4BPRA 5LQMA 4OQLA 5G4KA 2XAHA 5A0VA 5HY0A 4JGGA 2VAVA 2X9NA 3H0KA 1XTRA 3CV3A 1XKLA 3KB2A 2CKMA 3K9LA 1CRWG 3ZW8A 4B31A 3UKJA 4BE7B 5HMLA 3X1XA 1OAKA 1GPJA 4UUMA 3TETA 3MRVA 1WZEA 3IP8A 1COWA 1L7RA 3QSYA 4NG4A 4ZO7A 3BMCB 1Y48E 4P0PB 2Q49A 4A0QA 1LDYA 2A30A 1JZSA 1RXVA 5I9BA 2BHNA 4PTLA 5FT9A 4AZ0B 1CULC 4W8GA 1VHDA 2WMNB 2WJ6A 1XROA 2JNWA 3B89A 3U1VA 2ALEA 3VR2D 2E4VA 3SBXA 3D7SA 1JQAA 5AK6A 3E4DA 1NLMA 2VTBA 4EHHA 3QITA 3RSZA 3JVHA 4PFJA 1ZXBA 2NVBA 4RF5A 1CIJA 4U39A 2VWKA 3RFTA 5CVVA 1E9AA 1FSSA 3PHCA 5FTWA 1QVFU 1G5FA 1GSHA 1CZNA 1Z18A 4OL0A 3E8XA 4ARVA 2J5BA 1F12A 3E3AA 3HYRA 3ZWBA 4F11A 3OHSX 3HU3A 2XKAA 1SUFA 4ASUG 4UCUA 4P8RA 4DLKA 4DBLC 4GKVA 1UKBA 4F9EA 4TN1A 1IQUA 1CP9A 1NT2A 3FG9A 3EIXA 1KZ6A 1DDIA 5IARA 1YGPA 4Z0HO 4ZARA 1E2IA 3WLMA 1YMQA 5AM3A 2JAWA 2D0DA 2D5IA 1DF4A 3O8DA 2YI8A 1IHUA 3AW9A 3NETA 1QMPA 3ZE8A 3DL4A 5JJBA 1LK7A 1I1OA 2A33A 4JLBA 4G88A 1GZ4A 4EUKA 1VL1A 1IBLO 2EF0A 2GCNA 4FWTA 5H0IA 2B3DA 1NYRA 2B98A 2IIQA 1K2VN 1V71A 4N3GA 3RYFA 4ZQIA 2DERA 3C3WA 5DN6G 4A91A 1GN9A 2VN8A 3I2JA 4BT3A 1K6MA 1EVLA 2J5XA 1OW3B 4AO6A 3R09A 4W4LA 3X43A 1VQVA 4A9AA 2OFOA 2EEPA 5J40A 5DE3A 2B4AA 4MI3A 4FYPA 3L8DA 1L5SA 4CTOA 1PAUA 4ZEVA 2DLCX 4QJFB 4EHAA 2YIAA 4NHEA 4ESVA 3MD9A 4ZT5A 2ZNIA 3P26A 4MUHA 4ZGBA 4RELA 1ULAA 2CDCA 3ZGOA 2H2WA 1Y82A 3AY6A 4MPDA 4GHWA 2V4UA 4H0NA 1MG1A 4BX8A 2VS0A 3OWHA 3RUDA 2WKSA 3IA7A 4AG5A 1LVUA 5JDIA 5AW6A 3NHKA 3KEFA 4B74A 2NP7A 1XEAA 4UZEA 1PDOA 1XNJA 3UWMA 1XF1A 2A59A 5AKHA 1J5XA 3L7LA 4GH5A 2JGLA 2QXYA 2HL6A 4GC5A 1G7RA 5CD9A 4HXEB 1C3LA 2XUPA 1NV8A 2NU7B 4B6PA 3RAJA 2QRHA 4Q4JB 1Z0FA 3NALA 3L7MA 4JI7O 1U11A 1ZHOA 4KPUB 1CJTC 4W5JA 1EFHA 1QIIA 5AI4A 5C35A 5BW8A 3K9CA 3KYCA 2FC3A 1B1CA 3IKLA 5E4JA 3IO5A 4DYVA 1R10A 2JI9A 2GSMB 4DVGA 3KUKA 3SJAC 4ZHQA 3QO5A 2HJGA 1DAOA 1WVGA 3TUIC 4I9FA 3ABSB 5EYPA 1QCEA 2PLWA 4D2IA 4ZKEA 2JLYA 4DSAA 2YWDA 4M9ZA 5KKCA 5L45A 2OY0A 1ABBA 3DPIA 5IN5A 5SV2A 3S02A 3PTZA 3HS3A 2ZANA 3S2FA 4BE9A 1BE6A 3FXAA 3SPJA 2P78A 4PELA 4HBNA 3L4EA 4PPNA 4K0KO 3TQIA 3ZN2A 1C7RA 2G0NA 1E1LA 4RMIA 3A7EA 6AT1A 1HO3A 3UCFA 5LMCA 4X91A 2Q8PA 1N2XA 1E1QG 1XA3A 3ZY5A 2BBWA 1JVMA 1GLGA 4NESA 1XL1A 5C5EA 3IBSA 1P4RA 3OFSA 4OHFA 3F73A 2QQ5A 3L8HA 1RPOA 3WFVA 5G0SA 3DDZX 2Q1XA 3QUQA 1E0KA 5BRNA 3EAFA 3W7VA 3WL4A 6Q21A 3FGZA 4Y0AA 3SDBA 4QBHA 1V7QA 3ELDA 3TG2A 3GLFE 2ZKLA 4XB1A 3JWJA 3UH1A 3SSOA 1C1XB 2GF9A 1WXXA 2CLLB 1P5HA 1IIRA 2XCTB 1YH3A 3KZ1E 1G2IA 1FXSA 3G0OA 1B0UA 4DLLA 3QBDA 1V5IA 3KQUA 4ZVUA 3WG7B 1DKLA 1BHO1 4IDBA 1UCFA 1NRWA 5L3QA 1L1QA 2R1VB 2WI8A 4PYQA 1M7HA 1ZD4A 2LKDA 4C4SA 4U6QA 1QB7A 2WJPA 3AXTA 5LZ8A 4ZYXA 4Q0MA 4A36A 5KKAA 4ZHQF 1GPMA 4I50B 2VRZA 1PP9H 1NRJB 3V4FA 4JODA 3N86A 4B81A 1C3VA 1A7JA 4DIEA 5GADl 1DC8A 1XXLA 4DK1A 5IY5B 2NZVG 3AP3A 2BC9A 3VYUC 2UXNA 2PRZA 2YIDA 2EDCA 4Y1RB 4KN5A 4RK4A 4H4EA 2ZKIA 1KDRA 1XZMA 5L7YA 4HDNA 1GKIA 4US0R 4G07A 2C3MA 3R3UA 3ECSA 4QUIA 1F0YA 4MJLA 2D3TA 1XHXA 1UZLA 4C8GA 2O6HA 4HDQB 3EEIA 2WJ4A 4YLGA 2GN9A 5IKXA 1IJKA 3KAQA 4BKPA 2WF6A 1PGJA 1EDBA 1H0HA 1ZIPA 3WNZA 1M0WA 4KPGA 2ZUUA 2EJCA 2D2EA 3RIEA 4NU8X 2IEZA 3TJTA 4KC0A 2QG9A 5EHNA 2GCOA 3LT1A 3LSSA 4NMWA 1Z74A 3E7PA 1MX9A 4YX9A 3TRHA 1TZMA 2FF5A 3KYIB 4F45A 1ROPA 5LHHA 3VI3B 4UU8A 1QGYA 2GEKA 3LGXA 4DW0A 3NU1A 3B48A 2QY6A 3GARA 3VO8A 1KYIA 1Z38A 2AMTA 3BWBA 1JFFA 2C07A 4RACA 4U9HS 2OAGA 5EIOA 4LECA 4Y6LA 1BMTA 3VPCA 1B93A 1P8AA 1QF7A 3VQVA 2P79A 2GH1A 1PBNA 3URKA 4GZ5A 1XEWY 2Z1TA 3SIXA 3FMIA 1IXYA 2GM9A 3ZZMA 3T1OA 2O8NA 1J1ZA 3FCUB 2ZR2A 4JUIA 2DB3A 4F9GA 3H6GA 3QI2A 4BMCA 2QQGA 4RD4A 5T4FA 5TMEA 5DISB 1A9ZA 1Y8RA 4J03A 1GR0A 3ED1A 1R0YA 1UWVA 2ZBFA 3PWSA 3WDKA 2JLQA 1GCUA 4FEEA 2H54A 2WNHA 3B2NA 3KQQA 2JAXA 3ZKAA 5KSPA 1GQYA 1R18A 3HCCA 2XRZA 4MCIA 2VDJA 3L9XA 4MGKR 3TINA 5FTJA 2RCYA 3CJHB 1W7AA 4Q7KA 3VOSA 3G71F 3LWVC 4BLQA 3UCXA 2KW5A 3DL0A 2QE7D 3O6VA 4KGZA 1LD3A 3LM8A 5KAPA 4FBGA 4K26A 4RGVA 3U7FB 4MVZA 5F2VO 1YQWA 2H8PC 3M1YA 2DQSA 1WZCA 1TVKB 4S1TA 5ICEA 5HDBB 5ED4A 1JSLA 3ZQUA 1RW4A 2V7PA 1ZGJA 1OX5A 3IQDB 1RYHA 4RIIA 1ODCA 3PXDA 4OI4A 2XTAA 1JAYA 4N9QA 2ZAYA 1WA5A 1EQUA 2VHEA 4AVYA 4DABA 4E32A 1DJOA 4CM3A 4KVAA 4LHXA 1IOLA 3AKYA 3M4NA 5KOJB 3SJQC 2YWXA 1OWNA 3W6PA 2WU3A 4BWVA 2PE5A 3BFXA 1QF9A 3LK7A 1R5JA 4N0MA 1A1SA 1Z0IA 4UAVA 5IE9A 5IC6A 3Q6NA 2IDZA 3E8BA 4BFUA 3MUNA 3AUSA 1QYRA 5EXTA 2FEOA 1L3IA 4DCUA 2OD2A 5AJWA 3UKDA 1GT91 1YASA 2BMVA 5E3JA 1J99A 3GK3A 3ZHBA 3EA0A 4ND3A 1GL7A 1AK2A 3ZWXA 3ZXUB 3HDQA 2J7PD 4ZOQI 3CC2F 2IXFA 2G9IA 3LPDA 3GLGE 2PZBA 3ESYA 1P2GA 4PZAA 1Z4OA 3L46A 2O6LA 3EPJA 2PQ2A 2PMWB 1BHQ1 1WUTA 4NABA 3Q8KA 2I2XB 1B26A 1B6RA 2VBGA 1QPZA 5BQFA 1MEEA 4B83A 4KWEA 2XGJA 1RRFA 5EJGA 3TIFA 2I8CA 1SVOA 4HZUB 5F5XA 1DUIA 2AFHA 2GTHA 3OX4A 4IHQA 1FUUA 4A8PA 2Q41A 3BY6A 2HGZA 2QYHA 4HUQB 1H2GA 2GHYA 2WHRA 1TX4B 3IPYA 4CDNA 4JJKA 5BZBA 1QTRA 1ESZA 2FMKA 3B9BA 1OHHD 2EIKC 4KSCA 1NJ8A 5ALEA 5K4AA 1JHRA 4CCWA 3WYBA 3H2BA 1XI1A 4NXMO 3VYWA 4BVFA 2Y1OA 2GSWA 4AIIA 2ZQMA 1D1PA 1W35A 3EHBB 4QNNA 4LVCA 3ELWA 2VDNB 1G4UR 5B3JC 3W5SA 4TL8A 4G85A 2MSCB 2I54A 5BSEA 4TROA 2C2KA 2NUAA 4PBTA 4JAVC 3RRBA 1SBYA 3DCJA 2PBFA 1XIVA 4QREA 1QRAA 3N8GA 1C4WA 4GRDA 5CN0A 1L2TA 3QVWA 3K1AB 1GVNB 2XAAA 5D5PA 3SS8A 4WFBV 3KZOA 4LXUA 1KAHA 2PWBA 3DXZA 3EIUA 5CGZA 2Z2IA 1IUNA 2QTVB 5CVTA 2CBZA 1S2OA 3RSSA 4RORA 2D5BA 4AJLA 4A5OA 2W6MA 2VLIA 4X1IA 2P2CA 2AR9A 3BGOS 3BXEA 5BSGA 1SVSA 4QRIA 5K8VA 2Q28A 2BGTA 4IIJB 1I4TD 5ALRA 2ZPTX 1ZUNB 5B58T 4YECA 2CMFA 2CL5A 3COYA 1T4BA 2PMFA 1T9BA 3OFKA 4U2FA 1VJ0A 1NIJA 1YFLA 4LRSB 3I56F 4RA6B 4J1SA 1QCCA 1D1SA 4JI3O 2EGUA 2JLRA 3LSYA 2Z9CA 4LDPA 1U3GA 2CUGA 3AR3A 4BCDA 4IOLA 3ZY6A 5CAEA 3VYUB 1PG5A 1C7IA 4PFKA 1Y6FA 4L4XA 1NJ1A 2ZBPA 5DN9A 1DGQA 1NC3A 5AJZA 2FNAA 3CKKA 3NO4A 1U7OA 3ZCPA 4R1PA 1LS6A 5CK5A 5FQOA 4MZDA 5BV8A 2F95B 5BNFA 1V3QE 1KGSA 1HE8B 4BO0A 1NN0A 1UQTA 3PL1A 3MWEA 1EH5A 4GZ3A 2F66C 1TTHA 2IXGA 3KB6A 1ZUHA 3IAXA 4KR3A 3LNTA 3ECCA 4BIUA 4LF6O 2NTYC 3NWBA 4PD4F 1VRVA 4FYHA 1E2DA 2HZBA 1KS2A 2WFLB 3L4BA 2Q0QA 3AEQA 1NM5C 3VTZA 3FSGA 1X1SA 3GT3A 2G82A 1O6ZA 4XQCA 2IU0A 1QO7A 1QG6A 2O8CA 2OLKA 1C8VB 2BMDA 2A4KA 2IIVA 4TWKA 4GKJB 2BBSA 2JLVA 1ZN2A 4XVCA 3VR4A 3MYYA 2D13A 5H59A 2EBOA 2DFDA 4G86A 3HWRA 2JW5A 4ZCQA 5LNK1 4OYHA 4DR4O 3GD5A 3CCLV 3N8DA 4K8OA 1YCDA 2DP4E 2JJ8A 5IZCA 3E22B 4H0CA 4Y2UA 1ODKA 4UEWA 3HP4A 4HKTA 1SWVA 1J7HA 3DMTC 1XPJA 3JQBA 1JFSA 2IBSA 2HIAA 1NRIA 1SEVA 2A9OA 3DTVB 5L8VA 2CXPA 2AJCA 2C9OA 3JQ9A 3I01A 4D02A 4G25A 4BFCA 2GXAA 2G70A 4BO4A 2OTMA 1KJNA 3VH1A 3AYXB 3W1VA 2D62A 4D4KA 5FUQA 1WQ4A 3R6GA 4RDHA 1SZPA 4CLRA 3TD4A 1HT2E 2YJ3A 5JZBA 2QM7A 1E0DA 4JTDB 2DUUA 4P0QB 4I4IA 3IP6A 1VQ4V 3T1NA 1VZ2A 1UZAA 3HUEA 4FC6A 1C1DA 1SQVH 4M7PA 5HFJA 4EI7A 3LFTA 3BEOA 4HDOB 5A03A 3ROTA 121PA 1T9DA 4Y2YA 3CH6A 4FLFA 1JA0A 4NZNA 3SFTA 4CL2A 4BNTA 1DIBA 4FNAA 1CQWA 5K3CA 5IBQA 2R1ZA 3N6XA 4UVIA 1BEZA 5FO0A 3TM5A 4F2WA 2HJDA 1W87A 5AOCA 2VHXA 2C7QA 1PHRA 4XQ0A 4F4CA 3LZ6A 5TISZ 1NI4B 3ZWYA 2CBXA 3X1DA 5MN4A 4H6XA 1IV3A 4V0LA 2HKOA 1C3XA 3VR6D 2QM8A 2OZPA 1OYOA 2BF7A 1H2LA 2FSUA 3JVVA 1JHQA 1W0JG 3NTRA 1J2TA 1ZMTA 1VQ8V 3A6ZA 3UWPA 3ABUA 1Z2GA 4MHTA 4H44B 4URYR 4N5LA 2EX4A 2F00A 3S0JA 5HIMA 3DEHA 4EZBA 4CUZA 3BKWA 1SQFA 3KTAA 4U7PB 1EM6A 3D59A 1J1UA 3HG7A 3EWSA 4X9XA 3I52A 4BXOB 3C41J 5B3SC 2VT3A 2WUGA 4LFBO 1FYEA 2R4QA 2HF8A 4XYEA 4FKMA 2DQ3A 1X7ZA 4NVPA 3RC3A 4KN8A 3GAAA 1UAGA 3WO0A 3W5DA 1BMFG 5COQA 3KO8A 1WXIA 4R3WA 4WN9B 1VBNA 1N3LA 3G2OA 4P08A 4QPCA 4H6VA 4OX9Y 4C07A 3GZTB 3L7JA 1Y3HA 3FCXA 4FZRA 4MPTA 3KTOA 1LGYA 1J95A 3B85A 4OGQB 1Z2PX 4C4TA 1MZPA 4ND8B 1BNCA 1U2TA 1KEZA 5G3ZA 3MXOA 1ZINA 4BRSA 4LHSA 2VYFA 2EVWX 3AFIA 3CMEF 1ZVJA 4ALIA 2P5TB 3A37A 1IBRA 4HXFB 4NXNB 1JEYB 2C4UA 2UYQA 3W7XA 3FTQA 2H51A 2YHUA 1RXUA 3H1TA 5F12A 2EIKB 3A4LA 1H1DA 1WDTA 1QHEA 5JSFA 1UFVA 3LYBA 4JSRA 2HWUA 3MZ0A 3TMAA 2FY8A 2V98A 3GRFA 1SA0A 2NO7A 2WA3A 3JQGA 2EG5A 3G23A 2ZSDA 2D54A 3IUPA 4FMCF 5KHIA 2WPDG 1L8XA 1TDJA 2FYTA 4UNIA 4KVZA 3W9SA 3X1WA 1BW9A 2QPLA 1XTQA 1DTOA 1W94A 4I5FA 5KNDH 4KHPB 4FHZA 3KZKA 3OSZA 5TDHA 2Y0PA 2EZUA 3DL2A 3DHEA 2IQ5A 2R0QC 1O3YA 4HLCA 1JFRA 1GPUA 3FBTA 2OGTA 5A9RA 2Q3JA 1HNZO 3NM4A 3QP9A 4J6EA 1CR6A 2V7XA 4TRJA 4UNQA 2MSKA 1IULA 3WLHA 4MHOA 2QTNA 1VL5A 1MF7A 4MSUA 1T5HX 1HSZA 2NUTA 4N54A 3CLUD 3W5UA 3B7GA 1V5WA 1Y9JA 4MW1A 3KQVA 2W6IA 1AG9A 3CUYA 3ZNPA 5T6MA 4R8CA 4WZAA 5AUQA 1VF5B 4BMSA 3OUFA 4KLRA 3A11A 1QK5A 1JDJA 2ZUWA 3V3KA 3NH6A 2HS3A 3STYA 2VP6A 2ZQ5A 1GUDA 4DV3O 3HQ4O 1W48A 3WGMA 1I6WA 3K1ZA 1PFGA 4KK3A 1RZ3A 3E7XA 4R2WA 5LN1A 3ZRWA 1E4OA 5DPMA 5E7IA 3BMOB 4U00A 1GG9A 3CY6A 3SGIA 2O2SA 2ODQA 3V3TA 2GWRA 4MV6A 4IGEA 1T2VA 4N18A 1X80A 4BT7A 4FFSA 3E5RA 4E4TA 5J3JA 4J4BA 1G98A 4QYIA 3WHKA 3H11A 3GFTA 4GYWA 3QPCA 4GVLA 2OWDA 3A10A 3A28A 4FLEA 4ASUD 1VLMA 3UMBA 1L4LA 3TUZC 2O9JA 4WDQA 2GN0A 4N7JA 4YALA 3VHXB 5ICGA 3CLRD 4KAXA 5LGNA 3E3LA 5T6BA 4CR8A 1H4TA 3JAMA 1L4MA 2AHOA 2OXCA 4WJKB 3WMRA 3UMMA 1LLDA 5JFOA 1F7VA 3FOEC 4L9AA 3JATA 4Q12A 5TLSA 3KBBA 2OAQ1 3N0RA 1BN6A 4I08A 3QO7A 2PT9A 3U0ZA 3AFOA 3BE4A 1SUSA 1QU3A 3TJRA 1FFEA 3ZIUA 4PLYA 1KO5A 1XILA 1CQPA 5DN6D 3QEBZ 4WBSA 1MSDA 5BOSA 1JE0A 1KS9A 4MR8A 3D2CA 2BHTA 1KOGA 1Q15A 5J2UB 1XTPA 2AI2A 3A4IA 5JNRA 1Y6JA 1NG1A 4XCXA 3VR3D 3E4CA 4H0LB 2AOVA 4GFDA 4LY9A 1G4HA 5CEJA 5T7BA 2MYUA 3OCZA 4DW1A 2DMXA 3F46A 1DU4A 4XYBA 4HEJA 2VK8A 4QUBA 4ZVRA 2PUCA 4OOFA 1IK6A 1AMOA 1AC5A 2IW3A 4FFKA 1OI3A 3V4DA 3ANYB 4E2XA 4I1RA 3L79A 2O8EB 4OKIA 3KEOA 1I36A 1RKXA 3ROFA 5FRDA 1X1TA 4FCVA 4TV9A 1OXKB 1M8FA 3WLJA 2Y3IA 3OIFA 4NF2A 1GFSA 3RAEC 1TM2A 1Y66A 3T7KA 3CXHF 3TLXA 4KQKA 3BHIA 4LE2A 4KIWA 2CEKA 2F67A 4FZVA 1CUVA 6NULA 1PS9A 3QV2A 2B82A 1NI3A 4M9CA 3N0VA 4PYLA 1KIFA 2GARA 2H16A 4PLPA 2YN4A 2A9PA 1KIMA 1S0UA 4AKSA 4MTOA 2EIMC 4LGMA 4BY9E 3QHPA 3OC6A 2XUIA 2QTSA 3M4SA 1ZH4A 1QORA 4U3JA 1XNRO 1T0HB 1QHIA 1AHPA 5DNVA 5E8RA 1DBWA 5FUBA 1JRLA 4JKOA 3OCJA 1E79G 1FTQA 3D6TB 4LY6A 3QFRA 3GLHE 4PZYA 1OILA 3G2PA 2PFSA 2FR8A 2J3QA 3SQNA 4UFZA 4DB4A 1WHSB 3VFDA 2YXHA 2QSUA 5BURA 1GN8A 4KU4A 3GEIA 2AOXA 5DV9A 4AJEA 1RHQA 4XR4A 3DF9A 1EUYA 1GKYA 3Q5EA 4MVWA 5CNIA 1O77A 3AESB 2VA9A 4IFIA 4G4WA 3QELB 2CLDX 4BB0A 4WL0A 3TGUH 3FTNA 4IWYA 2NZJA 1E1QD 4DA0A 2GHTA 5K4HA 3DXRB 5A2GA 2BUAA 1GDHA 2NN4A 4TM8A 4GXTA 3HJHA 4YP7A 4CM9D 5B3SB 1IXBA 2AYYA 3ZWQA 3PGXA 5CVDA 2X4LA 1U63A 3SAJA 2ZE7A 1CZOA 5GJBA 3HO6A 1NVFA 3WK4A 1Q90D 3A9WA 1Q7RA 4P53A 4BQNA 1G17A 4B47A 3CCRV 4TV9F 1DC4A 1U0BB 5KAIZ 4DN6A 3QQPA 4AU1A 2PX3A 4RVGA 1MNGA 5JWHA 4KE8A 1OQAA 1MGOA 2HRRA 4ZDWA 1DDOA 3F97A 3ECAA 1X59A 5K3AA 2H0QA 3Q4GA 3AJRA 3BXXA 3HUUA 1PT9A 5LM3A 4ON9A 3G0BA 1FNNA 2ORVA 1U2RA 1KYXA 4BNKA 3W5BA 1ZW6A 3O85A 4KV7A 3W8EA 3DAGA 3EFOB 1Y1LA 2D5CA 4DV6B 1CS0A 1U1CA 3QPUA 3WK6A 5AQ1A 1G8GA 3L8CA 2PD6A 4P7GA 2AIZP 4MGEA 4DXAA 1M6VA 4CI9A 4Y2QA 3WJ1A 1DTEA 2FWRA 1O03A 5U1PA 4EJMA 1BCSB 1YZLA 3U3XA 4EGSA 1XHOA 1UPXA 3IQFA 3PC8A 3RHFA 4Q1CA 1E64A 1JG2A 3Q9UA 4H0FA 1MD9A 4EB8A 3RS7A 1E3WA 1JXAA 4R7TA 4MLCA 3UKMA 3W0LB 3EXAA 1GKFA 4IOJA 2HN9A 5EWJA 4DT1B 3EYAA 3HACA 1TMOA 2OHWA 3UMGA 4C7BA 3TZHA 2C94A 1NJ5A 4EVSA 1W1WA 4AY4A 3QOYA 2EATA 2ZWOA 2XW6A 1K8XB 3GMTA 2O2GA 5KNDA 2Q5QA 4G2KA 1FVOA 1FX0A 5DT2A 2JL1A 1UBUS 3TOXA 5L3RA 2B2CA 1SULA 2DTEA 4YDRA 1IV2A 2Q3DA 1POXA 1RPRA 1M0SA 4L72A 2OM6A 1ZCBA 1C2TA 4JYAO 4NENB 2DSNA 2WLKA 2E87A 3KAJA 5KA6A 2C99A 3GLIB 4WFKA 2YJZA 1U9IC 2C2GA 4NCKA 4Q39A 1JAHA 3RFRA 5IDJA 1EX7A 2B21A 3RVZA 4BT4A 1VKOA 2C3UA 4GEGA 3CEIA 3A2MA 4FX2A 5DHAA 4MV1A 1NHWA 3LKBA 3MRTA 4IDPA 1CJBA 4J9VA 1P7VA 1G4AE 3T7TA 5T8KC 4H7IA 1YVDA 1TM4E 3GH3A 4L7QA 1XZ8A 4KIJA 5GINE 4NS1A 2A8YA 4M1MA 4MI1A 1OZ0A 4HAVA 1IXKA 4HADA 2G09A 3WLEA 2V0GA 2C82A 4Z1MA 1KMMA 3ZGVA 3SKVA 2E9SA 2PFGA 2QW8A 1KMQA 3TBKA 1KZYC 1KTVA 3L5OA 2CSUA 1NS1A 3NOQA 2CTWA 4TZZA 1WTCA 4J80A 3CLVA 1WUHS 3U60B 1B0ZA 3EJWA 4FVMA 5KVCA 2LCIA 2REQB 4QBTA 5DGIA 1JBKA 3W4KA 4DXHA 1K5SA 3W8RA 5E6SA 1I5EA 4BNDA 1BQ0A 3DTVD 3PRYA 3EOBI 3ORRA 4JEUA 2BFWA 3U44B 3ML1A 1ZCAA 3CUSA 3ZOPA 4W4TA 4LXGA 1OV4A 2C1EA 1OIXA 4WACA 2WWHA 4HWKA 2KBFA 1Y74A 3DMGA 4AECA 4KE9A 1TZCA 3UHFA 2YMQA 1M0TA 3AHGA 3JQFA 3GWOA 1VP9A 1GD1O 2CL6X 2XYQA 5TV2A 3CX6A 4LWSA 3NP7A 2GQ0A 5DM6V 2NM0A 3MHPA 4KV9A 3GRUA 2MOKA 3ASYA 2W2PA 5LQRA 2PXHA 2JAQA 2OHHA 3DLCA 5ALXA 3K06A 2BSKA 3T4XA 3ON5A 3DE5X 2CW5A 2JF0A 1QTQA 3VKWA 3ZDCA 4IVRA 4KPFC 1X4TA 1E94E 3LGSA 4NZZA 4FEYA 2HHHO 4PAOA 2P9FA 4WGGA 4KL1A 1HMPA 1PEDA 2W2MA 1GL3A 1NBEA 3NWJA 4RVCA 5BYBA 2WSSA 2YXBA 2GK3A 5D85A 4YRAA 3ANXA 4QNHB 4KQMA 3OWOA 4EHBA 2WQ6A 1OFUX 4G5FA 1YITV 3IH5A 1MKYA 2EIMB 3H5IA 2BKAA 1UOQA 1FP4B 1E89A 3ZV6A 3GCXA 2BONA 1IHXA 1MV5A 2F43B 3B09A 3JYOA 2V54A 2Y0CA 2F4VO 2ZOVA 1LSUA 4HYOA 3FPCA 2QRJA 4EX6A 2XA2A 1Y0BA 4A0GA 2QZ9A 1VJTA 4XD7A 3M7MX 3QX8A 1ONIA 3A6HA 3O9OA 1XQ9A 5CBHA 3HBNA 4FJCC 2ZI6A 1IN1A 2E0IA 1Y7HA 5JVDB 1DE0A 3SKYA 2QVYX 2AJ8A 3CEMA 3PEWA 3OZGA 2J9GA 3K72B 4Q02A 3X1KA 3LC7O 3CHXA 5FOUA 1N34O 4AMBA 3HFGA 1C2YA 2UXDO 1USIA 2EZPA 2D2XA 2EEZA 2DFLA 1AZTA 3AWDA 4HCJA 2J31A 3KEQA 5C3MA 3KD2A 4M7WA 1DUSA 3BYQA 4ACBA 2FRVA 4OPMA 1U3CA 3LUCA 1QGAA 3CNBA 5JJIA 4RF3A 2NU9A 3DDOA 5FI5A 3R9IA 2AW9A 2VXCA 4WLNA 4MWDA 3CUTA 2AS0A 1XPUA 3NYQA 3K6SB 3NV9A 1ZK1A 1K1EA 2RJNA 3U7RA 2Y48A 2FMTA 1WOYA 4E31A 2E3CA 1PZFA 2XD9A 3IERA 1ETUA 3E3OA 3CLUC 1EGMB 3AJ9A 1QHTA 4KAAA 2IV2X 2C4TA 1U0HC 3DEAA 2IXBA 1THMA 2WLMA 1M73E 4J42A 2LV8A 4NULA 4C03A 3MBKA 1UAAA 1XNGA 1DRKA 5JCXA 4J41A 4B2LA 4XUDA 1R4NA 1H2FA 4LRTB 1YA4A 1RLMA 3IP3A 4OCZA 2VNSA 3K9QO 1L4GA 3CT4A 1Z5ZA 4B8YA 3NM6B 2QXTA 5JYDA 4OG2A 1U9ZA 3ZVNA 2WJYA 5DM60 1W40A 2A5LA 3WJ7A 5C80A 4S2EA 4WKNA 3U3OA 3TLEA 1VL0A 2V5AA 4XZ3A 2B2XA 1G8FA 1VG1A 3EQ9A 3BD6A 1US8B 2C5EA 3D00A 3OT5A 3P4XA 3PEEA 2PZJA 3PC6A 2E4AA 5DCWA 4BVJA 2XDAA 3VU1A 1CDEA 9GPBA 4PX3A 2FLVA 2ZRGA 4EUSA 1L7OA 2VPIA 4OAQA 3U40A 3QMMA 2LD4A 1I3KA 2BGMA 1EP3B 1LY1A 1PX2A 5TVKA 2ORYA 3CLRC 2AKAB 1E8DA 4GPBA 4ETWA 3SC2A 3L7BA 5FLYA 3OCXA 2YIMA 1ESEA 1FZQA 1DC7A 1SPXA 4ADSG 3AK4A 2P9BA 1GIAA 1YOBA 1G63A 3QXSA 3B7PA 2DPYA 2WFAA 2XUHA 4Q7JB 1YJ5A 4X7RA 5BPHA 2IQQA 3CXUA 4TMWA 4L4UA 3GFBA 2PS9A 4B6RA 1RAHA 1N5DA 2R8ZA 1S5JA 4IQ0A 3UQYS 3ZBTA 2IS2A 1JGTA 1FBTA 4XARA 3Q8MA 1I30A 1W5AA 3VOBA 2XNDG 4XJSA 2O0MA 4NZMA 1Q7CA 1KQFA 4PC7A 2QTPA 3GLTA 1KPGA 4NJEB 2ACVA 1WSAA 2V3WA 5C51B 1J8MF 2JCXA 2FB5A 3DFIA 1II8B 3CF6R 5IP5A 5GM2A 3KL4A 1VQ7V 2P3OA 3H05A 1MAUA 2Q6TA 1Q17A 3O4RA 1F6DA 1PR5A 1JWBB 3RU9A 5KTSA 4ICGA 1D2CA 4TT3G 3UG7A 2M6SA 3N2LA 1XAJA 5DHFA 5DHUA 2B8WA 3F0TA 4X94A 1HE5A 4F0JA 1E0SA 1BE1A 1HLFA 3EZ9A 4LQDA 1LK5A 2G07A 2NQ2C 5K3OA 4RKRA 5FOTA 1CNEA 2XVZA 4HLQB 3LXXA 2OB2A 2RAPA 1PXWA 2ZT8A 3VH3A 3VV3A 4QKQA 1W2WB 3UB2A 2XYVA 3OKPA 2QW0X 1MT0A 1MZEA 3GRVA 3JASB 4HOYA 3O65A 2GCEA 3BIOA 3UWOA 5BP7A 2RGRA 2AOTB 1IJEA 1U0LA 2Q9AA 3OIVA 4MS2A 3NB0A 3ZE1B 3QFCA 4MVMA 3SS7X 4M0UA 2YOFA 1E2BA 3BWMA 3SSNA 1H2BA 5L4NA 4ENSA 2BLNA 3CCFA 4FM0A 2QVXX 1PJSA 4NBRA 2IE8A 1XTJA 2H1LA 4Q3OA 4ZZ1A 1TXGA 3C3KA 5HIJA 4DNQA 4DIFA 3C87A 3SMVA 1N78A 2KMLA 2K7FA 1ZD1A 1XJCA 4M4SA 3UY4A 4CLDA 1AKUA 2FSVA 4A82A 3OIUA 5JCOC 5KX5B 2NXJA 3IDQA 5A3JA 3P0EA 2WTXA 1J8DA 7AT1A 2FN8A 1JJBA 1JEDA 2Y1DA 2R8EA 2H9IA 3GIDA 3LX6A 4X1KB 3TBHA 5CDYA 2Q3CA 4BU1A 3IMPA 3U17A 4E0BA 2X0IA 2D7CA 2GO7A 4XYLA 1FB5A 1IONA 1A2QA 3IIIA 1U7XA 4OQPA 4JLAA 5BVGB 4RZIA 1W0JD 1UMBB 4TKUA 1LTKA 4A16A 2IWRA 4RUKA 1YI8A 3D4LA 4X62O 1THTA 5AM1A 1M8PA 3RYHB 1UPUA 2PTMA 2JGDA 4TL9A 2K6GA 3I55V 3E5HA 3KSBC 3PC7A 4FFOA 3GMDA 2WA4A 1XBIA 4LI3X 2IYOA 1NP7A 1VLHA 4E94A 3LSUA 3BL5A 3VI4B 2JDIG 4O2AB 1BA2A 1C7FA 3RK0A 1U96A 2ZT5A 4ZOEA 1VHQA 4YJHA 3TG8A 5EWLB 2DW4A 3UZUA 2O3TA 5FPSA 2Y0EA 2WDZA 1U04A 2QXUA 2FOLA 3OLQA 1ID8A 4DR7B 2LIVA 1BMFD 4F4JA 1OR8A 2C59A 1YZNA 3NP9A 2CL7X 3RASA 3WQSB 1H3FA 4BMDA 3PU6A 3OCVA 3IESA 1Q81W 3MWJA 1DC5A 1UL1X 2QR4A 1GPAA 4TS3A 4LX0A 5I9LA 2WVJA 5TQ2B 3OGCC 2KX7A 4D4LA 3HNOA 2IH5A 2QTAA 1GH6A 1CRQA 2H0AA 3ZMVA 1UMDA 4IJ6A 4TL7A 1TYZA 1AS3A 2C1ZA 1Z0SA 4PQYA 3QY9A 1ZN8A 5CDFE 1QJCA 2BOBC 1WLSA 2DWUA 5B4TA 5B1DA 1R66A 1Z17A 1NOJA 2RGCA 1Q8RA 1MW9X 1B42A 1O4WA 2ZB8A 1G20E 3R66A 3GNSA 3ZRXA 4UJ3A 4C8IA 1S3JA 3IGAC 4ENUA 3Q5GA 3BMXA 2LW1A 2OILA 6PFKA 4KO4S 2A4MA 1XAIA 1MZVA 1YBAA 4H16A 3UW1A 3I2KA 3I1IA 1DIAA 3H4TA 3Q3IA 4PDVA 4YAFA 1J8QA 2GNAA 3NKVA 1KAQA 3QBJA 3PYXA 4J0IA 1TYBE 1IWBB 1Y8QB 2WPDD 1XSEA 3UUGA 3RO7A 5EMNA 4RANA 2O3RA 4WY8A 1V5FA 3D54A 3LH5A 1E2JA 4FE3A 3I6YA 2GM5A 3NMUC 3PKZA 1A9XA 1O97C 1M57C 3M6AA 3QE9Y 1BMDA 1F6WA 1YJNF 1RYEA 4K9RA 3REQB 3T4ZA 2VDWB 4BTVA 1QCDA 5EI5A 5KHGA 1IHOA 3JQ6A 2AH5A 2PGGA 4MW0A 5JPDA 3V4OA 1CCWA 3TL3A 3GZNA 4E14A 2ZVDA 4DJ5X 4L73A 4MKGA 1TMKA 3UATA 3EIHA 5EUMA 4DOMA 1XMQO 4OP3A 1QQ5A 1VJDA 2G80A 3W79A 3COJA 4EPRA 3HC7A 4LGCA 2GD6A 4B09A 2Q8NA 4RGQA 3U3ZA 1J9GA 2IT1A 1QZ3A 5ERGB 3QNUA 5I4CA 2I2FA 3SPIA 5ALKA 2X0JA 1UWCA 2AHYA 3RHTA 1E5DA 5FWDA 5ARDA 4E5YA 1RAEA 2XMCA 1HFJA 3HTNA 5JH7B 5BR1A 2P9JA 1QU2A 3OM0A 4P5DA 3DLBA 2KQUA 3E7FA 1WMBA 3ER6A 2FWNA 3E1KA 4XIFA 4HWRA 3GU3A 2AZTA 5KOYA 1NUAA 3T9BA 2FZWA 2CMKA 2V6IA 1N6OA 3MJ4A 3VDMA 3GP3A 4JX9A 1QP4A 1KEKA 1JHYA 1FKAO 3LXRA 1EFAA 3NBQA 3QIVA 1Q6UA 2XB6A 4FGZA 3VBEA 5B6IA 4RDIA 5ALLA 1W5EA 3EH2A 1FNMA 3G8BA 4CM6A 5FJJA 2ZBUA 1TPYA 2ILMA 4BNHA 5FLEX 1JG1A 3AZOA 5KU7A 1THGA 4AURA 1FMCA 2CJPA 2ESRA 2XF8A 2VDLB 1E5TA 4C6RA 4PGMA 3ND7A 1V7ZA 1M66A 3ZQJA 2Q3FA 4AJOA 3EIQA 1Y4UA 4HAOA 4P3XA 3V5NA 2EV9A 4MRSA 1A9QA 5BMOA 1KDZA 4RVUA 5EPUA 3K4HA 2ZJBA 1OVGA 3CB4A 1GGVA 3ZJYA 3K20A 4CQJA 4P1ZA 3ZEIA 2RBGA 5HIKA 1C9NA 1KJ8A 1A95A 1SHTX 3DVQX 3Q7PA 1I7FA 1UJ4A 2NOAA 1JDBB 5LA6A 2LCQA 2J9FA 2O2EA 2CKDA 4WV3A 1IEVA 1VI6A 5CB4B 3DMPA 3W2EA 3TIVA 3KOMA 1WN7A 4WFQA 2BGUA 3K4QA 3VI6A 4BDTA 1RC0A 3H2HA 3C0KA 3R5XA 2P8JA 4EFNA 3PE4A 4KNWA 1LK0A 5IJ0B 8ABPA 4IEEA 3KWLA 5HM6A 4DRXB 5A6VA 4QOHA 4JJ7A 1IOVA 4OU4A 1DC6A 1MRZA 2Q2QA 1MOPA 3FCOA 2QRVA 5BN5A 2ZB2A 3ZU5A 1E3TA 1XLTC 2VRWA 1TE2A 4D3DA 2VNJA 4NCXA 1JEJA 1ORTA 1YA8A 5CFNA 3HEAA 2WV9A 5I6DA 4BU0A 5JISA 1GTZA 4INAA 4EPTA 2MMGA 3GELA 1NVAA 4GMFA 4BUCA 3APQA 1IN6A 5J43A 2VSYA 1QGZA 3H8WA 4G41A 3IUQA 4MV4A 1OPRA 4LP8A 1VPDA 3OMXA 3ROMA 3CCEV 4DCSA 4GGMX 1AUPA 1F4NA 4FOOA 3UXMA 4ZD6A 3W6ZA 2UYPA 1ZOOA 1YB1A 4MWOA 2BEVB 2QY9A 1IDOA 2E1RA 4GWKA 1EDEA 2GILA 2PNJA 4UUJC 4FX5A 4M49A 3THWB 3RPEA 2HV9A 1W5FA 5EE0A 1H4SA 5C8YB 1H8HA 1X15A 2IOFK 3UMYA 2XHZA 1SKQA 4L5BA 4R8KA 5DNEA 5K0FA 3E5MA 1XCBA 3AI3A 3ZXSA 1A2BA 1GU7A 2VHVA 4MK4A 3I3OA 2I1VB 3OOJA 2ZRMA 1X7PA 5CYOA 1E79D 1NW9B 2G40A 3JQDA 4RV4A 3LDEA 2HP0B 3PEYA 4MYRA 4GMDA 4TS1A 3TD3A 3FYUA 1M6NA 5EZSA 2FSSA 2CVZA 4ZMRA 5LA6F 4BNWA 1W2BF 2RDMA 5CTAA 1C8LA 5E2BA 5KPJA 4NYJR 1NY5A 3IQXA 1YBMA 4UTOA 4QFBA 3MQ2A 3WLLA 3EN0A 4YQFA 3H9VA 1UEXC 3V1NA 5AK5A 5JS1A 5EVJA 4OB6A 3I05A 5CX1A 4PEVA 2ZAMA 3ZKWA 4KQIA 4GOND 4DSTA 1LBSA 2Y1GA 1P0MA 3INNA 3F49S 3UN1A 2VPQA 4UCTA 2OB1A 2PY6A 3CLTD 1SDSA 4EP1A 2GUZA 3IJEB 1DLJA 4WH0A 2CTQA 5I9NA 1GGEA 3MJCA 4JDPA 2JLXA 2QLNA 1H1TA 2IW5A 1P4HA 1Z5VA 2QVLA 5AVXA 2X5OA 4P33A 3ICEA 1RAIA 4HDKB 3RFUA 2EW8A 1N7JA 1D6JA 2JH9A 4DLVA 2HJ9A 2IIPA 2OENG 2LWIA 3HADA 4IYIA 3OQIA 3EQ8A 1NF8A 2HBRA 2WRZA 5AR1A 1VF7A 4UEJA 4R9VA 4KYUA 2FPIA 3T34A 2RG7A 3TFOA 5T4BA 4RKYA 3ZRSA 4AF6A 4I6GA 3PQ4A 2K1SA 3AOEC 2X5KO 4KXWA 1R5NA 2QI9F 3LDTA 1K8RA 3JZIA 4UKDA 3UJCA 1WKCA 1R3UA 3HA5A 2AXEA 3X2FA 3GRCA 1O8CA 1BDIA 1KYOF 3K15A 3PGJA 1GWNA 5JIBA 3CNQS 3CNOA 1RP7A 1GXSA 2PU7A 4WESB 3ZCTA 2UUCO 1N2SA 4DQVA 1VE5A 3VKFA 4I1OA 1LWOA 2K5UA 1Y76B 1A8UA 2PHNA 3ACDA 3JD3A 3OQHA 1M57B 1M9NA 5EK0A 2PZKA 4Q1AA 5BW5A 2CEAA 4EPXA 2ABWA 1EFUA 2OGWA 5JCJD 1OLXA 1MC1A 4ZPJA 5BNIA 2H2GA 4DV0O 5AVJA 4CZZA 2ZJ5A 3BL8A 3BFVA 5E79Z 2MQEA 3B3QA 4MMZB 4ZK6A 2RSLA 4HB2A 2CJYA 4Y2GA 1UM8A 4LH7A 4M87A 1T0IA 2GAFA 4P4UA 1SU7A 1CERA 2I62A 1HV8A 2EX1A 2JFPA 4RQBA 4FONA 4HNVA 2IUTA 2UZ1A 4OLBA 3CVWA 1SXJA 4LF5O 1UEJA 1NTOA 4DDUA 4JUFA 3A3OA 2BEUB 4JB3A 3T61A 3SYQA 1KVQA 2GJAA 2RKOA 4TTPA 4JI7B 3V6LA 3UFBA 3H2ZA 4HEA1 3CD6V 2H8EA 1R4AA 1UK9A 3LQKA 5MDHA 1F1BA 1C3OB 3HZRA 3LHFA 1GQRA 4EI8A 3KV3O 2A1UA 2WUDA 2B9VA 1UDCA 3SCZA 3N74A 4XUEA 3TXSA 4ZBMA 2ZQYA 2B92A 2BKXA 4PWYA 4BW0B 3T99A 4LOIA 3ZH9B 1AJPA 4ER0A 2PGDA 3C4VA 3JYHA 5GVSA 2QKYA 1L1EA 2EKQA 3IJ4A 5HG0A 4G56A 3GJYA 4UJ5A 1Z5GA 2P4HX 1QYVA 3PIIA 2PKWA 1A9TA 1L5FA 5AUPB 1XQYA 5JJJB 4G8DA 1NUUA 3ZVLA 5FA6A 1QIKA 5T41A 4UDNA 2J6CA 1WNSA 3WGIA 4Y9UA 2C84A 1H1LB 1EMDA 2J3EA 3FDFA 3EFEA 4Q9JA 1AP6A 1WIWA 2ZRLA 2ONYA 2J1LA 2W6OA 1U5AA 1AKRA 3FYEB 1SVIA 3VOAA 3EXFA 4XWTA 1QE5A 4DKJA 3VR1A 4EM6A 2GZ2A 4F21A 3O4JA 5ALMA 1EVEA 4FSHA 4R2IA 4KTTE 3IPRA 2WWWA 3RD5A 4WERA 2FPGB 4QGPA 4BIZA 3CE9A 4YV2A 3MEQA 2RK3A 2PYJA 3DDNA 3O8LA 3UYLA 2GBGA 3CM0A 3AVVA 1EFTA 5BQXA 1H8EG 1F4PA 3QVNA 1S3IA 4Q4HB 2GA8A 3T5CA 4PQEA 1M2HA 2OTCA 2XA9A 1WR8A 2UUPA 6LDHA 1PFQA 1KDYA 3AM3A 5LBQA 1I6LA 4JMLA 3KT3A 1AJEA 4ZAZA 4CLXA 4ZTZB 1CQIA 5EXEA 2CWWA 2I33A 5HS4A 3T5BA 3T5PA 2QEXV 3R40A 2RGNC 1U8UA 4E70A 2BO1A 2QJ1A 1CS4C 1YAHA 3KYDB 5B66Z 3FVQA 1SOWA 4DUZO 3QUWA 4QGFA 1NMYA 3RE1A 4QLOA 3G2LA 1VL6A 2I4LA 2OCAA 1QZUA 3C7KA 2R9IA 1FDOA 1S8FA 4IT5A 3ILYA 5L95A 2R8YA 3QKWA 5TE9A 1VF6A 1QUFA 4YPVA 1CRZA 2CV1A 3T7RA 5A5VA 4FLMA 4AUEA 5G4UC 3DGEA 3JRXA 1Q0PA 5CBPB 4Q4AA 1KH1A 1G3UA 1U0JA 4C4RA 2FWAA 4WK2B 4WKGA 2IS4A 2I78A 1XP5A 3FGOA 2ON6A 4IF6A 1VECA 1U0FA 1U8YA 2QRNA 3QKSA 5LB4A 2O7VA 4WA7A 1CZRA 4BFZA 3VPAA 1RYZA 4RULA 1FX1A 2WD9A 2ODMA 3T1HO 1U81A 1YZFA 1I7PA 3F7MA 1JDNA 5AI5A 1JKFA 2WWIA 4ZIRA 1VYTA 4PC2A 5REQA 3DNPA 4FI3F 4I1YA 1EB8A 1IMJA 2PUEA 2X6QA 4HFNA 4BAZA 2PX8A 1V8ZA 3ND6A 4K3AA 5EQFA 1FSZA 3G1WA 4M1WA 1F17A 4F3YA 2IPOA 2VYND 2GKSA 5DX0A 4WFHA 2CYCA 5IKOA 1YACA 4W6ZA 2P6OA 4U7JA 3PPXA 4AJ1A 1JT2A 4DXWA 4QBGB 5KHLB 1JA8A 1LUVA 3EDOA 3OOYA 4I5SA 2R1TA 3F0FA 3W7TA 1YCFA 4LOHA 3K2BA 3RT7A 3VXKA 4FM2A 1DG3A 3WFJA 3KKKA 1C0EA 2GNPA 2J3IA 1LRLA 2X77A 2B25A 2A6PA 2WG2A 4M38A 1W0KG 5J9FA 3H75A 4E1VA 1SHLA 4PFQA 2JBAA 3WYCA 3PT9A 2NXNA 1L5KA 5DTJA 1FU7A 4KDRA 3T9EA 1KKLA 2RGUA 2VDKB 3EQZA 4MIOA 3WK9A 4L7VA 1TA0A 5ITZA 1ZONA 1CLEA 4KWTA 3MRSA 3TTUA 1ZMBA 4EAAA 1QHSA 4G0ZA 1LBTA 3TLYA 3B6KA 4PLHA 3SGLA 2EQAA 3NW9A 2IYFA 4KWCA 4JP1A 2N42A 2GN6A 4OUKX 3I28A 2D3OW 2ICAA 3AF5A 3DBHA 3FFXA 1B7GO 2WTBA 1VCIA 2ZS9A 1Y67A 4MI6A 1RP3B 2HPHA 4F2PA 3H7IA 2DPXA 3ANTA 1M5UA 3BWVA 2YC4C 1RM0A 5SZJA 1BRMA 1AM4D 3UW3A 3DLAA 4LXHA 4P4SB 1NBMA 4RFSA 2YXYA 2OZLA 4OV6B 1UEIA 3PQEA 5EG5A 1ZQ9A 1ZEMA 2XE6A 2MDTA 4ARBA 3I9NA 1BCCH 2JFWA 5H81A 1RS0A 4C0SA 4BN5A 1RQRA 4DLXA 4UNSA 4MV3A 2Y66A 3U80A 4JZ2A 2ISQA 1Q20A 3ORYA 2HBZA 2C2MA 1QH8A 3ZGZA 2XNDD 3CMAF 5EE9A 1BE3H 1IY8A 3OOEA 1CZKA 2O8FB 5FWNA 2GBPA 2QA4F 1KECA 4C0LA 4S05A 2IBZH 1WWKA 5KNCD 3V1TC 5BSVA 3MD0A 3AGKA 3G8AA 3I58A 5CT4A 1FP1D 1QHNA 3R74A 1NVTA 4UXHA 3NWEA 2AGAA 4FZ1A 1JX6A 5D01A 3ZHRA 2FPSA 5KNBH 3SC6A 4DV4B 2GN1A 1EWQA 3D0KA 5EC2C 2YZ2A 4TT3D 1K8YB 4B35A 1TUBA 3V9AA 4QICA 3PE3A 2FEWB 2FQWA 1K98A 1DG1G 5KUMA 2HFEC 5TXGA 4HDAA 5A1JA 2EW1A 3CE6A 2XB2A 4PLVA 3ACCA 1OVMA 1ICEA 3RC7A 1JHDA 2C0CA 3FB1A 3W5VA 2Q9LA 4GOMD 2FKAA 4INZA 5LCXA 2Q2OA 1QH0A 2ES4A 1DIOB 2BE9A 4BT6A 1OLUB 2ODNA 2Y1KA 5IWCA 4CMIB 2ZPAA 2VAXA 3N8NA 3PR1A 3EH1A 4J1TA 4BO1A 4GI1A 1T43A 3WIOA 2VJQA 3WBFA 1DAHA 4NBTA 4JLJA 1JLHA 3N2EA 3AETA 1NONA 4HN4B 2BV3A 3KFXA 1RSOA 5JRDS 4QUAA 4XA8A 1R6NA 4B33A 1VMIA 4HO1X 1MXFA 2BOCC 1ZWZA 1P74A 4YRGA 3WDMA 3V2HA 2H00A 3SOPA 2AN9A 2PRSA 3BCCH 4XDZA 3D8TA 2V8BA 3IELA 5E7MA 2Q6AA 4HV4A 4JCCA 1HZZC 1YWGO 3NC0C 3NLLA 5EKXA 4RQOA 4MKHA 4W5WA 1JY8A 2OPHA 2OC4A 4G0XA 1R0SA 2AK3A 1IATA 4DEVA 2Q5EA 1RLJA 2X6TA 3ZR4B 3F67A 3C3CA 2XKBA 3BULA 3VSBA 1C0IA 3UK0A 4UD2A 1M34E 2QUJA 3TQTA 4JLUA 2ZNJA 5A5DA 1TTQB 1ZVQA 3KU4A 1TRKA 1Y5MA 1LKZA 5CNKA 1D5NA 3D5TA 3GJTA 2IZ0A 2JDID 1LNQA 4FYYA 1OAOC 3FY4A 3VJRA 3CLTC 2ZJFA 2JLWA 1II0A 1G21A 1NVDA 1Q11A 3G17A 1WE2A 3OUUA 1UOOA 2WHQA 3QX3A 3O21A 2OO5A 3H6KA 3C9UA 4KX3A 1YTUA 4IXDA 1LWNA 3NHUA 5K6AC 1YZVA 1EJBA 5CW2A 1ST3A 4J7UA 5IBPA 2F2TA 1K8ZB 2XAGA 2YICA 2IH4A 4HDMB 4Q21A 4DCOA 1T6NA 4EIWA 3P3PA 5P8WA 3W6NA 4PA9A 5GTHZ 3OZAA 1P61B 4K8ZA 3ROPA 1O94A 1OGJA 4EW6A 1GTSA 3RVMA 3BEHA 3OR7C 1A0OA 2PV0A 3UK6A 4Z8YA 1VQLF 1B6SA 3ROZA 3SIPA 1L5HA 3K9WA 3LX8A 2NZUG 3RC1A 3AF2A 1B06A 2HA7A 1UFKA 4ALNA 5BN4B 5LP6C 3DC2A 4R40B 3IEPA 3BK1A 3D01A 2IOYA 1KK0A 1HDOA 3QLEA 3U10A 3KU1A 1WQ1R 2Q1YA 4QAJA 1SBIA 5KVVA 4R51A 2RHBA 1MV8A 1USGA 4YTEA 4WFEA 3FR8A 4GDMA 2O1EA 4GYJA 3GRAA 3KB1A 1YKSA 2QUHA 1T0KB 3BFJA 2H4YA 3GN1A 3CVVA 4JV5B 2FDRA 3PEUA 3IAEA 1GTJ1 4CV3A 1L8AA 4YJFA 3OE7G 4ZU1X 4MGYR 2IS1A 2QK4A 1SBZA 4NI5A 2WF7A 3ZE9A 3D4PA 1T8PA 4EY8A 2Q0OC 3TGPA 4ZWNA 2WG1A 1HDIA 3GAMA 3NBMA 1DQPA 4MRRA 3CXCU 4JLDA 4UC0A 3DEIA 5TJ9A 4HHEA 3ASVA 5IVDA 2EWWA 2GPTA 4B3CA 1PR0A 3JSLA 3HVIA 4PAMA 7MHTA 3WZMA 3GUVA 1UMKA 1BKYA 2R7NA 2Z0AA 1RLTA 3CQ9A 5JANA 1O97D 1DIHA 1ZL8B 1A4RA 5NLLA 1FXKC 4HX5A 1LUWA 3I45A 5H5JA 4K28A 3A1UA 4AS3A 2IYUA 2ZE8A 3AHDA 3DD5A 2E37A 4S24A 3A1WA 3KHNA 2HSWA 4PQGA 3DVRX 1T25A 1KQGA 1KK2A 3GEPA 4ABTA 4DWWA 2FUNB 4M2LA 2JB9A 3DE0X 1K06A 4CH4A 1F06A 3M34A 1HDYA 4G09A 1G5IA 1ISJA 1FL9A 1Z6PA 5A0FA 1FPQA 1N2CB 2OCPA 5KWEA 2WV7A 4DDVA 2Q0SA 4V2IA 5GY7A 2PL1A 3MRXA 3D7MA 4YAGA 3DJYA 1JIVA 1QLWA 3PFHA 1PWHA 2PAFA 2ZSBA 4I4TB 3HYTA 2X3UA 3O1LA 3GHYA 3FPGA 3PENA 3EXHA 2HRUA 1K92A 3V9PA 1OB2A 1Y1KE 5E4FA 5KVQA 2PMEA 4EMSA 4X1YB 4HN2A 3FRJA 3PICA 3FI9A 4KQCA 1N1MA 2OP0A 3BQNB 4PBRA 2A5YB 5JAHA 3D81A 1V41E 4YCBA 3L82B 2D06A 3N4YA 1U28C 3WJAA 2WR8A 3A8TA 2UYJA 1B14A 4XGIA 3LA8A 1N8SA 5LJIA 4LFBB 2ZPUA 3EC1A 2A0YA 3X1YA 4AJHA 1QRRA 4FLZA 1M7BA 1XZBA 3BE5A 2CHSA 1UP4A 5FX2A 4JC8A 2G71A 4L15A 3LC2O 3O9MA 1XJ0A 2AI3A 3LUDA 2ZJ8A 3S99A 3OTIA 3O0DA 2GI4A 5D3MA 4WK0B 1P5FA 5E2AA 1D2NA 3DLHA 1TA9A 1FUEA 3HHPA 4BQFA 4OKSA 2Q68A 1C0LA 5BUCA 2PBZA 4G0VA 1WY5A 3G67A 1NDHA 2XSZD 4Q3CA 3A25A 1YJQA 3P9SA 2BMJA 3C3BA 3V8VA 4J3FA 1UWKA 1W46A 1MAVA 3G2QA 4Z7QB 1RRCA 1GMGA 2CVFA 1CY1A 3Q8HA 2QB5A 2M1ZA 4QDXA 1EFVA 3IR7A 5C1PA 4YT5A 2AC2A 4YH1A 3IP5A 4CQLB 3S3XA 1J20A 3ZJ4A 1G8YA 2Y4OA 3RS9A 4WVLA 3R7DA 1HDEA 1YZ3A 1VSVA 4B79A 3GQBA 4ENVA 1VLLA 3KAPA 5HS6A 2BGJA 3LFOA 3RBZA 2PX5A 5AT1A 5LQCA 5ALZA 3P5SA 1XZPA 1YV9A 3S06A 3I34X 5F2EA 3WYGA 2YOHA 2HR1A 3VMFA 1YQ9A 2Z83A 4QBIA 5JS8A 2LFRA 2VYCA 3KYBA 3KC2A 1HNZB 3UGKA 3WB9A 4P92A 5GOZA 2QBYB 3PKJA 5E3HA 4G4IA 5BSRA 2ZUFA 3RODA 3IHLA 4MUEA 2ZWIA 2QAGC 1T36B 3D7NA 1QQ6A 4URUR 2W2LD 2WHPA 3RF7A 4MVRA 1IEXA 1JAIA 2BLLA 1N6NA 1Q57A 4Z49A 5BVHB 2EP8A 2NP6A 1MFPA 3KL2A 4ABMA 4LVOA 3EWAA 3IODA 3OCWA 4UM7A 3BQMB 4U7GA 2V4DA 5CHEA 3WGNA 2Q7OE 1DADA 4CKWA 2QI2A 4EUHA 5EZQA 1LQ2A 4FJ1A 3GO4A 4C89A 5JSZB 1W8DA 2NV2B 3TZBA 1NYLA 3VOUA 1K8AW 1UDXA 3IAS6 4HYYA 4FB5A 1BXKA 2MW2B 1V8FA 3IIEA 3P5BA 2C2ZA 1US6A 2IEDA 4K3VA 2GK6A 2NSYA 4OI1A 2ZXFA 1XMSA 1DXOA 2BR4A 3ZGNA 4MGHA 1KEEA 2CCKA 2H5LA 1EVIA 3X2QC 1U2PA 1EI9A 1M56C 4C7XA 2QTZA 4HAXA 5DW0A 4RHYA 3N2YA 1LC3A 1OT3A 2Q4DA 2YIBD 1Q21A 4BWYA 4XEHA 4N39A 4ZDJA 1ZSPA 4S0XA 1E3JA 1F8XA 3I64A 3T5MA 3U9LA 2VDMB 3P4UA 5E6UA 5LP6B 3RJTA 3ZDXB 1EGQA 3BERA 1M2FA 1ZJZA 1G3QA 3UV6A 1JTEA 3B3GA 3EG9B 1RJDA 1ZK4A 3ZCUA 5LQSA 1L6RA 4PQFA 4EMTA 1Q3TA 1TMYA 2C2YA 1WUJS 2I9KA 4FDUA 1MORA 2C7VA 1KY5A 4WZ6A 1FRVA 1LBHA 3DBLA 1NMZA 3P9KA 4JPRA 1CBUA 3DCNA 3RU2A 3IT2A 1YI2F 3CKYA 3AF0A 4G4SO 2QF7A 4ROSA 4LNAA 4EGQA 3FRHA 3ZLJA 4RSMA 1ZI6A 3DE7X 1B0AA 3R77A 3S7TA 4E3ZA 1TAQA 1JLKA 5I4KA 2YBDA 4BP8A 2P4UA 2FFJA 1XTUA 3H9QA 3M6FA 2RN9A 4D6XA 5I9IA 4K9SA 3RT9A 3PHHA 2OFPA 3M5PA 3ZD6A 3MF4A 1E2NA 4P7JA 1T6ZA 3CYOA 2C7RA 2FJUA 3TXYA 4TRRA 4MUJA 2KG4A 3GT0A 4LNHA 1P4JA 2P6PA 1YRWA 2J5QA 2DKOA 2HU7A 4OUDB 1ADFA 1CUXA 2XA1A 3U31A 2F8MA 4B6JA 1U97A 3JY6A 3DP9A 5ECGC 1NTZH 4AX4A 3E8SA 1ONPA 1Y7LA 4AFNA 5BSFA 1FXKB 3TF5A 1JPUA 3ENQA 3H5AA 5K2MA 1I94O 4V3CA 2SBTA 4RY2A 3E05A 3DOIA 2RCVA 4OGLA 4ZAGA 3ZWKA 4XDLA 3PZBA 1PJCA 2IJIA 1VQNV 1C9KA 1SHJA 4REQA 4E51A 2ERYA 2CXNA 1ZMXA 2C97A 1IYZA 3Q9SA 1V2HE 2CNBA 3OEEA 4PTYA 1XEXA 3GCWA 3U16A 3L84A 4G1CA 1PTJC 3IUEA 1Z75A 4FOLA 3E53A 3RS0A 4MDFA 4A2PA 4CMAA 3KR0A 5LBIA 1KJIA 1JDBC 1NJ2A 2ZIMA 3HKDA 1UJ5A 3PP8A 2AXPA 3GEEA 4U5QA 2O2XA 2JI4A 2OWEA 3QXXA 3BAZA 4ZEOA 5ALFA 3L8FA 5K51A 3TD2A 3LBIA 1GFZA 5AVRA 1E1KA 5IJWA 2Y1EA 3VTFA 2EERA 1YI1A 1HG1A 5IBRA 1GO3F 5FWYA 3CVXA 4KQ6A 1M0EA 1X3SA 1D9ZA 3ZS8C 3DQPA 1F3OA 4LDQA 1M10A 1QNLA 1FFXB 3HKEA 1BVRA 1CR4A 2ZODA 1DKPA 2FK8A 4ENTA 3MAAC 3WYDA 4V1CI 4DQ0A 3GLFA 3TE7A 4I6JA 3V48A 4YMGA 3AVWA 2QR5A 3Q85A 3SU8A 2ZDHA 4C2AA 1H8ED 3K31A 1B8VA 2ZRBA 1AU9A 4CF4A 5TGZA 4X20B 2W5UA 1WZ2A 4RZQA 2XDQA 4PNPA 1EXMA 1K7FB 3VKHA 2OXIA 3BRQA 2WYOA 1IXRC 4A2QA 2WU1A 3GPIA 5HQTA 1ND6A 1SQ0A 3PFBA 5C8DA 1NU8A 3LPLA 5JJEB 1X3LA 5LMZA 2Z4SA 4TZTA 3LLUA 1OJLA 1GQQA 4GR9A 3C8LA 3JQ8B 4PXYA 4C8EA 4K9MA 1H2NA 2C8LA 1V1JA 2A5GA 4OXYA 5EBLC 2E6UX 4TMKA 4O2LA 5K3FB 4AROA 3MK31 2MCFA 3FLMA 1W44A 1PNVA 2D1RA 1TTTA 2A0KA 4FZ3A 1P7PA 1RADA 2ZXUA 2C4WA 4LWQA 1MJ5A 3CPSA 4RH3A 5B1AC 1FU8A 4A6EA 1M90H 1YE5A 2LNDA 1NP3A 5LMNO 1M83A 1VGRA 5B2EA 1WB9A 1QANA 2G9RA 3M84A 1PNOA 2D2CB 3QO8A 4EG0A 1UMCB 1W30A 1Z5WA 3E2EA 5ICSA 3L0YA 2OV4A 4ZRDA 2DUMA 4URVR 4HH1A 3PNBA 1XFAA 1KY3A 2LGQA 3AKZA 4UCRA 1DO8A 3OECA 3T12A 1OBOA 2WVAA 1HEYA 1ID1A 4BVTA 2PXXA 3IE1A 3TFWA 3I61A 2A7QA 3TSYA 4EVRA 4HPWA 5KS2A 2YUAA 1R74A 1U6KA 1PL6A 4IIBA 1SU4A 4DREA 3NONA 2HRQA 1V16B 1SOVA 3G6WA 4PX2A 1AO3A 4EJ6A 4YAWA 2RGWA 1NW8A 1KZHA 5LB2A 2FDXA 1N6RA 2AVNA 3QYAA 3C45A 1NXTA 3X1MA 1N2OA 4YA6A 1QZXA 2P22C 2QAGB 4C22A 3W7AA 1EZ4A 4Z2YA 5IT9N 3O38A 2KS6A 1R64A 3T54A 5AKXA 5JC1A 1C50A 5BNZA 4I4CA 3HXPA 3O8OB 1Z3CA 2OCCC 2GZ3A 3Q3EA 3D31A 3LOUA 4C0BA 4BIOA 1ENPA 1FSPA 2YW9A 4MH0R 1VQPV 4PZLA 5HSGA 4B48A 2ZOSA 5F3WB 5HKKD 1C14A 4HNUA 1V7CA 2RFLA 1YB4A 2V9YA 3RYTC 3A4VA 5FV4A 4MW6A 1SC1A 3DV0A 1NW7A 1DI0A 3UA3A 3F4BA 1U7DA 4QXOA 3K0HA 2TSYB 1NVXQ 3U3JA 4CG1A 2N04A 5I7WA 1I7LA 1F0NA 3AONB 3C98A 2HWKA 3IQHX 1W0KD 4BW9A 4EY5A 1DTWB 4DIMA 3CG0A 3X2QB 3MINA 3D8NA 1SZJG 2BF4A 3QOXA 5AHXA 1M56B 2IZ1A 3E70C 3VM6A 3NHPA 1EWVA 1U0NA 2CUZA 1W93A 4RK0A 1P9RA 1M7GA 1AQIA 3AM1A 3RYCA 1WBJB 3NBAA 4U0KA 2RI6A 3QTBA 4KUGA 4F8EA 3GRYA 3NC4A 2P0AA 5EUQB 1TPZA 1YQDA 3PVSA 1ZHFA 1DV2A 4Y1EA 3D36C 2YHIB 1JXOA 2HDWA 3BK2A 4FCTA 4KQJA 4NC9A 1XD2B 3E9NA 2VPPA 4KDEA 3NHSA 5DWQA 4NV3A 5IS2A 1PS0A 5EUCA 1Y1TA 4E11A 1XU7A 2A0LA 1OYYA 5A4KA 5SY4A 2JLCA 1JE1A 4O4LB 1E2GA 5TNXA 1Q12A 3T06B 3FGPA 2PTHA 1TQHA 2I67A 3OTGA 1Z0UA 3ET5A 1I08A 4J0HA 3K5HA 3SZLA 4BQOA 3G8YA 1AHIA 2Y1LA 1Z6AA 3H6HA 1QH1B 1QAQA 2VK2A 3ABRB 1Q82H 2D74A 2G5CA 2QUBA 1CUUA 1X9GA 3FTFA 3H5NA 1GU1A 5FI0B 2BP7B 3DDUA 5DBIA 3SPGA 2X2EA 3QHQA 2JATA 3TZEA 1KNXA 5AM5A 2A0WA 2WUVA 4AN1A 3ZV7A 1G9XA 4GVXA 2GK4A 3U7HB 2OXEA 1FRFS 3ISTA 1F2UA 2GXSA 1I0LA 4EPVA 4XBFA 1PFVA 1UR5A 1YVWA 2Y05A 4H60A 4YY3O 3GLGA 3L4JA 1E2EA 7REQA 2BR3A 3NHMA 3UC9A 9LDBA 5JJNB 2J6HA 3NANA 3ZXXA 2HHHB 4G2NA 2Q2NA 2QYTA 3FROA 3ZWNA 3E35A 4CTKA 2IYPA 3PQ8A 3RVSA 2O7NA 1XZFA 4G26A 4B46A 1HBJA 1HPLA 2FSFA 2BW0A 3NQ41 5F2NA 3UTCA 3TEFA 3PSAA 2XCLA 1IM8A 3G85A 4F8YA 3OTFA 4JI5O 2ZJOA 4V1CB 2N05A 3WQBA 1TAGA 3VSCA 3A6DA 2EWCA 3G9QA 3DHVA 5BY1A 4LNUA 2XYPA 4HVAA 1ITZA 3BM5A 2XUDA 1RJEA 3UJHA 1HM5A 1IZ3A 3MJDA 1GN3A 3VDQA 2WP8J 5KC8A 3UVEA 1QAOA 3STWA 2Q7XA 2DFPA 5F1OA 4E5DA 2Z1UA 2RE8A 4H9GA 1U8FO 2N47A 4P93A 2WM9B 2RMKB 2QLTA 2ZUTA 3A1CA 4HNAA 3FNEA 2EOAA 3I9V1 2C5GA 5CM2Z 1E3QA 1REQA 3MGAA 1XCGB 4D8XA 4IW3B 1SUDA 2HTEA 5EKSA 4C4YA 1M6YA 3EIWA 1A72A 4TLMB 4FWIB 3BCUA 2ITCC 2QS9A 2WVGA 3FFTA 3RUEA 5J58A 3C70A 2LZ0A 2XUOA 3E2MA 1MB2A 1BH6A 2AKEA 2GHQA 1IBSA 4BVGA 1ZEJA 3T7JA 3IBFA 2J3LA 2X19A 1C9EA 1FAFA 2W8ZA 4JOQA 2F1KA 5AESA 5L3SB 2NTNA 4BTEA 3BWYA 4FMTA 2DMRA 3HB9A 3BVPA 3HVRA 2VPXA 3U7GA 3DMHA 4WZBE 3UMSA 3GFPA 2WT8A 4YHHB 5L7TA 3M8AA 4JYMA 5F77A 2ZM6B 3IIJA 4LZWA 4XX0B 1A5AB 4YHBA 3KQLA 5AYVA 3VVMA 1PGPA 3TLGB 3B70A 1YZGA 1BCRA 3B38A 3KWFA 4MUAA 3HJRA 2OK8A 2B5WA 1XZDA 2FH5B 3LI2A 3MOGA 4JN6B 1EVQA 2QVGA 3ERNA 3BVOA 3AI1A 3GA0A 3O8QB 5B1AB 4DCJA 5BV1A 5AW4A 4LZNA 1P2DA 3AF6A 5UKDA 2V7WA 4L6AA 3H5WA 2XEXA 4Z4EA 5KHKA 1E7QA 3OA2A 4HQRA 4QFCA 4RGBA 2EIHA 4QT0A 1A2OA 5EERA 4FDVA 4JP5A 3D6UA 4YMSA 2ZSUA 1PQYA 4JQZA 4NJOA 4UU0A 4IVNA 2I9PA 2HVKC 2ZIWB 5FPHA 4MAMA 2C29D 4YFYA 3U0OA 2EW2A 2FEPA 5DBFA 5DI3A 5D84A 3TJZA 4OB7A 4Q19A 4X8MA 2GHRA 4YN3A 2CNKA 1SZXA 4TGLA 2ADMA 5FADA 3BGSA 1FFHA 2JJ2A 4GLBA 2GCIA 2ZATA 3LAWA 4R5MA 1KZ4A 1XTVA 4HQFA 4LZPA 3IDSA 3NJ4A 3HXOA 3K35A 3LWDA 1X70A 3QU7A 1JR3D 2C20A 5CM8B 4M6WB 1M1YB 5ENVA 3LIPA 4PVCA 3GGCA 4RZXA 5LMUO 1NX6A 2ZAIA 4DBLE 5JR3A 3Q6MA 2VBIA 3ZP7A 4DNFA 2OCCB 1KXZA 2CHVA 3O73A 1VQ5F 4UBOA 5H9CA 4RK1A 2IGBA 5L3CA 4JS0A 3NXKA 1ISGA 4QNRA 5B1OA 3RYIB 4L50A 3SEFA 2XE7A 4B7AA 1MAWA 3OE7D 4HWSA 5H2FZ 4RK5A 4UB6Z 1IBLB 1NOIA 2P3QA 5C81A 1Y81A 3ZXIA 1R0KA 2ZBVA 3OD1A 2C4KA 3IEUA 1B73A 2W37A 4RVDA 3O8BA 4BP3A 3WGUA 2AF4C 3IX7A 1B6GA 4QXPA 1G0OA 2GERA 1SCQA 3PLRA 4NL4H 1WL8A 4YRLA 3CSXA 3QWHA 2PUFA 1I2ZA 5L3GA 3CPEA 3ONEA 4K1XA 4TSFG 1MN6A 3DFUA 4S35A 2NZXA 2O8VA 3RTGA 4CXMA 4NQ3A 2CVHA 3GG2A 3HABA 3HR7A 1JOYA 3EZYA 2F7SA 4AYTA 1T0UA 1RJFA 1HL3A 1RBZA 4PR3A 1TUEB 2IY7A 5AD1A 5C4IA 3BQ9A 3P9YA 3O2QB 5EE5B 3FZEA 3L7AA 3SYMA 4KMOA 2H18A 5E8JA 4GEKA 5HTOA 4TZKA 4EI2A 3GW8A 3QPDA 3DVSX 2PWZA 1D03A 1UC9A 2R11A 3UK2A 1WP7A 4O2RA 1DAKA 5C5CA 4DK0A 5AKZA 1QAHA 1IN4A 2ZQZA 3VTAA 1YULA 2ZB4A 4IDHA 4WA8A 4KXNA 3D7RA 1ESCA 4L9RA 3ROKA 3KK0A 3AM4A 3OMNB 1EYZA 2AHRA 2P0YA 4BCCA 2BFNA 1XK6A 1GGJA 4LCKA 1GVHA 2A78A 4ZT2A 2VTEA 1E4EB 2LPMA 1MBZA 1TYAE 1XQWA 4D0GA 1YAJA 1K3EA 2C57A 4RHFA 5J9PC 1MAHA 2NO6A 2RK6A 2ZRNA 4FLUA 2FGKA 3KV1A 4RH0A 3R3ZA 1AXEA 2FW0A 3G0HA 3U3KA 4I2NA 2HIGA 4R71A 3DB2A 3EORA 1XBLA 4ZCIA 4LDRA 5DHSA 2JEOA 3ZXYA 5DNUA 2B37A 1FS0G 4ZYYA 4OSPA 2RBKA 4WFGA 4ER3A 1X2EA 3F1LA 3D3IA 1SXPA 2VJMA 4IIXA 2IPMA 5CYGA 4TV8A 1KZ7B 1RQNA 4DY6A 1KXJA 4LI0A 2I8AA 4K0KB 2YQ4A 3QNMA 4P4TA 2AE2A 4RKWA 3CZMA 1EIZA 3D0OA 3ELBA 1OTHA 3M33A 2JKYA 1E63A 2AJLI 1NF2A 4MVQA 2IDMA 4QU9A 3PQ2A 2WTMA 2H94A 1IBCA 1FMTA 2C2BA 1RSZA 1V35A 4O3FA 2WB4A 1OWPA 5I8PA 4LZZA 5SYNA 1E6LA 1IBMO 2A0UA 4EA8A 1G64A 3C97A 4MUYA 1ODSA 4NPAA 2DBZA 3FSJX 2VRCA 4NEQA 3CINA 3E0QA 1DCMA 4I2VA 2FV8A 1W88A 3P1JA 4ZQGA 4NP6A 3G71V 3TECE 4ZC1A 2W2KB 2MMCA 3RVPA 1E9SA 2PUDA 3SC3A 1GZ5A 4KXRA 1J8YF 4L0DA 1R6VA 1Z88A 3R3VA 1FFCA 1WHTA 2Z3WA 1EE1A 1CFZA 4KIUA 3DV2A 1EA5A 3GAZA 4P36A 1JJVA 4DYDA 4RL6A 1I51A 2PI5A 3TKLA 5JAMA 2JD1A 1SUPA 4QXMA 2R1UA 3UOAB 2ZI7A 1ZGGA 2G5PA 2AW5A 1XEFA 2PGNA 4HLNA 4F04A 1UKCA 1NQ3A 5ADUS 5I7OA 4FLXA 2HMTA 3LBAA 5K3EA 1XWIA 4WXMA 4WJZA 3RLFA 4GPEA 1O96A 3BT7A 4U5XA 4CIVA 5BRJA 4B6SA 1SHUX 2VDUE 2XMDA 4BJ3A 1B6TA 3J81N 2QU8A 4L0MA 4GKAA 4XR9A 1MSWD 1F0PA 1C0PA 2OHJA 4I9GA 3ZWAA 5HF9A 3G88A 4TV8F 2OA0A 3CC4F 2XCQA