2RHOA

Synthetic gene encoded bacillus subtilis ftsz ncs dimer with bound gdp and gtp-gamma-s
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
305
structure length
305
Chain Sequence
b'ASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATGFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell Division Protein ftsZ
molecule tags Cell cycle
source organism Bacillus subtilis
publication title Combined protein construct and synthetic gene engineering for heterologous protein expression and crystallization using Gene Composer.
pubmed doi rcsb
total genus 105
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 2rhoA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 2rhoA01
4DXDA 3UT5A 4EB6A 3VO9A 2RHLA 5CA1A 4IHJB 4U39A 3WGLA 2BTOA 4O2BA 2RHHA 2VAMA 4EI8A 4YJ3B 4X20A 5JVDA 3RB8A 3E22B 2RHJA 5IJ0A 5LOVB 3VPAA 4EI7A 4X20B 5JVDB 3JALA 5IJ9A 5KMGB 5C8YA 3VOAA 1Z5VA 4I4TA 4IIJA 4ZI7B 4O4JB 1OFUA 1W5BA 4FFBA 4X1IB 4ZOLB 5J2TB 3JARB 4EI9A 4WBNB 4M8IA 3WGMA 4FFBB 4TUYA 4X1IA 3M8KA 2Q1YA 4O4HA 5J2UA 2VAPA 3N2GA 1Z5WA 5EZYB 5KMGA 3JALB 4O4HB 5IJ9B 1W59A 1TVKA 4LNUA 4X1YB 4X1KA 3HKCB 3VO8A 4TV9B 4ZOLA 3HKEB 3RYFB 5M7EA 3V3TA 4I4TB 4IIJB 3VOBA 4ZI7A 5IYZB 5CA1B 4I50A 5JCOC 1JFFA 3JASB 4O4IA 5JQGA 3E22A 3HKDB 5IJ0B 5LOVA 5LP6A 5JH7B 3JAWA 4O4LB 5GONB 4U3JB 3WGKA 4F6RA 4IHJA 4YJ2B 5MN5A 4HNAB 5CA0B 2XKAA 5BMVB 4TV8B 3CB2A 3RYCA 3WGNA 5ITZA 3M89A 1RQ7A 3HKBA 4B46A 5LA6A 3R4VA 2R6R1 4E6EA 5KX5B 3N2KB 3RYIA 3ZBPA 3C8LA 5FNVB 5LXTA 5LYJA 2GVIA 4F6RB 3WGJA 1TUBB 4ZHQB 3HKBB 5MN6A 1FFXA 4DRXB 5CB4B 1SA0B 5ITZB 3ZIDA 1FFXB 3JATA 5JQGB 1W5AA 5FNVA 2BTQA 3JATB 2Q1XA 4YJ2A 2VXYA 5LYJB 5KX5A 2BTQB 4I55B 4O2AB 5GONA 2XKBA 1W5EA 1RLUA 3RYIB 4ZHQA 5EIBC 5EYPB 1SA0A 4DRXA 5CB4A 5LP6B 1W5FA 5BMVA 1RQ2A 1TUBA 2VAWA 5JCOA 4U3JA 5J2TA 5LA6B 3HKEA 4HNAA 5LP6C 2RHOA 5MN4A 5EYPA 4KWEA 3RYCB 2R751 4TV8A 4B45A 4I55A 4O2AA 1FSZA 5J2UB 3HKDA 5EIBD 3N2KA 4YJ3A 5JH7A 3JAWB 3ZBQA 4X1KB 4I50B 3UT5B 4EB6B 5LXTB 1JFFB 3JASA 1W581 4O4IB 3RYFA 5CA0A 3N2GB 4XCQA 4WBNA 3JARA 5IYZA 3JAKB 3RYHA 4O2BB 4LNUB 4TUYB 4O4LA 1TVKB 3JAKA 4X1YA 3RYHB 4TV9A 5C8YB 5EZYA 3HKCA 4O4JA
chains in the Genus database with same CATH superfamily
1TT5B 1ZDMA 3PZRA 2J5KA 4MITA 1J7JA 1MG5A 3UT5A 5CYPA 4BP9A 2WSYB 2HA3A 3PNYA 3UATA 2X9GA 3OLQA 3RFUA 1PFUA 1GG5A 4URYR 5FI5A 2DJIA 3R7WA 4AMVA 5IKXA 3BH7A 1SH7A 1KHTA 5H7XA 5BSTA 4CF5A 1JQLB 1Q3TA 5FBVB 3G8DA 1GG2A 5DF1A 1BDBA 3T8YA 1FFEA 4WZ6A 2CL0X 2RBKA 3F6SA 4UMVA 2CVPA 3BMQB 3FCSB 3NH6A 5AW9A 4CM8A 3NVKI 3CC7F 3IIMA 5EWJA 2Z01A 1T6YA 3K12A 2WIJA 1UL1X 1X9HA 2OYSA 3QQPA 3IAEA 3TI7A 2H8GA 4U2CA 1C7JA 3W04A 4YUYA 2XUFA 4X93A 2WG2A 3HA7A 2NU6B 3K71B 4P7JA 4C8GA 2FDRA 1FSGA 1GFSA 3BPSA 3VOSA 1RM3A 5EZYB 2LBPA 2FMKA 4MGKR 5AVOA 3NEAA 3UTCA 2CVHA 1O5OA 1V4NA 2QM7A 3CVOA 3LW7A 1N3BA 1QCCA 2B92A 2FTKE 2O9JA 5C7YA 3ASUA 2PPLA 3B7PA 4TKUA 3CZPA 4GOMD 4X7MA 4EY7A 1UJCA 2PR7A 1GTG1 4N0QA 1XRJA 5BV0A 3OG9A 2VIIA 2CHSA 3PQFA 4BVQA 4Y1RB 2X1MA 1J2RA 1NQTA 2ASEA 1NQ5A 4WOBA 5JCZA 3VR1A 2NV6A 3HP7A 4NAVA 3Q6MA 4YCAA 5CM9C 3ERCA 2YTZA 3QHDA 3R0PA 4UW9A 2HMAA 3EBLA 3QXHA 3NC4A 4X7RA 2C2OA 4E4RA 3ECAA 1A3CA 1P4AA 2C00A 1TO2E 2B34A 2SKEA 5FPHA 1EIWA 1VGRA 1JDBB 3FPCA 3WRYA 1ACLA 5TQVA 4LVNA 1DMSA 1HYBA 3ZWYA 3T94A 4BN4A 3ICPA 1NE2A 3OIFA 4LISA 2AXNA 3EORA 1Y4SA 2Y1WA 4YLEA 4YI3A 3PQ4A 1G41A 3QA9A 1YU6A 3LAWA 5FADA 4EMUA 1M0WA 5KTSA 3BHIA 3AF1A 1SCUB 2VEOA 4BLQA 3KLPX 1TECE 4GEGA 3D1LA 5T5QA 4BT3A 2I2FA 5A0FA 2IYXA 4YRRA 3WGIA 4FD3A 1Z4PX 4AK9A 2QRVA 2VPYA 4H7KA 1YZ3A 4Q12A 4PFQA 1KZ1A 1ZVKA 4YJ2A 2JATA 3RVKA 3TSCA 4IIGA 3ZUGA 2UZ0A 1PV4A 1DKUA 2QN8A 2VXOA 1YBVA 2OEPA 2VQDA 3E4DA 2ODNA 4OLBA 4WBNF 1GPYA 2XOXA 3IHWA 3WWCA 5JTUA 3AHGA 4U2GA 3JQ6A 2BUCA 1TNDA 3J7TA 3ELWA 1ZUNA 2P67A 3L18A 3O2QB 3RJ9A 4EK9A 5JRJA 4HB0A 4WLOA 4HL6A 2GD6A 1EJ2A 4KHZA 2VQFB 1EBBA 5JAZA 3TPCA 2VHUA 2YRWA 4HEQA 4MS1B 4GOND 1CJSA 2CJPA 2REQB 1IM8A 1VE3A 2QRKA 1Q14A 1ONPA 1XEAA 1YDGA 2C3MA 1PKEA 2PX8A 2ZR0A 5AXAA 1J23A 3QWIA 4N7BA 4UEKA 4F45A 3HRIA 4FONA 4NUTA 1JAYA 1Z62A 5IS2A 2C07A 1XKTA 4PIVA 4RKQA 5DNVA 5BUZA 1TUGA 1J49A 3LLVA 3MRVA 4G5XA 1RJDA 2J48A 1IOLA 4Z86A 5SZJA 3Q98A 5DFAA 3WPWA 2V9PA 4MLPA 5JMPA 1EAYA 1EFVB 3FYUB 3BAZA 4BCBA 1LV7A 4JJAA 4ZMBA 4OGKA 5A9SA 2IU0A 1GUZA 3CH5A 1DO8A 3AR5A 4TTQA 1X92A 3TLBA 2FJPA 4OP3A 1FTNA 1GNTA 3T7IA 2GKGA 3DPUA 1GV1A 1SUEA 3DT6A 3KJJA 4EW6A 1JKJA 3C2QA 4MDEA 4UUMA 4K26A 3NWOA 4YDRA 5DBHX 1JEJA 2N9UA 3NM6B 3IAXA 4B85A 3J80M 1VJTA 2XMBA 3I01A 3T1NA 2DUNA 3GTZA 4QTYA 4OHYA 2VF5X 1KEKA 3GJ7A 1NBAA 3S2SA 1QWOA 1JR3A 1Z8HA 3A4IA 3ROGA 3VR0A 3CNEA 1AA9A 2XUPA 4GYKA 5IT5A 4E5PA 1RXVA 1LUAA 4FMCB 4B34A 5CBKA 2JAXA 1PFQA 3V46A 1VL2A 3MWDA 4DA8A 2BTEA 3I1IA 5CA1F 4ZI7B 3BQNB 4CW7A 2FR8C 2PO7A 2HD4A 4F9GA 2OWEA 1T43A 2NW6A 4JDUA 2YJNA 3WGMA 4Q3KA 4TUYA 2JIOA 2UYPA 5HEKA 1ISFA 2XXAA 3NBXX 2YCBA 1Q44A 1QJCA 4ETIA 3CCBA 4RIEA 3ZCSA 5T41A 2C2ZA 2ZVDA 1BXKA 4ZQHA 1ZJYA 1L4EA 1HDXA 4WFQA 4PAOA 1BEUB 1CLUA 4XEHA 1O1YA 4JLKA 4EVSA 1NUQA 1SUDA 2WM9B 2IPNA 4IIJB 4Q34A 1LPNA 2Z0MA 2HLNA 4IMJB 4D9MA 3WK5A 3W2EA 1GD1O 1LX6A 1L8AA 1Q83A 1MN6A 3G7UA 4RF5A 2IYWA 1EUZA 1WXQA 2WHYA 4HB2A 3W5BA 5LMZA 3MVEA 3O8DA 1YBMA 4IUYA 1PK7A 4JL6A 4KUEA 5A02A 3QSYA 4D57A 2PAAA 3MC1A 3H5RA 4GSKA 1AZSC 4G2NA 5AOCA 2FPPB 2B1RA 2VGNA 1G5QA 1KZ9A 3SM3A 2D1FA 2P1ZA 4NFSA 3W6NA 4CMBA 2PIDA 3COPA 4F5ZA 4B35A 4AURA 2EZ8A 3L6BA 3OBYA 5AI9A 3DGFC 3PR1A 1BYUA 4HGRA 4EGAA 4MHOA 1O3YA 4L8VA 2PGOA 5BPFA 2RH8A 5TQ2B 1SBYA 5A2GA 3A1TA 4H7IA 2OY0A 1DQZA 3VC3A 4BKMA 2NGRA 3CCJF 3LZ6A 4YALA 4KW7A 2Z4RA 1YC5A 3HSYA 5DMXA 2O3TA 1MO2A 5CBPA 2BGMA 2IQIA 1YV9A 4PSDA 4B43A 3WTCA 5JD4A 1DAOA 5JWHA 3L8MA 3I42A 3TH5A 1QG2A 3P20A 4GVLA 2CCGA 2F4VB 1XNGA 1XC7A 2GZMA 3HUFA 2ZJ8A 4L3WA 1CK2A 3QUTA 1ZH4A 2AHOA 2HDHA 4PBTA 3X1ZA 5H9VA 2DFNA 3A4YA 2X2OA 1YBAA 4OOFA 4D4JA 2VA9A 3TQIA 1V6SA 3T3MB 5G4LA 1QV9A 3FIJA 3HG7A 4L9RA 4RS4A 5BSKA 4HUQB 4N3AA 1NI3A 1WCYA 1YS4A 3DBRB 2EFGA 1NSTA 2OHOA 3GRFA 1L7OA 3MMXA 4NZPA 1P4RA 4EFMA 2ZUTA 2WV9A 3I2KA 1IUKA 2EYQA 3MYYA 1EP2B 2Y4OA 3ZE9A 1WE2A 2IUFA 1JRLA 1U9ZA 4R4JA 4Y6PA 3ZBQA 2QHXA 1P1IA 4J9VA 2VJBA 4QOGA 3VH1A 4ND4A 2XQVA 3HGMA 3QNWA 3EYWA 2M98A 4C3VA 1XX6A 2IXDA 4L5YA 2IEYA 2ZAOA 3RIHA 1XTQA 4D4IA 2D74A 3T1HB 3F2VA 2Y1KA 1AQIA 1QIHA 3P2EA 3R3JA 2QSZA 1S7GA 3UGKA 4HFRA 5A3JA 4D5EA 1I4WA 1PG2A 1Z07A 2B2CA 2IPMA 2P8SA 4PGAA 4TMXA 3RVPA 4YP6A 1DP4A 3C5WP 5B5SA 2QT9A 3MJFA 4KH0A 2QTLA 4M8LA 1A8IA 4W63A 3H0KA 2JLAA 4Y2VA 4B6QA 3DM5A 4YC7A 1ODIA 3OZTA 3FGZA 2VDRB 4NBVA 3FDFA 2HCFA 2NU7B 5HBGA 2PGLA 3IV7A 4Q6BA 4QBIA 4TV8F 5AM1A 2WWVD 3ZN2A 1OI4A 1UFKA 1DQPA 3WBBA 2Q3CA 3L02A 3GP8A 2A4MA 1Z2CA 1XCMA 2FMXA 3CXUA 2FEOA 1XZPA 4NV0A 1HUQA 4RUKA 3M6AA 4FMDB 4ZAZA 1KU6A 1SQSA 1NW5A 2JFVA 4P84A 3EARA 4HS9A 1ULAA 5EKXA 3A4MA 4RU1A 3H8SA 4INOA 4RZQA 4BV9A 5EN4A 4CN9A 1JHUA 3R9IA 2VJOA 5F9MA 5DTIA 5BWLA 5JZ9A 3BKXA 4LF4B 1DT3A 2LRHA 3AYZB 5BQ5A 4A6XA 1RLOA 3OCVA 4DBZA 4PZLA 4LJ5A 4FMDF 5DHQA 4OHUA 4U7WA 2FC3A 1PNQA 5F9HA 3OZUA 4HAOA 3GPBA 1GAWA 3RVRA 4PRYA 1BN6A 5H82A 4RTNA 3L3BA 5FWXB 5KTKA 3C4VA 1CQIA 4G81A 1QDEA 4D9NA 3NH9A 4H4EA 4KMMA 1U1FA 3NKLA 3D3NA 3VYWA 1VFPA 3GGDA 5P8WA 2KTUA 4KRFA 4NJEB 3EVDA 3LWOC 4YCDA 4JYMA 4K9OA 1M8JA 1M83A 2XOEA 4P54A 4YP7A 1HX7A 3SDSA 3PJDA 2AYZA 3O8OB 3IKLA 2PPVA 1HNXB 4YP0A 3Q5GA 2DAPA 4N7JA 5DI3A 5FHQA 1DC5A 5KTYA 5KS2A 3SVZA 2IFTA 3Q3CA 2FKAA 3K4HA 2QOEA 2QA4F 3A6DA 3RHTA 1AQNA 3FSGA 3KYCB 1PW7A 3EF0A 3WLKX 1LF5A 3TUZC 1E9SA 2UAGA 4O6VA 4IH9A 4CKEB 4I5GA 2IX9A 1SUCA 3HKBB 1WETA 3WYAA 1PT5A 4PNHA 5ITZB 3EBOA 2D8AA 4MP3A 5A03A 5A6SB 3I01M 3E9QA 1PT7A 4H0FA 3N8IA 3EHEA 1YBFA 3ADOA 1U9YA 1NUSA 2AB0A 2BGUA 2CUKA 2R7AA 3NFYA 3PIRA 3UFXA 4ESOA 4C7OA 2HXSA 5B4UA 3VH3A 3D1VA 4EL0A 1H2HA 1ORWA 4F3NA 2VKQA 3F5DA 3INRA 3P9XA 2H5JA 1KI2A 1OI7A 3ZK9A 1E3SA 3AHIA 4KSCA 4TYMA 3FUWA 4M1MA 5BUCA 1HT2E 4F2GA 2OG2A 3LRXA 4A27A 1M54A 1VKOA 2AKYA 2RGNA 3EQ8A 4LXQA 1FDVA 2PMWB 2ERCA 1QK5A 3UXEA 1FDRA 1E3WA 1XJ5A 2EQBA 4HF7A 4V3BA 2F67A 3TZ6A 4C5CA 5HM8A 4RE6A 5JQGF 1W75A 1M0TA 4X44A 5FPQA 3I2FA 2IS6A 3OW2F 1JMKC 3CRVA 4MKZA 4DNOA 5JR3A 3PVSA 4NJMA 1UAYA 1TCCA 4H6XA 4MGEA 4UZSA 3E53A 4J1TA 4KQWA 2V03A 4RVHA 2CDAA 1EG7A 4JU9A 4KLNA 4PX3A 1JDNA 1PR6A 2HLHA 1K08A 3UOGA 3VVCA 4FEGA 2CLLB 5HS6A 1I2DA 1FDOA 3WMXA 3C1UA 3W9SA 4ZMSA 2XQFA 3A37A 3DV0B 4YMHA 3FTPA 3COZA 3O0TA 5IZ4A 3EXIB 5K8IA 4OYLA 3ZJYA 4Y2XA 3WK6A 4A82A 1I0LA 1T91A 2ZZMA 4HDNB 3EF3A 3QVVA 5DCYA 3WNCA 4W7HA 4YIHA 1IXYA 5LOVB 1JYFA 1S1CA 2DH6A 4PV7A 1ECPA 5J59A 4LGCA 5ECDA 3CZ9A 2W58A 3DUWA 4LKRA 4YRPA 1KYQA 1NHGA 1XQ1A 2X0DA 2QY6A 3OH8A 1X7WB 4J3JA 4IG9A 3GL9A 2CLIB 3C3YA 1XHFA 5FYQA 5B2EA 1VC2A 3MD0A 3AFNA 4A2PA 1OH7A 1UK8A 1VQ4F 4YP5A 5BV8A 4X71A 3AFIA 4IX9A 1NMZA 4D8WA 1SEPA 2GM9A 1A0OA 3ANTA 3Q8WA 3KXPA 1TOAA 3UQYS 1W29A 4K88A 4DYDA 2VK8A 3CUWA 1KJQA 2VS1A 4ZDIA 2I3GA 3EMBA 3GRRA 1IEXA 1MB3A 1GV0A 2BKEA 3EISA 5CIYA 1M6VB 2QRLA 1XDBA 3HWX1 2WJPA 5IRCD 1VPTA 3AQ4A 3F1KA 1VE9A 1TAUA 1F1JA 1KKMA 3PR2B 2ZAYA 5HY1A 3WFIA 2VGMA 4COOA 5GADl 3RC8A 2ECPA 1L4MA 2OCDA 3I9NA 4L9WA 1HG0A 3F1LA 2B3DA 3BZBA 1YR9A 1YFJA 3MFYA 3CSUA 1Z2AA 3T99A 4I1YA 3DTVA 2P9JA 1TAGA 1LBQA 3LYHA 5DLYA 1YRYE 3VU9A 3WLRA 4ZWNA 4QVIA 2FJ0A 2WEKA 4E2WA 1ZN9A 4NHEA 4OHVA 3LYUA 2E5LB 4ZT4A 4DBLC 4GXQA 2VHZA 4HZIA 2CNLA 1T26A 3KZVA 3SR4A 4FHGA 3CF4G 4EUSA 1E1NA 4ZK6A 1WMBA 2C92A 5SV2A 4IYJA 2W4QA 1KSHA 2PJUA 1VA5A 1A71A 4CT0A 2GFQA 1BDIA 4GRDA 3AR3A 1QANA 3NJRA 1GZDA 4PO8A 5IUJC 3BDVA 3TL6A 4N6OA 1WOYA 2FZVA 3T3NA 3CMAF 3PT5A 1Y3IA 3QV1A 5DISB 3TO5A 3THXB 3CPEA 1PJ8A 3QWBA 1P2UA 2OHVA 3KK0A 3W90A 2LPMA 1W35A 4C3UA 4CM3A 1WTAA 2HHAA 3PDUA 5G0WA 2FYTA 1KFKB 4XVQA 1WD5A 3WMEA 3TEMA 4ZZ3A 1ECJA 4UBLA 4BX9A 1CRPA 2W8BB 4LQLA 4DBLE 1UBEA 4A9AA 1ECFA 5G3YA 4UJ3A 1QRSA 2RMKA 1HQCA 4UKDA 521PA 1O2DA 4XQEA 5TS3A 1FMTA 4DG5A 1BMQA 4UOZA 1N6OA 4X6LA 2FCRA 5AW6A 1XTSA 5ALYA 5KJCA 1NLMA 4F5EA 1G8SA 2HT6A 5EAIA 2O0LA 1ZCFA 5BOSA 2X1LA 4I3FA 4YN3A 3I58A 2TSYB 3ESXA 1ILWA 3IUEA 4XJXA 3PHCA 1LEHA 3JAKB 2H1FA 2WWWA 2X5XA 1T6BY 1IEQA 1RI4A 3IQXA 4MAAA 2N0SA 5ABPA 2AMFA 2D1TA 4CNQA 2FPKA 4FT2A 4CDGA 4ESHA 2EBWA 3HCPA 1E0JA 4NV3A 2WUEA 4QPDA 5LQSA 1E0KA 3SY8A 3U62A 4EA7A 3RFCA 4F38A 3IAUA 3EA5A 2VWHA 2PZAA 3ICQB 3HZOA 1OX4B 3TGPA 4WMLA 2O6LA 3RVMA 3RSSA 1U6KA 1LNZA 2H85A 4J3FA 1TGVA 2PQ6A 4HWOA 2O57A 4IDGA 2Q29A 1A77A 2BHTA 3N39C 3NIGB 4OSPA 2HQBA 5EZQA 1TJ5A 2YV5A 4J8PA 1MTOA 3SZLA 5IT4A 4LCEA 3TRFA 4DCMA 2NUTA 3HQ4O 4RVFA 1H0SA 2BEKA 3ZHZA 1T5LA 3DPIA 1KYWA 5AKEA 3RREA 3OPYI 2QV0A 5DTJA 5H68A 2VF4X 4E1AA 1C80A 2G63A 3GK3A 3KUDA 1AZWA 4IXTA 2JI7A 2O05A 1CF9A 1Q15A 1WQ1R 1RXEA 2O0KA 2OR3A 3PUXA 4JKOA 2C4VA 1L8QA 3JPWA 1DRVA 3H4VA 4HH3C 2BEJA 3GBSA 1Y1RA 4X0EA 5IH3A 1O96A 1JT2A 1OXSC 3QLEA 4O4IA 4KAFA 2HJWA 2W43A 1R4AA 4TWZA 4ZOBA 1ENPA 2GLUA 4DDHA 1G8HA 2ZJBA 4HGYA 4U7TB 1P74A 1Y34E 2QSJA 1UZMA 3OX2A 4ECEA 5KPJA 3SFTA 4INZA 1Z34A 4EARA 1V16A 2YHAA 2I3DA 1PX0A 2CNOA 1KJWA 4LYAA 3CZ4A 4RF2A 4Q7JB 2KHZA 5DMHA 3FCOA 2PO5A 1DWOA 1KK3A 2ZYSA 4LXHA 1PHRA 4PCAA 2BMJA 1H6DA 4JEMA 2VLBA 4BFWA 1JIQA 1P33A 2WF9A 1PTKA 3DQZA 4FEAA 4DE5A 1B14A 3AI7A 1YBHA 1YTLA 1E2IA 1Y3DE 1J8DA 5JISA 3RTGA 2W2XA 2Z57A 3UENA 1M5UA 1UOPA 2FPWA 3RJZA 1FTSA 2J07A 4GBJA 3V4RA 3FTDA 4GOXA 2YINC 3UAGA 3V3KA 3EBPA 2ODWA 3M70A 4UDXX 5FUMA 4IJMA 4M1TA 5A5VA 3RC2A 5DJ5A 1YFKA 1NU8A 1QKJA 1Z74A 1JQBA 3VV2A 1SIOA 1HQDA 2OZVA 4LQ4A 4Y67A 1GY8A 1U02A 5F7JA 3ZHUA 4A0SA 5A2QA 3S68A 2Z8YM 3T9CA 1EH5A 2OWDA 3OLWA 2AXEA 3A3PA 3MCVA 4AJ2A 4J1NA 1LB1B 3WB0A 1KOGA 2W98A 3GGSA 3RSCA 4EPVA 5ERYA 5AOBA 1LVUA 5BNTA 1VI6A 4IHKA 2NM0A 3F4BA 5DI3B 1HNNA 2E3JA 3BCSA 1JDJA 1TYAE 5ENZA 4BFSA 3BIFA 4GLBA 4WOPA 3M34A 4OIMA 3C15C 3KQLA 3KHSA 4FYHA 2R751 3KJIA 3KPVA 4N01A 4HP8A 3K9BA 4U7JA 5FT9A 3T7RA 4ER0A 2BCGY 4TYYA 4ZDWA 1CV2A 4WKCA 4L51A 1KDZA 1JI3A 2OFPA 5BR8B 5DU2A 4PC1A 1K2VN 2MSDB 1MDFA 2FEMA 4YCLA 1N2EA 1YZHA 3U7GA 4RA6A 3SX4A 1GUDA 3WIEA 2BZ0A 2G5TA 1P1JA 3F67A 4QUBA 2IY9A 4X1KB 4Z0HO 1ETHA 1JU4A 4MUHA 4Q7LA 1N1MA 3RV3A 3ZNPA 2D2IA 4YR9A 4EY3A 3T5AA 3CLRC 5JNWA 4H08A 4ZT6A 4YO8A 3TK1A 2DUUA 4F2DA 2FDCA 4LMPA 4RGBA 2WI8A 4IDDA 3BK7A 4HVTA 4BNDB 1FXUA 1L5VA 4F1JA 4UARA 3CEPB 2Y0BA 2B0JA 1SQ6A 2QQFA 3F0GA 3G1WA 3WGOA 2ZJ3A 3V2HA 2H16A 3OAAD 5EJGA 4XR4A 5AM0A 3ZVLA 3MCAA 5GIPC 4JR2A 4S2UA 3V6MA 4UQLA 4YPOA 5IJ0A 3C74A 3CEMA 3AFMA 3NHLA 5IH7A 1OCEA 4L27A 3QFSA 3LFOA 2FV8A 3PNMA 5L3QB 3HUEA 2JFWA 4IFTA 4HFMA 4I5IA 4P2GA 1ZGJA 2P5TB 3N05A 4CJXA 3EWAA 1XZAA 2L19A 3NWPA 1CD5A 3CYQA 3GNSA 3T61A 1OWPA 2PD3A 5C4GB 4TZTA 2XCQA 2R25B 1KPHA 1T8UA 1DFHA 4J4TA 4FHZA 4PG5A 1NW6A 2FZ5A 3ESCA 1KI6B 2BONA 1A4XA 1J1IA 4Y7CA 1SCDA 2OOKA 4Q4LA 5CH3A 3ZDDA 2ZB2A 4QG7A 1P5JA 1WY7A 1QB8A 2P7IA 3IHTA 4IQFA 3FLEA 4UASA 4Y9UA 2O50A 3PX3A 4F1KA 2P9YA 2IY7A 4WLNA 3WYNA 3EXAA 2YWEA 4YQZA 2R96A 4BQEA 1J20A 4IVQA 3QFRA 3C8UA 3QI7A 1FYXA 1NBOA 2W2KB 4H7FA 4R2LA 4PEVA 1U7DA 1Q16A 2HSWA 5LMCA 1Z0FA 5AVMA 1D0IA 4DGSA 4ALMA 2HOQA 2G67A 2JGDA 4GI3A 1RI2A 4DDWA 1Q81H 2HPZA 4PWZA 4RENA 3ZGOA 2VNHA 5TF4A 4DV5B 5FL7A 3WAGA 4MUEA 5LMUB 4G1EB 4BVSA 1VQOF 4D8TA 5AVRA 3PYXA 3IBYA 4JUFA 4QYIA 1P8JA 1XVUA 1U2ZA 4HQLA 3LD9A 3ZLUA 2PL5A 1NT2A 4ZHWA 1SWVA 2D0PB 2Z04A 3K1YA 3N2IA 1U40A 3EXG2 3PJEA 3THOA 5LP1A 4JUBA 1M6VA 2WTMA 4UEOA 3R7NA 2A33A 2BI7A 2C3PA 3FZGA 3W5CA 1XTVA 3ZOPA 4UBIA 2ZJOA 3DC2A 1Y6QA 5DM4A 3RARA 2GYYA 3PC2A 5KCZA 1G291 4P0QB 1CS0B 5A4JA 3O8OA 2FJUA 3ROZA 3OQOA 3ETDA 2BFDA 4YAWA 1E1QD 2QIOA 3GFFA 1OAPA 2WYVA 5K51A 1I1HA 2YV1A 3BBLA 1RJ9A 5EIEA 2W2LD 4U02A 2FSUA 1WDWB 4FUTA 3ID6C 3NUQA 2GPJA 1C2YA 5BSVA 3VPBA 4FIDA 1PNVA 3WK9A 2ZDHA 4Y2HA 3ADBA 3ET4A 1QPGA 5KYUB 2I2BA 3LXRA 1NLZA 5EIBD 5C8YF 1WKCA 3QNMA 1GPUA 3WX0A 4HDNA 5JZBA 1KJ8A 4Y2YA 4DCGA 4EUKA 5BW6B 2B7LA 1QRTA 1R6DA 3RWBA 1IQRA 4HDKB 1A5TA 5AIAA 2O59A 1EFPB 1Z0JA 1AUOA 2PZMA 5KYGA 4GC5A 1P75A 1SXJC 2WIAA 1LFAA 2Y1EA 1XQ9A 4KSBA 2VT3A 1TYZA 1FU7A 3BICA 3D8RA 1UM9A 3GGPA 4NJEA 2Q3BA 4D74A 4YUXA 4TSRA 3TIVA 5ITWA 1VJ0A 2W6QA 5CLIA 1V8DA 2PQ2A 3CCUF 5K3SA 4X3LA 3VR4A 1Y0BA 2GB4A 3IP7A 1UEXC 2NP7A 1Y7IA 2JIRA 2IL1A 4MV4A 5EJ6A 1JXOA 2YVUA 3OP4A 2NZJA 4R2XA 1RHMA 621PA 3KUXA 1P9LA 4O2BA 3W4KA 1O54A 1QGUA 1Z88A 5A5GA 3QPDA 5CAEA 2WTNA 2XDQB 4J6EA 4JI4B 2E18A 4RNDB 3JR7A 3AHFA 3PC6A 3JALA 5DX1A 4BVHA 5HWSA 5I9LA 3GHZA 3DLHA 2PUDA 4PQGA 3UA3A 2DTEA 1FMLA 1T9KA 1PEDA 1W4AA 5F2NA 3DDCA 5CR9A 1CUHA 4V0KA 4I99A 2H1HA 3KEMA 3A2LA 16PKA 3TLJA 2V3CC 3G88A 4YXWD 1EEHA 3EGXB 3OZIA 4M7OA 1K5GA 4P4NA 4L07A 4Y6GB 1FP4B 3KQNA 2XUOA 4R8VA 4W1PA 4FYWA 1U81A 1EP9A 1II8B 1WBJB 5B7QA 1M72A 1ZIYA 3SOPA 2XY4A 5CT9A 1MORA 4Z9AA 4E6PA 3J81A 1U6JA 1O0BA 1F8XA 1NP3A 2EJCA 1MZPA 3L4SO 4IJ5A 1NJ5A 4YMLA 1MLDA 1HK7A 1KVUA 1XAHA 2ZIXB 5L3SB 5A6SA 2CZWA 2J67A 3HKDB 3LUAA 4DCOA 3NOQA 1I94B 4MO9A 3QVWA 2ZSAA 1VLVA 4QJBA 4AF7A 2B7CA 5DHPA 1FNKA 1TK2A 3IE0A 2Y1FA 1E2EA 3VNAA 1GG8A 5SY6A 3ZHBA 5BNZA 3Q8KA 1KFCB 3V4FA 1Z6YA 5JPIA 3RTCA 4HMQA 2BAGA 2RI1A 3AV0B 4B87A 3C7KA 3F5FA 3F8WA 2JANA 3ZV3A 2VWQA 3S6JA 2HL6A 1WLYA 3V33A 2Q6LA 3QEOA 4D2IA 1YGYA 3KJEA 4B79A 1N32B 3WLPA 2AFIE 1KERA 3Q87B 4AMYA 1JJFA 5BMOA 1NU6A 5F9FA 3V32A 1GUFA 5AK6A 3X0DA 3S0YA 1EVKA 4ZZ2A 3WGJA 4A0HA 4PX5A 4D02A 3THXA 5JNRA 1T3HA 3NNNA 1NG1A 3NDJA 4BOYA 3UMRA 1AHPA 2CFSA 4HBGA 2BFCA 3Q8HA 3G0DA 5YASA 1Z63A 3MELA 4F71A 2ZVPX 4AZ3B 4C7VA 2PFGA 1X86B 4P3XA 5D5QA 5AMXA 3BXGA 3NOOA 1ZL0A 4OB6A 2PV0A 4HRXA 2W2TA 3WYBA 1JWLA 3BMNB 1XRSB 1DJMA 1AU9A 5LP6B 1N3IA 2J9ZB 3AEUA 1PE0A 2BFWA 3DTVB 3KAKA 3GY0A 4NZYA 4U7HA 4EITA 1IBKB 4HOYA 4G9BA 1U1EA 1CU1A 1WSBA 4OXNA 3RAEC 3II6X 5EAZA 3QVSA 4CMCA 1GAEO 4YQFA 1DRJA 1K3TA 3OOEA 3P2IA 4L9SA 5AUNB 3RD5A 1R0BA 2QN9A 3EE6A 4B45A 4YASA 1B15A 4NFHA 2JGFA 4YQEA 1OJLA 3PQ3A 4D9FA 1LQ2A 3NMUC 4HV4A 1E4OA 1PEKE 1NJ8A 3F90A 4MVYA 1LI7A 3KSAC 5IM5A 1IJKA 3OQMA 1F1BA 3OKCA 2ZETA 3OZWA 1OFVA 4XWTA 4QGBA 3ZX5A 4B6EA 3GZJA 5BN4B 1C1DA 5CA0A 4ZO6A 4NF2A 2A58A 1YZNA 4REMA 3HYSA 3G2PA 4RY8A 1F6BA 2NADA 3L8YA 3ZVMA 5B7NA 4RF4A 1CY4A 3DVRX 2BGIA 2ORYA 4BHTA 1VDMA 4UNPA 3SJZA 4BECA 2QN2A 1G7SA 1E4YA 2YYYA 4V1CI 1HPLA 3P7MA 1CIPA 2WQZA 2A2ZA 4FINA 3BGWA 4E12A 1A04A 2VNKA 2WZBA 1VG0B 1JJIA 4MUKA 1Q91A 1KA9H 2H63A 3O38A 3ITDA 2X0FA 2GO1A 4ITVA 5B1IA 4ENUA 1QP4A 1WMDA 1WRBA 2AIRA 3M49A 1P7VA 1T4GA 3AI1A 4WZZA 2YQZA 3B2NA 2VJMB 4NLLA 4U2BA 2GI4A 2NQ2C 3M33A 2Z2KA 3MWYW 4BZQA 4PS1A 3JYLA 4J9UE 4OUDA 2H1OA 3N7AA 2M32A 3H9CA 2DC1A 1YVEI 4MVJA 3JSAA 1ZQ1A 2X6TA 4BW0B 1ZGCA 2IE0A 4JGGA 4RMGA 3DOIA 3Q3HA 4OQ4A 1KQFA 2W8BC 2VSOA 1M1XB 6NULA 1UAAA 4YRCA 1F2VA 4TV9B 1Y7PA 2HGZA 2D5AA 3HKEB 3V3TA 5AI4A 2Y77A 2L17A 5BWMA 4ZP1A 1HETA 1RZRA 4JLPA 4AIIA 2DZDA 1TQ4A 5EHXA 1XCBA 1N8TA 4WCFB 1TT7A 4ALIA 4XUEA 5CLFA 4GX5A 2OV1A 4CG2A 1JHYA 4WKGA 4D1YA 3UGTA 2RIPA 1IQ0A 3R0IA 2VJQA 2CNNA 5E4JA 4ZT2A 4ARZA 3VYVA 4IXWA 1IN7A 4J0HA 5CDGA 1AXGA 4B46A 1TMYA 1E66A 1P7PA 1WO8A 2GJ8A 2IJGX 3TW8B 2C0PA 4QODA 1JFVA 4ZXFA 4EAAA 2Z6QA 4QBFA 4B09A 1EFRA 3BULA 1PQWA 2GBGA 3E70C 3DEFA 1UI9A 2V7BA 3NPAA 5E7MA 3VVBA 4ACAA 2F00A 2JEOA 2VBGA 1EVLA 2GXQA 2W5UA 1MNQA 4Z0NA 3JR3A 4NAUA 3E82A 4ZO7A 5JH7F 4Z9XA 1YI0A 4RDXA 3K5HA 4C6HA 3NVMB 3OOHA 3ZVRA 1ZXLA 4O3FA 1VIYA 4NICA 4L9AA 3FPAA 1Q7EA 1YJWF 4HLQB 2IBSA 5I7FA 1EFUA 2I7DA 2OGUA 3QVLA 4FYMA 2BFCB 2P65A 1K89A 1PEAA 2WIGA 4IIBA 4OYRA 4S2EA 2J9XB 4FGZA 3DAHA 1PVVA 3C1OA 1G7CA 1TVMA 3LWVC 3DA8A 2DM6A 4J1TC 1YRQA 2EW2A 2V5VA 1N5IA 4HYYA 3JS5A 5JAPA 4DMRA 2ZRHA 3S03A 5HQTA 2PLAA 1QH8A 5DYWA 2FP4A 2IOFK 1WU7A 1QM5A 1TAHA 2A7QA 1TKBA 2GKSA 3INNA 4ARBA 4DRZA 4BGUA 2G40A 2ZBVA 2PLFA 2HK6A 4W6QA 2NPFA 4UTNA 1BE6A 5I7UA 3OIUA 1AKMA 1YZVA 1QVVA 3HR4A 4QD3A 3ROTA 4BQNA 2HW8A 2DPLA 3ESDA 4OGWA 3RS9A 2C1EA 4P9NA 5B1HA 3UG7A 4DLYA 1GQOA 2OFOA 2F7SA 1E7SA 2K1SA 2ZS9A 3QLTA 3FB1A 4PQEA 2V7QD 2PWZA 2IWRA 3S4YA 1PVOA 3M5PA 1PEYA 3ZWKA 2I5PO 2NYRA 1R0YA 1XLVA 3KIPA 4NZ9A 4MUIA 3K8ZA 4Q93A 2E21A 2XZDA 3FETA 3QPCA 4WDRA 4ANFA 2WTBA 3SR0A 3L0IB 3F8SA 4G0MA 4MP8A 1ML3A 2ZYTX 2P6MA 4OFBA 1OA0A 4RA6B 4CCWA 3C6QA 1KE1A 3V8NA 1HI9A 5KYUA 3B3FA 1QS0A 1EVJA 2ANBA 2P2SA 3D7KA 3MGKA 1CYDA 2G9UA 2ZIGA 4NYMQ 4W4TA 1MV8A 4EQ6B 5LNK6 2DSNA 2P0AA 1QKIA 1W6UA 4ZN6A 3JARB 2C8LA 3CGGA 1NF3A 2EOAA 2TS1A 3FPBA 4RMHA 3HU3A 4HNTA 4P38A 1IB6A 1FVXA 2I6UA 1VOTA 1U0RA 1ZO8A 2JLYA 1NM5C 5JJCA 1QD9A 5J2UA 2BFFB 4YACA 3DXYA 3LH5A 1Y1PA 3Q3VA 5GOTA 4YFYA 4RTMA 4LWQA 2D6FA 4JLJA 1DTSA 3OC6A 3Q2OA 1KAEA 1P5FA 2GPBA 4RDCA 5KKAA 3O84A 3JVIA 2V6JA 2ILVA 2Q3EA 1E63A 3EGVA 3LT2A 3UB2A 1VSQA 1NW3A 2HX1A 3AO0B 3FR8A 3QVOA 3KEGA 4GMFA 4CMEC 4OL9A 4Q4CA 2A0XA 3IPRA 3EXFA 4UHBA 1ZMXA 3STVA 4D9CA 2GAIA 1YK0A 3P9NA 4IGKA 3P9PA 1B8PA 2EL9A 3KV3O 3M1LA 2H4FA 4ZO8A 5HBRA 1SHKA 3U56A 2ACVA 1R4MA 1U3CA 2EX1A 3JD2A 1E5QA 4EL5A 4WNAA 2R5WA 4AY2A 1P5RA 1LW7A 5ALWA 3GNTA 3CB2A 3BOSA 4QASA 4Q7MB 5C3UA 1RQ7A 3SYTA 3BDAA 3DKPA 4A5SA 4G09A 4J76A 3ZX4A 4JJ8A 5EUQB 1M2NA 4K0RA 4A6PA 4E5VA 4IHJF 2MJLA 4CMEA 1VSBA 1T3SA 3IQEA 1UJ4A 1WXDA 4MWZA 3PGXA 3ND8A 4QRIA 1U0FA 5J4VA 2JDIA 721PA 1FJ2A 5DOZA 2AMLA 5KVCA 5EJ4A 2JIQA 1SKBA 3ETCA 2VH5R 4B48A 1QKKA 2WIFA 1ZH8A 3DKRA 4LYHA 4PSUA 3VTAA 4BP1A 2J08A 3GJXC 3IUNA 3N86A 1T0AA 3ZO8A 3OO0A 5P21A 1TCVA 2FY8A 3KSZO 1PZNA 3DE4X 1IBLB 2AG0A 4MA5A 4ENVA 3W8FA 1V6CA 1XTZA 3GDFA 4RS3A 4DJJA 4EY5A 4F6LA 4CQLB 4NQZA 2YMQA 4QU0A 2IDJA 4YRIA 4P92A 3PLAE 2G7ZA 3U48A 1C9JA 3T9EA 3A8TA 2AEEA 2RG7A 4BMOB 3AH8A 5ISMA 1C9DB 3B36A 3ML1A 4XJTA 5DX0A 3ZI0A 1N2OA 1PDWA 4QM6A 1BRTA 1VXRA 3GCGA 1X1QA 2XWSA 2VA8A 1F51E 2B4TO 3Q1LA 4MW9A 5KWSA 4HSGA 3GVHA 2VP3A 4XJSA 1GQSA 1LGYA 4BB6A 3I2JA 2RKOA 3Q3EA 2VBCA 1AG9A 4BX2A 2CXSA 4BMZA 3TX2A 2H6LA 3NETA 5IBQA 3RUIA 2NQTA 4PC7A 3V5NA 5J23A 4DB4A 3CISA 4LFBB 1JIUA 5NULA 4POAA 3O91A 1FNBA 3A10A 1K7XB 4TQ9A 5AI5A 1OT5A 1NNSA 2X0NA 3IO5A 4KGVA 3W78A 3V2GA 5I48A 4BASA 2YH2A 3TVYA 1CR6A 4FDVA 3NTQA 3ZS8A 3FNEA 5J43A 1H4SA 4JL8A 4F72A 4HZUA 2R6HA 2RGUA 3AUSA 2DPYA 3B5IA 1R12A 2BJHA 2VKTA 3QSGA 4FSDA 3TBHA 1JKFA 1E3MA 2I0FA 4BL5A 4I2NA 3SYLA 4E7OA 2NTYC 3AP2A 4NMLA 3EW9A 3T4XA 1D2AA 1R0KA 1SCNE 1SK8A 1X87A 1UH5A 3DMDA 1JX6A 3L9XA 5KNLA 4E14A 4PX9A 1T8YA 5DB4A 3TBFA 3EXEB 3VPAA 4F96A 1ZVVA 3KBOA 1KNKA 1JL3A 4A36A 4F56A 1TI7A 5J5CA 2GK7A 3OF2A 1FNDA 2CFIA 3MJ4A 5K7SA 1W88B 3WRXC 4JH0A 3UF0A 3CM0A 4YR7A 3HE3A 3MHTA 3M1IA 1KQOA 4DNQA 4LTMA 4NYMR 4S0XA 1FSPA 1X94A 1Q7TA 3TSAA 1T15A 2AOUB 2J9YB 3QEKA 2I34A 1N2IA 1CG6A 2OBFA 2W37A 4KIWA 3V1LA 2CKDA 1YA4A 5LQKA 3RYTC 2MQEA 1JEAA 2CXNA 5M7EA 1UQRA 3DONA 3S70A 3Q88A 5DCLA 4ZYWA 1OXXK 5CA1B 3UNXA 4YQYA 3UJ8A 1HKUA 4C3OB 2JLVA 3U5TA 4Z9BA 2VTKA 4J43A 4F9TA 1ND5A 3FGNA 3C9UA 3NYQA 3UYKA 4YT2A 3HDHA 3GWZA 1Z5NA 1W4RA 1SBZA 4N3NA 3RJTA 1F6DA 1QIEA 2FLKA 2J7KA 1JFRA 1SXIA 1OSNA 3BK1A 3Q10A 4WEQA 2QRJA 5COBA 2LUOA 2X41A 3WFZA 1GO2A 5BVGB 5EWMB 3GHHA 1JHAA 5L3VA 2QMUA 1EX1A 1HEYA 3DAGA 4BP3A 1XTBA 2DFLA 4DS3A 4D9KA 1VJGA 2QUHA 4JGBA 4MI9A 4OGGA 3Q8LA 3TG8A 4X7BA 2KYRA 4YHBA 2YY6A 3B1WA 3H9GA 3HFJA 2FB9A 2FG5A 1ZVQA 1VIDA 3E35A 3NTLA 4REQB 3TCXB 4RIHA 4W9NC 1E2GA 3DPSA 3GG2A 1TM5E 3DZBA 3JD4A 3TFQA 5FJIA 4Q24A 1N5JA 3OJLA 2FPRA 1W34A 1OWLA 3TQCA 4I4CA 1JE1A 2FPOA 2OBBA 1IN5A 4GWKA 3TL2A 3RIMA 2G1UA 2VVTA 1L4KA 3ZVKA 4RFVA 3SMQA 3OIDA 3D3WA 4WINA 2QSUA 3W4JA 4GR5A 2FFAA 1GFZA 1COMA 2JIPA 3EZ7A 5AK4A 5KJ6A 1YAJA 3S8YA 1SU6A 5F33A 1EPUA 3CJRA 1FRNA 2X1HA 1B8UA 3F0DA 1W4BA 3C7CB 3EPPA 2RAUA 4HADA 3UGJA 3QU7A 3F98A 4RQAA 1TO1E 5BYKA 1I2MA 1B0ZA 2Q5EA 3PC8C 2QGFA 3OWXA 1H1DA 3VV3A 5C81A 4WBSA 5E3JA 4TKUB 1HT3A 2R60A 4RVGA 4C2TA 1KO4A 3O73A 1DARA 3A4LA 4NL4H 4RVCA 8OHMA 1MX9A 2PJDA 3NWJA 1QIGA 2ZIAA 3HH8A 3I45A 2AI3A 4G63A 1M1YA 1PJCA 4OCZA 3RBXA 4Z53A 3NVKE 1NW4A 3CA8A 3DZCA 3GDOA 1PJ3A 4KLCA 1U98A 4N8DA 4XASA 4B73A 1YCFA 2O0JA 1VHAA 5KQSA 3EJ6A 4US0R 1FDWA 4NY1A 5G0VA 1JAXA 1YRBA 4Q1VA 5E1DA 3MWFA 1GTVA 4H2DA 3ANXA 1A27A 3KE9A 4N49A 4Z51A 2E4UA 4PO9A 5ITSA 3FI9A 2R86A 1QCZA 4I5DA 2DUMA 2ZI5A 1QJ4A 1XV2A 1PNOA 5CW2A 4NVRA 1RLTA 3ZE2B 1MDBA 2IIQA 3DZGA 1XA0A 1IJFA 3CF4A 4G5FA 3KDSE 1QH8B 3AIMA 4G8DA 1UUFA 4RYDA 4ZOLB 4WK6A 3ZJ4A 3O9ZA 2Z8YA 4OJQA 3SYRA 2G9VA 4KIUA 2H57A 2IQ5A 2FHPA 4NTZA 4P93A 3RBVA 5LDGA 1W0KD 2GK6A 3WO1A 1EQUA 3PNKA 4BY9E 3AHJA 5IT9M 1FP4A 3KD3A 2FOXA 5ESXA 3RRMA 3WAKA 4HDAA 1O8BA 4MPTA 1UDBA 1UC4B 2I76A 3E23A 5K3EA 3AF2A 3VIUA 1CT9A 1L7VC 4EX6A 4F7WA 4N7RA 2O2JA 2ZIWB 4OHMA 3VOBA 2ZBRA 3PHLA 4ILEA 3CX4A 5JJIA 1JDPA 3K20A 4DM3A 1Y37A 3IERA 2HS3A 2ZSUA 2GNAA 1RPAA 1QTNA 5D7BA 2F1KA 2ZCVA 2QI2A 1RACA 4ZHVA 2NNWB 3ETJA 3DDOA 3VJRA 3LHKA 1YMQA 1D1PA 1J56A 1ESMA 2P5SA 3IVAA 4OAPA 5CXXA 3ZU3A 2HM7A 2Q99A 2Z2IA 4BMPB 5LKAA 1RBQA 3EAQA 4QPJC 5KREA 1JJVA 1MB0A 3ZY3A 5MF6A 5HFAA 2FSVA 4BQRA 5REQA 1N6KA 4YGXB 5ALGA 2HRRA 4OX9B 2YIVX 2JKVA 3ERNA 4M55A 3R3YA 2G3YA 1HO3A 3HL0A 4TTSA 3AFGA 3IP9A 2Y3IA 3OQNA 1OI2A 3AQIA 1FNMA 1HEUA 2X8LA 1W6RA 4JVSB 5B55A 2V7GA 3UAVA 4IM7A 1RVV1 221PA 3Q1KA 3OPNA 4S3MA 1J8QA 3KUKA 5AW1A 1NVMB 3BD6A 4GSYA 4GPTA 4W7SA 3KOXA 4B8ZA 1CZLA 1JGTA 1RJEA 3HUTA 4LECA 3DVSX 1JDZA 2Y71A 3H18A 4NYIR 3IIJA 4XIFA 1AE1A 2DUWA 3GLUA 5AKKA 2WKSA 2C83A 4JYPA 3HJFA 4BZWA 2ZQZA 2XGGA 4ZEWA 2XB8A 2YUTA 1A95A 3T7AA 3Q2KA 2Q9BA 3CVWA 3IJEB 5EFOA 4CIYA 2X0RA 4I5EA 4R69A 4MUMA 4R98A 2I4NA 2BH2A 3TF5A 3ZHTA 1ZZEA 4E32A 2EEZA 1QQ7A 2VPIA 3CO5A 1IL0A 5AKYA 5KAMA 4AIRA 4CU2A 5UKDA 4E2ZA 3SQXA 3H0CA 4FILA 4MJLA 1L4HA 1PT9A 1J2UA 2I65A 1HFEL 4PPFA 4QSHA 2NACA 5DWVA 3CVJA 2Z5VA 5GIOC 5HKLA 3GRAA 3D0OA 3R2JA 1GPWB 2X86A 5AKIA 3CG4A 1BU5A 5FRDA 1H2BA 1VE1A 3T1QA 2GHIA 3TXYA 4WW0A 4BAZA 1KSGA 5H81A 5I4KA 1HGXA 3L04A 5DULA 3PFGA 1EXNA 3UJPA 2IPOA 1CK4A 4QNRA 4CQMB 5JD6A 2L42A 1UXHA 2G5CA 3R40A 2NZYA 5CFNA 4O2BB 2GZ1A 1N92A 2IAFA 3WL3A 1WXFA 2ZLBA 1ZUD1 3KYDB 1CQIB 3HZRA 3UPUA 3P4XA 1ZU5A 1YZQA 1HLFA 1QAHA 5KSPA 2NVBA 1YQTA 1IRXA 4IDFA 4ISBA 2QX6A 4IR7A 5B36A 5LDDC 1KI1A 4TLEA 3DBLB 4A5OA 3TZBA 3SIRA 2QVYX 3KU4A 1U0HC 5I9NA 1ZKDA 1TJPB 3FR7A 4Y30A 4ZODA 4Y1RA 3AVPA 3MHPA 4BFTA 3L7YA 4Z3OA 1N78A 3IIEA 1A8UA 1IYZA 2CBGA 3S2EA 1CUWA 1AZLA 4L3VA 1H9BA 2NVUB 421PA 2A9OA 4WXYB 3PF9A 2V0GA 3OJCA 2JCGA 5EQTA 4EG0A 2DGDA 3ZCQA 2APJA 1VLHA 4R0NA 1ZLXA 1BKDR 1BXGA 1FOEB 4NV1A 3EVCA 5F21A 2C7PA 2HBQA 4D0RA 4F85A 1W9HA 4OI4A 2I71A 4L08A 4TQUS 1S72F 2O8EA 1H8HD 4JIGA 1RHKA 4F11A 1ZZGA 1BWPA 5JCOC 2YWDA 5HP8A 1M8FA 3KLNA 1EDEA 2QB5A 3HL4A 3TDKA 1KPGA 5CDTA 3UPTA 3EGDB 4Z0TA 5IXSA 3SBXA 2QENA 3ESYA 1NBHA 8ATCA 4P98A 1AT1A 3OF3A 4I8IA 2B1GA 2J3KA 3SWWA 1JJ2F 4TKLA 1QGZA 4UC0A 4XYEA 4YJHB 1SVIA 4PW0A 4U7GA 3I56F 1A76A 2ERXA 2INGX 2BFEB 1Z2EA 4BFZA 2C2MA 1XZMA 4E1BA 4EG3A 1XQ6A 1E6EA 1CUIA 2PXCA 3SAJA 1E7RA 3WB2A 4WLFA 2PJRA 1H7MA 1KJ9A 1M2VB 3EY4A 3AV3A 4MWOA 4B3JA 3NP9A 3GFRA 4JQYA 2OENG 5K3DA 4Q9IA 5HF9A 1K6EA 4CG0A 4ZARA 4MQUA 3LI2A 5CLGA 2PQ0A 1AF4A 3AR8A 1O97D 4Q1EA 3I28A 1S8FA 1NBEA 2FQ1A 1IPEA 4GW3A 4ALKA 1KZHA 4EF5A 1SU8A 2C42A 4MOWA 2IWHA 2YWFA 4MKRA 3VU3A 4IDOA 3GZTB 5FBRB 4K9KA 4MJXA 5BXQC 1G4UR 3WGQA 2ZB3A 1TLLA 4I55B 3FH0A 2BFMA 3AW8A 2V58A 3KYIB 4LYDA 5AD1A 1YMUA 1VE6A 2QORA 1A4IA 1B6GA 3ZHYA 3AJAA 4Q39A 5GV7A 4G4ZA 3EH1A 2DKNA 1U0NA 2ONJA 4LTDA 2Z95A 3RFFA 1IHYA 5CIQA 2JAWA 4RJLA 4G8CA 5JJKA 1HDYA 1N34B 4NI5A 4WY2A 2XT0A 3ZCPA 3VNVA 5LA6F 1RW4A 5TPZA 3E9NA 1E3DA 2RHTA 4AG3A 1E79D 4OL0A 2VZEA 4BKRA 3TNLA 2VZ0A 3O92A 3OFKA 2WYWA 1CZRA 2XMDA 1BOOA 2DHDA 2H59A 2WSMA 5BQXA 2H4JA 4E1VA 1UCFA 4BWYA 1U9IA 1UXJA 2KPOA 3R5JA 1I24A 3WLLA 4YFVA 1EWQA 3DTNA 4TYPA 1OU0A 3B6JA 2J87A 4J7CA 3IP5A 1OGJA 1U7UA 2C20A 2CF5A 1T25A 2IOYA 1JUDA 3SZ3A 1N6HA 3P2JA 1XOIA 3RA5A 1FMJA 3P10A 1DADA 3ADKA 3A6ZA 1RPJA 3EG9A 2J0EA 3QPVA 4K9PA 4MJ7A 1YJ9F 4WPGA 4C30A 3EPLA 1RTKA 3KG2A 2X40A 4BDTA 2VJMA 5DTMA 2XCSB 2IOFA 4DSAA 4EFLA 3DH0A 5DDIP 3EIOA 3SC2B 1WVIA 2X3FA 1MAAA 3N8NA 1E5XA 1BJKA 1N2BA 4BT5A 1P62B 1UC9A 2CJWA 2RGXA 3MG9A 1EFTA 3CB4A 3OF5A 5KQPA 3IH5A 4OFXA 2AHRA 3KKMA 3PJGA 1UINA 3MUOA 1CBUA 3R8XA 4RABA 1GPNA 3AM4A 3ADCA 4LDAA 1OFUA 5EZ6B 2PR2A 4E46A 4RJTA 3G4SF 3WA7A 2IXEA 1YITF 3GEBA 3FCYA 3W5VA 4FGJA 4LBWA 5CDFE 1T3ZA 3I32A 5HRCA 3KZOA 3H2BA 2XA1A 2YC2C 4L4XA 4Q5IA 1IM5A 3AKZA 3IDFA 4WX2B 1P9WA 2OGZA 1U7ZA 2RC5A 3KLOA 4KACA 4IV8A 1J4AA 2NVUA 4S1WA 1N9GB 1NLFA 1OYVA 2CK3D 2X5KO 4JIMA 4MKGA 1KGSA 1THMA 5EGNA 3LWQC 4DLZA 4XIIA 4Q4AA 4I50A 4MINA 2JLBA 1A82A 3VHLB 4ZI2A 1S8OA 1CZHA 1WU8A 3OTQA 4BMSA 5CG1A 5T57A 3UW3A 1PGPA 1K7EB 2QL5A 3MS7A 1RRVA 3HBJA 4JLBA 3MIZA 2WJGA 3LCRA 4OJKA 4EF6A 1WW8A 1ONNA 3D6JA 2X3YA 1IAQA 1P45A 4GNKA 4UXHA 2PAFA 3A28A 3ZCUA 1Y3CE 5E0OA 1CDEA 2IEDA 3H5TA 2ACWA 4IJVA 5JI3E 2P9HA 1E6KA 3AF5A 4R1TA 3TSWA 2PYDA 2W7TA 1PI3A 5U4XA 3HWRA 13PKA 1WXWA 3QF4A 1SXJA 3N2KB 3MGGA 1U7OA 2AN3A 2CYCA 4N8EA 4QXRA 3MGBA 1WUIS 3JAMM 1NKSA 1QZUA 2CJFA 1TUBB 3B1XA 3OTHA 2C31A 2O1SA 4L8GA 1P2SA 3N8HA 5CYFA 1UPBA 4BQIA 4CKEA 3U39A 1V4BA 2IXFA 1P7YA 2R97A 2D0DA 1TZJA 5CFMA 2OVBA 3THWB 3WL6A 3JATB 1BS2A 2I2CA 4S04A 3DZKA 5EMJA 1X7XA 1ODTC 1OLXA 3MJDA 1QTQA 4BAUA 1W87A 1U5BA 3DW1X 5ALEA 5KIAA 1AM4D 4FCVA 3LO5A 4N12A 3E2PA 4UNQA 4O4JF 2JDID 4B3XA 3G8BA 2WJZB 1OYOA 3HSSA 1Y82A 4RORA 4MX8A 1FDSA 1YR7A 2BSAA 3RJ5A 2BFNA 4MDHA 4UHEA 5I7HA 5JNLA 4MQLA 1EE9A 2DYKA 4Y98A 4B3BA 3EY9A 1UFVA 1XXLA 1Z73A 5A7FA 5K05A 5JNSA 2BM9A 2P2NA 3FMFA 2RONA 3LKBA 1LF0A 4KEAA 5EE3A 3UMJA 4HFJA 1JTEA 3NT5A 4QRHA 1HL3A 4V2UA 3X1JA 3C85A 4DLTA 3UKOA 3OJOA 5JXHA 1FVOA 1YQGA 5FBHA 2PUFA 3NP7A 1YIDA 3WRYC 1G42A 2A84A 5FX2A 3T5MA 1UFQA 2H7YA 1XVTA 3CUYA 2JFOA 3L7KA 4JB3A 4EHKA 5K8UA 3ZGZA 2GJ4A 3MF4A 2W6IA 3HA2A 4NARA 3G8YA 2E2WA 5TEWA 4EJSB 5TGZA 3DP7A 3AOGA 2HC9A 1XU4A 4ZVLA 3K32A 2IYSA 1UBKS 4UUQA 2DY0A 3VYSB 4WGFA 3GRZA 1GTMA 3OE4A 2WG1A 3DUFA 4N5IX 3T15A 4O4JA 3TOXA 1GL9B 1KY5A 6CHYA 4DMUB 4CMKA 3I6QA 1A8HA 2WF8A 4GUDA 1EZZA 3FZNA 1F5SA 2XYRA 3QUAA 4FWBA 4BRSA 5E1OA 3ZQUA 5FWXA 3I1YA 5FV7A 2PMCA 1L5GB 1XSEA 2DBQA 4RY2A 5CTJA 5DM60 1RRCA 3U2QA 5B7PA 4MS3A 3BFVA 4INAA 2FSPA 3HJUA 2WUFA 1YUBA 2CUNA 1V45E 2ZZKA 1QQBA 3FUXA 1AK2A 1PO7A 4MIEA 4FSHA 1YNOA 2LVBA 1UP7A 2N1MA 2BFOA 5HA5A 3DF7A 5FDFA 1FQOA 5GINE 2JNBA 3HRKA 2HV9A 1U3WA 1JNYA 3WR5A 3VO8A 4RNCA 2DTXA 2OPBA 1TA9A 4I1VA 5ENVA 3K0TA 2E55A 1SXPA 1TE2A 1W36C 2GD2A 1BX3A 1ZITA 5B3LA 3L1UA 2PKYX 5H3LA 2OZKA 4YJDA 4HX5A 3A26A 3IAFA 2HKIA 4NBRA 3CNOA 1O4VA 1OR8A 1UF9A 1TZBA 1YRAA 2DOKA 1FUEA 1HE8B 3AUJB 3F6YA 3FTCA 3OQVA 2AZTA 4L4YA 2NMUA 1MH1A 1S8NA 3I2HA 3LJKA 1MU0A 2ZAIA 1WB6A 2LKDA 1P6UA 3D64A 1ZONA 3WOHA 4DR2B 1B42A 4R7TA 1G5TA 2GN8A 4ZGGA 2PQMA 4K6HA 1GTRA 2VHWA 4DJTA 4PIMA 1UK7A 4B74A 3DL2A 1QLWA 1IC6A 3BA1A 4J90A 1JR2A 4UU8A 3NRJA 3ZWQA 1KYIA 1WS6A 3D59A 3ED1A 3KM0A 3OLYA 3PDIA 3Q6NA 3OEHA 1A2KC 3STUA 1Q6ZA 4QICA 5J4KA 1LDNA 3ZGVA 4NBNA 5EJ7A 2FSVC 1RLUA 3DLAA 4JZKA 1NMEA 3VZQA 1FFBA 3A3OA 1YR3A 3MINA 4IJWA 1R8YA 2EATA 1GZVA 3LC7O 5DTEA 5A5DA 3W06A 1Q0RA 2Z1UA 1VJDA 4ZD6A 3T95A 2FW9A 3PFKA 2E1RA 1GXSB 3BL8A 4FX5A 1TMKA 3RK4A 4JP5A 4Z4EA 1RWPA 4WIAA 1Y5LA 1QG4A 3I0MA 3I9V1 4RCVA 2R00C 4GLLA 3PGLA 3IB6A 2AFHB 4J75A 4MW5A 5IG2A 4MLCA 3CUUA 2Z98A 4E22A 4I4IA 5EB0A 1NXOA 1VZ2A 2GEUA 3KQQA 5DNUA 2O8FB 4JT4A 3PNSA 3SLRA 1KNXA 2HBYA 1T9AA 2OOSA 5HXZA 1GG9A 1QAQA 5IJXA 4DCJA 4REOA 3OKPA 2HHCA 4BO0A 4BLOA 1O5TA 2I6TA 1GAJA 4BLPA 5ADHA 2GAFA 1EA5A 4HPWA 3SICE 4HUTA 3OCXA 1J0XO 4L7VA 2O1EA 4HD8A 1XFDA 1Y8RA 4NEGA 3W5IA 4H1HA 3RF6A 2QUBA 1DTWB 1IFXA 1W49A 5JLAA 4XVRA 2PCJA 3RS0A 3PHGA 1JS1X 4ASUD 4CMIA 2I1LA 1OVMA 4EG8A 5CFQA 1HNWB 2RHWA 1GT91 1D8AA 5DOVA 1RVDA 1E2JA 4TTAA 4V39A 4HWTA 3D3EA 4L4SA 4QO8A 4TLDA 2O8EB 1O9HA 2XMZA 2PMEA 2PDAA 4MICA 5D01A 5CFPA 1WLSA 2JJ1A 4GMKA 4WKOA 2Q3MA 5IJ9A 2C5BA 3WXBA 5FPTA 1VJ5A 3PUZA 4ZAYA 5DNCA 3WJQA 2WNIA 5THXA 3QXGA 3AUUA 2J3QA 5KDDA 3DE2X 1MJGA 4A0GA 5E6SB 1QPZA 2OMKA 2J30A 3AM5A 3CONA 1CEYA 4BXOB 4WXPA 1TTQB 3F9RA 1E9DA 3BM5A 1QQTA 1T5IA 3EZ9A 5IYZF 4M0MA 3ZW7A 3OPYB 4JWTA 5B3JC 1W5TA 4G0UA 4WXMA 3SQDA 2XTJA 2B2NA 2O8VA 1VG8A 2DFKB 2JI6A 3E3NA 3STHA 1K8YB 2UYGA 1NQAO 1A8SA 3E5RA 4O59O 4CCAA 1W7AA 3ZD7A 2O8CA 1Q3KA 4KO3S 2GM4A 2AFIA 4HGPA 2X4IA 4JU8A 4LRUA 4Z4QA 1SOAA 1E3JA 5CP8A 2O7SA 2YXLA 3CH7A 5EJAA 5K0EA 4BEBA 3UWDA 1CQJB 4W9NA 3GMSA 1JLRA 3G9UA 3CUTA 4BBZA 1HURA 2VF7A 4EA9A 3I72A 5KVVA 2HJVA 3GP5A 4FZVA 1TADA 3BDIA 2PRIA 3AUFA 4PYLA 2VUUA 3TZEA 4A23A 2J4FA 4A2QA 1W93A 4GBED 4EQZA 2OCIA 3HNRA 5F1PA 2GAAA 2OB2A 1LU9A 3BFJA 2J3DA 3OFNA 2OHJA 5E6UA 5CEJA 2UUBB 1F48A 2D3TA 3JVVA 2PGNA 2VOEA 4M36A 3ROFA 3GQBB 3MGCA 1B6RA 5A06A 3KRTA 2R7LA 2XWPA 2QZ4A 4G1MB 3W34A 4AKSA 4C78A 2DBYA 3OM1A 4TL7A 4KO2S 3ST7A 2V8BA 1F0NA 1T9DA 3VPGA 4UTXA 3OTIA 2RC6A 4KO8A 2QD1A 1NQUA 1QO7A 3BJEA 3LPDA 4GQIA 4J0GA 1Y9DA 2OC4A 2O1XA 3JWJA 3WC4A 2VN8A 3MUNA 1VMAA 2AL7A 3F9IA 4KRXA 5EKSA 2B69A 4GUAA 1WA5A 2ZAUA 1GU1A 5F78A 1QO0D 2PS0A 4FDAA 1T2UA 4KN8A 2AG1A 3C5CA 1M2JA 1V5FA 3H5LA 3NHSA 1GSAA 3R7LA 2TRSB 2YASA 2G4CA 2PRJA 3A3YA 3F74A 1R6BX 1W1UA 5EG5A 1RWXA 3BQMB 3UJCA 1V5GA 1BE8A 2WUDA 2QVCA 2XUJA 2P40A 3RUEA 4E13A 4X66B 2Q3HA 2UZ3A 2JIBA 1OB5A 1FW6A 1NI4B 2PA3A 3UMBA 4WFIA 3EPJA 1E3EA 3N8DA 1FRVA 5CVTA 2WAAA 1MRNA 1S6YA 3QBJA 2FW8A 1R4NA 2Y92A 3KTAA 2HDNB 4MGIR 4HQNA 2Q2QA 3KB8A 1N5MA 4KGDA 1E18A 2E4AA 3EGDA 2Q9AA 3H5NA 1EDZA 4L4UA 4CF3A 2GASA 3BHMA 4NDAA 4XSVA 3CNNA 5CU7A 3K0SA 1IRIA 1QVRA 1TUIA 1XRPA 2Q9CA 2C04A 4D6YA 3QITA 3K31A 3F47A 3GGOA 1OROA 1ZY2A 2WABA 3NK6A 5A1TA 5FPKA 3FYHA 5IYZA 2PMBA 3JQDA 4XXHA 3WSVA 1AX9A 1E1CB 2JFPA 2PKXA 4UNSA 1FU8A 3UJ6A 5CB4F 1AGRA 5IF3A 2W2LA 4EY6A 3ONEA 2QTGA 5DKFA 3LK7A 3S5JA 2O2GA 2BGKA 3O3NB 3A9UA 3TOVA 2BO1A 3ZEAA 4UJ5A 3MBKA 2EGHA 1Z83A 3LW8A 3NFRA 1CUAA 1S2DA 4UMEA 1DCKA 2AR9A 2DJ5A 3E5HA 1JTFA 1PS8A 2QVXX 4PQRA 5IHPA 4NG5A 3ZLJA 3RA6A 1Z7GA 4C08A 4ZDKA 2Y1CA 4B62A 1KYXA 3B60A 3DB1A 1PF5A 2GXSA 3LUKA 4L5JA 5LD2C 3PYMA 3PQ6A 5IAJA 2W8ZA 2OZPA 1G5PA 3B70A 4LHVA 2VYND 2H2GA 3RFTA 3RNLA 5A04A 4WBNB 3NHMA 5D5PA 2QP3A 2H4YA 1HC7A 1XU7A 4JX8A 1XP5A 4D3XA 1V4VA 3LGSA 1RYFA 3ER6A 3K96A 3KXKA 3LUHA 4Y0NA 1KQPA 5LYJF 1G7RA 2I6FA 3DTTA 1IV1A 3DVLA 5KJFA 2QR3A 5JO9A 2HUPA 2NTJA 1RWWA 4PZDA 1XMVA 1MIOA 1NDQA 1YH3A 1G1AA 2NPIA 2GSDA 1HFJA 1N2XA 2KS6A 2VUSA 1VQNF 3LLSA 4OTZA 3CINA 5ULLA 3OY7A 5M3BA 1AJEA 4NCNA 4JYAB 3PA6A 3ZIAA 2ID4A 2YMMA 3HEAA 3L7LA 3WLQA 1FDIA 5DNYB 1ENZA 4DKXA 1XEFA 3P8ZA 1E98A 1KK2A 1J6UA 1UKCA 4L15A 1FTYA 1NZJA 3HCOA 2BR5A 1RIIA 2WIKA 4A7PA 2EJVA 2XMCA 3RYCA 1IXZA 5IFKA 5L7TA 1MIHA 4ATNA 1P5ZB 1RADA 5J47A 3LS2A 4JP2A 2PZJA 2O2IA 1QOQB 4F9FA 1RWQA 4PBSA 4UBJA 3PPXA 4EJMA 2ZYUX 4M98A 1JU9A 3WJRA 1X2BA 2NO9A 3CN9A 4XIGS 5JG7A 3TL3A 3RANA 2HR1A 1EFDN 5C5CA 4NABA 2ANCA 2JCSA 1BX0A 2XD9A 2R1TB 2W0MA 3B38A 4AJLA 1PJTA 3G0BA 5GV8A 3NXKA 4QTTB 1T0PA 4GYWA 4WLEA 5K3FB 1UDXA 2OECA 3A2NA 3PGVA 5AYVA 5B57C 5JAOA 1V9CA 3W5UA 2LCFA 3B9QA 3WLMA 4C4ZA 3I5UA 3KO8A 1AQLA 4ZAGA 1CUFA 3BILA 3A7DA 1PV2A 1M74A 1UC5B 3DE6X 4WCFC 5HX7A 2Q21A 2WIDA 3HLTA 2DPHA 1NIJA 3OETA 4BQPA 5BMVA 4JITA 4R2JA 1F0PA 4V02A 5H3CA 4ZI3A 5E95A 3GRCA 4HNQA 1GR1A 1LDYA 2HP3A 1O94C 2PX0A 4Z4GA 3SEQA 4Z7NB 2RKBA 1GGFA 1VQMF 5KNCH 5F23A 4YRGA 1QDUA 3DHYA 1WPQA 1RAEA 2B1JA 2H2AA 2Q5CA 3LHIA 4RHUA 3I23A 4PZYA 3CBQA 3HADA 4RSGA 5DK4A 4BO8A 2AOTA 2I4OA 4TYNA 2PL3A 1GKIA 4LWPA 1QTRA 1P0FA 3Q72A 4Q4AB 1A9OA 1USUA 3MW8A 2P30A 4JD5A 4Q3EA 1D6SA 3WL5A 2Q5OA 5EMLA 5TVGA 5L3SA 3E3LA 2XQKA 3IIKA 3R3HA 5FOWA 3PXXA 5A0VA 1P1RA 5I51A 1M6EX 5HJ2A 1LJ8A 3QOFA 1BD3A 1OLUB 3KXDA 3W7BA 5CX1A 1QH1B 4E11A 1L3BA 3C6YA 4M2LA 4HVLA 4OQNA 5C4IA 3W3ZB 4P22A 4QDTA 4TRJA 3QU4A 5HFNA 1R27A 2D7JA 2C2GA 1D1SA 5C8YB 2JHAA 3DAYA 3HYTA 2JVIA 3CF2A 3ICVA 1PLLA 2DQ4A 5ALDA 1QG6A 1EE2A 2A88A 3VKWA 4P0PB 2PWPA 4INJA 1EK6A 4TM7A 3BE4A 4PYRA 3TD5A 3WYGA 1T5HX 1PSWA 3WZLA 4QFBA 1GSIA 4US2R 1U9CA 2WOOA 1Y8QA 2R8ZA 3MGAA 4X20A 4J4HA 5EIOA 4F4CA 3EEOA 2OXIA 5CXUA 1TT5A 2XNHA 2VZLA 1QFSA 4UUOA 2HFJA 1ISSA 3DG9A 1NN5A 3FPEA 2I03A 1HDRA 2P9BA 1WZNA 4U0JA 5JS8A 2DHRA 5DXJA 5ICGA 1NXXA 2H1IA 3CX7A 4AJ9A 4JUDX 4EY8A 3NHZA 3DTVD 2A9VA 5JSZB 5T6BA 2F6RA 4ZI5A 1NR5A 3IPLA 1W0KA 2GN4A 2MSKA 2QWXA 2OO5A 6AT1A 2G9NA 1C0IA 1CUEA 2JGLA 4TL8A 4AFNA 4R1QA 1GUBA 4R2IA 3EFOB 1KQSF 5FP0A 4R7GA 1RXYA 1NDHA 3KJQA 4J0CA 1JR4A 5HDQA 3VX3A 5LQAA 2X9NA 1ZRSA 5CUQA 4WN9A 1IZ7A 3VO1A 2QAGC 4JLDA 3R7FA 1YJNF 4GPZA 4K2HA 1B00A 1PGQA 4G9GA 2IE8A 1KF0A 2X6RA 2UZHA 4WHMA 5ESDA 3K2QA 4OV6B 1NVXQ 1TX4B 1ZOSA 1AN9A 3RJMA 3G85A 2FXVA 4BE9A 3RG8A 1XI2A 3FDXA 4OFZA 121PA 1BGWA 2ARKA 3I1JA 4U4AA 3ZBPA 1CJVC 4B7XA 1C1DB 3I0ZA 1ODKA 2HMYB 3BG5A 2J9FA 1K7CA 5CM8B 1K86A 1QUFA 1GRCA 3EASA 1QE3A 4OPMA 2EWMA 5H8WA 2VYVD 2FX5A 2J5BA 3CRW1 5EHZA 2CSLA 1YQUA 4YIKA 4LY0A 5I8WA 4UM8B 1XCJA 2DEUA 2VATA 3WGHA 3V1YA 1U1DA 4O2AB 3KEOA 4ND3A 4XQGA 2WHPB 5JZMA 3AWIA 5C5IA 3D02A 1GTZA 1PFVA 4Q7EA 3W2FA 1SA0A 4P8RA 5CB4A 1DG3A 2WJWA 3PFBA 3KFXA 3FB4A 4LBVA 2AOUA 5A5FA 1BCRB 1PX2A 5L6MB 2GYVA 3U9LA 4AXXA 1PTJA 4DSTA 4IKEA 2AEFA 4I9GA 5CDHA 1R2QA 4ZVPA 3UFBA 1CVLA 4QAQA 3JQPA 2BEWB 3AM3A 2H92A 5DXAA 1NNLA 4LJLA 1E3IA 4NCXA 4Q3CA 5I5EA 5KJ1A 2ENUA 1H2AS 4QBGB 1ZH6A 2V0NA 4AMGA 1SR8A 1BVRA 2GESA 2OHGA 2QTHA 1O8CA 1L9KA 1KFJB 2VZ8A 4FGUA 2NP6A 4ZRMA 2NWQA 3H2JA 1K1EA 1W9MA 1GX1A 4EKGA 2W4IA 2VNIA 3HUUA 4BRZA 1IU9A 5C7LO 3CGWA 1E3QA 3BRSA 3OLXA 3H6KA 1YJXA 5DH9A 1U2DC 3JASA 1OAKA 2JLCA 2OSVA 2IEGA 3OLCX 3EC7A 4ENPA 2YJGA 4Q37A 1AUQA 1NVVR 3IAM6 5DP2A 3VPFA 1BFKA 4YMGA 3PXAA 4KYVA 3IDAA 2HI0A 2QJRA 4M7WA 3ZLTA 1W1IA 3QY0A 4HNRA 3D8BA 2MSEB 2OQVA 1UBNA 3AHCA 2NYAA 5HIMA 4ZYTA 3IOYA 3UUWA 5DYGA 2IBMA 3MWDB 4KR7A 5DX8A 4JOQA 3FFMA 5LUBA 3ZV7A 3FSEA 1K8AH 1F9AA 3HSKA 1PFYA 4PLHA 4X90A 4P53A 3UOAB 1R10A 1D03A 2ORIA 2Q6VA 2GN2A 3R7SA 1TKRA 3KHKA 4KXYA 5E2BA 1Y48E 3R3XA 2WYOA 4QQ8A 2R0QC 5ADWA 2VDWA 4MKHA 1WSAA 4C20A 2RHBA 2PWBA 3PNPA 2AJBA 3VOAA 1T29A 3L9WA 4GR4A 3TD9A 5JWOA 2P2ZA 1IZ8A 2B30A 3LUCA 5EC8A 2DPXA 3FTNA 4R8KA 3DZDA 5B4TA 3CMMA 3RVLA 2Z6AA 1DDIA 1ADBA 3A9RA 4ZYVA 5KMGA 3GYBA 4OF4A 1J99A 1JDTA 1I0IA 2WMNB 1SHLA 3ON1A 1FX0B 1NGSA 2BPOA 3F6CA 1RCUA 3PYLA 4Q1AA 5E9WA 3HKCB 3DW3X 1SGWA 4JAVC 4AZSA 4DIUA 4A15A 2B99A 1YR6A 4RY0A 1KP9A 4RA9A 1XZJA 3WWEA 2KGWA 4MHTA 4QU8A 2B9VA 3LUJA 4PHFA 4D0SA 4PPQA 5K0FA 2JASA 1Y89A 2JKZA 1YOVB 2QYTA 2M6SA 1V96A 2X58A 1KDOA 2IYZA 2CJXA 2MTBA 2JK0A 3DXFA 3F4LA 3OIGA 1UZUA 3PL5A 4P3OA 4RHXA 2OHXA 4D42A 2OQ2A 4YPVA 4RTKA 1ZN2A 4TZ0A 3QXCA 3TGLA 2DQYA 3DBRA 3G7NA 5AQ1A 4RVUA 1OIWA 2AQHA 4M0PA 3ELYA 3CCVF 3A1CA 2VHEA 1QRRA 3ENKA 5CT5A 4OVKA 2HH9A 4CI9A 1JJ7A 1DXHA 1DJOA 2IHBA 3A1FA 4ID3A 5E3HA 4BTLA 4IINA 5G4KB 5BP7A 2AJDA 3WQBA 1EBUA 2Y67A 1R5NA 4LIPD 5HE8A 2WAYA 2RD2A 1OZ0A 5AHWA 4XYMA 5ICFA 4HDSB 1OIXA 1I36A 3O8NA 1XPJA 4MKIA 2Y2UA 4ZYUA 1WKBA 2HMWA 4GI5A 2BFEA 2J8ZA 3JATA 3AP3A 1VP3A 1QIMA 1RYYA 4BVLA 3LCJA 4J07A 4Z7JA 2QY9A 4B2LA 3KX2A 1SUWA 1EX9A 2V8OA 1WULS 2HQSA 3QMWA 2ZRPA 3SC3A 3NBKA 1GN9A 3DOFA 2I2WA 4FYPA 1T4DA 4YT5A 3Q7RA 3L0DA 5E0KB 4H59A 3B5EA 2OO5C 1VMDA 2PUHA 3PTZA 3H17A 4TKMA 5D1NA 5J2TF 3HFSA 1IXSB 2O5CA 3VKGA 4JJZA 1HV8A 4YAEA 3NHFA 2VAWA 1SKAA 4H6VA 1C1XA 3WB9A 4BRUA 1RHJA 1TC2A 4J0EA 3Q5DA 2Z8XA 4G89A 3E27A 4JBHA 4UQOA 4DR1B 2FW7A 4CBVA 2WSIA 2CLKB 3BB3A 2ZUEA 1TXGA 4FGKA 1PYGA 2PGDA 2RHCA 1JWAB 1ISMA 1NJ6A 1U8XX 2IEZA 2ZWAA 3E05A 3LWNA 3FD5A 4XPZA 1WMFA 3AY0A 3O1IC 1XZNA 5FBKA 4C6SA 5LR6A 3M7IA 4XUCA 3FOWA 4HH0A 2ZITA 2QN6A 4V2IA 3FVTA 4TUYF 4DA0A 3R0VA 4RFSA 1SXGA 2JFHA 1BC5A 3G2QA 3GOQA 3H97A 5BYAA 1SPBS 1G63A 1YRLA 3AUXA 3G2MA 5EMKA 1URPA 3CEJA 1J0EA 4HI0E 4BXOA 3JQRA 2UVPB 1WDLA 3RS5A 2QE7A 3TRHA 2FK7A 4BT6A 1DT5A 1Q7BA 2HCTA 2WIBA 2Y0PA 3HYNA 1C4WA 3R3SA 1SUAA 3BF7A 1P1CA 3O31A 3I09A 2DF8A 4PCVA 4EPYA 5ES4B 2ZQ5A 4V0NA 3QPWA 3U4GA 1QG0A 2WJHA 1A2QA 4XRGA 1Q0PA 2E37A 1W2BF 5JMOA 3AVXA 2OC9A 3L7MA 3A0UA 3QHQA 5DYIA 1QR2A 5SZHB 3GT3A 3O1JC 4MVJG 5BSRA 4ID9A 5IANA 4MV1A 3UJDA 3R3VA 1LTHR 4Z9FA 1RQGA 3PFHA 1QS0B 3TQRA 4EBFA 3FPHA 3LC2O 3TTWA 3HO1A 2J6CA 1T5DX 1ABBA 2CUZA 1BNCA 3GLFB 2B4RO 4B3TB 1NNI1 4UFNA 1UKYA 2EFDB 4B8WA 1A8QA 4LOIA 1W2GA 1XCOA 1SUFA 4ZEOA 3GJTA 4O4HB 4BT7A 1DAGA 2H07A 4TOIA 3O75A 5BSHA 2NLOA 3MT0A 1ESZA 3MZ0A 1OLUA 3C45A 3HNOA 3PS9A 1CP3A 4C14A 2V65A 1NR7A 3G8CA 3ZWMA 2FEPA 4C0WA 3FMOB 2CLSA 3EPRA 2OP0A 1WQ3A 3CSDA 3VBEA 3GWGA 4B75A 1F12A 5DN6A 3LQRA 2CSXA 4D5GA 2XWQA 2VDUE 4F4UA 1MAHA 1Y9AA 3EUEA 1UJ5A 5MN5A 1Z75A 4LCJA 3U7EB 4UHCA 3T54A 1T8SA 1EVYA 1SOUA 3GN1A 4XX1A 3B53X 1G8FA 2R2AA 2IHUA 1WNFA 3TRJA 1KEVA 4N5HX 4NCBA 1U9IC 2Q3LA 3FZQA 5JAHA 2DCUA 3C8LA 3FKJA 3PDIB 1QQAA 2A67A 1JFTA 2XDAA 4NCKA 2JK1A 3N0VA 3SLGA 1VHDA 3IUPA 1FQJA 1M8PA 3HU1A 4X65B 4WESA 1YZTA 2JLQA 2XCLA 3GLVA 4RPKA 5BR7A 4WXEA 3VTFA 4IVRA 5D7NA 3A31A 4P6VF 3UK1A 3A04A 5IBPA 3T06B 2R6FA 2QE6A 3VCZA 2F64A 3CEAA 2FRXA 3GBVA 5EQFA 3NZEA 2WJ3A 5H70A 1X42A 2J0UA 3S7TA 4MQEA 2HLDD 3T35A 2CHUA 3NWEA 1D9XA 3HBMA 3V7YA 5E9AA 1COZA 4EJ0A 3DMHA 4HEJA 3ZWWA 2PGXA 3O3OB 5ETJA 10MHA 3PPVA 1B16A 5DM2A 2XUQA 4Q3NA 4ZEMA 2PBRA 2ZRJA 3KZXA 4O5AA 4U3JA 2NZUG 1IK4A 3HDQA 3V4SA 5E8RA 1HDOA 3ENZA 3GGJA 2RSLA 1L9XA 5LP6C 3W3AA 4G5YA 4IBOA 3BKWA 2B5WA 4MWBA 3E1YA 4RKFA 4TWRA 3BIWA 3K1AB 4KNYA 3N4ZA 1N5KA 4P5PA 1CJBA 2WILA 3FCCA 3LNTA 4QYSA 4EH1A 2O7VA 2AZDA 3LA8A 1JEOA 3OCZA 3O8CA 2FW6A 1UZLA 2N75A 2ZUSA 4EY4A 1U3UA 4FE4A 1QVWA 1ADGA 3MDOA 4OQFA 3GJZA 5JZVA 2H11A 4NNOA 3C70A 1ADJA 4HQ6A 2ZTVA 1KWKA 2C7QA 2W2QA 1MRSA 3C97A 1QLJA 2V45A 5IARA 1MD9A 2I2AA 1MEOA 1JWBB 1ISPA 3D00A 3ESBA 3TVTA 5BVHB 3E1KA 3OUUA 2JAHA 5HQ3A 1BXRA 3IEUA 3RYHB 3SJUA 3BXXA 4GPD1 4XFJA 1MENA 1SVKA 4R01A 2Z09A 2Q7OE 4IX1A 4IH4A 3K8YA 3ZQJA 4EB6A 3LWBA 3ZCXA 5DO9A 3K09C 5TT1A 4IUDS 2RHLA 3PBKA 2QJWA 2E0IA 1FYWA 2EXXA 3DULA 1JVNA 1GR0A 2ZS7A 4I46A 4H60A 3NHRA 5BSUA 2I22A 4AL4A 3H2IA 1U65A 2P75A 3OFSA 2ST1A 3SJBA 5C1DA 1MOSA 3GH3A 1VYHA 2JGJA 2A0WA 5ILQA 5CFRA 1Q7GA 3AEXA 2CKMA 4JQSA 4GHWA 4YCBA 3EFOA 2J32A 4XUDA 2HXYA 1C4OA 3KXIA 1PIWA 1I13A 3G6KA 5HCIA 4PSCA 1M66A 1SZQA 1ZESA 2X0JA 2O2SA 2EF0A 1XDZA 3O7WA 3OE5A 2OCYC 1XBTA 4MKXA 3REGA 5ILOA 4QM7A 4LJ8A 1AHIA 3DC7A 2NO5A 2SECE 4J1SA 1MXHA 1FYFA 1KQNA 1CY8A 1ZX1A 2PS3A 2WU8A 4F8JA 3G5UA 1BN7A 1W88A 2W2PA 3DE0X 4GDFA 2NXWA 2OZLB 5DRTA 2QM8A 5JRDS 2VPTA 4UPDA 2NX2A 4ALLA 5AW4A 5EJIA 1P7WA 9GPBA 4RMJA 1KOJA 4UM9B 5JPDA 1M90H 3N07A 3O93A 2V9CA 1JBQA 4IFBA 4KRGA 2AW5A 5DIFA 3TZQA 4ZV4A 1G16A 1KY3A 1AKTA 1USKA 1WCWA 1XR3A 3VZRA 2FA9A 1RPTA 1Z0KA 2HRBA 1MABA 2AUMA 4PC3A 5K3CA 1XDUA 4JSTA 3T3HA 4BO3A 5IKMA 5JEDA 5EKUA 4MUJA 4L5CA 3IUYA 4JX9A 1CLIA 1JVBA 1UFRA 2O2ZA 2HZBA 5BOVA 2HCJB 4KQGA 2EKBA 4YCSA 1CC1S 1V95A 2P3SA 3FX2A 4GS5A 4ER5A 5JS1A 1T5BA 1DSSG 1BQ3A 4G4WA 5K0TA 4HYTA 1FK8A 4MDYA 1RAHA 2EKPA 2FU5C 1RYZA 2BT4A 3NOXA 4MIOA 1POWA 4QYMA 4B47A 2WWYA 2A57A 2QG6A 4N7MA 1KI7A 1YS7A 5M04A 1Z6TA 4WKBA 4KR9A 2R44A 1C41A 2A1UA 2O2EA 3HVJA 3ZIDA 1IN1A 3BXHA 4RZXA 1ZD5A 3T5DA 4EMBA 3C3KA 1SIUA 2ZIEA 1PFKA 3KSRA 3PJFA 4EHJA 2JLZA 2BTQB 2O3RA 3W5SA 2PMPA 1DWUA 2KSQA 4RHFA 3C98A 4LOLA 5IAGA 3NUGA 3DOCA 4YNBA 4EEKA 3ZDBA 3Q3GE 2C54A 1N25A