2RHOA

Synthetic gene encoded bacillus subtilis ftsz ncs dimer with bound gdp and gtp-gamma-s
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
305
structure length
305
Chain Sequence
ASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATGFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell Division Protein ftsZ
publication title Combined protein construct and synthetic gene engineering for heterologous protein expression and crystallization using Gene Composer.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Cell cycle
total genus 105
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 2rhoA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 2rhoA01
4WBNA 1RQ7A 3E22B 3RYIB 4O4IB 3RYIA 4YJ2B 4X1KB 3VOBA 4O2BA 4YJ2A 4B45A 5LXTB 5LXTA 5J2TB 4O4LB 4F6RA 1TVKB 4O4LA 5J2UB 4ZHQB 1TVKA 1W5FA 3JAWA 4I4TB 4TUYB 4ZHQA 5J2UA 4TUYA 5CA0B 5FNVB 5EYPA 5FNVA 3VPAA 5MN4A 3HKCA 4KWEA 2VAMA 3RB8A 5IYZA 3ZIDA 3UT5B 5LP6C 5CB4A 3CB2A 4YJ3B 5LP6B 4U39A 5JCOC 4DXDA 5LP6A 3JARB 4X20A 5JCOA 3WGLA 3JARA 4WBNB 4IIJA 4I50A 4LNUA 4EB6A 2Q1XA 1RLUA 4O2BB 4O2AA 4XCQA 3VO9A 3ZBPA 5CA1B 3HKBB 3JALA 4F6RB 4O4JA 3WGKA 4B46A 3HKBA 5CA1A 3JATB 3RYHB 4TV9B 3JAWB 2RHLA 3JATA 3RYHA 4TV9A 3RYCB 3RYCA 4X1YA 5EYPB 1OFUA 1Z5VA 3HKCB 4O4HB 2RHOA 5LA6A 4O4HA 1Z5WA 5IYZB 5CB4B 1RQ2A 2GVIA 4IHJA 3C8LA 4X20B 5JH7A 3M8KA 5ITZA 4IIJB 4ZOLB 4I50B 4LNUB 4ZI7A 4ZOLA 1W581 3HKEB 3V3TA 3HKEA 1W59A 4EB6B 3JAKA 4TV8B 3WGJA 4EI8A 4O2AB 4TV8A 2RHHA 3VOAA 5C8YB 2RHJA 2BTQA 5C8YA 4E6EA 5JH7B 3JALB 4O4JB 3N2KB 1FFXB 1W5AA 3HKDA 5BMVB 3N2KA 1FFXA 2R751 5BMVA 5IJ0B 5IJ0A 5LOVA 4X1YB 5EZYB 3WGNA 4M8IA 5LA6B 5EZYA 2BTOA 1W5BA 3WGMA 1SA0A 4IHJB 1FSZA 4X1IA 4U3JB 4U3JA 5JQGB 3RYFB 5ITZB 5MN5A 2Q1YA 5JQGA 3RYFA 4ZI7B 5MN6A 2XKAA 5M7EA 3E22A 5KX5B 3R4VA 4O4IA 3JASB 5KX5A 4FFBB 2VXYA 5KMGB 3JASA 2R6R1 4FFBA 4X1KA 5KMGA 4EI9A 3JAKB 2XKBA 5JVDB 1JFFB 3VO8A 5JVDA 3ZBQA 1JFFA 2BTQB 5EIBC 5LYJB 5J2TA 2VAWA 5LYJA 4X1IB 1W5EA 3HKDB 4I4TA 5IJ9B 5CA0A 5IJ9A 5LOVB 3M89A 3N2GB 5GONB 3N2GA 5GONA 4DRXB 3UT5A 1TUBB 4DRXA 4YJ3A 2VAPA 1TUBA 4EI7A 4I55B 1SA0B 4HNAB 5EIBD 4I55A 4HNAA
chains in the Genus database with same CATH superfamily
1X7PA 4E07A 3GJ7A 4EJSA 1QE3A 5CDFA 4TT3A 3NVDA 2I7DA 1RABA 4LXYA 3UAWA 2RIPA 3B8EA 1K92A 1KMHB 1TU4A 2B99A 3I53A 4RIHA 4YMUA 1SD1A 1VE6A 2WV9A 5JV5A 1SULA 5TEVA 5T41A 4XQGA 4QUDA 3T5CA 2JGAA 1N8RH 2Y0DA 4QUIA 2JCXA 3U1TA 1ACMA 1O0SA 4MAAA 5TGDA 2H07A 2J32A 2HU7A 2ODPA 3L0IB 5JDIC 3HUUA 2Z1MA 3TMAA 3QFTA 2C9ZA 4EGQA 1CEXA 1Y9JA 1JJAA 4D9IA 3EIUA 1FX0B 3WLPA 3ADKA 3UA4A 5CEJA 2WYVA 3IAM1 4KK3A 1LZKA 3F8TA 3L0ZA 4L15A 2JGMA 4DMKA 2C8KA 4B75A 1X92A 5AHXA 1ZSNA 2FPRA 2Q7XA 3T5TA 2ZPUA 3WMFA 2GPYA 3LUDA 5K8CA 3PPIA 1X7YB 3B6NA 1IZ9A 3HHEA 3TDKA 2EL9A 3HLTA 3I3OA 2FC3A 4EB6A 3LECA 4KGDA 5AVXA 1SCQA 2XVMA 4AP5A 1GQFA 1L9XA 4CE6A 1DIAA 5TARA 4QBKA 4KR6A 1YZYA 3BYZA 1A04A 1H05A 2K2QB 3E82A 4PGGA 3UNXA 4ZFNA 1XCPA 3L05A 4EYKA 2VNJA 3FDIA 4FNOA 4LDQA 4O25A 1I5EA 5T6MA 5B55A 3BF8A 4MAFA 4Q4HB 5JS2A 3W3AD 1F14A 3OFNA 3AFHA 3L77A 2QX8A 3I23A 4UHEA 3PICA 2AWNA 2TYSB 4OOFA 1V6CA 1OC4A 3M8KA 4FFWA 2YJZA 5DO9A 4Z4CA 3AIKA 4CKYA 2QTCA 1SKMA 5JECA 4RY0A 3FPAA 4FX2A 2QP9X 3OTIA 4OHKA 2XX3A 2R66A 3ZWVA 4XLZA 1Z0UA 1TCUA 3N2IA 1WB5A 1VSTA 1ZN8A 2PKRA 4L50A 4TYWA 4RELA 3O9ZA 1SEPA 2VHEA 1R8JA 3QLTA 3X44A 3BFPA 4RXUA 2FN4A 2YWDA 3EDMA 1XTVA 1Z8FA 1THMA 3VI6A 3OOYA 3QWAA 4QFDA 5LA6B 1JR2A 1I1OA 2OLJA 4LOAA 1Y42X 2IZ5A 4JLJA 4YJFB 5HS6A 2NOAA 2ZR7A 4CF4A 4Z3OA 1YB2A 4HZGA 2PVSA 4NENB 3K09A 5DBOA 4OIMA 3GVIA 2BEUA 2V97A 3KQMA 1N2JA 1QGZA 1KJJA 2I3AA 4KVAA 4PC2A 5CRIA 2VHUA 2BV3A 1P0FA 3AC0A 3Q3EA 3A1NA 1E3JA 5HFJA 4EG7A 1M5TA 2C4TA 2J5QA 4IF6A 5IJZA 5JASA 5BSEA 3DLCA 1DIRA 3BERA 1ADGA 1XVAA 3RHSA 3LWQC 4GL4A 5CCDA 1HPLA 3RBZA 1JSXA 2OG2A 1PX0A 5K1ZA 4DV6B 2IS1A 3EW9A 4QM7A 3ZBQA 2UXCB 4NPHA 1U7OA 2GEKA 2Y27A 2PBZA 2WU3A 1BW9A 1F6BA 1NJGA 2EZTA 5HW0A 4PLWA 1ZFNA 2ZB2A 2PL3A 3EYAA 1QCDA 4UE6A 1ZICA 4XR4A 1UFYA 4NU0A 1TUBA 3AVUA 2AR7A 2GETA 2CXOA 2R9VA 3D6AA 2I6XA 3LQ4A 3PC4A 4R81A 1YOBA 3RADC 4HNAA 1G3MA 3F4BA 2PA0A 3SBDA 3R5XA 1JEOA 3KK0A 2WV7A 1AM4D 1XL0A 2AZTA 3HBLA 3BAFA 1Z8NA 1HFJA 3N8KA 4YQEA 2GAFA 3HTNA 3B12A 2BL4A 1D1SA 4G65A 2DM6A 4HUQB 3I2JA 3K0BA 4NYMQ 4UEOA 2H1RA 4RJIA 4DIFA 5B3JA 2OBBA 3AEUB 1U6IA 3PJEA 3PPWA 4JHXA 1GVNB 3SBOA 4F2WA 5LXTA 2HM7A 5FLXM 3ZUGA 2CSXA 1CR6A 4FQ5A 1SQFA 3PFCA 4HDQB 4YHBA 4MW5A 4LXTA 3HFSA 3PGMA 5F3WB 4HJXA 2H1IA 3ESYA 2IDMA 2WTNA 4YP9A 1WOMA 3CF6R 4K0KB 2GM5A 3GEDA 3MFQA 4J0CA 3RARA 1Y3HA 3F3YA 1U4NA 3GH1A 4DC0A 5ILQA 4LJAA 4C4WC 3KOZA 3ZJUA 1H1DA 3E8MA 2VJCA 3LK7A 1EVJA 3H1TA 5HKOA 2FR8A 4X7PA 4A2CA 5IH3A 3RQIA 3G49A 3H11A 5EZYF 3EIQA 2ZITA 2WAYA 2RGRA 1QV6A 1I3LA 3C1OA 4II3A 2XIJA 2PFGA 1HYEA 1WOYA 2IHBA 3JZFA 2MYUA 4H4DA 2C00A 4KIUA 4EOGA 1TECE 5CA1B 2YHIA 4X90A 3OC6A 2XUZA 4OB6A 3F71A 3TRHA 5KINB 3IDQA 4CLEA 2Z3ZA 3N0VA 3R3UA 3STUA 3DOOA 1TEVA 2O2EA 5DKFA 4JBYA 5LD2B 2GVIA 3EE6A 4XIIA 1OBHA 2DPHA 1RLTA 1JVBA 2B8NA 1A76A 4IV5A 4KQEA 3RM3A 2HB6A 2KMLA 4FYHA 1YS1X 5JZOA 2OA0A 2ERYA 1ENOA 3D31A 3SGLA 2A84A 3EBOA 4UD6A 1WV1A 4CETA 4UTVA 1H66A 2W58A 1Z38A 2OCLA 3L1IA 3JAKA 3CLKA 2PMBA 4MRMB 1HH4A 5FPYA 3IE2A 1A95A 1U1DA 1FTGA 1KNXA 4MMYB 4ZGBA 1NVXQ 4N5NA 4C07A 1E2MA 4HYEA 3V4VB 3TVDA 4KL8S 3U1VA 4CIDA 5KOHB 5C7OO 2NU6B 4Y9UA 2NV6A 4BCDA 2CNWD 3EH1A 4JOQA 3RIMA 2IUUA 3THYB 2QMYA 5ENVA 3VO1A 3A4VA 3K5HA 4MUAA 1HF3A 3VTKA 2NVOA 4QD3A 1JEDA 1M1NB 1JLSA 5D85A 1HT0A 2JRLA 1G1AA 2OBNA 2AFRA 4EY6A 4CIWA 2V7QA 3UICA 4LYHA 1VJCA 5HTKA 2P78A 2Z5LA 5LZ5A 5DISB 3UH0A 5MDHA 2Y77A 5DX8A 4HAYA 4X66B 3JASA 3CRZA 4FSXA 3FR8A 1ISPA 3MUNA 1CPYA 2IY8A 4RYLA 3E2IA 2K1SA 4LHSA 3C3AA 1B6RA 2QUZA 5CG1A 3N2LA 2PLRA 3NT5A 3QE4A 4G9BA 2WPNA 4RIGA 4NV0A 4XJTA 4EPWA 1YCFA 4I4TA 1E2LA 2JIZD 1K5HA 3RC3A 1UDWA 2Z98A 3ZUPA 4B4WA 1Z82A 5DBGA 3S2IA 3RVSA 3HJGA 1YB5A 3REQA 3GFFA 5A9SA 3RS9A 1PFWA 1K6IA 2PLNA 3QU9A 3ZS8A 3Q7TA 5BWBA 4LDJA 1GFZA 3O8NA 3DAGA 1MPTA 4CM9D 1GKYA 4FI3C 4LWOA 1RXSA 2Q2OA 1KZ1A 1W44A 1XFDA 3G68A 1LLUA 3FDJA 3RVLA 2P6NA 3RYIA 5IU6A 4Q4AB 4S2UA 1ZPDA 3EHDA 5KJFA 3PLAE 1F2UB 4B45A 1CY0A 4EG6A 2DP4E 4R6XA 2IXGA 1PFUA 3LX4A 4G5QA 4H15A 5TQ0B 4C4RA 2HZ7A 2CFRA 2P62A 2BEWB 2I7TA 3U9TA 3FZQA 4Y6QA 1NN3A 2Y1EA 3OU6A 4OA8A 4U9IS 1X52A 3IOEA 3W3ZB 1PL0A 1J06A 1XP8A 1ZA2A 5ALEA 4EGJA 5I4KA 1YA8A 4HT3B 3UFXA 1WDKA 4XWGA 1JT2A 1NJFA 1BXRB 2WINI 3NKVA 3KV1A 3ELBA 4WACA 5K8LA 1Y4UA 2OMEA 2QX4A 1JJ2F 1DRUA 1NW5A 3K32A 4RA9B 4BJ3A 3D3WA 3BKXA 3U4CA 3WDKA 4R69A 2CNDA 5D84A 4QZVA 5KWIA 5CP8A 4JQCA 1AS2A 3BTOA 4FNMA 1ZVJA 1IBSA 2GZSA 5DVZA 3M3HA 3G59A 3KKNA 4J6FA 3NWJA 1O96A 3T5BA 4UCWA 2KQUA 4C06A 1HC7A 2AF3C 5DHUA 4R9UC 3KR9A 2CLDX 2XCIA 1EK0A 4LCEA 2P6YA 1EFLA 1A8IA 3VSAA 5J47A 5H16A 3E9CA 1BE0A 1HK7A 3E23A 2XHZA 4DJTA 1NSTA 1O5OA 2Z6VA 3TEFA 3W5IA 2LBXA 1P72A 2P90A 3UWMA 4BQIA 4H1TA 2ZJ5A 3DYBA 4QJ4A 5ELLA 3VAAA 4BJ6A 1Z7WA 1P1IA 1ZMOA 1HT3A 4DR7B 3IIJA 4A1OA 3NHSA 4QBHA 1KH3A 4AN1A 1KJZA 3IQWA 4ZOLA 2FCRA 2P0YA 4TL7A 4IS2A 4Z2AA 4KV9A 1USUA 3AW9A 1S2IA 5A1TA 1IATA 1TEHA 1WDTA 1YQTA 3O1IC 3WGUA 2VKTA 2WWTA 2Y68A 2YW9A 3TVYA 2D1RA 2YZ7A 1N0WA 4HMPA 4U2BA 1Y9EA 1FNMA 2RHGB 3I3SR 4QQFA 1NMXA 2JIMA 2O8EA 4E6EA 2BMAA 4CQMB 1M7GA 3CINA 4ZT3A 1M6YA 3MCZA 3QA9A 3RNOA 1F2VA 1QGUA 3DE7X 1WF6A 4GUDA 2C5LA 2UUPA 2VK4A 4JASB 2IUYA 2NADA 2AW5A 2NM0A 1DHTA 2KB0A 3IUEA 1PGOA 2ZVZA 3KALA 3LVQE 1FNKA 3I2IA 4CMEA 2A58A 4BPRA 1KI1A 1JJ7A 1I6KA 5KI6A 2A67A 1D7AA 1LLDA 1P0PA 2FY8A 4TVSA 5F7ZA 4K9OA 4EELA 3BFVA 3I9OA 2P68A 4P1ZA 1POWA 3RRBA 1MB3A 3NPMA 1YO6A 3IDOA 5HY4A 4B7AA 4DWOA 2V6BA 1C1DB 1DADA 3E22A 4JS0A 5DBFA 5F23A 4IHQA 1DLJA 4MWZA 4PAMA 1T34A 5FPTA 3WYFA 5DTJA 1R0ZA 2YXNA 2AUMA 3OHPA 4QQRA 5JSYA 5LQSA 3SP1A 2HA4A 4TLAA 2KBEA 5TJ9A 1KRHA 3E5HA 4PBRA 4ADSG 1XE3A 3AM4A 2PO5A 1AXEA 2ODNA 1GP2A 5JI2E 2QVXX 1ZH2A 3CRRA 3C3PA 3LQ1A 2YVUA 4IMPA 2Q1TA 4NE2A 1CZOA 3TSCA 4UM8B 1KY2A 3BTUA 2AN4A 2K2WA 3T5GA 1UEXC 1ONBA 5DLYA 1C5KA 1E1YA 3D7KA 5IM5A 1FQKA 1CKEA 1KYTA 1SXGA 2P5SA 5H0IA 4C08A 3ZG6A 3KFLA 3UAGA 4BZQA 2EZUA 4G4SP 3SXUA 2ANCA 1TM5E 4PLYA 4BTEA 2W2OA 1KXJA 4X41A 4ZDIA 1SCJA 4W1QA 2FF7A 4FONA 1ABBA 3TGWA 1VLQA 1DARA 2ACKA 2PUJA 2RGCA 5DWQA 4O2BA 3UENA 4DUYB 1NU6A 1UP4A 5JWOA 5IM4F 4C8IA 2EXXA 3COYA 3H04A 4HTFB 4B6FA 4A8JC 5TS3A 1Z5ZA 3UHJA 2LIPA 3FAKA 1XA0A 3QFRA 4XYMA 1WCWA 3UW1A 4R8KA 4UXIA 4IFIA 3ZEAA 3TVTA 5BNFA 3S03A 4LFAB 2OV4A 4YMHA 3OZXA 2H8CA 1FNCA 4G26A 3RTDA 1IQ0A 4AYTA 4E3WA 4OQ4A 4Q12A 4UPDA 4QLBA 1T6ZA 1H3NA 1PGNA 3VR3D 4DG5A 1Z88A 4IIJA 5AW3A 5K8VA 3OIGA 1HKHA 4R68A 3QY9A 5FA8A 5DK6A 1SG6A 4ZC1A 3H19A 2NVWA 1F20A 2V7GA 3PD1A 4WKOA 1KEWA 5KYKA 2B82A 1ZYUA 3H0CA 4MWCA 5JSKA 5A9RA 5M04A 4CTNA 4RLQA 2JFGA 1RPNA 3MRXA 3IEKA 3MT8A 2FWIA 3DOUA 3ZVNA 3JAWB 1T26A 2RHWA 4US0R 4XUGB 1XLTC 5KX5F 3LZCA 3CM0A 2G9VA 2ZJBA 3KP1A 3CLTC 1G3UA 1KOGA 4IVRA 2X77A 5KNCH 4A8HA 3VNQA 1T9GR 1EVIA 4OU5A 4DLLA 2W2KA 2BGUA 1PVDA 2ZAYA 3FWKA 2HX0A 4RSGA 4MPPA 3OKPA 4JB2A 5EHGA 3ZPXA 3DZJA 1WV0A 4FP9A 2D7CA 2UYPA 5ANRB 2P5TB 4GQBA 1SXJE 1X2EA 3TSOA 3F7TA 1KZHA 1DKQA 3NEYA 4P3YA 4QFCA 3A6ZA 5JROA 1E1QA 2OCPA 4HAWA 1OHHD 3BM5A 5I7FA 1OKKA 4KAFA 4OO3A 2R7NA 4PZUA 4UOZA 3FHCB 2FWMX 5C37A 1JTEA 5IJ0B 1RXCA 1N3LA 6REQB 4R0NA 1FYWA 5KYXA 4A15A 1RZRD 5IDWA 3NT2A 1SZQA 1F60A 5EHNA 3RGGA 1NUPA 1JDZA 4BMNA 2G5CA 4MOWA 5HEKA 5FA6A 1K7EB 1RI4A 3MMNA 4B3IA 1SOUA 3R0XA 3ADDA 1VBKA 2IQ5A 3UJAA 1MHTA 4MIEA 4U02A 3D6VA 1SXPA 3A11A 5BSTA 5EMNA 2ZDHA 3H2KA 2AHRA 2ZU6A 3H16A 4H0NA 5A4KA 5B7NA 1KRXA 2JFYA 2V7UA 5EP4A 3PEWA 2VHYA 1U8YA 4ILEA 1ZUNA 2NLOA 3AUFA 4LC1A 4B6GA 2XZOA 2XNKA 4ER6A 4G6ZA 4GWKA 4PAQA 1GXSA 4TL9A 4ZAVA 4RTMA 1IY8A 3LTEA 1QRSA 3LH5A 4PINA 2O8DB 1W0CA 1W1UA 1Y98A 4GRDA 1D07A 1WVMA 2HK6A 3L8HA 4HQLA 1WPRA 1BMFD 3M89A 3SYKA 4E15A 3PGJA 4WLFA 1O95D 1QAHA 1U8ZA 2FFRA 2IK8A 4I8DA 4JJFA 1X8XA 2ORED 1IDOA 1Z2NX 1DKRA 4KZKA 5FLYA 4D3DA 4Q6WA 5EJ8A 1DFGA 2OD2A 3OI7A 3C8DA 4RMGA 2I6QA 3C9RA 3MJSA 3KJXA 1C14A 1BIFA 1SOAA 3TW0A 1N77A 3TTUA 5JS1A 3VTIC 5EIFA 5EXPA 4MUNA 3SFZA 1XO1A 2CJXA 3TUIC 4KO4S 4W8GA 2FPPB 1U7ZA 1C7FA 1M9NA 3L7YA 4UEJA 1UBCA 2VBCA 1A2KC 3ZY4A 4FW9A 1DWOA 4G84A 3I01A 3NFYA 1PEYA 5EQTA 3AF2A 5FUYA 2OK8A 1YS7A 1XMIA 2P9BA 4JUIA 2VQEB 4NV3A 4JDPA 1H7MA 5JATA 1R1MA 1IG3A 3GPIA 2F3UA 3ZNQA 2YY7A 4OB8A 1E0JA 1QX3A 3V33A 4AZWA 2VAMA 1HOXA 5LM3A 4LTNA 1EX9A 4YJ3B 4OHMA 4IOKA 4C2UA 4GR4A 1AJEA 1D5WA 4ZEXA 1EFHA 5A2QM 3WGLA 1MV5A 1N5JA 3UMVA 1TCBA 2DTEA 4DCPA 3KEGA 4H3KB 1E6MA 5JC1A 1XTSA 4BMSA 2WFLB 3L1JA 4I5DA 5FJIA 3JD0A 4C7MA 1ICEA 1NXQA 3FCSB 5G2OA 2HW8A 2FQXA 5CK5A 3LPLA 3Q4GA 3IH5A 1E79D 1CR0A 4ASUA 4CM8B 1H4QA 4RLSA 4Q05A 1YA4A 1U7PA 3ACDA 3SQOA 2PDAA 1LWNA 2E87A 1UODA 3FPIA 2L69A 1KKUA 2OHXA 1G0OA 4Q1EA 2BFDA 2EHDA 3EFEA 3KXKA 1X13A 2UYQA 4AMUA 8LDHA 1UMDA 4IW3B 4IMIB 2OAEA 4KIGA 2R4TA 5EVJA 1JG2A 1Q3KA 2IOFK 2W9XA 1JA0A 3M6XA 1H4VB 3IDAA 4D6YA 3O03A 1J8MF 1EE2A 1W1IA 3ICVA 4A16A 2PBRA 1SWWA 2VNSA 4QT0A 2MQEA 3QX7A 4DM7A 5A2GA 3U1BA 5DP2A 3RGWS 1GGJA 1ADYA 1GFSA 3L9WA 2X4DA 3RFTA 5HIKA 5DOVA 3MBMA 1KOFA 2HF8A 2QRVA 2QRPA 3JD4A 1BROA 2BZGA 3OLVA 5IS2A 2J0SA 4K9MA 1W88B 1TMGE 3O4FA 1VQ8F 2XECA 4CT5A 1D1PA 2WTXA 3OJEA 3WLIA 1AXGA 3RBAA 1V47A 3I9NA 3PQ8A 2Y0CA 2PGJA 2RGWA 1WCIA 3OLWA 1XZFA 4DCCA 1OAOC 1BMTA 1Z06A 4J49A 4QU8A 1E8NA 5FLEX 2NIPA 1HDIA 1P2BA 1JIJA 2GRUA 2QYOA 3A70A 2WT9A 1XEFA 2JNWA 1L5HA 1XNJA 1ACJA 1T3HA 2DBRA 1JJVA 2I1QA 2OXEA 3NHPA 3RUCA 4EB3A 1U7HA 3L0DA 2IKQA 3NWOA 4YVFA 3HVRA 3HR8A 4OREX 4EPTA 1TF2A 4QVIA 3I42A 4DV0B 4E5UA 4W4TA 4DR6B 2R8OA 1XRMA 5LFAA 4M1QA 4Z51A 2ERCA 4ZDKA 1SC9A 3E7WA 1DBFA 3G5MA 3HMKA 1CFZA 2E4AA 4BL5A 1Y8AA 4CR7A 1RJFA 3FPGA 2P41A 2ALEA 3P2JA 4NNJA 4QU9A 4EKYA 3TH5A 1OGJA 3AP2A 4HG2A 4HGPA 2GHQA 1QLHA 2K6GA 4RHEA 3ADPA 1R16A 4C01A 3FW1A 2ORVA 4MWGA 4NNOA 2RGEA 4DHWA 5IJ9B 1ODSA 4DBLC 2FX3A 2NP6A 4REQB 3PIRA 2J0UA 3TE6A 4EVRA 3ICEA 4PGAA 4MQUA 2JLXA 3QJGA 4YHHB 4IKPA 1QZ3A 3ZWKA 3ETNA 3NWEA 4H7HA 3S5JA 2FWRA 3H8WA 3W8NA 3ICWA 1CJVC 3OESA 3DVLA 1XVLA 1C3OB 4UHCA 5DEOA 1MC5A 1KJ9A 2DTDA 1LFDB 2E37A 1Y3DE 3KWMA 1W4BA 2PAAA 3KZCA 4BRZA 4F21A 1XDGA 4C81A 1FE8A 4YJ2B 4HGQA 1ILEA 4YDHB 4BFSA 5BPFA 4IINA 4G85A 4Q7KA 3GL9A 1N5DA 3C3MA 2XNHA 1ORIA 4HCJA 4R2KA 3W78A 1ONNA 3T7IA 4F6RA 4YCAA 5HUQA 3GLRA 1YIOA 3N0XA 1YIJF 2C3PA 4H6VA 2WZDA 3HM2A 5FQNA 3DPUA 2WKWA 4IH9A 2QRNA 1CHDA 3CKMA 3GYQA 5FUVA 1PZGA 1IIBA 1Y9ZA 2O2ZA 3R3YA 2GPNA 3NEAA 4R3NA 4TMXA 1M0TA 5EKSA 1R5OA 2VOEA 1WCYA 4V0RA 2P0EA 5CFNA 4X93A 2Z8YA 2PEYA 4B79A 5IANA 3IXMA 3WKCA 5AI5A 4D79A 4DE5A 1E59A 3WK8A 3K31A 1K6JA 1T4CB 2GZHA 1U0FA 4MJLA 1OFUX 1PT5A 1RAHA 3AF3A 2A9OA 4JIGA 3WYNA 4Z5XA 4C8EA 2FJPA 2HMAA 4JUDX 1PNQA 2IIVA 4YRZA 1CP2A 4BVFA 1XQ1A 3AERB 3MS4A 2UV8A 4TN5A 5A4DA 5C2JB 1Z6GA 1T10A 2IF0A 4Y9SA 3UPDA 3N0WA 1OUMA 3N59A 5AK6A 2P9EA 5J4VA 3HKBB 3H0KA 1T9HA 3HU3A 1MNAA 5D5HA 4S1OA 5HFNA 1KYQA 3UIEA 4WY2A 1P39A 2BO1A 4UFNA 4Y9DA 2CEAA 5E3IA 3S2FA 2H2IA 4HV4A 3G1WA 1X1CA 3ZWMA 2ZRGA 3OFJA 1G8MA 1Y80A 2HA7A 1TM1E 1QSGA 3CY6A 3QELA 1L5ZA 3H17A 1XHOA 2IPMA 2O0LA 1JKXA 3O95A 4AS2A 3PHHA 1T2VA 3EZ6A 4R5MA 2NWQA 2GS9A 4YV2A 1N3YA 2CYBA 4DMUB 4A27A 1KS2A 1NVAA 1TIKA 9LDBA 1NP3A 5FI0B 4X8OA 3ZHQA 4FFDA 1S1CA 2FRXA 1DOAA 4B34A 3IKTA 3OZBA 1JKMA 5AK5A 3QPWA 4B4UA 2OZLA 1NI3A 2VF5X 4ZVSA 4BFCA 4CMAA 5AUNB 5IT4A 4IVPA 4V0MA 5LLTA 2MSCB 5IRCD 1UM9A 1JY8A 3R24A 4KWIA 1N0HA 3DNPA 4ER0A 2JJ2D 1FIUA 3QLEA 3CVYA 1K75A 4AIRA 2AOTB 5GINE 2O3TA 3IT2A 5EPOA 1SZDA 2UZ0A 2PL9A 1FL9A 2PR7A 3CXCF 1VPTA 2O8CA 1NVDA 2ESRA 1G7SA 4CLOA 2NXJA 2JJMA 4FFBA 1SUCA 2FSPA 3PPYA 1RWXA 3E7DA 3I0NA 1XTRA 3IR6A 2XA9A 1Q12A 4MRRA 2PS3A 3IJPA 4JLDA 4CKBA 1YOVA 5KTRA 3OZWA 1F1JA 1B6SA 1G7TA 2GCGA 2CHFA 4Q16A 3A10A 1XNRB 1TT5B 4H60A 1Y1SA 1BQ4A 2EEPA 1ZNQO 1OFVA 4JP8A 3ZV7A 3CCLF 4ZYYA 4DNXA 1GG2A 1TJ4A 2X22A 1QGYA 3DUWA 3KE8A 5AVYA 1Y6RA 2JAQA 2CZWA 4MWTA 1RWWA 2Z1TA 3R9XA 4UDYX 3NANA 1MDBA 1GCUA 1G8JA 2AJTA 2JHGA 4QG7A 2EP8A 3OQHA 3SIWA 4EA9A 5K0EA 5KTNA 1O94C 2GYWA 3FCYA 1RXYA 2WZCA 3DWFA 3H97A 3K2QA 4TWAA 2R2GA 1T3SA 4HBGA 4JCCA 4RFLA 4XQEA 4ZQHA 3DBIA 2FUKA 5AYVA 3W2GA 2AEFA 2Z3VA 3G2KA 3LWDA 4HVCA 2ZVQX 1I4OA 2R2AA 2VPYA 3Q5EA 2OTCA 2PCJA 5JS7A 2TS1A 4EY4A 3AGPA 1YR3A 4YRPA 5JTUA 5DNWA 4Z4EA 4FU0A 2EJBA 2HV8A 4TQ9A 4UDXX 2A1TS 2AXNA 3OBBA 4EHIA 1CD5A 1PK9A 2I3GA 3EJWA 2G67A 1E4VA 1E63A 4RF4A 5CIQA 5DMHA 5BQXA 5KHOC 1IOZA 2YZNA 3U4IA 4ND7A 4YJHB 3VJLA 3VVMA 1NN0A 1L7RA 4X7RA 1Y5LA 4BGDA 3FNIA 1A9PA 3EZ7A 5KC8A 2W6NA 2XZPA 3AP3A 3ZJVA 2PRZA 4L4RA 4L8YA 3NYQA 4B3MB 2RI6A 4DEVA 4UCQA 5BN5B 1JEQA 1RWMA 3ZU3A 3U09A 3P1JA 2XRZA 3OTWA 3HRHA 1FRFS 4HB2A 4U2KA 2PU7A 1Z6YA 3D54A 4P0QB 3SC2A 4FEAA 4MKIA 3DFZA 4U2CA 1OFUA 4C6TB 4AJHA 1PQPA 1LGYA 1ZGHA 2IYVA 3B78A 5FD8A 5JAQA 3TFWA 3NBUA 4PR0A 1FVOA 1L5SA 5B5SA 1T5OA 4I99A 3KIPA 4MGKR 2P35A 4X92A 4MROA 1EGMB 1VIVA 2VA9A 1UPTA 1WR8A 2GK6A 2VTVA 2EIHA 4IICA 2P3QA 2ZJ2A 2FJ0A 4UBJA 5B6JA 2YMQA 4PZ9A 4YXFA 2HWWA 5D86A 2DPYA 1OIWA 3K1JA 1NLZA 2VYVD 4NEQA 3CIOA 4YRDA 3ASYA 3GDFA 3AUSA 3FMIA 1RJ9A 1R4AA 2HJGA 1XZKA 4PNHA 1E89A 1N57A 1Y8RA 4TXLA 3BX1A 4LJ4A 5AKLA 3MDOA 3W0LB 5BSRA 2FGJA 4GYKA 5EJMA 3X1JA 4F4DA 2R4QA 2B0CA 2WJGA 4IG4A 5KHLB 3PC6A 4J6EA 4G5XA 1YI8A 3JQFA 4FEYA 4LCKA 4TQGA 4BNIA 1ZW1A 4BVKA 1LVGA 1GSHA 1IPHA 5IASA 4MK4A 1SIBE 1ESEA 1X1SA 1NP6A 2R60A 4MMZB 2EDCA 3V1NA 2ATEA 3CFYA 4B17A 4U7TB 4BMYA 1Y48E 2WSYB 4US1R 1WB6A 4FFOA 4PHTA 4Q48A 4YPOA 1XDBA 4J07A 4RGYA 3TK1A 3S81A 1IHPA 2H4WA 2G08A 1DS6A 4RIIA 4GM1A 2JFQA 1EDDA 3AKZA 3R7WA 1SHLA 2VZLA 3WAJA 1ZX1A 2R3SA 3QEJA 4YTEA 1RWVA 4ZRDA 2B4YA 3GROA 2Z5VA 1X9GA 3ETDA 3OJXA 4V0OA 3ABIA 1Z17A 4MUEA 1TYBE 3T3OA 5EHIA 3KKZA 1EP9A 2YYZA 4B3SB 1UFRA 3GLSA 1EVLA 2PUVA 1VIMA 1XZNA 3NBZC 4XA8A 1VMEA 2B4KA 3WLAA 1Z4NA 2VUIB 1N6PA 5LMZA 3D02A 4MVJI 5A5FA 3VSBA 3ZXUB 2ZULA 5IYZF 3LFUA 1L1EA 1UDAA 3ZXXA 2FWBA 1KE2A 1LJ8A 4JENA 4YH1A 3T8YA 3VKGA 4P80A 1T6NA 1JR3D 2BLLA 1W0KA 2H18A 2AFHA 2AXQA 3EF0A 3ZP7A 1W41A 4IS3A 2BONA 2PWYA 2Y1CA 1DTWA 4Q1BA 4BVTA 3M2PA 3QPUA 1DOHA 2GHRA 3NIBA 3SVTA 1CQWA 1QLJA 1ABEA 2W4IA 3WLTA 3HVUA 4KR0A 5L6LB 3RVNA 2JB9A 5KDDA 2CJWB 2C0CA 3K9LA 5JYEA 5TLSA 3BDVA 5GPBA 3W2HA 1N78A 1P4HA 4FYVA 5FV7A 3VH1A 4ZOQI 3DF7A 4DR3B 2R6AA 4MV3A 4QE3A 4Y6PA 1FYEA 2I4OA 2O50A 4QO8A 3WK9A 2AMVA 2VT7A 4CF5A 4FYIA 4HXYA 4MULA 4UULA 2BUAA 4JEUA 5CDTA 1HG0A 3DE4X 1J9EA 1OYYA 4ARVA 3E3NA 2C20A 1WBJB 1DXHA 2ZYAA 4JX9A 4A0QA 2QLBA 2C95A 1KSJA 3LD9A 3O9VA 3VPHA 1HQYE 2NO1A 2ZP1A 2L2QA 2NT3A 1M34E 4U9HS 2Q6LA 4BY9D 2FUG1 3H05A 3GEIA 5E0OA 4NK4A 5ESWA 4HAOA 1V7ZA 1EE1A 3PUIA 5DEIA 3FTDA 4EF5A 3AQ4A 2J87A 3E9EA 3ZCQA 5HP8A 4ONEA 4RV4A 1LPSA 4FMDB 3K9FC 4MLPA 3ZWPA 5AESA 3QMWA 4NYIQ 1PJQA 3PEFA 4FQ8A 2YW2A 1COWD 3QEBZ 4Q4LA 3P9QA 1HR0B 1PFVA 4KWTA 1EP2B 1NX9A 4MITA 2ZJ6A 4DHEA 3FWYA 1XQYA 3GJ4A 2I5PO 3MEQA 3F6EX 2R1TA 1YRHA 2OYRA 5K3BA 3DLAA 3UT0A 3SAJA 1GZ0A 4A9AA 1DC7A 1PHRA 2IHYA 2PRSA 1YE5A 4BLUA 2HXSA 3LP8A 4AKHA 4TV8B 3DHNA 5DJ5A 2HJWA 3ESJA 1XVIA 3BMOA 1SU8A 3QE2A 4C7KA 2OFWA 3OMWA 4P4GA 5L7YA 3UHAA 4QWWA 5DP1A 4R41A 3PTLA 1EYZA 4GM4A 4IQFA 1OZAA 4KPUA 3K4HA 2WJ6A 4RK5A 1YQNA 2HDHA 1KGSA 3F3MA 3VR4H 2WWYA 4U3JA 1RRVA 2P3SA 3RYFA 1A2BA 1EUCB 4INPA 1AQUA 2J3IA 3IIMA 4P92A 2QQEA 4J1SA 13PKA 1O4VA 1IPAA 2R96A 3UO8B 1RDFA 2GWHA 1WVIA 4JT2A 1MG5A 1T2NA 3DUFA 3ONNA 5DYWA 4DDKA 3UCFA 2FMHA 3QVGB 4ZV4A 1C7EA 2HSZA 1PF7E 2PSJA 4X7BA 2VNIA 3GA7A 2WAAA 2R5FA 2PPVA 3V2HA 4QUKA 4Q9HA 1ID8A 4BVSA 4E08A 1XSEA 1H8HD 2YHUA 4YWHA 1G8YA 3N87A 1V5IA 4HX5A 4M7PA 1K63A 4H27A 3U60B 3VTZA 4KQGA 4C78A 1FA9A 2B2CA 5EXXA 2V58A 4FWIB 3EQ2A 3MTDA 1PNTA 5HP7A 1VGQA 2GVDC 2OFFA 1RE0A 2YOFA 1JIUA 3PQ4A 1KP9A 3A4TA 4I9NA 3KT3A 1WXHA 1VFPA 2CUTA 2C5FA 2HAEA 1SKBA 1E9DA 1XU9A 2KM1A 4QXPA 2ZJ1A 3KT0A 4J1NA 1Q0HA 2PUEA 1J7HA 3IDSA 1XJCA 1ZAKA 1YQUA 1EUZA 2NO0A 2BF7A 2WE8A 3PL1A 3G8YA 3GD5A 4Q1AA 1C7QA 4K9RA 3NK7A 1D2CA 1E1CA 1M34B 3K0FB 3CB4A 2UVPB 4ZHQA 1A4RA 3MBOA 1EK5A 4LSZA 5EQFA 5HHTA 3WJQA 4ETIA 1J9ZA 4YP5A 5MHTA 2AEJA 3RBVA 3JS5A 1V4BA 4JLKA 3C5VA 4CT0A 5LP6B 3FUTA 1TFUA 4D9FA 2CV0A 3QX3A 1WMDA 2HBRA 4Q5IA 1HDRA 4NMHA 4W9NA 1H2XA 1Q0UA 3K92A 3Q8XB 2PGLA 1FBNA 2PK3A 3WB9A 4FJ1A 3EIFA 4L6AA 2XAAA 1LTHR 1WPQA 1M6WA 2RONA 3DF9A 4TKVA 1M2OB 1Z0SA 3GPCA 4J29A 4YX9A 4PV7A 2FMIA 1V95A 5CIYA 2VWQA 4DR5B 4NZMA 5LA6F 5CB8A 1Z13A 1M72A 4MR7A 5DXFA 2HLNA 3W3AA 2YQ4A 1U1GA 5IUJC 4R9SA 3V32A 1XRSB 1SD2A 2E7ZA 3B3AA 2ICAA 3MUOA 3QQ5A 4BGVA 5A5VA 1KBQA 3GP8A 1VG0B 1P4GA 2JEOA 5F1OA 5IBRA 3G0BA 3CNOA 3QUSA 5G4KB 2MSEB 1IEXA 5EE5B 4MINA 3FPLA 5IAEA 5J5CA 5A5DA 4W9RA 3B7WA 1DJLA 4K9LA 5EINA 5BORA 5EIAA 1YDWA 5JSHA 3QBJA 4TWIA 5JSFA 1N2SA 4IIDA 4FSDA 1AA6A 1ZBQA 3BG5A 1N2OA 1E9AA 3HZZA 3KXLA 4B43A 2ZGVA 2QN1A 1LNSA 1ID1A 4UM9D 2NZWA 1U3PA 3PEYA 3WADA 5G53C 1GO1A 1AZTA 1OLSB 5JH7B 2EP7A 3PC8A 3T5DA 3WG9A 2Q5FA 2P3OA 3ZCPA 2JIPA 5C5DA 3LHFA 5A3VA 4M1SA 3UC9A 1PXWA 1UXOA 2BBWA 1T1GA 3AWDA 3QMMA 3TX2A 1KGDA 3IEUA 3EGWA 4I7EA 3CC7F 3PUYA 2FUEA 4N7BA 2ORYA 1NVUQ 3B7GA 3T3IA 3OQMA 3BZUA 1DBPA 4P32A 4B4DA 2EWCA 5ECGC 3LP6A 1ST3A 3Q3HA 2OT3B 1PJ2A 1GU1A 3WB1A 2BMFA 4N40A 3FZNA 3DBVO 5GM2A 4TTVA 2G06A 1DZ3A 2GFQA 2LCIA 2O0HA 4UHKA 4MQ4A 2JCBA 3OE5A 3MTQA 4FKMA 4JB0A 4OOEA 4JYMA 2P2ZA 3GLFA 5HXUA 4LI0A 4XRGA 5JW6A 2WIDA 3TPFA 5AJZA 3QV1A 4FD2A 3UWSA 3OLYA 2WNSA 4GF5A 1TF5A 5DH9A 1JFSA 3LZDA 5F4ZA 2PZLA 2WD9A 1Z5GA 3CMCO 2X2PA 2QJFA 1R0YA 4P08A 4KITB 1Q22A 4RESA 4XQCA 3WYDA 1R6DA 1VQ1A 3LVBA 3NQ41 3CONA 3JYPA 1HWYA 4WGGA 4Z2YA 4BUJA 3C3YA 2ZR8A 5CA1F 5JJBA 3B3FA 1JZSA 2NXEA 5LKAA 3F47A 4B0PA 1NT2A 1QV9A 4B84A 1YRWA 2P69A 4YY3B 3KVYA 4CIBA 4NOKA 5T4BA 5KU7A 3FG9A 4DV3B 3EVNA 3U7JA 4ZOEA 2C03A 4LY9A 4QGGA 3NG1A 5FFNA 3UN1A 1UFKA 2QIPA 1SELA 1KU0A 2UYGA 3EUAA 3FYUB 4AU1A 3S8YA 3CVXA 3T7EA 4B62A 1EFAA 1X0VA 2QZSA 2RHRA 1BVUA 4IIEA 1NG9A 1JQEA 5IC5A 1ZISA 4R1TA 3VR2D 2IG8A 1VOTA 1OPRA 1S7GA 1CQJA 2AR0A 3BIFA 4BBAA 4BBZA 3LBAA 5CFOA 1D4AA 1PU2A 3DZKA 1QU9A 4WCFB 1HOTA 2ZRIA 1J5EB 3D7MA 3C6MA 5ALZA 3Q88A 1T0AA 3WLFA 3GN1A 3H42B 2CLCX 4W7IA 3Q8HA 4R9VA 3TRDA 3H0EA 2O3RA 3KDPA 5K0SA 1CJMA 1ZR2A 1AZWA 1FP4A 4TWBA 1ZVKA 4GX2A 1GN9A 2HDNB 2EQ5A 1GG9A 5KSWB 3JYHA 4HF7A 4HSEA 4P0PB 4UEQA 2PJRA 1JDSA 3LCUA 1MFZA 4LOKA 4HMQA 5C3MA 1YITF 2FN9A 4NVRA 3RROA 3WP0A 5JU6A 4MUYA 1HYHA 3EGEA 5AKIA 2DEUA 4QFMA 1QHNA 1M10A 4KJXA 3SU8A 1RBYA 3PDCA 2I7VA 1JHMA 1H42A 1MOQA 4P31A 1RM4A 4L4YA 2F62A 3GEEA 4Z3KA 1HI9A 1XKTA 2X5OA 2YJ4A 4G0ZA 5CYGA 4PAOA 1PWXA 1OA0A 1ZU4A 2B1GA 2CNWA 4KQ1A 3GLGB 4AD8A 4Z0TA 2VHCA 5BQ5A 3SJ7A 1GQSA 3A0UA 1UUFA 3NV7A 4IIHA 1V11A 1AGNA 2HGSA 3DBHB 1T8PA 2VT2A 3GDWA 3LJKA 3HN2A 4WINA 3CC2F 4KMRA 1J49A 3IOYA 5EHXA 5JMTA 2ZUWA 5IVHA 3TG2A 4YUZA 3K0SA 3R6LA 1XYVA 4FDUA 3M6WA 4X1YB 2EKBA 3OWOA 3GK3A 5K4AA 3ZZ1A 4ZZ0A 1QCCA 2ZYDA 2WTBA 3MAGA 4GE3A 4UTZA 1U2TA 4C03A 1Z4MA 3D6NB 3LNCA 3FRHA 1GKIA 2DWCA 1VRCA 4X1IA 1PFYA 2X4IA 1KEPA 3AEZA 5AKJA 2G4LA 3NS7A 5H3CA 1YR2A 2N3ZA 3OZTA 1W48A 3W5HA 2JIZA 2YWJA 1SBIA 4NHOA 3L93A 3R7FA 2ZM5A 3H4IA 1K5GA 3WXMA 3K0EA 5SZHB 4LBWA 1SUIA 1DIOB 2WG2A 3JD1A 1XVUA 2IBTA 3T0GA 3GLIB 1KH2A 1PJBA 1M66A 4QAJA 5C1DA 5EJAA 2JLUA 4CM9A 1B7GO 5IG2A 1J42A 2YVKA 4FHGA 3KVNA 4I1RA 3GFPA 1Q7GA 4HDNB 1WXIA 3TX6A 5GGYA 2P2DA 1WXGA 3L4EA 2I2WA 3AILA 5F9FA 4V0SA 3OBWA 1O6CA 2G8LA 4MPJA 5L7WA 5K0ZA 3FNEA 4JP1A 4BVQA 2BT4A 4S1NA 1B4DA 3C3JA 4BASA 4QKQA 1CDEA 1CVLA 3EIEA 4FR5A 1UQRA 4YUWA 2BHNA 2WIFA 3CE9A 4Y2TA 5TB5A 4AY2A 2CB0A 2F3SA 2WE7A 4J0GA 4LVOA 2PHZA 3LPCA 3VBEA 4I1VA 3DL0A 4BNFA 3JR3A 2H57A 1UMKA 2VZ9A 4WVLA 1BVYF 3VJMA 1EXWA 1K7FB 5IVDA 5TPWB 1N9GB 4EO7A 1YGYA 1NNSA 4J1TC 1VE9A 1N2XA 3I01M 4KVZA 4QDOA 5D1NA 1O8BA 3TMKA 3QUAA 1U8TA 3PHCA 3VNSA 4UM7A 1NUAA 3CKYA 3OJWA 5B7PA 3HVKA 5AVRA 1ZL0A 3I6IA 4A5OA 4RM3A 3SQWA 3E7FA 2LDBA 3FPFA 2A35A 3KYCB 3PWTA 4HDAA 2Q1WA 3R6TA 4P83A 1PT6A 1W87A 4HEHA 4RDIA 1U94A 4P58A 2GK3A 3NKFA 3VPBA 3DYIA 2XXAA 1ZUD1 2Y93A 2OZBA 3EXAA 3O8LA 4NJEA 1NVGA 3ELDA 4ARSA 2WD7B 2JFNA 1PRYA 1Y7TA 3PRHA 4K3UA 4DYVA 4A3SA 5TX7A 1FY2A 1ORRA 1OVMA 4S1TA 5KYYA 5DZSA 1SBYA 1G41A 3OCXA 1QC5A 3RSGA 2RCNA 3I0ZA 3QXHA 4S2EA 5A7FA 3LS2A 3JATB 3DEHA 1HE3A 1VP9A 3CURA 1O2DA 1FP1D 2BFBA 2GPAA 2P9ZA 4IFTA 5B4TA 5JBNA 5JJKA 3LRTA 4AQDA 4C6SA 3D7LA 3RODA 2P79A 1IBMB 5A4MS 4AL4A 1C4OA 1XG5A 2P9GA 3H5NA 1QRTA 1C8KA 4TM7A 3QUCA 4MWBA 3A05A 3JTMA 3QM1A 3SN6A 4KBYA 3P9SA 3JPWA 3C4JA 3M81A 2BTUA 3CZ4A 1SKQA 1NR7A 2WYIA 1MZVA 2V7WA 3R77A 3RRMA 4JWKA 3WYCA 4ND1A 1K4KA 2OUKA 1QR6A 2PRKA 4DANA 1IAQA 5CVEA 4YRTA 4OBWA 4D41A 4JN6B 1IVSA 1U0GA 3VDRA 1QH8B 1ULSA 2P6MA 2ID4A 1FK8A 2DFTA 3K9WA 3U7QB 4A10A 4CG2A 1OB2A 2IBSA 2IH4A 1QQBA 3R09A 3KPJA 3ROTA 1IIRA 1F4LA 1EESA 1QIHA 4NU8X 2Q5LA 4MQFA 4YRSA 4CDRA 1U0OC 4AF7A 1WD7A 5EZYA 1W4LA 1EK2A 4HX9A 4W6QA 3ROPA 3UANA 4C0SA 5AM3A 1ZIXA 2XRYA 2WYHA 4GP9A 1P1HA 1AH2A 1QE5A 3FD5A 2ZI3A 4EHLA 1F8YA 1EFKA 5MN5A 2DWUA 3REOA 1Z07A 4R8RA 2RH5A 3EEBA 3RSHA 3DO8A 3P9ZA 4P4SA 1X7XB 2JFPA 4TL6A 3ZDBA 4MIKA 3SF0A 4JODA 1GITA 1KNQA 5LLSA 2K7FA 1N5IA 2YXZA 1BX0A 4EP1A 3C24A 4EUHA 2OVFA 1GQYA 4GOND 5JAHA 1CQXA 1AQJA 3V1LA 1IVNA 2DX7A 2XQKA 3HB4X 1KQNA 1HT2E 1OZFA 2HN9A 3JAMA 2NV2B 3IPLA 3EF3A 4HAIA 2EU8A 3QLVC 2QRJA 3PE4A 1L3IA 3LFOA 1DV2A 2I65A 2MSDB 2J07A 3PFBA 4PPFA 4UUQA 4Y1GA 1LLFA 4DRXA 3MT0A 1KC3A 4HLUA 4PQYA 3V8BA 2YIJA 4OK5A 4BQEA 3PNMA 1UKEA 4WVFA 4BQOA 2BBSA 3RS2A 3ZHUA 3VYVA 4JY7A 4LJ9A 2FSSA 2VJLA 4TZTA 1FQWA 2Q5OA 1TADA 2FRDC 1D4OA 4UU0A 5TV2A 3PG5A 3A8TA 2IW1A 2YJ5A 4BO4A 3UK0A 3NKLA 4NF2A 4R8MA 1CIPA 3SYTA 1RMQA 1Z83A 2I4RA 2HCBA 1O03A 3I1IA 3W2IA 3VR3A 2QM0A 4KAJA 1KY4A 3E70C 4XB1A 4R8VA 4WY8A 3JCZA 4CG0A 2BM9A 2J9FA 3PFWO 2WF9A 1TVCA 3N0TA 2PYDA 3BSWA 2YRFA 2XCOA 4G1FA 4KLAA 2Z1UA 4WDRA 4WY5A 3S02A 1PO7A 3ENNA 3UM9A 4G1BA 4L73A 2A1UA 4U39A 4M1OA 5GV7A 2XUDA 1OB5A 3W4IA 4FEGA 1CUGA 1L3BA 1QAQA 2R5WA 1NDQA 2O3JA 2Z8YM 3C45A 3SHWA 3X2FA 4ZT4A 2QRLA 2XI4A 1W4ZA 4LQDA 5NULA 2H7CA 4K26A 4IIYA 5I7VA 1NVMB 4DSUA 2C29D 2ZVPX 3FM9A 3IJ5A 3R74A 3V7UA 4V38A 1HXHA 5DIFA 1KTIA 5D7BA 1Q82H 1PN3A 5CCEA 3OM8A 3W1WA 1QU2A 3P4EA 1RE1A 1I1NA 2VJMB 3EAFA 4B71A 4Y2HA 1T2AA 4NCIA 4OGGA 4BS9A 3FUWA 4HDSA 2AEMA 2DFDA 3C7KA 2AN9A 1T43A 2NTNA 2CHTA 2JDID 3MJ4A 4HDOB 5DYNA 1VJGA 1D4ZA 5FAXA 3O90A 4XGKA 2N47A 1MPXA 1Z5WA 3G5TA 4B3XA 2QG9A 4EDHA 4YMTA 3OCYA 4BO7A 1IJBA 1HTTA 1N9ZA 2IX9A 3GRVA 1OHHA 3EFBA 4QDJA 3MTGA 2GD6A 4JP3A 3NM4A 1J90A 5I8ZA 5ITZA 2DBQA 5E9AA 2WDZA 8ADHA 1MBZA 2FDRA 4DM3A 5GVSA 1J4AA 4BV3A 3F1KA 2YYYA 4XYBA 4ZT6A 4KR7A 1S2LA 2QI2A 3R8CA 5KSZA 2YZ2A 1RZRA 3F9IA 3I56F 2MWMA 4NJMA 2DR2A 1DFIA 1JG6A 1OV6A 4MWSA 5JZMA 3KWLA 5LDGA 4JVOA 3N1UA 5KNCD 4NCBA 1XWWA 3F67A 3UUWA 4FYPA 1K0FA 1I1QB 3BSYA 4UEWA 5AJTA 3PBKA 2DOKA 5T7BA 1JHQA 4PSCA 4QYIA 1RIFA 2BGTA 2E18A 1I2DA 1TJNA 2HF9A 2W83A 1ECGA 4IDQA 4J91A 2VLBA 1T1IA 3WGYA 3H9BA 4OX9B 1JXMA 1XXHA 2PANA 3HCEA 3P0HA 5CGZA 3FDXA 2A0XA 3HCWA 5E4FA 5JOQA 2QM7A 4Q39A 2QB5A 1W85A 2L0XA 2UVQA 5KQLA 2FJUA 3F0TA 3HA3A 4M1KA 5D5QA 1EB8A 3B1XA 4Q1CA 4R9NA 3RSFA 4CMHA 1WD5A 2YIVX 1B15A 1IBRA 3O5AA 4IDFA 4XFJA 3R0PA 1BMFA 4HWPA 5KKNB 2QUJA 3DVSX 1RJDA 4MVYA 4YJ3F 4DAOA 3QSGA 5JWHA 1W76A 3JVUA 1S8NA 3PT9A 1IEQA 3GT0A 2FW7A 4IVQA 2IYEA 4OBEA 4OF4A 2FRVA 3C7DB 3N28A 2VNKA 4X6UA 4G1MB 5AHRA 3ADCA 4D4JA 1G6Q1 1GNSA 3S7TA 3UYLA 2VR1A 4ZOAA 1YH3A 3AINA 4XIYA 3L1UA 1ELOA 3R2JA 3UC5A 1ML3A 1T2FA 5AQ1A 2OD7A 3IAFA 3TJMA 1Q7EA 2A0FA 3HR7A 2WFAA 1GUDA 1RLGA 1PJ4A 1RQXA 1U2PA 2B1JA 1LFAA 3QKSB 4OIFA 4PZPA 5TGZA 3PCTA 3RIGA 3TI7A 1EEXB 4RPJA 1Z73A 3FLAA 5AKEA 4ZTUB 2XYVA 2GOYA 6ABPA 4CKEB 1MEJA 3INTA 3NVKE 1E64A 1R64A 5CBPB 4LK3A 4CLRB 2HSEA 2PX0A 3JW8A 1YRAA 2CCJA 4I1SA 4X95A 5E6RB 1OD6A 2FR0A 5HJ5A 1QMPA 4TUYB 1IE3A 1E62A 3D5QA 2JF0A 4NZPA 3UTDA 1EWVA 2OB2A 4NX2A 4IGKA 1N5MA 2OCDA 3MJHA 4BUCA 4CMCA 1JPVA 2CT8A 2XODA 1RYYA 4RXMA 5ERYA 1G17A 1C1HA 1E1LA 1JKJA 3ZTWA 2ZVYA 1U5BB 2BR5A 3CUYA 5CNMA 4RZSA 4ZK2A 2XTAA 1L4EA 3QLUC 4C6RA 5A4FS 4XJXA 2G0TA 4K6GA 4DLSA 3LZ6A 1FFBA 2JHCA 3GGPA 4EPVA 1NI4B 2EBHX 3WBKA 1ZVVA 2XE7A 3HJWC 4DSNA 5IKMA 2KE5A 3U7IA 4PBTA 1YBFA 3IP8A 2IEDA 2Q5HA 3HC7A 3MWGA 4FS3A 4WOJA 3URMA 5FR1A 1E7MA 3C5HA 3DE2X 3O8DA 5E8RA 3J81A 1SD5A 4Q18A 4XM2A 1II8B 1XZQA 5FBRB 1ECJA 1XZ8A 1WW8A 5FADA 3NTXA 3JALA 1D1QA 1DAFA 1FYDA 1RYHA 1JILA 1MABB 2LCFA 4MS1B 3DMNA 3T4PA 5L6MB 1KETA 2PH5A 2QQ5A 3FTCA 3GLHE 3WZ2A 2O07A 3EYWA 5IULC 3D2BA 4ISCA 4NDZA 4DRYA 1JVNA 4FHEA 5FWNA 3FTEA 2VK1A 2VWGA 1Y82A 3D6MA 4JGBA 4UDOA 3VDQA 5P21A 1ZVMA 1B0AA 1O77A 3LUCA 2HCFA 5IM4A 2XSZD 1CRLA 1EUDB 1F7UA 1L7NA 1GA4A 4R1UA 3NDJA 4GR9A 4KMMA 5AICA 2COUA 3LYUA 3JPYA 1QH0A 5T3YA 1OIXA 1ODIA 2W2PA 4NCJA 1U43A 1BJRE 1QF6A 3HY6A 3AVPA 2XGOA 5HA5A 3W2FA 4DLXA 5AJYA 7MHTA 3T5AA 5FI3A 3HKDA 1FFXB 1EINA 1RS0A 1PGJA 1QO0D 2OILA 3QVSA 4UAVA 3SOZA 2X8BA 1C0LA 2EG9A 2FPOA 2AMLA 1EJ2A 3I6MA 5EP3A 1AMOA 3G8AA 1PKXA 1UQTA 4YJ2F 1BDIA 1JHAA 3BN3A 3NTRA 4OHCA 4AFNA 4DSOA 3GPLA 1WM1A 3FSEA 1C7RA 1GSOA 1YS6A 4UBIA 1MRNA 3N5CA 3RF6A 1EDZA 1DAEA 5FT9A 5FI5A 3EZGA 1LPAB 1UINA 3ON5A 4ZI7B 1E2GA 4LF5B 5BYAA 1V9CA 1YA6A 4UUOA 5FOQA 1NMZA 5KX5A 5E8JA 2C3MA 1DEAA 1Z22A 3FTQA 4Q9DA 4C8GA 1K7CA 5BR1A 2VP2A 5BRNA 5LQKA 4KXNA 5THXA 3TYXA 1PZMA 4B4KA 3IPRA 3PXBA 2ECPA 3EHEA 3VYSB 3MJTA 1NY5A 1BEUB 4IWXA 4U6SA 3QKWA 4I1OA 3TNYA 1FQOA 1LW6E 4CEIA 1ESMA 3VOTA 4NEHB 1UK7A 2X23A 4TRMA 1I4TD 2CYCA 2JFOA 5DHTA 2GM3A 3RF7A 5DN6D 4MRVA 1RCTE 1XEWY 2LVBA 2XY4A 3TKAA 3INGA 1IEWA 1H3EA 3K4PA 3KZ1E 3UFBA 4IH4A 2EJVA 3U7FB 1VTKA 5JMWA 2UUCB 2CK3D 3L7AA 3RTEA 3B1YA 3N2YA 3NHAA 3KYIB 4JQZA 3ESCA 1EFTA 4ZOCA 4CN8A 5CCBA 4MV8A 2Q0QA 1IHDA 3EXHA 1G2IA 3HADA 4WXPA 4IRUB 2HPHA 1H6AA 2IE8A 5ABPA 4BX8A 1Q0TA 2IH2A 4OATA 3JRXA 3KT6A 3I9FA 3KD3A 2B35A 1RYDA 2QMUA 2VFAA 2BFFB 4OQFA 5EUBA 3QVUA 2P6PA 1Z8DA 4L8FA 1TC1A 1XZAA 3DOFA 1F8XA 5LQJA 2QLFA 3MWKA 2E6UX 2BI7A 5ALMA 1YUBA 5ALYA 5LNK1 1MOZA 2Z2XA 3SEFA 5HXZA 4AZVA 1LVHA 2OYCA 3MQFA 1ZDMA 1Y4ZA 4HTAA 3UT6A 4NXMB 1RWPA 1JFVA 3ITEA 2QTMA 3MT9A 3KL2A 5K8UA 4MZXA 2KX7A 3G2PA 3MMSA 4JJ8A 4G0UA 4UKDA 1YQGA 4UPVA 3E2MA 3L41A 3QPAA 1JLLA 2OENG 3P32A 4YR7A 1XJ5A 3U16A 5AKZA 3GI1A 5GM1A 3U3KA 1IV3A 2WAXA 1RP1A 1SZCA 4YONB 3OJOA 5BURA 1J2JA 3NI2A 4DNFA 3WLQA 4E31A 4S3MA 1KNJA 4L57A 2FSVA 2J3MA 3LDUA 1UC9A 4KUHA 2C04A 1BZYA 1DX9A 2FPKA 2FQ1A 3HV2A 4RV9A 1XTQA 4I14A 1AGRA 1JTVA 3C7CB 3GUVA 4UATA 3WWZA 4OY3A 1U7WA 3BEOA 1I7DA 1NNLA 2HWUA 2P9HA 3OMXA 4W9NC 3AI1A 3ZIUA 5B3LA 4QGSA 2UYYA 3O3NB 3DJFA 1CK2A 2OCBA 3FVWA 5E38A 2B33A 4DN6A 2WHYA 1U2EA 2AD5A 3AW8A 3B89A 1CZHA 4FJ0A 2KG4A 1L5KA 1YZGA 1THZA 2CDNA 4PRYA 4N6OA 4Q66C 3RKUA 2F8SA 3AK4A 4X6LA 1LDBA 1SBCA 5I7UA 2BGGA 2WLTA 5AJUA 2RHHA 2PZ8A 2OCYC 1GCGA 2JJ2A 4ZCIA 3BD9A 1NAHA 3N2KB 1OC2A 5GZ6A 2BCEA 3SHTA 5KB3A 2DBYA 3CO5A 1KVSA 3NGLA 1TVEA 3RIEA 4FZ5A 3ROGA 3ZHVA 4DEXA 4C0JA 2IZ6A 4RVSA 3WHPA 2VK8A 1ISIA 3L0SA 5HGJA 5A3SA 3VC1A 2GJ8A 1TO2E 5ES3A 2R7MA 4WZAB 3ZOPA 3VVCA 1FSZA 1P7YA 1LU9A 1PZNA 2V3VA 5DT2A 4BT5A 2F59A 1ZY2A 3H1BA 4LZJA 4QWMA 4U63A 1WHTB 1SC3A 4CQLA 1I3MA 2P2YA 4ATNA 5JSZA 2EW8A 3PNVA 3FETA 1H93A 2C5AA 5KMGB 2NZYA 4EHKA 2OZPA 3KZNA 2APJA 4MUXA 4DREA 2CXRA 3F1LA 3E1YA 3T95A 5HZGA 3CMEF 3FOBA 1EK1A 4DA0A 1XVVA 3KLMX 2V9ZA 2WM8A 4EW1A 4UNRA 2PZMA 4HB3A 1JHZA 5C8ZA 2NTYC 3SZMA 2H65A 3IQGX 2W8BA 4MX8A 3W6UA 2VUSA 1YRYE 4HATA 4N5MA 1QQ5A 2P5YA 3L4BA 5CB0A 4BLWA 3WDMA 3ANSA 2IY7A 4EI7A 3PQEA 1LSUA 4YAIA 4XM0A 4AZ0A 4YUXA 4FHFA 3SX4A 3GAZA 1G3RA 4W1PA 3ZQJA 2RB5A 4W63A 5BNIA 2RG7A 2YVAA 1YZ3A 3N58A 2QTHA 4Z3DA 1RKXA 3N07A 2ZIVB 4UTXA 4Y2YA 4U6NA 4TXNA 4PO3X 5LKRA 2GJ4A 1ECPA 2E5FA 4F2DA 5I5EA 1I7QB 5JJCA 5EXEA 1SOMA 2ON6A 2QEQA 5C4GB 3ZZNA 2GN6A 1PAUA 3MBIA 4FHDA 5E95A 2XUQA 4F9GA 5HR5A 3JWHA 1A1SA 2PJUA 1L7OA 4GICA 3P2EA 3M2TA 1Q0RA 4QJ3A 5DM70 3DZGA 1ODFA 2BKXA 4A4DA 5F2EA 1IJFA 3B1KA 4IDHA 3W8EA 3STTA 4AO7A 3T7JA 2CDCA 3T9CA 4MAMA 5E6UB 3P96A 4UCXA 2VH2A 3AESA 2HEIA 3ROFA 2BAGA 2G1JA 1U8XX 1BMQA 2ZUCA 1CZUA 1EJ0A 3IAS1 1P60A 1UJCA 2IC5A 3A36A 3MIIA 3W5AA 3CEJA 4WZBA 4UEKA 4C2TA 2Q3MA 2WJIA 1RRFA 1RPTA 2RAUA 3G17A 4BQNA 2GTIA 4I6EA 4M8SA 4IQ4A 1TQDA 5JXGA 4E09A 5AFSA 1O97D 5JLJA 2NXNA 4M0PA 3I7TA 1YQDA 1SBNE 3DZIA 1BKDR 1PL6A 3DTVB 3KU4A 5CFPA 1TRHA 4IUDS 2CY0A 2IP4A 1TLLA 1WNFA 5AVJA 3RD5A 1E0SA 3EQ9A 4OJNA 1G8AA 4JJAA 3FNRA 3BICA 3SNHA 2GJKA 4KB5A 5IHPA 3SKVA 3DXXA 4KOAA 3AUJB 4RKRA 3WGHA 1YUNA 2QRZA 1DP4A 4AY4A 2CXTA 1KRWA 2WKPA 2V0GA 2WY2D 1EXNA 2FNAA 3Q2IA 3H2YA 4LS3A 3UGTA 1L4UA 1R8XA 4LVUA 2PSDA 5JEDA 4G0XA 2KYRA 3KRTA 2QORA 4KQFA 4D92A 2QL9A 1ZM4A 2GN1A 3I45A 4IVNA 1E3SA 4G9GA 5ENZA 3SEQA 2Z4RA 5ALGA 2EGHA 2WNHA 1P75A 5DOZA 1NZJA 2EQAA 2H3HA 1CY2A 2IXDA 2J3QA 1P0IA 1POXA 5AKGA 1PJ8A 2OGSA 1N8KA 5K6AA 1A4XA 4RQTA 3SFTA 2BPOA 2CZCA 3PSHA 1TDJA 2ZJ8A 3KAPA 5C1BA 1NW7A 2ONZA 4GLJA 5F73A 2XYGA 1GILA 2C4NA 3L6RA 3RASA 5K6TA 3PWSA 2NMUA 4GGPA 4WEOA 4UBMA 4YJHA 4BNDA 1QYIA 4H4CA 4A0HA 4E5KA 1FLVA 1J2RA 1PI3A 1BCRB 3H4MA 4QOHA 1G9XA 1DCFA 1Z37A 4EECA 4BVHA 3R9WA 1RI5A 1IV1A 2DZDA 3G7SA 4QULA 5BW6B 2OY0A 1GZDA 2ZBVA 1U99A 4XIGS 3SBEA 3KZKA 3WGTA 5GIPE 1G55A 3N4ZA 2O3QA 4N39A 1VPVA 3OIDA 5BOVA 1B6TA 1ZUIA 1EBFA 4G5SA 2AJBA 4I5EA 4TS9A 4QG3A 4BNUA 3K0TA 3C9UA 2AE2A 4FFVA 3NNSA 1AC5A 4ENQA 2VYCA 5TQ2A 5EJ4A 2J4CA 4C7XA 1JG1A 1X7DA 2TECE 1TKAA 4ND8B 3BQMB 3H5LA 4UUPA 2Q6TA 3SE0A 1LTKA 1LF0A 2OCIA 4PLTA 4BB6A 4URVR 5IWCA 1JDVA 4JI2B 4YQZA 2CLIB 1J22A 3E1SA 3D0OA 1F5NA 1W49A 3F9RA 1JR3A 1NJ2A 2W2XA 2BISA 4EB0A 6LDHA 2AG6A 5DMXA 1NC3A 5EIEA 3N8GA 1ZKDA 4X1KB 1AOXA 1DEXA 1HT1E 4FMDF 5FQOA 6AT1A 1EHIA 1CUAA 5B7QA 7ABPA 1DU4A 1QP7A 1K8XB 2IIBA 4KYIB 4NFHA 3A6HA 4INJA 1U1FA 1ZCJA 2IU3A 2XNSA 5GP1A 4C5AA 1IB0A 1XAIA 4UTOA 3KSBC 2QN2A 4JK3A 3RUPA 5LMUB 3A1DA 2ZYGA 2ZSFA 3G6EF 2VTKA 4RTLA 2BFEB 1Y1PA 4TV8F 5LQMA 2OORA 1R66A 1WW3A 5H80A 1NMUB 3ZWAA 3EGDB 4JSYA 4WADA 1X1RA 1F0KA 2ZI9A 1RP7A 1BXGB 3Q85A 1YCDA 2OO5C 1GZHB 2QQ0A 2I76A 3L7KA 4BNLA 5A02A 1LRJA 2FLKA 1GZSA 4HYTA 2IP2A 1BDJA 3GAFA 3HYTA 4KFUA 4MDYA 3T9EA 1OI7A 4BNJA 5JS8A 2NU8B 4AKSA 3SOPA 2M6RA 3R3WA 3VUEA 1QHEA 2R7KA 2NZJA 2I6RA 3MWDA 1OMOA 2BFCB 1N2IA 3D00A 2CVOA 3AKDA 1NVWQ 2FU5C 2B83A 3KPYA 1O08A 5EE3A 4FDMA 1XBTA 5KTTA 2R1VB 4JLNA 2X1LA 2MSWA 2Y92A 1OH5A 4Z4HA 2MYTA 3IDZA 3JR7A 3AUTA 4ZYWA 1G3IA 3CPJB 1EGVB 3VX4A 2VSQA 4TTSA 4HK4A 3K6RA 2ZT7A 4RM2A 3KZVA 2IS4A 2DU8A 2GXAA 1JECA 2GWRA 3BWBA 4GI2A 3D0RA 2AIRA 3NH6A 1M2JA 4MKHA 3TL3A 3ML1A 1IHOA 3ZU5A 3WVNA 1B26A 4M49A 1JR4A 3GRPA 3MTJA 2YUTA 5FTMA 2D1SA 4PTZA 4NPAA 3QU7A 4G56A 4IIXA 4LEIA 3S2ZA 3JVHA 3ER9A 3OPMA 1K8YB 4QJ5A 5A5GA 2W2LA 1KEEA 4QGFA 1P1RA 1AKYA 3KB1A 3ESQA 4J0QA 2CVZA 2XMPA 2ZREA 3ME5A 4JU9A 4YCDA 2WHQA 2XRMA 5H70A 3E61A 2XUKA 4YRMA 4YRQA 3OY2A 4PFKA 1E98A 1SCAA 1RWOA 5JR3A 1JDTA 4YV7A 1HSOA 5LQRA 5JG7A 5KSOA 4RD4A 1FS5A 1GD1O 3PHJA 4C88A 1DBVO 4L2IB 1YMUA 4CV1A 2PSFA 2E1RA 5HF5A 1VQ4F 1Q0PA 4ZCMA 1V16A 5JE8A 5F77A 2OAQ1 1JKFA 1ZUHA 5LP6F 4S1WA 2ZUUA 1H8HA 2JGNA 2R8ZA 2WVHA 4ZQCB 1JFFA 1ZA1A 3VR4D 1G59A 1DC8A 3MW8A 1MAVA 4B3TB 3VO2A 3IILA 1OXKB 3CIFA 1IWOA 4WKPA 3CW8X 5CVJA 3S2UA 3VDXA 3EX7C 3U3RA 1WEKA 1G20A 4HFMA 3LTNC 2OWDA 2B8WA 4PE5B 2YN2A 3ITKA 3DDOA 1ZVQA 3KBOA 4MQLA 4D42A 4F4CA 4QUEA 1E4YA 1YULA 2BFMA 2B3TA 2FZ4A 1VSBA 2GPWA 1ODKA 5A6SB 4TM8A 3ORQA 5DBEX 3OFVA 3HWUA 1NONA 2QL5A 4IQGA 1AKWA 3HL4A 2X0FA 4J0HA 5HNKA 1C0IA 2YJTD 4L51A 5ED0A 2KGWA 4EF6A 2X9LA 3AHDA 3LYBA 4F45A 2W11A 1I14A 1KEKA 2AVDA 4DWWA 1Y63A 3PC7A 2VJYA 3ORSA 1ODCA 1DC6A 3VSDA 3OPYB 4ZPXA 4UVIA 5MN4A 1LLQA 2UUBB 4I1PA 1SG9A 4HC4A 5FNZA 2YXBA 1HNNA 3ROXA 2OFXA 3EVGA 5KCMA 4AMYA 3IMEA 3WJAA 1KL7A 4XQ9A 4F84A 2GYVA 4ZWNA 5JH7F 5FJ4C 1NMQA 4G0OA 1RZ3A 3QVLA 3WGIA 2VOJA 4I50A 1HZJA 4II2A 3GUUA 1I7PA 2VPIA 3X0DA 4BO8A 5T57A 2ABWA 3CUSA 4L85A 2VXOA 2XDQB 3D8UA 1JQAA 3M1LA 5CHYA 1U8CB 2MSLA 4XJVA 3UJ6A 4EHFA 5KTYA 4MQEA 4V02A 2FEPA 4KDRA 4YDSA 4N47A 2QN9A 4B7XA 4DKXA 5JHGB 3EDQA 3V2GA 1ODTC 1YC2A 4KBGA 1FLDA 4MUBA 4ZT7A 4N48A 2RAVA 3QA3E 2VBGA 3S0HA 1RWQA 4MRNA 3WL8A 1KOJA 2ZB3A 5KWSA 2FCAA 3EQ8A 4RY2A 1ZITA 3CSDA 1M6EX 1P19A 1UWCA 2ZUFA 2Q46A 3DAFA 3HU1A 1BVRA 3EA5A 1CIVA 3B1VA 2NU7A 3EQZA 4BKUA 1RAGA 1EHCA 4UARA 1MAAA 3LV8A 3U0VA 2C77A 1G7CA 5EY5B 3GRFA 3PJRA 4NESA 4OYYA 2I7XA 4YUVA 4OSEA 5K3CA 2VHJA 3CZMA 3PITA 2YN0A 4LRXA 3SY8A 3UCXA 1RRMA 3K5IA 3MCAA 1K8AH 3GO4A 3C97A 4LRYA 1QANA 3Q0IA 1GTL1 4A36A 3EARA 5K0GA 4NZNA 4L5IA 2BTQA 2FWPA 3LYLA 3HBNA 3JX9A 1NBIA 3GYBA 1NF2A 3PP8A 4QXMA 3AFNA 4L4SA 1DC5A 1TJ3A 2NUAA 2H5JA 2ZJ0A 3QHAA 2PFSA 3F78A 2BHRA 2W43A 3P20A 4PSUA 1N2BA 1XKXA 4TN1A 4XWOA 2PJDA 1FZQA 1II0A 3B85A 1R6TA 3EOAI 4LRSB 4RWZA 5LBTA 3V5NA 4YRKA 3C74A 2DMRA 3RV4A 1JAIA 1FFCA 1BKSB 3CX6A 4DYHA 1XWFA 4FEEA 4IRMA 4GQIA 3D8HA 3G5LA 2P9CA 1QB8A 3AM1A 3G0OA 1UC4B 5THQA 2TSYB 4TYNA 1MO3A 1AN0A 2ZUBA 3AY7A 5AI8A 4EQZA 4F1KA 3WL5A 1QWSA 3EZLA 2H5EA 3NHLA 1EX1A 3IE1A 4BPBA 4BJ5A 3BOSA 4DQVA 5CFZA 1A8SA 4G88A 1VSQA 2HMSA 4HDRA 3GEMA 3ZS9A 4ZYZA 4EO4A 5BNTA 3DAHA 4DZTA 2W2NA 2GARA 5CA0A 3PJFA 4HH1A 2C92A 3PENA 5GONB 3JAMM 1O87A 1YUMA 1BWRA 1V2HE 1YS4A 2R1UA 2ZE6A 1KSFX 2XYQA 4KC0A 1SVUA 4RAQA 3VPXA 1T5IA 4IDGA 1KFEB 3KTOA 1SJ9A 5CX4A 4ZPJA 3HDQA 7ADHA 3MERA 1M2EA 4UMDA 5C32A 4RZ3A 2D0OB 2FPGB 3EC7A 4TGLA 4DCOA 3R75A 2YJ6A 3LPDA 5M2QA 1CRWG 3OTQA 4RPIA 1Z6TA 3IMCA 5I7OA 3GJ0A 4I6JA 5CDHA 4QUJA 4P5EA 1K8QA 4Q00A 3SDZA 2EX0A 3BXOA 2BJVA 1P2FA 2AJDA 4RY8A 4RH3A 4XE5A 1JHVA 1X8JA 1DJPA 4O4LB 5FOVA 3IA2A 4Q3NA 3HSKA 4UU7A 3VR2A 3WRYA 5E2AA 4FE4A 3FBAA 2WC1A 4IZ6A 2V9YA 5CJPA 3RVDA 3VRHA 2ZXFA 3KZXA 2V45A 4K9DA 3UKJA 4D0LB 1DGQA 1WEHA 4GMGA 1I24A 1H6DA 1SBZA 4UOQA 1WBBA 3D7NA 4GUAA 3LLCA 4D8YA 3AU9A 3KKQA 4LJ8A 4JI7B 3CH4B 5JNTA 4HN9A 1VSUA 3GLKA 4YAGA 2A3RA 4NZZA 4CUKA 4YRJA 1FS4A 3FY4A 4PRKA 5IAKA 4X63A 4JOSA 1EG2A 1X7YA 3VU8A 3CKLA 1PFQA 1T9ZA 3RKRA 4OXIA 4NZYA 1KVRA 1JB9A 1U90A 4DMGA 3PQ7A 4AJ1A 4MMXB 2I1WA 1CLIA 2IDJA 1PJLA 2VUHB 3NBYC 1H5QA 4JBXA 1CUYA 4O4IF 1T2DA 1CZNA 1T1EA 1E3MA 4TQUS 4FOLA 1E60A 1ZLYA 3CZ9A 3II6X 4OV6B 5K0FA 1KI6A 4RJTA 2Y9PB 2XITA 3JVDA 5H81A 4X3LA 3C6XA 1I7SB 5BUQA 3DDZX 2DKNA 3THWB 3H4VA 3PSAA 4QUHA 2QEXF 1XCOA 1E18A 2IL1A 4Q4JB 4TTTS 4WECA 1JFTA 2VF7A 1M5UA 3NCTA 2QOEA 5DN9A 2X5XA 5AT1A 1R6AA 3B6KA 4XD7D 5U4QA 3TINA 5EB0A 4Q7EA 2R1ZA 3DAOA 1CQZA 3LWZA 4RX1A 1BU8A 1QBGA 3FI0A 5DLEA 3J7AC 2GD0A 1ZI8A 5HQJA 1DJNA 3MS2A 4ENRA 3D7RA 1A9XA 2O4CA 5H5JA 2HSGA 3CMAF 1IC6A 4IFBA 1M5RA 4KBFA 3PHGA 4BZPA 1JQ3A 1R0XA 1D5CA 3EG9B 1QS0A 5DGCA 1T2CA 3NJ4A 3V55A 5FUMA 1NUSA 3NRBA 2FWAA 3H75A 1SQ0A 1KS9A 1RPZA 2X40A 4K9SA 4YRLA 4E03A 5HILA 2PYZA 3ZY6A 4CR6A 4EEXA 1RVV1 1QK3A 2VDNB 1FX1A 1R50A 3L18A 3P26A 1MO5A 5FUBA 3UJ9A 4QGHA 1SCBA 1EFUA 3HCOA 1T6YA 1XF1A 1JXOA 4FIDA 1WY5A 4MEJA 5MFZA 3DOEA 2H9IA 4PSDA 2Q9BA 4TRNA 2WMOB 2J59A 4UBNA 3DVAA 4ED9A 1Y6QA 3ED1A 4I3FA 4Z8YA 2Q0HA 1M1UA 1R4ZA 5DGHA 3IAM6 4LQ4A 5SY6A 3SS7X 3GLFE 1ZU5A 3B9QA 2JJ8A 1SKUA 2FMXA 3O84A 3M5WA 5AI4A 5EIBC 2LE0A 2ACEA 4AICA 3MQWA 2ZRPA 5D3KA 1E9BA 5AXAA 1YS2X 2DETA 3AVVA 1XHFA 1GRQA 2FVXA 2EJCA 1PLJA 1CB7A 1TW3A 1ZOIA 1TZJA 2MCFA 3KQUA 2VQFB 2UYOA 2E3JA 4MP6A 2BZ0A 1GQQA 1MB4A 1Z3CA 4IYJA 1IXRC 1JHUA 1HZZC 2QDXA 5BWCA 2BGKA 2QTAA 3M5DA 2Q2QA 1UPFA 4MTLA 2P9TA 2WJZB 3DFMA 3PEVA 4E70A 5HJEA 3WBFA 3JQPA 4DDMA 4MR8A 3T0FA 4HUQA 1CJBA 5FYDA 1I33A 1FUEA 1ISGA 1PR1A 3RR2A 3DP9A 1C9JA 2M6SA 3QF4B 3AEUA 3L4SO 1US8A 1E3QA 3VCZA 1YR1A 4K8RB 3LCRA 4B2YA 2ZWVA 3QRWA 1WRBA 2QLLA 3K1TA 2FEWB 4LE1A 2ECFA 1SM4A 1XEXB 4A8JB 3MCWA 4ESHA 2NYAA 4ROSA 1RWNA 5CX1B 5EYPA 4F04A 1BD3A 5SZKB 3WIEA 2YZGA 4EL0A 5G4VC 5BSWA 1VJ1A 4X45A 1A2QA 4GVLA 4OQZA 4IDOA 2ZF8A 1V1RB 4DMMA 1VZ3A 4B3JA 1P4AA 3S1SA 2JFHA 4I9HA 3EDYA 4HZIA 2OHFA 2C4KA 1QOQB 4IJ6A 3ZWCA 3NFRA 3IKFA 3CBQA 2Z1EA 2EKZA 3MINA 1IUKA 2V55B 3JWJA 5DYIA 3ILSA 4HGRA 1Q0LA 2XB6A 2NU9B 1NULA 4BV2A 2CLLB 3DEJA 3J81M 1TYCA 3SM3A 1P7ZA 5CA1A 3M6LA 4OHPA 1Z4JA 1F9EA 4TV9B 1SU6A 4UVGA 5FL7D 3RVQA 4KU4A 1SIOA 3P9CA 4DIMA 4N1AA 3C4QA 3OIFA 3IEWA 3P9IA 3KDSE 3QJYA 3GCWA 2NPFA 4W5TA 4X20B 4M55A 1S2GA 1K9SA 1X86B 3NP7A 2CLSA 2NO4A 4MV7A 1VJ0A 1K7XB 2PZBA 3H5TA 4RK4A 9ATCA 4DIDA 1E6LA 4J0IA 1IDN1 2Z43A 4PWYA 3TTVA 3BWDD 2QRKA 1LC3A 1B2LA 1E6UA 1PJRA 2QL6A 2XMZA 3WYEA 2NUTB 2W90A 4B6QA 2YTZA 3FTPA 2IWHA 3ESAA 3ROQA 4ERNA 4F5ZA 1PS8A 2G9ZA 2XW6A 2XMBA 1JIVA 3V4LA 4K7JA 4XJSA 4OMFG 1YZTA 4JA2A 3UQZA 1GEEA 4DADA 2IPXA 4KXXA 1UBKS 2BYTA 4B8YA 2AYYA 4NYJR 4C6HA 2XGJA 3N2ZB 5GMOA 2VDKB 2NU6A 3MTIA 1P3Y1 5FFFA 2A9KA 5CVUA 4CGZA 2IITA 5K0LA 3D4OA 1ZSVA 3GVXA 3QWFA 3QYPA 3UBTA 3R7AA 2OD9A 2ZB7A 1OR8A 4LV8B 3GGJA 4LZWA 2QLTA 2CHGA 3EOZA 1X7WB 4UNPA 2YNMD 2IT1A 4K9NA 5CK4A 4Z9FA 4BLRA 4ZIRA 1DINA 2QXTA 3QOFA 1Z36A 3WWEA 4ARIA 3OUUA 3DO6A 3WLKX 3KJNA 4KO2S 4PPNA 3PUVA 3AHGA 1HE8B 4B83A 4B6RA 4BKMA 1F0PA 2EP5A 2ZANA 4LF4B 3V9PA 3QXSA 1IN1A 4G0PA 1MLDA 4KUEA 3SF8B 4LWZA 3AQIA 1MGOA 4E88A 4CKZA 3NB0A 4L5YA 1JIQA 1TO6A 2ZAOA 3QK7A 3RSZA 3IQEA 3WJ1A 4LMAA 3EVAA 1SA0B 4E7PA 3R44A 1W19A 2PMFA 4RVHA 1AG9A 1U3VA 3FN4A 5G1OA 3VIUA 2E4UA 1OLXB 3BA6A 2PT5A 1GL9B 2HSWA 5J5AA 1E96A 5C53B 2OC4A 3FYCA 1X8KA 3EBPA 3MWEB 1S9DA 2QMZA 2V6MA 3E53A 4Q4AA 5B1YA 3CLUD 2FE1A 4EMUA 4CV3A 4LFBB 5BN4B 1X38A 2G83A 2LRHA 1GGHA 2WK1A 3DH0A 2W2QA 3O21A 5FOXA 2B9EA 1XOIA 2D06A 3OZRA 5DTRA 3KLNA 4RGBA 3AIIA 4KCGA 4I3GA 4ZQGA 3CMMA 3DBRA 3L4BC 3FZEA 1KMMA 2PKQP 3WTCA 1KDTA 3ZWBA 2EYQA 1BXRA 2VCYA 2DE0X 2ZSJA 4X0EA 2NTJA 3F7NA 3Q8MA 3EGXA 4RA9A 3TLEA 2P75A 4IDAA 5HIMA 3BMNB 2XDAA 4MB2A 3X2EA 5HM6A 3PJDA 1BKYA 1O3YA 1XK7A 3FWNA 4CUJA 1IBLB 4FR0A 1A9RA 4A0FA 2WHPB 3IJEB 1Q21A 2JDIA 3AUKA 4JI5B 4R8SA 4KR2A 4NBVA 4EGSA 1NTOA 2ZWIA 4N0DA 4LHEA 1LRKA 5IXYA 3COSA 3VO9A 3ANMA 4UBKA 2PBFA 4JJEA 2Q3FA 2QRUA 3LXRA 1OV4A 5IZ4A 1H6BA 2XT6A 1URPA 2FG7C 3B51X 2BFWA 1FDIA 1XEAA 2BF4A 3MGAA 4Q3OA 2Y0PA 4GXRA 3M4JA 3SYNA 2XV1A 3U13A 3MK31 4AY3A 5F98A 1DQRA 3QVKA 1KI8A 3SIVA 4XKJA 4D4MA 3QOWA 5IMBA 3B5EA 4UUMA 2WILA 3N2NA 1BCSA 1T9BA 1QU3A 3FPSA 1XFAA 4OMUA 3ZBTA 4D97A 1OH6A 3CZAA 5ALSA 1B41A 4P35A 2I99A 2PTHA 4WW0A 3KKMA 1RKBA 5ARDA 1Y81A 3K1AB 3RREA 1NYQA 2ADFA 4LA4A 4PZYA 3E03A 4H1WA 3HI6A 4BEWA 1NW8A 4G89A 1FU7A 3Q87B 3DD5A 4I08A 2Y1OA 3O1LA 1ZOOA 3PYXA 3HUEA 3ZWWA 4BQQA 3U40A 3ZU2A 2OPBA 4D3SA 4B3GA 3K0CA 3MWYW 3S2EA 5LBIA 4JZKA 2QE7D 3V8MA 5IABA 5KQMA 5LLDA 4GZLA 4D7AA 3IBFA 3OSUA 3DMGA 1UJBA 3EZNA 2ZKIA 1JZQA 3E05A 5IK2D 3ZU6A 3HB0A 1JBQA 2UZHA 1E9FA 2GZMA 1V4NA 3ETHA 3QBTA 4TUYF 3SDBA 4CI9A 1EG7A 1MJ5A 2FP3A 3WB2A 3WC4A 1C1DA 3HM9A 1DX4A 1KVTA 1ZD9A 3G2MA 1NUQA 2ZYHA 3FLBA 4CXMA 2FSUA 1T2EA 1KFJB 2C5EA 4HZUB 1KO7A 2XUHA 3KYBA 4IGIA 3CUKA 4B6OA 5K0TA 2J0VA 4KGZA 3ZNNA 4GPZA 1VJTA 1IY0A 1WUHS 1VHLA 2PN1A 3K53A 4WK6A 3T35A 3HJCA 4BO3A 1OQAA 5K20A 5B30A 1AQYA 2KLBA 3NM6B 1CIJA 3OT1A 1BAPA 2OK7A 2CVQA 3H1GA 4LDRA 4NCHA 5H59A 3UKDA 1XU4A 3VZPA 4YUYA 5E4JA 4Q7JB 3FUCA 2IYZA 3O2NA 1M7BA 3I55F 4D4GA 2BD0A 3FOWA 4D45A 1TD9A 1NW9B 4EMBA 1WZN<