4O4HB

Tubulin-laulimalide complex
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
430
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle/inhibitor
molecule keywords Tubulin alpha-1B chain
publication title Structural basis of microtubule stabilization by laulimalide and peloruside a.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 172
structure length 426
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4o4hB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4o4hB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4o4hB01
4O4HB 3WGLA 3JAWA 5ITZA 4I50B 1OFUA 1W5FA 5KX5A 4WBNB 5KMGB 4E6EA 3E22B 3M8KA 4HNAB 5CA0A 3JASB 1W59A 3VOBA 2RHOA 1TVKB 3UT5B 5C8YA 5JH7B 5J2TA 2R751 4EI8A 3R4VA 1JFFA 3RYCB 4O4IA 5LP6B 5FNVA 5EZYA 3N2GB 4TUYB 4F6RB 2VXYA 3WGKA 2VAWA 3HKCB 5JVDA 3N2KB 3WGNA 5MN5A 4IIJB 3HKEB 3JALA 5J2UB 4X1KA 1W581 1TUBA 5GONB 3VOAA 4I4TA 2VAPA 1SA0A 3ZBQA 4DXDA 4U3JB 4EB6A 2RHJA 4ZHQB 4DRXA 4TV8A 4O2AB 4X1YA 4O4HA 3JAKA 4ZI7B 5LOVB 3HKDB 5EYPA 3ZIDA 4ZOLB 2BTQA 5LP6C 5LXTA 5MN6A 1RQ2A 5KMGA 2XKAA 4LNUA 4EI7A 1TVKA 5EIBC 2XKBA 3UT5A 5BMVB 4YJ3A 4O4LA 5IJ0A 3RYHB 5LP6A 3N2GA 4TV9A 3HKBB 4YJ2B 3RYIA 5CA1B 3V3TA 2Q1YA 3RYFA 5LYJB 5IJ9A 5JQGB 3C8LA 3WGJA 4IIJA 3JARA 4FFBB 5GONA 3JATA 4B46A 3JAWB 1Z5VA 4IHJA 4ZHQA 3VO9A 3CB2A 5IYZA 4O2BB 4O2AA 4XCQA 4I55B 5KX5B 4KWEA 5CB4B 3WGMA 5LA6B 5CA0B 4O4JB 5LOVA 4M8IA 3VPAA 4I50A 5C8YB 5J2TB 2R6R1 4WBNA 1JFFB 2BTOA 3E22A 4HNAA 4O4IB 3JASA 5FNVB 1W5BA 5JH7A 1W5EA 5JVDB 3RYHA 3RYCA 4X1IB 4TUYA 3JALB 4F6RA 3HKBA 1FFXB 1TUBB 5MN4A 3HKCA 5JCOC 4I4TB 1SA0B 4B45A 3N2KA 1FSZA 4EB6B 4X20B 4DRXB 3HKEA 5J2UA 4TV8B 4FFBA 4X1YB 2RHLA 3JAKB 4U3JA 5EYPB 5JCOA 5ITZB 2BTQB 5LXTB 4O2BA 4I55A 2VAMA 3ZBPA 4EI9A 5CB4A 1Z5WA 5LA6A 4ZI7A 4LNUB 4O4JA 3HKDA 2RHHA 4ZOLA 5IJ0B 4YJ3B 4O4LB 3RB8A 2GVIA 5EZYB 4TV9B 3RYIB 5BMVA 3RYFB 5IJ9B 1W5AA 4X1IA 4X1KB 5CA1A 4YJ2A 1FFXA 3JARB 5EIBD 3JATB 1RLUA 1RQ7A 5LYJA 4U39A 3M89A 5JQGA 4IHJB 4X20A 2Q1XA 5IYZB 3VO8A 5M7EA
chains in the Genus database with same CATH superfamily
1MLDA 1GPJA 4D8UA 3E22B 2OO5C 4ZCQA 1K8AW 3LH5A 1V45E 3PQ8A 2A2ZA 1R0LA 2FQXA 4JI1O 1CRWG 1FFSA 1UIRA 3OBIA 1PP4A 1U94A 3BRSA 5J4VA 4FDTA 5B1OA 1V9CA 2YX1A 3ODPA 1EVKA 4NXNB 1O57A 3HCBA 1QV6A 2EG9A 3WLIA 2HK7A 3Q6IA 4OQXA 4QPPA 2X0FA 1E32A 4WLVA 1NPYA 4AJ9A 3TLKA 2C2HA 1JR3D 4LISA 2FEXA 3A25A 3GLVA 2DCUA 4Q4AA 2LPMA 1LPOA 3VU9B 1NLYA 1RFLA 2P30A 2PZBA 2R68A 5GINE 5KJFA 3UOGA 3DHYA 3MHSC 3GT3A 3GP3A 3JQQA 4M1QA 2PO7A 4KYIB 4DBLC 3GBVA 3Q0IA 3H83A 1XYYA 3WLKX 1N1GA 2XJ9A 4CLDA 3HS3A 3F0EA 4NCBA 1XHZA 4EG5A 4JYCA 1UMDB 1NPDA 3MQWA 3V2UA 3AKCA 4DMLA 1V47A 1IAQA 1WY5A 2GD6A 3AWDA 4CM9D 3UJHA 2CJWB 5K6AC 3KLBA 4GRAA 4V02A 3R3VA 1TKCA 2ECQA 4ZYXA 3OSZA 4AY3A 1SETA 1E98A 1SK8A 4NE9A 3OE7G 1WUIS 3EAGA 3T4ZA 1USUA 1QFMA 3BWYA 3SVZA 3CR8A 2I4LA 4YFVA 3G9ZA 1L8OA 2QAGA 5BNZA 4Q00A 3AKDA 1EZ4A 3WRXA 1EX6A 4MVJH 3PKZA 2FY8A 2WPNA 4EL5A 1SUFA 1JEJA 5K2OA 3BZBA 1PYDA 2YKGA 4WINA 2W2QA 4BPBA 4FLYA 1ZITA 1BDBA 1R3IC 1NLFA 1VHTA 2PRIA 1R6BX 1F6DA 1CUIA 1IM8A 3H9EO 2WWTA 4R8LA 1BD4A 2PK3A 5CW2A 1C29B 3WBFA 1LDYA 5IWCA 2D3WA 2VI5A 1Y4ZA 2Y48A 4OHZA 3PEEA 2HO4A 3PENA 1NMXA 1EUCB 4RQAA 4UCFA 4PHGA 1QCZA 4MR7B 4JWKA 4JTDB 5B3JC 2IS2A 3IMFA 2GN0A 5EJ2A 3ZXSA 1YE5A 4RC9A 1AM4D 1IBMO 4QBKA 1JV2B 1IHXA 3NJ8A 2WWGA 2PUSA 1X38A 2G76A 1X3LA 2A5DA 4L76A 1U02A 2J46A 3CNQS 5LA6F 1Y37A 5LFAA 4PGFA 4UEJA 4U2CA 4PELA 4CN8A 3P0JA 5JYBA 3T0FA 4AM8A 4W5WA 3Q8HA 3QKTA 4OFZA 5K3CA 3ICWA 3ONNA 4X61A 2YYEA 1A9SA 3L6OO 5BUSA 4JI5B 2X58A 3D59A 2X6QA 3U49A 5ALLA 2VRCA 3DMNA 2ATEA 2R5FA 4AQ7A 3OPYI 5JPCA 5AG2A 3WL7A 4QAQA 1PW5A 4Y9TA 4JY7A 3T5BA 4ZOQI 2IQQA 3QKWA 3TG2A 3QWBA 2V6MA 4K8OA 2BGRA 3TRHA 2VJCA 1U3TA 3KJHA 1IZZA 1TD1A 4OHBA 4BO3A 3A3NA 4QUDA 3V7YA 3JARA 1J21A 1YVDA 4YRNA 3ZV7A 4AJOA 1N7GA 1X19A 2WJ4A 4F0JA 4FC6A 3PUJA 4CM4A 3BXGA 2JI8A 4JL5A 4C2AA 2IIQA 4KE7A 1B6TA 1LBHA 3WMXA 2CFOA 2QD2A 4EGAA 3U62A 3RVMA 4DB4A 4J9YB 4L4RA 3MEQA 1DKUA 1CQIB 1XTIA 3LZDA 2VDJA 1EI9A 2D1TA 4WLEA 4NENB 2OZBA 2UXBB 2Q7OE 3LPAA 1V2GA 2ZE8A 3J7AR 1AGPA 1KE1A 3DF9A 3HJRA 4BATA 1KBQA 3VKFA 3U6KA 3BXPA 2PLAA 2WHYA 3EDMA 3A3KA 2ZIXA 2I3BA 3WLAA 2NR5A 1E59A 3ILYA 4X3LA 3VSCA 3TMAA 4UEWA 1B3RA 1HNXO 1I5YA 3JW8A 5BVHA 3MA0A 3O0TA 3R0ZA 3V6MA 2QSYA 2O0JA 4C03A 1PN3A 3HC7A 4MVQA 4E21A 1RWBA 1SMKA 2AI3A 2PR2A 4A0GA 4Q7KA 3HK2A 4FQ7A 3ZJ4A 2IYWA 1WMBA 2ILVA 3L7YA 4FD3A 2CNOA 4KQMA 2AC7A 1ZFNA 2YHSA 2JFZA 1SESA 3KFXA 3G4SV 5CT5A 3LT5A 1IXRC 2PYDA 3ED1A 4J11A 3TFWA 3ABLC 1XVAA 3QJYA 4Q34A 4UEOA 5LQSA 1KVQA 2L18A 4MVJM 1EVLA 4N21A 1W0KA 1K68A 1A5SB 4YYZA 2FSVC 2DPXA 2N9UA 4DV4O 5TVKA 3GLHA 3VI4B 1WQ3A 3VYUC 1QE3A 4OA5A 2W2XA 3N8IA 3RUAA 3BSSA 3HH8A 3VOAA 3MK31 3NX4A 2RAFA 3TZKA 3RASA 5KMGA 2QZ4A 3LT4A 1PWZA 1NV9A 3DPUA 2CHSA 1N5RA 1VGQA 1I24A 3NUGA 4DC1A 3A0RA 4AI8A 2CV0A 2IHKA 2VCHA 3G13A 2GK7A 3ZCPA 3B7PA 3RROA 1JEAA 5AOCA 3VPGA 4YUWA 1KGDA 3G88A 2L17A 1DSSG 4NCKA 2GKSA 4ZEWA 2FPPB 2XMRA 1JGTA 2ZUWA 5J2UF 4DILA 4XYBA 1V1RA 1SAYA 4XIFA 4H7EA 4I36A 2R44A 1RAGA 1L6IA 4MWOA 4BXOB 5AYVA 3ELCA 4R9NA 3T1TA 4M0CA 2QRLA 3PJEA 2HP0A 3SDBA 5JJ5A 1CUHA 4PF1A 2NVUB 2AC2A 5AQEA 3Q15C 5EKSA 1DBSA 4EHDA 1ZLXA 1BL8A 1XNQB 1A8PA 2NYUA 1DT5A 4TUYB 2PGDA 4W5OA 4HAXA 5L95A 1O7JA 2B20A 2POQX 3OJXA 3WIBA 1P19A 2ZSIA 1W48A 5HRUA 4HB4A 3FMOB 1NOKA 2PPVA 3G49A 2WJVA 1UPAA 3KKZA 2VS0A 2R4TA 1LUVA 5BQ5A 3GDHA 1SIBE 3MQ2A 1TU0A 2R8BA 4ZC1A 1TAEA 4BW5A 4ZOEA 2JJ1D 4ASUD 3SFTA 3E48A 3G9UA 2E75B 4TYNA 1IPAA 1RM1C 1DO2A 5GGXA 5UKDA 1JZQA 3S06A 3K0FB 2QTPA 4PO8A 3NOQA 2XUKA 5J9FA 3BMXA 5ARDA 3KC2A 1FXHA 4MA5A 2VJAA 3TRKA 3L7KA 4JXXA 5DN6D 3CRNA 2CJFA 3QFHA 2W2MA 5CGZA 1PDVA 4H44B 4K2HA 4OEHA 4GUAA 3HZZA 2P9QA 4BKRA 4ZIRB 1VBKA 3DEZA 5AW8A 4RAQA 2EEPA 4HXYA 2A5LA 3LHIA 2ZPAA 1JLKA 4HGZA 3W5AA 2Q49A 4LXYA 2XQKA 4E5NA 3FPHA 1GTG1 2BTUA 4RVOA 1G21B 1ZH6A 4F2WA 1OUMA 2X8LA 4UHBA 2Y77A 3AVOA 4ESVA 5AW6A 3WKDA 2V4DA 1Y5NA 4RTLA 1TZBA 3U7RA 4RO2A 3BERA 2I4NA 1CULC 1PJCA 5ARBA 1I01A 1A8HA 1HDYA 3DT8A 1VGVA 4G8CA 4X54A 1KAOA 4A6EA 3ICCA 2O7VA 5CNKA 4MQFB 4PFQA 4RLQA 3KEMA 4AJJA 3JRWA 3RYFB 1EM8B 1J00A 4ID9A 3VAYA 4W5QA 1TZ2A 2HWYA 1TJYA 1YE8A 2H54A 1UWLA 3NUZA 1A1SA 4HSEA 2ORED 3H13A 4G3XA 1W96A 3AY7A 4H4EA 4IIJB 3L1KA 4MLDA 1JF8A 3UATA 2O4UX 2DN9A 4DDTA 3F49S 1G20A 4C8GA 1NJ5A 1JDZA 3QXGA 3B70A 3SKYA 1TGOA 1Z4LA 2P4SA 4YY3B 2Q46A 3IQGX 4PBTA 3H6HA 4HLUA 1GGMA 1DPFA 1G8HA 3E8GA 1Z5VA 2AFRA 5LOVF 2Y68A 2NO0A 1FS6A 5EBWC 1PUXA 2JIBA 4EQ6A 5IT5A 3X2EA 5AVTA 3THWA 5JPIA 4A7PA 5EHNA 3EBPA 1RPRA 3O4GA 4TLBA 5K20A 2X7RB 4MDFA 2RBKA 4M0FA 2VUSA 1F2TB 2QWRB 4P08A 2VTBB 2VP4A 2OTLF 2CMKA 1VCMA 4J80A 3BD9A 3G2NA 4GX0A 4MDHA 5FUMA 1B76A 3DFKA 1DADA 1Z62A 4R41A 5BR4A 4TLMB 1G8KA 2V6JA 4ZZ2A 3BH7A 4Z0HO 4LQCA 4YXWD 3LCRA 4NCNA 2PZKA 2LXNA 2ZJAA 4PQFA 5KNBD 5B1NA 2X22A 3EDRA 4EHIA 3Q98A 4ZTZB 2EJCA 4DQVA 2YYSA 3U48A 5DGHA 2IUSA 4JLPA 2H2IA 2PL1A 1OWOA 2VSXA 5LBTA 3KJEA 4B71A 1E1CB 3W2IA 5B5SA 5B6JA 2NQ2C 4URUR 3SQWA 2JEUA 3I9LA 4ZZ0A 3LQ1A 4IIGA 5JY1A 1M8KA 3KCNA 4RZQA 1GR0A 4K7JA 3IAXA 3SJAC 5D85A 1JLMA 3T3PB 4BEVA 5REQA 2F8LA 3EQ6A 2QG4A 3CISA 4YJDA 1ZSNA 3GRUA 3FCCA 3TR0A 3D4IA 2FJUA 3G5TA 3AP1A 1N57A 4C87A 4MQ6A 2WHPB 4W7HA 4CKXA 2OHVA 5JTTA 5HX7A 4CM7A 4B6JA 2R2AA 1AKMA 2QSUA 3A6HA 1YDMA 2JB9A 4MIYA 3RSHA 2HSGA 3GMDA 4PLFA 1DMRA 3QXCA 2Q2QA 5H4HA 3Q4HA 1QHXA 2NNLD 2X13A 3JQGA 2JG3A 2CLDX 3CC7F 1SJ9A 1K5SA 4TS4A 1TGVA 1WAMA 3WNVA 1EA7A 4E5UA 2C4WA 1VE9A 4YJGB 5FQNA 3WRYC 2HV8A 3KCQA 2IUUA 2ECPA 3UK0A 3H3JA 3KKMA 4HVTA 3HVJA 3WYBA 3ETCA 3DR5A 2ZFUA 2Z8YM 1OYYA 1WV0A 1TTQB 4DANA 5EFZA 2JGIA 2OXEA 2VF2A 3QU5A 3QVVA 4LCUC 1GUBA 3S7ZA 2EATA 3RSQA 4HEQA 1SO8A 1W42A 1LTQA 3H87A 3RT9A 2OCIA 4TLCA 3GGGA 4PRYA 3JV7A 2EFHB 4C6HA 4JK3A 4IBOA 3A1WA 4GM4A 1WQ4A 3BD8A 3IODA 2AG0A 2EHJA 2VNAA 4YAJA 3K9GA 4NYJQ 4ZVPA 3CCSF 1GFSA 2J67A 4EOGA 1VARA 3GVMA 5H2FZ 4YJ2B 5FV4A 1FU7A 4WT7A 3UOWA 3H4VA 2H85A 4QWWA 1L4KA 4FGLA 3VNVA 3HXPA 4RD4A 4WOCA 4A8JC 4L3VA 5K0EA 5CVDA 2DSTA 3E7XA 3CVWA 2JLXA 3NOVA 2BFNA 2AD5A 1L5ZA 1SEVA 1C0EA 3UAVA 1CQJB 5E7JA 3F0FA 4MW1A 5AM1A 5INTA 3VR0A 1MV5A 1R8JA 4HB2A 1YTFB 1HDJA 1U9ZA 1Y33E 4E4RA 2GWRA 3CX3A 2HQ1A 2CVFA 5KCZA 4P3KA 2AFHB 4DQKA 4DRYA 3E2PA 4PYLA 3GBSA 4RK4A 1EGAA 3I1JA 2WJGA 2QTWB 1NBMG 3N8HA 2HCBA 5H3CA 3T54A 4NAUA 4WH0A 5JJEB 4RVNA 4IXNA 4F97A 4KR3A 1XPOA 4BIIA 2A4MA 1UWVA 1EGQA 1XL6A 1JKXA 3I05A 4CH4A 1LEHA 1IV1A 1U9JA 3E9MA 2Y1XA 1GP2A 3JQAD 3R20A 1CLUA 1OFGA 1LVGA 2QM8A 2YXEA 1SXHA 5ESRA 1XCOA 5E6RA 4AMVA 1HY3A 4QJBA 1YS9A 1H5UA 1AZSC 4NU6A 1GR1A 5FL7D 2QV7A 1LLCA 2CTRA 5THQA 1SUPA 2EBHX 3IO3A 3B7WA 4ND5A 2YWHA 4CT5A 1NE7A 1TYCA 3RC1A 1VI2A 4D74A 5K3EA 1Z0ZA 3Q9NA 2PI5A 4IZ6A 4YH1A 2X8JB 4HNSA 1ABBA 4KREA 2F3RA 3AUXA 1N2XA 4E31A 5JIBA 3LFOA 3DONA 4ISCA 3VHLB 4BAZA 4JP1A 3EIFA 1GZSA 1N3YA 3ORRA 2XE7A 1I7FA 2QL6A 3Q3CA 3IDOA 1FYVA 1UAAA 2DPGA 5C9ZA 3BJIC 4KLRA 1L5VA 5CB4B 1DV2A 1RWVA 5KYKA 2IV2X 3E5HA 5B55A 3C3PA 5HKKD 3KLMX 3RYHA 3U1TA 1JQJC 4QDUA 2AFIE 1BMFD 1OHHA 2O5EA 1A96A 1Y42X 1NWCA 1SBZA 3K9WA 1JPNA 1RFGE 1UZLA 4I0XA 4PZ9A 3N28A 4I1OA 4ZI2A 1Q57A 3C7CB 3GGPA 3PC2A 1JXMA 4HADA 1ECFA 2BAGA 1D2CA 2HD4A 5KYUA 2J5BA 1FRQA 5BP7A 2A67A 2X5XA 1FXKB 5IAJA 1L1QA 2OE2A 1SXJA 2A14A 2BE3A 2CMHA 4KFMA 4D8YA 4DSZA 1P18A 1CVLA 5C8DA 3TVDA 4B7EA 1X87A 1G3QA 3GUYA 1HNWB 1XP5A 1D6MA 2XWJI 1DFIA 2NO6A 3L77A 3VKUA 1JVMA 4RLSA 4HQNA 3CNOA 9LDBA 3M6XA 3KQOA 5D5QA 2YIBD 2J3DA 2DPMA 4OO3A 2O2GA 1H0SA 4H7HA 1GM5A 1UJ5A 4MRMB 1Z5NA 2GZDA 1P2SA 2ZCJA 1OFIA 2R48A 4K1LA 2BZSA 4V2UA 1SWVA 3MQ4A 4PYIA 2CNWD 2VA8A 4E3WA 2ZJ5A 1O6BA 2BYTA 2G9RA 1E20A 2X5NA 1RM3A 5HY4A 1GQYA 4M98A 3FPGA 1MEEA 3GLUA 3LRTA 3RJ9A 5HMLA 4MI9A 4TRJA 3T06B 5JY6A 3TGWA 4D81A 3TQFA 2GMWA 1S5LZ 3DC2A 1Z0DA 3DF7A 2HCFA 3OZSA 1HE8B 1AK9A 2BFEB 3A9VA 4AYTA 1GN6A 1O94A 5FHRA 4D02A 3WWYA 4G5XA 4NNOA 3KYDA 4B3IA 2B8EA 5HCNA 1PQUA 2X3UA 3TR6A 3L7JA 3GRRA 5U9CA 3CPWU 1EFRG 5I8PA 4Q16A 1FIUA 2GWHA 4JI7B 3VUEA 2R8YA 1KH3A 1QG2A 1NV8A 4HDSB 1MEOA 1QDLB 4NABA 5C5CA 4AJ2A 3WNDA 2XCQA 4D41A 2W6NA 1YRWA 5FO1A 4RV4A 2EJUA 1Z5GA 1CN7A 3U61B 3P9NA 1UK6A 3DOEA 1P7YA 1VL0A 4W9NA 3L70H 1K7CA 2C29D 2I2FA 3R5FA 3VYTB 3QLUC 1K5QA 3IE2A 4CCAA 2M7WA 1NF3A 1VRWA 3V1MA 2NUAA 2JFQA 2XV1A 3FTDA 1G7RA 4ZKIA 3JU3A 3VPSA 1SVLA 2WKRA 5WRFA 2ZTLA 2WYUA 3LO5A 4AF7A 1OJ7A 1DNPA 4BV2A 4YN3A 3AETB 2IU3A 2QE7G 1BE1A 1ECJA 2YWCA 4REOA 2CHTA 1X25A 2NM0A 4YROA 3I2GA 2PZEA 3VOUA 1W5SA 1IE3A 2HA2A 3KR0A 5DGXA 1RXVA 4FGUA 1WKBA 1B0ZA 3VO9A 1Q6IA 4K26A 4UNQA 4DEXA 5KOYA 1RWKA 5KOHB 4FB5A 1YZKA 4WK6A 3FHCB 5KKAA 2YMLA 4D9IA 5IVPA 2AN4A 1E1RA 4TL8A 5EMNA 4JI3B 1UPFA 4X93A 3FKSA 4DUPA 2QRKA 3M1LA 1RT9A 5CN0A 5JLJA 4G0ZA 4UM7A 5GW7A 3DOJA 2QZPA 4EYOA 1EWRA 2HX0A 4CFZA 4ZDKA 1MJHA 3REFA 1CR6A 1FQWA 2QN6A 1E6WA 1C4OA 4ENPA 1W52X 4C7XA 3B9PA 1MTZA 1QE0A 3RLIA 2VZ9A 5JD4A 4WFQA 3L9XA 2XCOA 2PQ6A 3C7DB 2IDZA 3ND6A 3QA3E 3W4JA 4FWBA 5KPDA 1DUVG 3V9AA 4FZ5A 4GPD1 2XHBA 4DA0A 2AYZA 1JKJB 3NBZC 4J9ZB 1GGJA 3L84A 4J49A 5K8UA 1Z5ZA 2BGWA 1W0JG 1CUWA 2PLFA 1P77A 4LFBO 2DM6A 1TVEA 4A2QA 1HWYA 1IB6A 1P4SA 1Y1LA 3AF0A 1LV8A 1G1XB 4Z51A 1DT3A 3CIOA 2FQ1A 2ADMA 1X9HA 4K1XA 1LH0A 2PU5A 4MTOA 1DJLA 3FH0A 1X92A 1YA4A 1KD1W 3DVLA 3E9NA 3LC0A 4GGMX 1G19A 4BNKA 2XQVA 2QVYX 4AS2A 5IM5A 3DC6A 4EO9A 5AKYA 3LXRA 5DM0A 2PLRA 1ZJ4A 1KWGA 4ZHVA 1XA3A 4L8YA 4Y2YA 1FFXA 2OZLB 2HU5A 3RBXA 1Z4IA 1FYXA 3M6LA 4IWYA 1QGYA 2V7XA 4L1KA 3UPTA 4F3YA 1M6NA 4JYYA 1SRQA 2H92A 1V9LA 3VQTA 2IL1A 4I4NA 1ECBA 1V48A 1OCOB 1XG5A 2IF0A 1N5OX 5A5EA 4GMFA 1EUDB 4X88A 4EGCB 1SZDA 2DFKB 3F5MA 2WP0A 1K3FA 1TJ3A 2W2TA 1KEEA 4EX7A 3I5UA 3R8FA 2IU0A 4PG5A 1IK4A 4QNHB 1M34E 1P7WA 4JHXA 4R9RA 3GXOA 1Z2OX 1ZZEA 3PFBA 4Y2QA 4TX1A 2AC4A 2D62A 2MYUA 1I3MA 3QH4A 1OLUB 4WCVA 821PA 4NTYA 2O5RA 4Y7CA 4KR7A 3EPRA 1ZI6A 3WJ1A 3ED5A 4IVRA 1Q5OA 4X64O 1S9DA 3ANLA 3FJYA 1MQAA 3ESZA 4H1TA 1EZVH 4ARUA 4H3HB 2JI7A 3RS8A 1D1QA 3C1OA 3RJTA 3TDNA 3RW0A 3FB8C 4O4LF 5EIWA 2YWGA 1Y74B 1BE6A 3USES 2IEIA 4D26A 4FFWA 4MVXA 3SDSA 4QE9A 2FEMA 2X76A 3THYA 3OX4A 3D9QX 1CZOA 1PDWA 1IRIA 2ANCA 3HFGA 4C30A 4CC6A 1NH2D 5KDLA 1NT2A 3E83A 4JU8A 1CERA 1FSPA 2FMTA 1Z0AA 3JQEA 1U4NA 2FJPA 5DX1A 5ARCA 2RHBA 3DUWA 3GFPA 4QC2A 1POWA 5KA6A 1NJ6A 1T4MA 4WFIA 5J4HA 3R7LA 4QOEA 3ZGXA 4B8WA 3QOYA 2PUEA 4EA6A 3THOA 1GRVA 2P2NA 1EB8A 3D3QA 3KL4A 1QBKC 1Q95A 2G9IA 3PSAA 2ZR2A 1I0ZA 2AG5A 4RK7A 3BMOA 4RVGA 2OCHA 3K57A 4Y6PA 4P4GA 2KGWA 3FB7C 3OP4A 1Y48E 4Y2RA 4AHCA 3B36A 1A2BA 4AB1A 3S03A 4D9HA 1M0WA 3SJBA 2EBWA 2YS6A 3EXHC 5A3SA 1Y4AE 1WA8B 4Z1OA 3L2OB 2K6GA 2AUTA 1E6LA 4FDMA 3H0EA 1KHHA 3JPWA 4LY6A 2L6LA 3JQBA 4Z2YA 2QL9A 3W6PA 2A35A 4JQZA 5CFRA 4QNMA 2VDWA 3AG7A 5GONA 2LZ0A 3GHHA 4QXAA 1RI3A 1YMUA 1RM5A 2QYHA 1H6CA 5CBPB 3ZO8A 4PAQA 3SLKA 4TKVB 4G63A 1N0IA 4KU4A 1V6AA 1WDKA 1GUZA 4JI2O 1PNTA 2QMUA 4PGMA 3OM0A 1E0JA 5HZHA 3A31A 1VLQA 3DHEA 4EGSA 4HDQB 2ZI6A 4ENRA 3TGUH 4O08A 3V1NA 4FZJA 2IOHA 4EBFA 1RA4A 5IXYA 2WAXA 2YNMA 2I03A 5AM2A 2AKYA 4DUZB 3HKEB 5ICCA 4XWKA 4C7JA 1T8YA 2AZDA 4NJEA 1BCSB 3CCRV 2GSDA 5B1AB 1Q15A 3KE1A 2QJRA 2YWEA 1DK1A 3EEBA 1ST3A 3ROQA 3QVTA 4F8YA 3FHLA 1SQGA 1W46A 5K7SA 1K86A 1Q0ZA 2VWHA 4AJEA 3M9LA 3QUCA 3RC3A 2B0CA 4COOA 1IFXA 10MHA 1JDSA 1R6DA 5BXZA 4ROTA 5FQOA 2PZLA 2J45A 5DBIA 3BF7A 4CLRA 1BE0A 1LS1A 4JGSA 1TAQA 3T2MA 3ZWOA 3CLKA 2XPCA 3I56V 2GZLA 1T5DX 3ELBA 2AQHA 2GBLA 1KXJA 3MB5A 5IKEA 2YIVX 3HU5A 2EG5A 2N47A 2O5VA 1KJQA 2LBXA 4LBVA 4D3DA 4GGPA 1AUPA 3FWZA 1B6GA 3PXGA 4I8IA 3JALA 4WZAA 4M1OA 1E5QA 2DQYA 3D6NB 4UEKA 1CEYA 1AB6A 3T38A 2NTEA 4BVLA 1ZBDA 2H9IA 3UOAB 3U4CA 5M2QA 3UT5A 4KQ1A 2A1TS 4Q1EA 1RP1A 2ZTMA 2OHXA 1SQPH 5K8IA 3S2GA 3URKA 2D0PB 2P4KA 2O7RA 2VT6A 4RVFA 3WLPA 4U5QA 3NHPA 1GH6A 1YBAA 3BXZA 3ZHYA 3C6MA 1SH7A 2V6FA 4KO2S 1CUFA 2RI0A 4CLOB 2E6KA 1MAWA 1EVYA 3M49A 3JQ8B 1GSOA 4H37A 5FLEX 1BQ4A 1G6HA 1G5RA 2YMPA 3KYJB 1CY7A 1ADBA 1KQFA 3FSGD 5J4YA 3MFQA 1QIJA 2H57A 4C78A 2J4FA 1JJAA 2VQEB 2X0KA 2C8LA 3OUUA 4RA6A 2R1UA 4B4OA 3IA2A 3WK9A 1GKIA 3O47A 1BHO1 2GRUA 3CMAF 3HGTA 2OFFA 1J7HA 2VQDA 3H9BA 3QNEA 4UDXX 1NF9A 2ZT5A 3VZSA 1YF2A 3IP8A 5AW1A 2YR0A 3CLHA 5TQ0A 1UBEA 1M2HA 1ZR2A 4Y2GA 3TTUA 1P6UA 4FKMA 4IHJA 3DT9A 4I4LA 1X7YA 1NP7A 3KTFA 5HDQA 2XHEA 3FHOA 1RKQA 3K0BA 5IWAB 2QT9A 3PHLA 5LUAA 3BAFA 4Q3KA 3ICVA 1FNMA 1V11A 3T6KA 1ZJWA 2B83A 2JZNA 4TVBA 2W6PA 3U13A 1H85A 5IUNC 3ROGA 3UHPA 4OQEA 3RO7A 1YQ9A 3P9ZA 2NTYC 3IPXA 2KMLA 4IDDA 4FGJA 4QDKA 4L08A 4MKHA 4PHTA 3OX3A 4MCAA 3HBLA 2VP0A 4NULA 3FJ1A 3C8ZA 5T3UA 2I6UA 3G82C 3DD5A 1NDUA 1I80A 4WLNA 3ZMTA 3EA5A 3P9CA 1MOFA 3K0CA 3RRXA 5A4DA 5EYPA 3TNLA 3QRWA 1IRXA 3ZS8C 1Z7GA 2JK1A 4B3HA 1KA9H 2PS3A 2QNBA 1C3VA 4CNBA 3QLTA 5DKFA 3UXMA 5JJCA 4QU5A 1W5BA 3OD4A 4LDNA 3LIIA 2V7PA 1RJEA 5EZ5A 3QVNA 2B37A 5J59A 2HBRA 1HW7A 4GP6A 2QUHA 3MLEA 3G71F 3GJ6A 5A05A 2WF6A 5TSDA 1W35A 2RGEA 1FMJA 3K30A 3L6CA 2CNKA 1DRJA 1I08A 3CY6A 3E3NA 1SCAA 1GVNB 4J0EA 3OTWA 3GEGA 3UCEA 5BWBA 3I6IA 4BKMA 4MB2A 4ZA2A 1T3SA 2AMFA 1JJVA 3O5AA 4U4AA 1NXSA 5ALFA 1P4RA 2FQYA 2GCIA 1THTA 2WKWA 3LM8A 1U2GA 3R9KA 3GRCA 2XAUA 1VFNA 1MVOA 1RQLA 3I45A 1B23P 3TAUA 5AW3A 4WRRA 4L2IA 1QLJA 4OMDA 3GLFE 2QF7A 5FWDA 1XDGA 2DR2A 3T0IA 1D2MA 1OZHA 1S3GA 2YQZA 1V4VA 4QXRA 4BB0A 4RACA 2JF0A 4IDNA 4UPVA 5C8VA 1YZUA 1I1OA 1X1CA 3H1BA 5K4HA 4MPPA 2FWJA 3HA2A 1KTVA 2O0HA 4ANFA 2ZWOA 1J09A 4RADA 3CSXA 4PYOA 1CLEA 4UEQA 1JE1A 4P7FA 3TTTA 3A32A 4HQRA 3ZU5A 4RIFA 2PEZA 4ZYLA 2PJZA 1KJYA 7MDHA 1UOQA 3WGGA 5FFFA 3DXRA 4IZIA 5DTQA 4BLUA 5B7GA 4YCNA 3ZOPA 1XZAA 3K0SA 5BSHA 4EB6A 1FSFA 5AUNB 3MTEA 3S44A 3PFCA 1Z3IX 1QZTA 1V8OA 2OCBA 1P9RA 4LVOA 2O8CB 1E3SA 4LMBA 1IPEA 1HDXA 3GAFA 3WO0A 4X90A 2ZPTX 3BWXA 1QMGA 4QEDA 3GRPA 3IDSA 3I73A 2GT1A 3PXDA 1SG6A 4DNFA 2AG6A 3OTOB 3CFYA 3PNKA 4R2KA 1L9KA 4HAYA 3WDMA 1ONOA 1ZH8A 1TT5B 3CSDA 1CUAA 4DHWA 4F1JA 4NVRA 3TBKA 2WWYA 3Q85A 4RTPA 2QOEA 4E6PA 1ZX1A 2E6UX 3P0FA 1QF6A 5F5NA 1UJNA 2DX7A 2ZWPA 5JNTA 3RVLA 4J03A 5ENDA 3T7SA 3R3YA 4B48A 3DAPA 3FN4A 1UXHA 3QMPA 4U5XA 5JCJA 4FCCA 3GROA 2YWJA 1ZZGA 1MHTA 1EFPA 1VCNA 1AJPA 2Q6OA 2PCJA 4KV9A 1Q83A 2C07A 3QPBA 4QD3A 3LT1A 2YN0A 2R86A 1Q6UA 3WJQA 1P74A 3EQ2A 3HDQA 1USIA 4KUHA 4BBAA 5JDCC 3N3AC 4I1RA 2R8ZA 2DFVA 1NFRA 1GPNA 1WL8A 3HCWA 4LJKA 4B74A 1BWSA 4NR1A 4Y9RA 4ZYZA 3CPWF 1PQWA 1VZ3A 1UMBA 3ZJUA 4F9EA 2OVBA 1HE5A 4AO8A 1KYIA 4J43A 2O48X 3HM2A 5ECWA 4KQEA 1WP9A 2NUBA 3SG0A 3BA1A 3GHZA 5EGNA 4MV3A 3GZNA 1TO1E 3DBLA 1WM1A 4DQDA 1DI0A 1JFSA 3MILA 3R3XA 3HQ4O 3SIWA 1KDRA 4GLJA 1KL7A 4G0UA 5I7VA 1QFJA 3VC7A 4QT4A 3H9CA 1W88A 3EFOA 3ZY2A 3LPNA 1JG3A 4MKZA 3WI7A 1GM9A 4X7PA 3S8EA 4EKNB 3DWEX 2YMQA 4ABTA 3EGDB 1SZXA 2DHCA 3B77A 5JI2E 4OU4A 5K0LA 3LK7A 4M7OA 2JJMA 4KLNA 4KKVA 2ZCUA 1FFHA 1J2TA 1X4TA 3LX6A 3QPCA 2Y1CA 3QYFA 1NT4A 1W0CA 2HJDA 3BXEA 3TPFA 4C05A 3MWEA 1ULBA 4J9VA 2CNDA 5FUBA 3R4VA 2LFSA 4TQAA 1FLNA 3UQ8A 2ITCC 5ICFA 1XU7A 4DW0A 3ZIDA 4JELA 5FA8A 4NOMA 1Q86H 1YBFA 1P4HA 2I8CA 3HABA 5IJ0A 4TTSA 3RK0A 4AF6A 4W5TA 4TMYA 3RYIA 2VLBA 1BHSA 1WLYA 2Q1YA 2FSFA 3A70A 1U0RA 2I3DA 1SIOA 5BN5B 2IHNA 3IAAA 3PLRA 3WBKA 3TGPA 2B4TO 4GI3A 4R01A 3D8TA 5EBMC 2ERYA 1XV2A 3NLLA 3EGXB 3G3EA 4B40A 1K8ZB 1T2NA 1XZLA 2WTEA 5JAIA 1YITF 1UH5A 2CHEA 3EZLA 4LWZA 4Q0MA 3K9CA 2I80A 2FB9A 1F0YA 1KDPA 4UCRA 2R6HA 2O8BA 1WU8A 1QQCA 2WU8A 4R8KA 4DJAA 2BJWA 2N3ZA 3GFSA 4QSMA 2WU1A 4IYIA 3LO8A 1E3JA 1EDZA 4LCBA 2JDIG 1CEZA 1QS0B 1HKUA 4UE2A 3CRMA 1IMJA 1ZJ5A 2BEVA 5F51A 1L5NA 1SCDA 4NZPA 1CHDA 1Z0SA 2W0FC 1UEXC 2GN8A 5B57C 3RUDA 3SC2B 4JA0A 1JHUA 4I5DA 1T2FA 3PXCX 2AXTZ 2IVZA 1S8AA 4JZYA 3WMEA 4WGGA 1P0FA 5IYDO 2FRVA 4Y6SA 1LDBA 2HWUA 1Z0FA 2KB1A 2J3HA 2JFOA 2PJDA 1BOFA 5IBQA 2IHVA 3ZJTA 2EJ7A 4A5SA 4Q1VA 3BH6A 3ZCXA 2PPLA 1HMYA 4RBNA 1RXCA 1BN6A 1M8FA 5IJAA 4B3GA 1G1MA 2FOIA 1XN1A 2F1OA 3ZIAD 3MERA 4IKOA 3N6VA 2ZR7A 2C4HA 2V7VA 4CKBB 5CD1A 5IKMA 2VNSA 2UUBO 2D13A 3O1IC 4XGIA 5D01A 3JCZA 1T2EA 2ZIFA 5IKPA 4R2IA 4AXXA 3ANTA 3V1YA 4H27A 2G4CA 2A33A 2O20A 4CV3A 4PANA 4DADA 3M3PA 3LL7A 4ZJUA 4V0ME 2Z04A 4BS9A 4XUCA 5HY0A 3FOEC 5EQJB 2L2QA 1KVUA 5JJKA 1KEVA 3SK0A 1T9GR 3ABOB 1FUKA 1Z7EA 3LY9A 1V35A 2Y76A 3BOSA 1DBIA 2XMDA 1EVJA 3RC2A 1I1NA 4S35A 3IQWA 3PEFA 3DDOA 4CH5A 1XHLA 2ZJBA 1T9HA 4NYKA 2ZT8A 3GPDG 1NTMH 2BJVA 2P65A 3LDGA 4JITA 4KH1A 1BOOA 1QAHA 1CJCA 4JOSA 2DTEA 2YC2C 3QLVA 4JEMA 1K6JA 2NT4A 2YI8A 3OFVA 3F8TA 4O4IA 4YJKA 4HNGA 1SD5A 1LK7A 1Z4QA 3EPJA 2BFBA 4OA8A 3ZRSA 2R8PA 3I9V1 2XNDA 4NBKA 2C2XA 2QENA 1MX5A 2C2ZA 2O6LA 4YFYA 1L8DA 3DNFA 3RVRA 1C1DB 3TECE 1XLTA 4MQEA 3CNNA 1EB9A 3CNHA 3TGLA 4EG4A 2EILC 1T1GA 4WXPA 4YXFA 2EQ5A 4GKKB 2RBGA 4PC6A 1P9LA 5C35A 3TW6A 1FX0B 4UUMA 1AR5A 1CUDA 1NVAA 3WGZA 3NK6A 2M32A 4K87A 3PN1A 4BFVA 3WQSB 4R54A 1BKDR 1BRMA 4L78A 3ML1A 4CL2A 3KOYA 2ZM6O 4TZZA 1EU1A 4TXNA 2CGNA 3FVRA 3U9SA 4L8FA 4OKSA 3EEQA 3NT2A 1DG9A 5LYJA 2WBLC 1I30A 2H0QA 4BT2A 1A5TA 3OZDA 2PX8A 5KU7A 3UK6A 2CL0X 3AF5A 2JGRA 2PR7A 3KDAA 4EI8A 3JVHA 4MGEA 4CDNA 2OT3B 1DCKA 1MTOA 2W6MA 1GPYA 2I8LA 3QEBZ 1TD9A 4DSUA 3NHRA 4R9SA 3O95A 1O08A 1PG0A 2ORVA 2VJMB 3E3AA 1HG0A 3WIDA 2PSFA 2WPDD 3GAZA 3G2KA 4NV1A 4G4YA 4AMYA 4P80A 2EZ8A 5GINC 3IJEB 1OWMA 4NNJA 3J7AC 4P3NA 1QVFU 1OF1A 5I3CA 2YUIA 4AD8A 2Z0MA 3NALA 4JLNA 2P41A 4YCDA 2CJXA 4PBRA 2P1DA 3I3SR 4AC9A 3FYUA 1NI5A 1SQXH 3VTZA 3STWA 3UG6A 2BHTA 5H6RA 3GDGA 2H51A 3U3OA 1IXMA 2VK8A 1S2DA 1H8HG 1KY4A 1WXXA 1JNYA 2NQ8A 5E9AA 4D1YA 4RHCA 1JALA 3IR9A 4B34A 3F73A 2WT9A 4PDRA 3UCSC 3P4XA 3DE4X 3PGVA 4AG3A 2R00A 1HQDA 4NZZA 3TL3A 5IASA 1KP2A 4MV5A 2X8BA 2MR5A 5LZ8A 1EKXA 2OG2A 3BWBA 4KMSA 3G0HA 3VPFA 3VZCA 3MCQA 5A02A 3UGJA 2BC9A 3DDZX 3BJEA 1EWYA 1A9OA 3R6GA 1IXKA 3SSAA 3T12A 2O0KA 1NMQA 4QE7A 1OGYA 5HF5A 2HT1A 2Z5LA 4R2LA 4A8TA 3BFKA 2F1KA 4RSRA 1E0AA 2JW5A 1HI9A 3FUVA 5IS2A 3ZDRA 4NK4A 5DW3A 3UJ7A 1Z68A 4RF5A 3NRBA 2BBTA 3BIOA 3AJEA 4FLZA 1IULA 4TLDA 1F8GA 1RABA 2AXEA 2N0SA 3NWPA 3B4SA 3M4SA 4PZPA 3LVBA 1PT6A 1WQ1R 2FUKA 4RDXA 5GAJA 4G4WA 1HLGA 3LP6A 3OAAA 2ATKC 4X60A 3P5BA 2YYYA 1Z18A 3F1LA 1Y3FE 2VATA 2CV2A 1H5NA 3G1WA 4CF5A 1U2DA 3HP4A 2GAOA 2ROQA 4A10A 2BDEA 1LNSA 3F5TA 1SKQA 2VHJA 4M86A 4UHJA 4RY0A 3OEEA 4EJSA 3U3ZA 1E9BA 5KYGA 1NULA 3OFNA 3RRZA 1AKRA 3MZ0A 3OKFA 4ZQBA 1KOFA 3KIPA 1HT2E 5JEEA 4EB8A 4XVRA 3T7AA 4AJPA 3K9LA 1AI7A 2V7QG 2W8BB 1XTSA 3NAMA 3EQ7A 5LWHA 4PXSA 4LDAA 2YCBA 5IMBA 1SERA 2JIMA 3OQMA 3JWHA 4W1QA 3C97A 3MHTA 2JVIA 4M0LA 3D8BA 2Z8YA 4HAIA 2JGNA 3QO5A 3BRWA 1ISMA 1NI8A 2H8CA 1DEHA 2YY6A 3N53A 4XB1A 3EZXA 3FRHA 3ID6C 4LOLA 1C5KA 4IZOA 3WC4A 4PA7A 1DRWA 3PU6A 2TSYB 4MW5A 1FJ2A 3RH0A 1X6VA 4DZZA 3V34A 1II8B 3MTDA 2CBZA 5AOVA 4H1UA 1XREA 4YGYA 1KKUA 4RW0A 4ZYYA 2HEIA 4M0UA 1RKUA 5CB6A 4IGEA 2P6JA 5CFLA 1Z2GA 4G0OA 4ZU3A 4BVGA 5CMLA 1I6MA 2VL7A 4QIWF 4DJTA 5IYZF 2FR8A 1ESEA 1AX9A 2JARA 3IKVA 2IEAA 1TRKA 2RKOA 5E1OA 3IQHX 3QTCA 2XZTA 2JFWA 2GV9A 4D9MA 1D1TA 3M3HA 3EIEA 4NOKA 4FHCA 3ULKA 2MYPA 2ZWMA 4IQGA 3WNCA 1ML4A 5KUMA 4UB6Z 2DYYA 3N7TA 3PC8A 3QPVA 1BJRE 3KLPX 1ZK4A 4UVAA 3FNRA 4JLAA 4ZVSA 5HM8A 1E1QA 2J9FA 2Y9PB 2B1QA 2QN1A 2FGKA 5TNXA 4CMAA 5FV7A 2XBLA 5D2CA 5EIFA 3G8AA 5JNRA 5KAMA 4QG3A 2WZBA 2YYAA 1ISFA 4DZTA 3BE5A 2XUOA 3G7SA 3PDIB 1DLJA 5LQNA 3HYNA 1BVUA 1SVOA 2JLVA 3MJDA 2GNOA 3SQXA 3AFIA 2JAOA 3VTAA 1UKBA 3MAGA 1ZIOA 4C08A 4NY1A 4FFRA 3BXFA 4KX3A 1EN6A 4FVMA 1MC1A 4RPLA 2C2AA 1OFTA 2E7ZA 5GTDA 4H7KA 1XL1A 4Z1VA 2QWOB 4D8VA 4XBFA 2EIKC 2AR9A 1T9KA 3K06A 5DTMA 3CP1A 4ZC8A 3DAFA 3RSZA 3ABTA 4J10A 5JJLA 1KY3A 1J95A 1W30A 2RGAA 5L7TA 4OFXA 1JSRA 3C3TA 2WKQA 3C6BA 3CS3A 4RHFA 3D2LA 4F56A 4A27A 3GEIA 3VQYA 4PDMA 2WSSD 3PRYA 5HQ3B 5AVJA 1UMCA 2REQA 1R1BA 1GV0A 2JCBA 3T4XA 3OJCA 3NEAA 1E2NA 3M4YA 1HMPA 1QGUB 1ORWA 3MJEA 2QQGA 2YW2A 1H8ED 4JP2A 3EVEA 1A69A 2DUWA 4Y1GA 3AM3A 1GUFA 1Z6QA 4F2GA 1XHXA 2PRKA 1K5DA 1RAIA 1VJDA 4JBHA 1G60A 4HZIA 2GJ8A 2V9YA 3KKNA 4BTEA 4XQ0A 2ZRAA 1MRSA 5T4HA 2I6FA 1ZU5A 2NT3A 2OMKA 5M3BA 5D3MB 3BE8A 2Q9AA 3AB7A 3GI1A 4HNHA 2BW0A 4YGXB 4U02A 2P4HX 3WG9A 4F4CA 4D3SA 3HEAA 3KJXA 4G4IA 1T4BA 4UBJA 1WDWB 1J5XA 2WVGA 4KR9A 1JYFA 3Q3VA 2Y69B 2UUPA 3QU9A 1MPTA 3F6MA 4KAXA 3FF4A 2HHAA 3KSRA 4KQHA 4GPEA 3GFTA 3DBHA 1ZVVA 2II6A 5IARA 3D0QA 3EG5A 2Y4NA 3MIIA 3AVXA 4RM2A 3B1KA 3MD9A 3N7AA 4WGFA 1Z7BA 2JS7A 4DW8A 2DLNA 2IXBA 2Q0OC 4G4GA 2C92A 3PQ3A 3GWZA 4LF9O 3TH5A 2X0LA 1JLHA 3WHPA 3VI3B 5KZMB 4MKGA 3MDOA 3U3MA 1MB0A 2A0FA 3RA5A 1ZGJA 4L4XA 3NWJA 3PNMA 4KLZA 2RDCA 2EKQA 3I64A 3A1UA 4JBGA 3P8ZA 5AH0A 4TTAA 4F9FA 1KYVA 4P4LA 4KXVA 5EESA 1HYGA 5AW7A 3R5TA 3DMYA 2EKPA 2HBYA 1GYQA 1KDOA 2JLBA 3USZA 3FWYA 4DV5O 2JGDA 1P0MA 3CVJA 2R65A 4JUBA 4M49A 1MOQA 2V58A 4HMQA 1N25A 3TJRA 2QR3A 1VYVA 1XPRA 1W40A 1G2PA 2ISSD 4BQOA 3EUFA 5L6MB 1Z5OA 1VBFA 3REOA 3LYLA 1QGZA 4P4NA 3SE7A 4WKBA 3STUA 2NGRA 3ZV3A 2YS7A 1W5TA 1BMQA 1CJVC 1HNZB 2P3OA 3I3FA 4GZMA 1G21E 2OENG 2WD9A 5AK3A 3C6QA 3M99B 3IJRA 4KVAA 1Z28A 2EP7A 1GZUA 2FW6A 4BVKA 2YDEA 5DDIP 4BMNA 5EZQA 2X3FA 4EFMA 2ATCA 4D4LA 3RSSA 1QIMA 3JQ7A 3EY4A 2D5IA 4LHSA 2IP4A 1JPXA 4IG4A 3FB4A 1O0SA 3HB0A 4WL0A 5L4LA 4R84A 3LUCA 4YRRA 3SKVA 1A71A 3IPLA 3HXKA 1USGA 1V9SA 3IKFA 2VN8A 5LQCA 4JAVA 1P1KA 1R7RA 4PSAA 3ZIUA 4M46A 3SQMA 3W5SA 4B7KA 3DZJA 3K5WA 1YDGA 4YLEA 3OVMA 1RTTA 4OJYA 1XUOA 1NW4A 2WTMA 2V0GA 1LFAA 4MWTA 1SVKA 1XZEA 3T9CA 1UOPA 4CKCB 5EZYF 3VR4D 1BDIA 3AEUA 2ATXA 4ZKEA 3T9BA 2GUGA 1JU9A 4AKSA 3V4RA 4J29A 1PNVA 2ZRKA 5I9LA 1AF4A 4PPFA 1M2OA 1ZIPA 3TDKA 3ORQA 4BO0A 4G09A 5KC8A 3C24A 1ODIA 3E35A 2YL2A 3OLZA 3UK1A 2GFHA 4ZHQA 2VWQA 3GLGA 3TM4A 1U0NA 2F9LA 4BB6A 5ECYA 1HR0O 4UD6A 3GFBA 3V7UA 4XUGB 3IUQA 1ZK3A 1XMXA 5H3LA 3EODA 1F2DA 3DE1X 3J7AU 4EMTA 1FB5A 3N75A 1OCRB 1GNTA 3HBJA 4US2R 3PQ7A 3RRYA 5B4UA 4RZXA 1HFWA 5ALSA 1Y8QA 2ODWA 2IBSA 2VWGA 1OD6A 3EXG1 3Q4GA 3GJ7A 3S2SA 1HG1A 4L0CA 4M7RA 1NVDA 3FPAA 2NWQA 4R9UC 4WAUA 1P1CA 4PG4A 4AILC 1QQ6A 1KF0A 1PFGA 5CYFA 2V98A 3L8GA 3CV3A 1OW3B 3W2TA 3QFFA 5TS3A 1YIJF 1CR2A 4XASA 4KDRA 3SDLA 2QD4A 4XARA 2DU8A 1SUIA 1XMOO 1BQ0A 3KZNA 4XQEA 4DEVA 4M89A 3GC6A 1LWNA 1E79G 4GYYA 4RF2A 2ZI4A 2N46A 1QIGA 5J47A 4DRXB 1KKMA 3LLCA 7ABPA 3NTQA 3R9XA 1YHNA 3NHZA 4QLOA 2HCJB 1RHUA 1IY8A 5B1YA 5C7LO 4F06A 3PBKA 1B8UA 4HDRA 1E3IA 2IYXA 1ATIA 2OAGA 4Q3BA 1VE1A 4XFKA 4A2WA 1PYOA 3QVXA 3DMPA 2XZLA 3RRBA 3WLQA 1G8AA 2HVYD 1VJRA 1VYUA 1O8BA 5EK0A 1U0GA 4ZVRA 3ESJA 1N6KA 3NVKI 1L1RA 2JJ2A 5B1SA 5CX1B 3SPIA 3ZP7A 4HZUA 2VPXA 4TTIA 4YAGA 1YL7A 1VMAA 1VQNF 3FVWA 3PLNA 2W2KA 3ZE0B 1RYBA 3Q6MA 1W5EA 3N7UA 2X5KO 4FIZA 3PUVA 3U17A 2OCCC 5A5FA 2AJLI 1PI3A 2D2EA 3MWDB 4BHTA 3SXUA 2DPYA 4CEJB 3ETNA 2D8MA 1NBWB 2OGSA 2ONKA 2LDXA 4HKTA 3NVKE 1GAJA 1ISPA 2CMGA 3LW7A 1E9AA 1EFLA 3F74A 4BIOA 3NR2A 5C8YA 3EASA 5AVYA 2FEWB 5FLXM 1L5YA 5EA2A 4CM8B 2PL5A 1U0BB 5CYOA 2OQ2A 5L3GA 1ACLA 4D0SA 1RI5A 1R0BA 1ROPA 2N1BA 1FMCA 1OGJA 2QJWA 2QRPA 4B81A 4EKYA 2ZCVA 3JWPA 2R7AA 6CHYA 3M6WA 1YE3A 4ND3A 1LBIA 1HV8A 1UKZA 4QNNA 3I6BA 4S1NA 4F6RA 3D64A 3AFOA 3PHGA 5GZ1A 2EIXA 1MIOB 4B1FA 3W7AA 4CC5A 5BUCA 2AFHE 3MTJA 3VYSB 5HNKA 3O93A 5F2EA 1EQ2A 2H5EA 5CLHA 2VDKB 5IP5A 5KTPA 4AQDA 2RFLA 3QZUA 4PN7A 4K3VA 1H1DA 3CUYA 5BOSA 2E5LB 2B25A 4M1YA 5IM4F 5JMOA 3G7NA 1E99A 4WESB 2YZNA 4Z3OA 1ISJA 1FXWA 3K9QO 5IVIA 5EQDA 2OFWA 1P4GA 3EMBA 2Z2ZA 1HURA 4E46A 1UK7A 3JSLA 3CUSA 1EXNA 3LCUA 1UBLS 3BMNA 4KWCA 3JVEA 5IRCD 1JQAA 1P2TA 4ZCIA 1F6WA 2QI2A 5LP6F 3BABA 1N8RH 3HP1A 2A0WA 3W9YA 4XX0A 4QODA 2KG4A 2PV7A 1NATA 3CG4A 2XH8A 5T67A 2ZAYA 5KNBH 4RY2A 2JFPA 5H80A 4L87A 1SQVH 2WALA 1K9VF 5EP1A 3EXAA 4G36A 4KOAA 3DE3X 4WXMA 4E2YA 4I1IA 1RXEA 4KRFA 3W78A 2VNIA 4F96A 2UYGA 1P31A 1N2IA 5ALMA 1ULHA 4HRAA 4P3XA 4G5SA 1NZDA 1QWSA 1ZGHA 2IEYA 2LIVA 1QLNA 3PC6A 3UWSA 1M1KW 1Z4OA 2ZBQA 4QLAA 3OECA 3IV7A 2UZ1A 4IEEA 1QVFF 1OFHA 3KUXA 1WZEA 4WOKA 2HA3A 4DMUB 2AE1A 4V3BA 3WX0A 3DFIA 4ZGBA 5JH7B 1RYNA 1HM5A 5AJTA 4LZJA 4HDMA 3DTUB 4YI3A 2JS3A 4JDUA 2G77B 4MUNA 2CEAA 2NZ8A 4LBYA 2HW8A 4DWJA 4CHGA 2CH7A 1GJRA 2XCTB 1FDUA 5EE5B 4Q6WA 1SWWA 1ZISA 4AAYA 4NDNE 1E0SA 2PMEA 4QDTA 1PJZA 2WG1A 4XH9B 4F4IA 3KOXA 2CEKA 4E51A 1MPXA 3OT5A 4AKHA 5AHRA 1V7QA 4UHHA 5FJJA 2NLJC 4RFSA 2PYLA 2J30A 1L4YA 4FR2A 3QV1A 1IOZA 4FN5A 5CT4A 3IP3A 1A4XA 1E8DA 3DYVA 5HIMA 2Q3JA 4BFUA 4I3FA 1H3FA 2FVXA 2FFJA 1M9NA 2OXFA 2KS6A 2VZLA 2A0LA 3ZCTA 4EJ2A 3KEQA 4H0NA 2QWXA 3DXFA 3GJSA 1TVCA 1K27A 1Y6FA 1VBNA 4KW7A 2MQEA 2C0CA 1OVMA 3KU4A 3IL2A 3N0VA 4MZDA 3BCSA 3EYWA 2Z57A 1MJFA 1WULS 1YI2F 1TO2E 3BQ9A 1ZL2A 3MUFA 4JBIA 4RKWA 2C42A 1VFPA 1J9EA 5PNTA 4NPHA 1WB7A 4RQEA 5CG2A 3KQLA 1O0CA 1XRRA 4IEIA 5H5JA 3E03A 5KYNA 1B93A 1PD1A 3P2IA 1W34A 1DV1A 4UV8A 1NXTA 4N23A 1MT0A 3SJCA 3G2HA 3ZGZA 1N2CB 1H2WA 4TT3A 3STXA 3CCJV 2ZSUA 4BZZA 5FXMA 4FW8A 1CF4A 3WDKA 5C5IA 3M1YA 1NQ5A 3N86A 4QATA 2AUMA 3B82A 5GVSA 5CDYA 1VE7A 1Y9EA 1UFQA 1S5HC 1DJOA 3IIKA 3JYLA 1NU6A 4DKXA 2WV7A 3UF0A 4EHFA 3GQVA 2C0QA 3OH8A 2AOVA 2GX6A 4CJXA 1GTL1 2EWCA 3MTBA 3TQQA 3EFEA 1HDZA 2GPSA 2CC2A 4G4SP 3I9KA 3UBMA 4J0GA 3GMSA 1VIVA 4TTQA 4IIHA 3AIMA 1UWKA 1WXHA 3H5TA 4L5IA 1ZSVA 1PJRA 4G27B 2QRQA 1Q0TA 3SICE 4ZI7F 3OEYA 2I4TA 2WZQA 1U3WA 1QTIA 2WFAA 4J0HA 2R4UA 1XB2A 4N7RA 4A5OA 5BQFA 3Q2KA 4C2TA 3QIVA 1CZRA 3JYPA 3OT1B 3LXMA 2F59A 4QDZA 1DIRA 3I8XA 4R40A 4XLTA 5KTRA 1KVRA 1T36B 2J0UA 3FLMA 4YWHA 4CGYA 3AOEA 1KFKB 5LMNB 3TD4A 4UQPA 4TZKA 3I4CA 3T5CA 1XWFA 4NWIA 3VDMA 4B3SB 2ZXEA 5TQ2A 3DVAA 2P67A 3P2OA 1CR4A 4I5SA 3DXXA 3U3DA 4FHZA 3HCFA 4PNZA 4Q3CA 5KNLA 2ADFA 2F3QA 3C9UA 1VPVA 3BDIA 1NQXA 4PI2A 3GJYA 4RTNA 1Z6PA 3OMNB 4NKGB 1X0VA 3G67A 3REQB 3AP3A 1IYZA 3ONVA 2VP5A 3BFVA 5L7YA 1Q16A 1AKQA 2NP6A 2CKMA 3CCEV 4YB8A 4D8TA 3RRNA 4LE2A 1Z6ZA 2WD7B 1A8SA 5BR8O 2ZBDA 1GL6A 4AULA 4GLXA 1YIOA 3M6FA 4B3XA 4AN1A 2JGAA 3FMPB 1Q7GA 2G80A 3FLBA 3OSUA 4MJXA 1D2RA 3NVDA 1X86B 3CCLF 3HPLC 3RI3A 3OZCA 3RT3C 1NDQA 5FWXA 5KYWB 1NJSA 3GJRA 4QPDA 1JAYA 4CODB 5KAIZ 4PCLA 4YNBA 5BMVA 1X8LA 5B6IA 1KTIA 3VPBA 3VR3D 1E1RG 1WB9A 4JJFA 3FKSG 4BWVA 3QKSB 1WVIA 3ZQ6A 2YXNA 3VTFA 1F0KA 4ZU6X 1GKUB 4JIMA 4CDMA 1XD2B 3QX8A 1AQIA 1VE3A 4UM9D 2Z5VA 3DJFA 2GTAA 1U3GA 3DAHA 1MIHA 2VHVA 4GSKA 3SEQA 2PL9A 4NH4A 1WABA 5BSUA 4DT1A 2G28A 4D4IA 1ZD2P 4DR6B 1KZGB 4N5LA 5KNCH 1J49A 3K53A 1WEKA 4HFMA 4QOSA 1E2HA 1NQOA 5M5BA 1V16A 1MVLA 4RH1A 2GF9A 3HKBA 1MC5A 4MB6A 3R7WA 1Q50A 1F9AA 1PCXA 3GN2A 2FDRA 1K1EA 4MTLA 1C1HA 5IJ9B 1XMJA 1V55B 1ZUQA 1RWPA 3KJIA 3THRA 1PEYA 2BSXA 4RAOA 4J0QA 3LQFA 1M10A 3M34A 3KBBA 3PXBA 1T2UA 4K6GA 3HP7A 5JVDF 3QUSA 3IR5A 1DAEA 4D5EA 3FNBA 1FW6A 2V55B 3HN2A 4LS3A 3GH1A 3CKLA 2IEGA 1SQ0A 1FNNA 4H7JA 2I54A 4XCVA 1YB2A 4EKGA 5LP6C 1S7GA 3MWYW 1VQ9V 4DR4O 4R8SA 1OJLA 3IIIA 4EVIA 2ZQZA 1XHOA 3H8WA 2KLHA 4EAAA 4PCVA 5JMPA 2CDNA 4EPVA 4CUKA 4P1ZA 2GARA 4ZIBA 1VRVA 3P5SA 2XI4A 1PUJA 4CZ2A 3E3MA 3L3BA 2GTSA 1V7ZA 4X1IB 4DSOA 1O9BA 2Q6AA 5A4MS 2JCXA 4BEBA 1KDYA 3EDQA 1PNMA 1A2KC 4JIGA 4V03A 2DECA 2Y1GA 4URWR 2Z08A 1GO2A 3EISA 5KJCA 4JLOA 1PZHA 3CXUA 1MG5A 4X00A 1QP4A 2OHJA 3NUQA 1TUIA 5B2ZA 2VRBA 2Q5FA 3L1UA 3JYQA 3A2MA 2V4ZA 1JHOA 4KDFA 1H38A 3A05A 2A5FA 5CFNA 4ZYVA 3TTYA 2Q2WA 3L1HA 1LD3A 3EG9A 2K2WA 1NUUA 4TVKA 3V48A 4BWGA 8MHTA 2ZF8A 5SZKB 1AGYA 2F3TA 3ZGNA 1XMSA 5I5EA 3S2EA 4CR7A 3A6FA 1QLHA 2VH5R 5CNJA 5KNDA 3CC4F 2EWVA 3IVXA 3FTPA 4MITA 1HFEL 1ODJA 3ZOKA 2PE5A 1C3LA 4PG8A 2NVOA 5ALJA 4TZTA 1MCZA 5M04A 3X1KA 4M83A 5HA5A 2OA0A 4O2BF 2O3QA 4UUNA 1TLFA 4ZBMA 4M21A 2O8DA 2DKOA 2O0LA 2AG8A 1U5BB 3UHJA 3QNMA 4YBRA 5F7XA 1MP0A 3KT8A 1FFAA 2HJVA 3KDSE 3NTOA 1IL0A 2AZTA 1ND6A 4OPHA 2FPUA 4ZDJA 3MXTA 1IPFA 4JI0O 3GRKA 5JZSA 3GW8A 4WECA 1U40A 5KO2A 1KFCB 2YUTA 3N2GA 2P9YA 3UUGA 2QTZA 3QITA 4DR1O 1T0PA 1J0BA 4KO8A 4I4IA 3CPHA 1Y1RA 3AG6A 1ZSPA 5ILQA 4UDYX 4PYQA 3SIUA 3HI6A 2VF7A 2LTAA 2CCJA 3GFRA 1I94O 1N8KA 1DAMA 4FHGA 1SKAA 1UEJA 3W8RA 3C3AA 2ODEA 5A06A 4W6QA 3U4QB 1M90H 2H18A 1AOXA 1J0AA 1VQ8F 3HR4A 3QVJA 4MWZA 2JHFA 2YW9A 2Q4TA 4O3FA 1XTJA 4NBNA 5K3FB 3EY9A 5G0SA 4O4HA 3GT0A 2D54A 4QGFA 2DW4A 5BQOA 2CJYA 1N5DA 4RV9A 2Q5EA 1JBEA 1H66A 2JVJA 1BYIA 3ICOA 4IMJB 1ZK1A 3C74A 4I55B 3U3JA 4LF4O 4W5JA 3FAKA 1ADJA 3DMTC 2NNWB 1ML3A 1JL3A 3IBSA 3PITA 2M2IA 3OM1A 4P0PB 4Q4HB 1CB7A 3GUUA 1PQ4A 2WMNB 2W70A 4KMRA 4PX3A 1UJ4A 4JI8O 2QL5A 1Y34E 3T5TA 5TGDA 4MR8B 2PN1A 1GZDA 4NYIR 3SMVA 5ALGA 3ZHVA 4DCVA 3VC3A 3WY9A 4BUCA 2L42A 2Z30A 5CDTA 4CG3A 1D5CA 3W2GA 1VF6A 4KGZA 1T5SA 1L5WA 2DOKA 2GEDA 3WRWA 1OI2A 4LJYA 3DA8A 4WCFC 6ABPA 4RJTA 1SQQH 3EMDA 3A1EA 5AM3A 2OV1A 1YVRA 4O63O 5CCBA 2E5WA 3VMFB 3GNQA 3QUWA 1AMOA 2DGDA 2BGTA 3TOZA 3NXSA 3W6ZA 4DVGA 4XGRA 3TCNA 2ICAA 1FFDA 3GLKA 4L6AA 3PIIA 4PONA 5FL3A 5JSZA 1JVSA 5I9TA 1DIGA 4BQSA 2O2HA 1RSOB 6LDHA 3ND7A 3HL4A 1MW8X 2RCYA 4AUKA 2H2WA 4W4TA 3SQOA 3T52A 3KAQA 5HOQA 4IFBA 4P9OA 2I6DA 2JFGA 2YHAA 3HNPA 2JLWA 2DUUA 2G6BA 3EFHA 3TSOA 3OLQA 1XI2A 2XWPA 2WF9A 2JHCA 5L3VA 4FHEA 1HBJA 2B8NA 2A86A 2O4CA 1ZEMA 4W1SA 2GO1A 2RD2A 4RXUA 1UJCA 2IJGX 2OD7A 3G0DA 4N3BA 3IXQA 3QE3A 1IXZA 2CDCA 4LCKA 3TCXB 2WSLA 4FE7A 4IDAA 4ZK7A 2WD8A 1W8DA 4EY5A 1VH8A 1KNQA 2Y0IA 4TN1A 4MVJA 4GBJA 5AT1A 2GBPA 2BP7B 1H2AS 1EP3B 1CSEE 2H29A 3OY2A 1CNEA 3LX5A 2IHTA 4M1WA 1RM4A 4G24A 4ZAGA 1V0JA 1VB5A 3R7SA 3W1VA 4B4VA 1AHIA 3QBVA 2LQTA 3EQ9A 1S2MA 4YRZA 1PV2A 4FI3C 1NU8A 2XTMA 2QGNA 2F6RA 1JEQB 3CD6F 3I2HA 3SZOA 2QMEA 3RUIA 5BSGA 3B20A 1N75A 3T4DA 2JZCA 1GILA 1E9FA 2IYUA 1QBGA 4E6EA 2D06A 2OYRA 2BR4A 1U2SA 5FP0A 2AN3A 3M4XA 1X1AA 5LPNA 4BVJA 1KMIY 1GADO 5G1NA 3VJMA 3MF4A 1VQLF 1YO6A 4C7UA 1L5GB 5A3JA 1M1XB 4LRSB 2ZXWB 4WK4B 3IAEA 1O4WA 1E3WA 3OR6C 6GPBA 4Y3UA 3L7AA 3ZH9B 4R4JA 3HI4A 1XIVA 1NHGA 3I39X 4C0WA 1E2JA 3QEAZ 4Y0AA 3ZVLA 1J7KA 3O3CA 1GDDA 1W87A 3WO1A 1WNSA 5GV7A 1M3SA 3WV5A 5CA0B 1IY0A 3G17A 3R6DA 5B2FA 2OV2A 4GC5A 3B2EE 3P4EA 4Y9DA 2XX3A 2NU6A 4X9QA 3ASNC 2BISA 3EPHA 2C4UA 4JAUA 5A03A 3KOMA 1HEYA 3MLAA 5GWXA 1YVEI 3RHTA 1NQTA 3QTBA 3D36A 2NVBA 3TAHA 3KVRA 4NZYA 2QLTA 3ABMB 4S1TA 3FWPA 2IXGA 1WPXA 4UCTA 1DC8A 1P73A 4GXQA 2OTJV 2X4LA 2NU7A 3AL0C 3NVMB 4YO7A 3ENKA 3DBIA 5B1DA 2XOEA 5FAXA 1NBIA 3I2IA 5DJ5A 1G4HA 4PXYA 1SXGA 1C7RA 3FR8A 1J8FA 2CHGA 3DVQX 1O1YA 3O73A 5CNMA 3NHWA 5DRYA 4PR0A 1JQ3A 5LL6Y 1U97A 1XF9A 1NM5C 2GZMA 1T8TA 1NOJA 3FWKA 4C06A 1CXZA 4C88A 1EMDA 3ZDQA 4FVTA 1V6CA 2YVUA 3ZDDA 5DTIA 4BCDA 5HE8A 1MFZA 5L3QA 5BSRA 1OYVA 1UT6A 4TV9B 4WKGA 1FYJA 3JS5A 4G89A 2VDLB 2IUTA 4K40A 4F6EA 2CXUA 1YFKA 3KSDO 1UXJA 2X19A 1GAQA 4KVZA 4EDHA 1LUWA 1ADCA 1HT1E 2Q0AA 4NCAA 1BXGA 3W0LB 2FMIA 2Q4DA 1LK5A 3ESRA 4JI4B 4Q4JB 4F91B 2AKEA 4TWBA 1J06A 3OI7A 4CM4B 3K9SA 2W2PA 3PTZA 3A0HZ 2QX9A 1MOPA 4JUAA 4OL9A 1Q14A 2QQ5A 4QDJA 2PIDA 1GYRA 3O2NA 3GRYA 3O4RA 1EVZA 3SS7X 3ZX5A 3NYIA 4Q48A 6Q21A 2AW9A 2I66A 4YRDA 2Z1UA 4YJFB 4EY7A 2DT4A 1JTVA 3P0IA 3DMFA 5LMUB 3MN1A 4E5PA 4H6WA 2WZCA 4YT2A 3KAPA 3DAYA 4TXMA 2I8AA 4S0XA 4BNFA 2I2BA 3O75A 2FZCA 2QVLA 3JTEA 3JQDA 4CS4A 3KR1A 4V2IA 3IUSA 1GAEO 5TMEA 1B15A 5C80A 3IVMA 3ZD9A 5EGSA 4GM0A 3NQ41 1EM6A 1NVFA 1AXEA 3C85A 5CDFA 2YVLA 4NBTA 1RWQA 3H2JA 4R51A 4DV6O 2C96A 2G5PA 4CTJA 221PA 4QXOA 5L3RA 4LZZA 1PJ8A 1BCCH 2ADOA 3RKSA 2BR5A 3ASOC 5T4BA 1DEAA 5FORA 4HNAA 4E4TA 4FM0A 3C98A 3IT1A 5JWRA 1RVV1 3DR3A 3TZHA 1X1TA 4O1IA 1Q1QA 1YT5A 4M9XA 3IDQA 4NI5A 1T6BY 2GETA 3EGIA 1R18A 4K88A 2J5XA 4FPPA 3STYA 1T3LA 3GLHB 3SHOA 4B31A 4S05A 4BE7B 4QARA 3RVYA 1BEZA 5IFKA 5EWLB 3E58A 3HCEA 6AT1A 2L69A 5KMGB 2Z1EA 1PBNA 3ZVNA 4C9BA 1E3EA 3CYFA 1X8JA 1G66A 1YACA 4XW2A 4M9SA 2OORC 4MYDA 1N6IA 3RAPR 3OOWA 3SE0A 3QVWA 3DULA 3I6QA 4KSYA 1U3PA 4AKIA 4EJ0A 4Q9AA 4OSOA 4ZTBA 1W4BA 2B4AA 1ECPA 3OQIA 3K6KA 1DQSA 3W3ZB 2J4CA 3R7DA 3BAAA 2IXEA 3LWRC 1QQAA 2RG1A 2XGOA 1O95A 1V1RB 1L5KA 1PG5A 3CN7A 3EMVA 2VHCA 1SCIA 3WR5A 4LXIA 2ZBVA 1C0IA 1NYTA 2G17A 2ZZKA 2LIPA 2JIQA 3N6XA 4IDOA 2DFTA 4NBUA 2CK3A 3RJ5A 2IHZA 1UQRA 3CCMV 1T3ZA 5FBRB 1Z7WA 4TKUB 1PVDA 2IXFA 3PHHA 4JVNA 3TQTA 2CLKB 1LDNA 4G1VA 4JUDX 2HSWA 4YDHB 2QRMA 5CXXA 5G3ZA 1VLHA 4WX2B 4YR7A 3OEHD 4DUGD 1T15A 1MXFA 3H65A 2JVKA 2IDMA 3T7CA 4PDLA 3C6YA 4UAGA 3NFYA 5GV8A 4UTVA 4CKEB 4YMLA 3TZBA 4C89A 2ASEA 3K6SA 3H2ZA 3QO8A 2XMSA 5I7SA 1HDRA 4TWJA 4MW9A 2ZJ1A 3AM5A 2B92A 4B0PA 3EZNA 2E48A 3I5DA 1R4NA 3EHBB 2GUZB 2VYNA 4ZCPA 3B6NA 1XTKA 4WEQA 2PXXA 4QXPA 1G5PA 3RARA 4US0R 4IMPA 2JIZA 2QE6A 4QKQA 4C7BA 2QTCA 3HO1A 1Q7RA 3PWZA 4B3MO 3MMZA 2WC1A 4D9EA 1JHQA 1KJIA 5HJEA 3K70B 3H5LA 2C99A 4ZT6A 5A3QA 2Z1FA 1JHZA 3MQFA 1WDMA 1JMVA 3B8HA 2E2WA 1Z4MA 2VPWA 2EX0A 1E18A 3U3KA 3SM9A 3UMYA 4R6WA 1ZOPA 3QW2A 2Y1WA 1WR8A 4K6MA 2JL1A 4G26A 4DCOA 3QHQA 1IJKA 3K3WA 3HV2A 3E1YA 4AW9A 5JAMA 3ET4A 4ZHYB 4NHEA 1TYDE 1GPH1 4ALLA 2J6HA 4A5UB 3TDMA 2BE9A 4CXMA 1QVWA 3CVVA 5G4LA 4AO6A 5BWLA 3F6BX 4NUTA 1Y6ZA 3LOQA 4Z1MA 1ZLYA 4Q4CA 2BTOA 1PUIA 4Q21A 1WXQA 4P2BA 4NXNO 2AH5A 3MDSA 1I36A 1GGEA 1KZ9A 2BCJQ 4J2TA 2CL6X 3LC2O 4O4JA 4HRXA 3TVTA 3R0XA 3BGVA 2P40A 2X6BA 3N4ZA 2BKVA 2DT5A 1G20B 2VJYA 1XK7A 1Z36A 1TKAA 4LHEA 3W5BA 4LYDA 3NM4A 3MAJA 4EUSA 4RMIA 3AEKB 3VZBA 3KHNA 3NVIB 4OP3A 5LQJA 3HUEA 3I62A 4CN9A 4MUMA 4YHBA 3GJXC 1NY5A 2GN4A 5MFZA 2ZOVA 2GKGA 2GCGA 3NBFA 3THWB 4MVMA 5T5QA 5CH3A 2ZTUA 3LFTA 4LZOA 4NZMA 3AX6A 4KYTA 3DDHA 1RCFA 2BE7A 4YV7A 4YAFA 5LLTA 3FGOA 4XDYA 2DJ5A 3OUZA 3PNQA 1AI5A 1G6Q1 1U3VA 4ZO9A 3GYBA 1YC2A 3NBXX 1IV3A 2BM1A 3OCUA 1FNCA 5TEVA 2XVMA 2QRHA 3NT4A 3KQQA 1QGAA 4ND4A 4R1OA 3K0AA 2MCFA 4LOIA 3D4BA 4G4SO 4X1OA 1W0KG 4I50B 2M1XA 4U63A 3KQVA 3HUDA 3L1IA 3UENA 3WS7A 3HVKA 1R2QA 3OA2A 1KQNA 3K5HA 4B80A 3PQDA 4FEGA 4XM1A 1ORIA 3UICA 1IN4A 4Q7EA 5CAEA 4IMIB 4Z4GA 1CT9A 4XB6B 2RGNA 2FK7A 3HWRA 2RB9A 4QL3A 4HBNA 1P7CA 1NJ2A 5FOSA 3DMDA 1QE5A 2H7VA 1PL6A 2HDWA 1VQ6V 1IQUA 5EMLA 4PNEA 3B5EA 4PM4A 1J0XO 2NXNA 1EE2A 5DHPA 4OSPA 3TBHA 1LKZA 3ZTTA 4L8JA 2AHOA 3S7TA 4U9HS 3GK3A 4LFAO 4ICGA 2GM5A 3V5NA 1SA0B 2VWJA 1JIQA 2OQVA 2GCPA 2Y0DA 4PA3A 4H0LB 3C15C 3SAJA 5JASA 2KQXA 4A2CA 1DAGA 3KJZA 4BNUA 5AK0A 2FSHA 3U1BA 2OFOA 3CRCA 4Q20A 2FPGA 5F1OA 4F3TA 2VH1A 2Q4OA 4YPOA 4PC7A 1NUSA 4YASA 1WCIB 3U3RA 1KJJA 1VI5A 3JQGB 2QJTA 5IJZA 3ZE6A 1XTQA 1FL9A 2PZ8A 3I04M 2I4MA 1J1IA 4NMMA 4EW3A 4TM8A 1I1QB 4PZ0A 3F78A 4REQB 2O7QA 3FFBA 4QGGA 1DDIA 1SUDA 2Q4EA 4YCLA 1X70A 4PR3A 4ES6A 5HF9A 4KZKA 1L1FA 1KYWA 1Z2CA 1YQXA 4REMA 1E7YA 3IAYA 1JBQA 1GNVA 5A6VA 1LW7A 1YZTA 3KPVA 1WKVA 4DV0B 1YJCA 4Y0NA 3ZRVA 1K8QA 2GF2A 2YY5A 3V3KA 4JASA 3MCWA 4QXQA 4L51A 1K0UA 1VQ7F 4BJ1A 1O87A 3HM9A 4P5DA 5DLPA 3HWUA 3RAJA 4MAAA 1BVHA 3IEPA 1XZKA 1XRMA 3ETGA 3AJAA 4DLRA 5HSGA 4AY4A 5HS6A 1JYSA 4NZOA 3AKEA 5B58C 3NC1C 2AJCA 2HF7A 2WEKA 3AG1B 1YIDA 5KWIA 1RAAA 1DEOA 4CUJA 1XU9A 5EXSA 4I14A 2X5OA 4WNYA 4KZPA 5GANK 2R1ZA 5LKRA 3AR5A 1GA4A 1Q84A 3T7IA 5D7BA 2GHIA 1N0JA 3VU0A 2NZYA 2FPMA 1KB9F 1UDWA 4WJKB 3II6X 1FOEB 1IZYA 2FFQA 1P4JA 3E20B 3ANYB 4V3CA 1I6WA 4Y9UA 2VSQA 4GHWA 2HK6A 2HM7A 4G23A 3IHKA 4B82A 2AYXA 3JD0A 4OIFA 4U7HA 3TRJA 2J9YB 1SUBA 4DV2O 1Q0LA 4N7BA 1T4DA 5JG7A 1JEDA 1AUQA 1I5EA 4OI1A 5JEDA 4DCMA 3Q2IA 1FXSA 4UFNA 2P06A 3U4IA 3AIKA 1XA0A 1YTFD 4GWLA 5AOBA 1F48A 3L0CA 3IHTA 3B2QA 4JENA 3FX7A 4QFMA 3T3HA 3I32A 4OLAA 5EB1B 3VYWA 4XGKA 3LPDA 1K6XA 2ZJ3A 1TM3E 1WP4A 3OAAG 4LTMA 6YASA 1M0EA 1K73H 3VHQA 2WR8A 1L8LA 3HY6A 1WE2A 2FSGA 4D82A 3DGEC 4BVAA 4INPA 1LZKA 1YKFA 5L3DA 1AUVA 3SXPA 7GPBA 4Y6OA 5DM2A 1EE9A 3RRFA 2ZSDA 1ZGBA 3OEEG 2J33A 4HP8A 3ST7A 3NP7A 4X1YB 3OFNG 2QTNA 2HOQA 2QY9A 3WLMA 3D7RA 3Q5GA 1OAOC 4NMWA 4DR2O 1ORQC 2I2CA 1B3QA 2PYIA 1D5WA 4F92B 1OH5A 3FJOA 4YUZA 1GHTA 1PJAA 4JJ4A 3VH4A 2C2OA 3L0IB 2G5GX 3GCXA 2E4VA 4RYLA 4O0LA 4DHEA 4Z0NA 3G5AA 3TZEA 1KRWA 3MUOA 5FPRA 2XOXA 3FE2A 4BZQA 5DBEX 4DMGA 4RGYA 1M2GA 5AVKA 4X6XA 2C3MA 1HLFA 4UNNA 2JC3A 3RYHB 1U3CA 5CA1B 1T8RA 3BIFA 4B33A 4ZQGA 3D54D 2RIPA 3WLJA 5IG2A 3DKIA 2FTKE 3IERA 4OY3A 3ROXA 1ZCAA 4WFFA 3ZPXA 4ALMA 4D9KA 4N0MA 1IBLB 4NDZA 4FCVA 2Y2VA 4IYJA 4TZ6A 2H5LA 4K9SA 4AWXA 2PVPA 3I28A 1YB4A 1J2YA 3DDCA 5CBGA 2BGIA 1HLDA 3H9UA 4OTZA 2XZPA 1LB1B 1Y81A 1J90A 1EG7A 4BVHA 5KWEA 1ZXLA 2R1VA 2JFNA 4F72A 1W36B 5IE9A 4MP8A 1JJIA 3ABSB 4OX9B 2JKZA 4JJ6A 3VR5D 1KSJA 5LNK1 1DKPA 1E1QG 2XYHA 2F1RA 1ZCFA 2WLHA 1C2TA 2BTQA 2KG7A 5FNZA 3WGUA 3MPUA 1XZIA 1JPUA 1OXMA 3WKBA 2Q4PA 1X52A 3VNSA 4ZQEA 1U99A 1UCFA 1LA2A 1G5IA 3RNOA 1JVBA 2LVBA 1EFHA 4XFDA 5AK6A 5A62A 3ETEA 2FW7A 3PZRA 3W05A 3ZW8A 3BA9A 3BB3A 4W5RA 2D2IA 5I9MA 1EH5A 3BCCH 3V8BA 5IDJA 2ZVYA 1UZMA 4O2LA 3ZK8A 3E0QA 2EIMC 1UT8A 1XWIA 2FQQA 4LBEC 1XQYA 3LD9A 4HPWA 2QSJA 3ZVKA 4AJIA 3ENNA 2AQ8A 5IDQA 4IIEA 3AG4B 1MVNA 1XXHA 4AYXA 1T9CA 1CS4C 3DEHA 3IAS1 1UKCA 5JV5A 5HXAA 3PGXA 2AJTA 3NKFA 5HVNA 1E6CA 1XRLA 5JJIA 3T5GA 3LWVC 1PZFA 6ADHA 3L18A 4L15A 5HXZA 3AR6A 1S4MA 2D2FA 4NCIA 3K4PA 5KJ6A 3H6KA 2DEUA 1KJWA 3I2KA 4DUYB 3U40A 2VF8A 1EXWA 3JYCA 2CCGA 2VPTA 3P2EA 3JQ9A 3BF8A 3EHEA 2IA5A 1RYHA 1OLXB 1DFHA 2QY6A 3WB9A 4YY3O 2JK5C 5LP1A 4PSUA 2Q6VA 1VKOA 3B8MA 1PX2A 4H3VA 2HHLA 2ZI5A 2X15A 4PSKA 4PG6A 1ARZA 4X89A 3S0JA 5DYNA 1YR6A 3E8HA 4ZHWA 2NAPA 2D1FA 4A15A 5LZ9A 2Q68A 3WK6A 2IF2A 1FY2A 3F6SA 1MGOA 2A79B 1OFUA 4JB3A 4X8MA 3L1JA 2ZG6A 2WF5A 2V4MA 4BNMA 4XIIA 4YIPA 1U9IC 4HTFB 1GYPA 3U7QA 1M4UA 1BW9A 3DDUA 1VKHA 3OBWA 3D2CA 5AKIA 1XOIA 2BSAA 4J7AA 5LIRA 1J7JA 1QAMA 2AZ0A 4YC7A 3Q3EA 4K9RA 3HCAA 3B85A 4EUFA 3H19A 1SC9A 4KPGA 4OI4A 1OI3A 3AJDA 4K35A 2PFSA 2HMAA 5FPKA 2EZPA 4B45A 3HDJA 1ICIA 4PZDA 4GP7A 1WB6A 5MF6A 3DZKA 3O3NB 4YRLA 2C03A 2XY4A 3TLAA 4A3SA 1G1AA 1P1JA 3WGQA 4C1BA 2D5LA 1TM4E 1JJ7A 1FTNA 3KQWA 4I1UA 3N39C 1D5NA 3EZFA 1ZM2A 5IZCA 3RQSA 3L7DA 2IX3A 1JH9A 4HH4A 4NPAA 5AKHA 2EX1A 3VJKA 2I22A 1B8NA 2GYVA 4E2ZA 2AIRA 4B8ZA 3QX9A 1H0KA 4AMZA 2ZYSA 1Y3DE 1UFRA 2YV5A 2VQ3A 1L1EA 2HK8A 5AHXA 4AJHA 2FX2A 1PZEA 4RVUA 2PAFA 1Q6YA 1CE8B 2JCVA 3DWIA 1O6CA 4LRUA 5CCDA 5IEBA 4WZZA 1OBHA 1XEWY 3L71H 3C1UA 1PZMA 1EPUA 4B5CA 1W9HA 3W4KA 3T0GA 1FFXB 1G5TA 2EXXA 2WUGA 1OHHG 4B3DA 2QTGA 3MUNA 2YCLA 1BCRA 3G8CA 5KAFZ 4AMGA 1A77A 1BJTA 4GKJB 2OEPA 4PW0A 4PGHA 2AMJA 4CM3A 1OX4B 3EXIA 3K9HA 2AMLA 1XALA 5IC6A 4KVFA 1DAIA 1R8YA 4MGZR 1IUNA 4IRUB 3SKXA 1QKKA 1MQ9A 3LMEA 2PWPA 3LUHA 3BB4A 1DKRA 2XVAA 3ZWVA 1G6OA 1KEEB 1RJFA 3Q10A 4L28A 4BLRA 1K4MA 3NAQA 4ZT2A 1BXRB 1DHRA 2AJBA 3QXJA 2D7JA 1XEAA 3BCRA 3DAGA 4CMCA 3PS9A 13PKA 5JQGB 3LWOC 4Q39A 4BC0A 2Y4UA 3T7KA 1M75A 4YI5A 3CT6A 3ZCCA 3JSNA 1SCNE 2BLLA 4MKXA 1CY6A 3P0ZA 2LP4Y 4FDAA 4B2PA 5JDIA 2VYVA 3DBRB 4IS2A 4C3UA 4C4TA 4KN9S 3BMCB 1II9A 2MSLA 3E9EA 4TXLA 4FFBA 2YV4A 3PX2A 1BD3A 4X63A 2P2YA 3R40A 2R9RB 2TMDA 3X1WA 3P32A 1IUKA 4D3ZA 5JUWA 3THYB 2A0XA 3T41A 4LC0A 1EXDA 3PGJA 4WBNB 1VG8A 1NT2B 4J7ZA 2FMFA 2FPOA 2XWQA 2P9GA 2XEXA 1RQNA 3MJCA 2QKAA 2F4VB 2WZDA 4XJXA 2FZEA 4C3OB 1WZ2A 1J20A 1A27A 3G6WA 4JLKA 4J4HA 3R23A 1NW7A 2HLDA 4KWIA 5ELMA 1NF8A 4ENQA 1E6KA 3ZKAA 1YDEA 2BM9A 2O2SA 4MIOA 1GSIA 2QQFA 1PSZA 2Q5IA 2B35A 2EX3A 3UZUA 1EFUA 3R3HA 4XCXA 4YUYA 3KTOA 2V3CC 4UBOA 3EVGA 3BMOB 1VIMA 1YA6A 2VUIB 5B1BC 5EE0A 1IJEA 3Q9LA 1F1JA 4OJKA 3T5DA 2J3LA 4YRMA 2PGNA 2XKJE 5BWMA 4OGKA 2QPAA 3UPDA 3A26A 4RHTA 1J25A 4X20A 3MTIA 3OIUA 4K5QA 1LI5A 5DI3A 4ACAA 1Z0KA