1QVGF

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1qvgF00
3CCVF 1VQ8F 4BW0B 3LWOC 3CCSF 5GANK 3MCAB 3CPWF 1Q86H 3CG6A 1NJIH 2I6DA 3RA5A 1YIJF 5FJ4C 1GO0A 5EO3A 1Q7YH 3SIUA 2FC3A 3LFOA 1GZ0A 2CZWA 3JCMM 3WXMB 5GIPC 1M1KH 2KTUA 3PAFA 5FLXM 2OTLF 3VMFB 1T0KB 3O85A 3CC7F 3NVIB 3OW2F 3CC2F 2OZBA 3G6EF 1N8RH 1M90H 2LBXA 1W42A 3I56F 3CCJF 2QA4F 5GAPK 4LCKA 3OBYA 1S72F 3ON1A 3J7AR 1Q82H 2AIFA 3FFMA 3RA6A 3CC4F 1X7OA 1VQLF 3CD6F 1X7PA 5GIOC 4X3MA 1W40A 2LBWA 3N4YA 3E20B 3CMAF 1Q81H 2QI2A 4NUTA 3NK7A 1YJ9F 3CCRF 5G4VC 1X52A 2OHWA 1VQ9F 3HAXD 3LWVC 1E7KA 2VGMA 1KD1H 5DCVA 1VQPF 1DT9A 1YJWF 1VQ6F 5EWRA 3E1YA 1VQMF 1K8AH 2KG4A 1W3EX 3OBWA 1VQ5F 3LWRC 1RLGA 2OTJF 1K73H 3I55F 1W41A 3G4SF 1YITF 3CCUF 1SDSA 3CXCF 1QVGF 1H7MA 5G4UC 1VQ7F 3V7EA 5IT9M 3VI6A 1CK2A 3GYQA 3CCMF 3CMEF 1KQSF 1PXWA 2BO1A 3N4ZA 1VQOF 3G71F 3J81M 3LWPC 3JAMM 4TZZA 1YJNF 1VQKF 1W2BF 1CN7A 3NK6A 1IPAA 1VQNF 1YHQF 1YI2F 2KTVA 3CCQF 1K9MH 1QVFF 3LWQC 1NMUB 3IR9A 3NMUC 5GINC 4C4WC 3HJWC 3CCLF 2HVYD 2VGNA 3SIVA 2JNBA 5A2QM 3PLAC 1VQ4F 2WALA 1KC8H 2QEXF 3J80M 3AGKA 3CCEF 1JJ2F 2ALEA 4BY9D 1RA4A 1ZWZA 1XBIA 1GO1A 3V7QA 3CPQA 4X3LA 3NVKE
chains in the Genus database with same CATH superfamily
2V9YA 1W5EA 1VQ8F 1QD9A 2VAWA 4TV8B 3JARA 5IYZA 1Q86H 1NJIH 4B62A 5FJ4C 5EO3A 5LXTB 2YXZA 4BT4A 3MCQA 1Q7YH 4EI7A 3SIUA 5LYJA 3LFOA 4YJ3A 3WXMB 4ZOLB 1RLUA 3PAFA 2OTLF 3M1XA 3VMFB 3LMEA 3O85A 4X1IB 2IAFA 1FFXB 2DT4A 4TV8A 2OZBA 2DYYA 1KNKA 2VXYA 1M90H 1JFFB 5LXTA 1ONIA 1Z5VA 3WGJA 4TUYB 3HWUA 3ON1A 3LYBA 4ZOLA 3J7AR 2HX0A 4X1IA 4ERHA 1FFXA 1X7OA 4G4ZA 3RYIB 3EORA 4X3MA 1W40A 1JFFA 1SA0B 1TVKB 3F0EA 4TUYA 4FFBB 1VQ9F 4U39A 3S06A 5C8YB 1OAPA 3RYIA 1DT9A 2PHNA 3VYUC 1SA0A 3E1YA 1TVKA 4C81A 1VH8A 4FFBA 4ZI7B 1QAHA 5JH7B 2OTMA 2OTJF 1K73H 1U3LA 5MN4A 5C8YA 1YITF 4DRXB 3QHDA 5G4UC 3V7EA 5ITZB 5IT9M 4BT7A 5HP8A 3VI6A 4G4YA 3GYQA 4BVRA 3RYCB 2BO1A 3WGMA 2HP0B 2CWJA 4ZI7A 4TZZA 5JH7A 1VQKF 3KHNA 4WBNB 2MQEA 5AVMA 4DRXA 3IKFA 4C8EA 5ITZA 2H8EA 3NMUC 2RHJA 5GINC 3RYCA 2Z1TA 1FNJA 2UZHA 4C4WC 5HY4A 4TV9B 3HKDB 3HJWC 2HVYD 2VGNA 1RQ2A 2HP0A 1FNKA 1QU9A 4RHAA 3R0PA 5A2QM 1VQ4F 2FGYA 4X1KB 1W55A 3ERNA 3K0TA 4WBNA 5LP6B 1KC8H 3CCEF 3FBAA 4BY9D 4EI9A 1ZWZA 2P6YA 5JCOC 1GO1A 3KJKA 3HTNA 4ZHYB 4TV9A 3HKDA 1W5BA 3CCVF 3ELCA 3HKEB 3RYFB 4BVQA 3LWOC 3CCSF 4X1KA 5LP6A 5GANK 3CPWF 4C8GA 3TD5A 2I6DA 1YIJF 1IV3A 1GO0A 5GONB 1VQVA 2CW4A 2FC3A 2ZVYA 2BTUA 2CZWA 2W8BC 1M1KH 3JVHA 5FLXM 3ESJA 2ZAUA 3HKEA 3RYFA 3CC7F 1JY8A 3NVIB 5EB1B 5B8FA 2AMTA 3HKCB 1OFUA 4XCQA 3CCJF 4G88A 3CB2A 5GAPK 3VOBA 2PMPA 5GONA 4LCKA 3OBYA 1S72F 3E22B 3ZO8A 5IJ9B 1YQNA 3M4SA 5KMGA 2ZOVA 3FFMA 3RA6A 3ZOPA 3HKCA 1YGYA 2NMUA 4I4TB 5GIOC 3MDOA 4ZK7A 4EI8A 2LBWA 3N4YA 3E20B 2HS4A 3CYQA 3E22A 3CMAF 1Q81H 5IJ9A 1YJ9F 3C9SA 3MQWA 2CHSA 1SZQA 3VO8A 4BT3A 1X52A 2HS3A 3LWVC 3D54A 1R1MA 2Q1YA 2UYPA 4I4TA 3B6NA 1JN1A 3GTZA 1K8AH 5CA0B 3V4DA 2RHLA 3VCZA 4KWEA 1J7HA 4M8IA 3JAKB 2G9IA 5EAZA 4NWOB 3CCUF 3ZP4A 4ZHWA 5MN6A 3IKEA 1QVGF 2RHOA 1PXWA 4R40B 3N4ZA 1Z5WA 5CA0A 3LWPC 2YYEA 3I7TA 1YJNF 5LA6B 3JAKA 1CN7A 2HS0A 1IPAA 1VQNF 1YHQF 1YI2F 3CCQF 3LDTA 3IR9A 5FNVB 2ZVZA 2RB9A 4O4IB 3WJQA 3WGNA 4LNUB 5LA6A 4HNAB 3PLAC 2WALA 1W5AA 2BTQB 1ODEA 4O2AB 4F6RB 1W581 2HRYA 2ALEA 3F6MA 5FNVA 4O4IA 1VHAA 4X3LA 2UYKA 3V7QA 2IQQA 1DBFA 5J2UB 5HWEA 2ZF8A 4LNUA 4HNAA 4G4XA 4NQ3A 3P10A 1PF5A 1U40A 2R751 3RA5A 4O2AA 4F6RA 1T0AA 3N2GB 1GZ0A 3S0WA 2RHHA 2AIZP 3JAWB 3JCMM 1XHOA 1IV1A 3JASB 3C8LA 5J2UA 4X1YB 3S0HA 3CC2F 1KNJA 5BMVB 3G6EF 1N8RH 4C8IA 4G4VA 5LOVB 5HY0A 2GZLA 2LBXA 1W42A 3I56F 2VAPA 2QA4F 1JD1A 2CHTA 3U0OA 3N2GA 3JAWA 4EB6B 3IEWA 3M84A 3JASA 1Q82H 4X1YA 2AIFA 5BMVA 1VQLF 5LOVA 3CD6F 3VOAA 2VAMA 1W5FA 4IIJB 5KMGB 2QI2A 4NUTA 3NK7A 3CCRF 4BT2A 4EB6A 3F0FA 5G4VC 2OHWA 5CB4B 5EYPB 4O4HB 3ZP7A 2L26A 1KD1H 5HXZA 5J2TB 1NQ3A 2F9ZC 1VQPF 3TD3A 3D01A 1YJWF 1VQ6F 1W59A 4C82A 4IIJA 4I50B 1TUBB 3D00A 2HQSC 4O4LB 5IJ0B 2KGWA 3K2XA 3WGLA 3LWRC 1RLGA 3P0ZA 5CB4A 3TD4A 5EYPA 3I55F 1IV2A 3K14A 4O4HA 3WGKA 1SDSA 3CXCF 5J2TA 2CVLA 1H7MA 1XV2A 3CCMF 1VK3A 3CMEF 3F0GA 1KQSF 4I50A 1TUBA 3S02A 4O4LA 3WJRA 3G71F 5EZYB 3J81M 5IJ0A 1IV4A 3N2KB 2HP3A 5EIBD 3Q8HA 1Q8RA 4G4WA 3CYPB 3NK6A 2KTVA 3FD5A 4B46A 3LWQC 1NMUB 3JATB 3QUWA 1U3PA 3WPWA 2Z1FA 3DDNA 1GX1A 3CCLF 5EZYA 4DXDA 3N2KA 2JNBA 4ZHQB 3RE3A 2K1SA 3OONA 2QEXF 3J80M 1JJ2F 4RQOA 3JATA 5JCOA 3NVKE 1UFYA 2GLZA 1X25A 4PWTA 4ZHVA 5LP6C 4BW0B 4ZHQA 3MCAB 3VYTC 3CG6A 3WJPA 3VTIC 5HP7A 3L7QA 2BTOA 4E6EA 3KE1A 5GIPC 2H6LA 2KTUA 2LCAA 2N48A 1T0KB 3C9UA 4BT5A 3OW2F 2Z1UA 5HY1A 3F0DA 3RYHB 5KX5B 2Q1XA 3JALB 3FPIA 5CA1B 2ZODA 1XRGA 3S03A 3CC4F 3IEQA 3T80A 4O4JB 1X7PA 4YJ2B 1U43A 3VYSC 1H48A 3RYHA 5KX5A 3DC2A 3HKBB 5HY2A 1CLIA 3JALA 4IHJB 2HRUA 2UYNB 5CA1A 3HAXD 3C9RA 3GHZA 4BVTA 5HXUA 2IG8A 1E7KA 2VGMA 5DCVA 5MN5A 4X20B 4O4JA 4B5CA 3S0YA 2H8CA 2Z01A 2B33A 4YJ2A 3K12A 5EWRA 3QTYA 3IMPA 1VQMF 2KG4A 5JVDB 3HKBA 1W3EX 3OBWA 4IHJA 2LBTA 1VQ5F 2UYNA 2Z1EA 3P4EA 1W41A 4BT6A 3G4SF 4BVSA 3WPXA 4X20A 4O2BB 4B45A 1VQ7F 3MBMA 1CK2A 5EB0A 1VQOF 5JVDA 4U3JB 5EIBC 3JAMM 1RQ7A 1W2BF 5JQGB 1QVFF 1K9MH 4O2BA 2GVIA 3UT5B 1H47A 2EWCA 2QTPA 3C9TA 3VIUA 3I3FA 4I55B 4U3JA 1FSZA 3SIVA 1UI9A 1COMA 3JARB 5JQGA 5IYZB 1W57A 3AGKA 3FD6A 2UYJA 3BYQA 3UT5A 1RA4A 5LYJB 1XBIA 3V3TA 3CPQA 2R6R1 4YJ3B 2CSLA 3KIZA 3KJJA 2I6RA 4I55A
chains in the Genus database with same CATH topology
3CCVF 5HWEA 4BVQA 1VQ8F 4BW0B 3LWOC 3CCSF 5GANK 3MCAB 4NQ3A 3CPWF 1Q86H 3CG6A 1NJIH 2I6DA 3RA5A 1YIJF 5FJ4C 1GO0A 5EO3A 1Q7YH 4EI7A 3SIUA 2FC3A 3LFOA 1GZ0A 2CZWA 3JCMM 3WXMB 5GIPC 1M1KH 2KTUA 3PAFA 5FLXM 2OTLF 3VMFB 1T0KB 3O85A 3CC7F 3NVIB 3OW2F 3CC2F 2OZBA 3G6EF 1N8RH 5HY0A 1M90H 4XCQA 2LBXA 1W42A 3I56F 5HY1A 3CCJF 2QA4F 5GAPK 4LCKA 3OBYA 1S72F 3ON1A 3J7AR 1Q82H 2AIFA 3FFMA 3RA6A 3CC4F 1X7OA 1VQLF 3CD6F 1X7PA 4X3MA 5GIOC 1W40A 4EI8A 2LBWA 3N4YA 3E20B 3CMAF 1Q81H 2QI2A 5HY2A 4NUTA 3NK7A 1YJ9F 3CCRF 5G4VC 1X52A 2OHWA 1VQ9F 3HAXD 4BVTA 5HXUA 3LWVC 1E7KA 2VGMA 1KD1H 5DCVA 5HXZA 2F9ZC 1VQPF 1DT9A 1YJWF 1VQ6F 5EWRA 3E1YA 1VQMF 1K8AH 2KG4A 3D00A 1W3EX 3OBWA 1VQ5F 3LWRC 1RLGA 2OTJF 1K73H 3I55F 1W41A 3G4SF 4BVSA 1YITF 3CCUF 1SDSA 3CXCF 1QVGF 1H7MA 5G4UC 1VQ7F 3V7EA 5IT9M 3VI6A 1CK2A 3GYQA 4BVRA 3CCMF 3CMEF 1KQSF 1PXWA 2BO1A 3N4ZA 1VQOF 3G71F 3J81M 3LWPC 3JAMM 4TZZA 1YJNF 1VQKF 1W2BF 1CN7A 3NK6A 1IPAA 1VQNF 1YHQF 1YI2F 2KTVA 3CCQF 1K9MH 1QVFF 3LWQC 1NMUB 3IR9A 3NMUC 5GINC 4C4WC 5HY4A 3HJWC 3CCLF 2HVYD 2VGNA 3SIVA 2JNBA 5A2QM 3PLAC 1VQ4F 2FGYA 2WALA 1KC8H 2QEXF 3J80M 3AGKA 3CCEF 1JJ2F 2ALEA 4BY9D 4EI9A 1RA4A 1ZWZA 1XBIA 3V3TA 1GO1A 3V7QA 3CPQA 4X3LA 3NVKE 2GLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV F;  1VQ8 F;  4BW0 B;  3LWO C;  3CCS F;  5GAN K;  3MCA B;  3CPW F;  1Q86 H;  3CG6 A;  1NJI H;  2I6D A;  3RA5 A;  1YIJ F;  5FJ4 C;  1GO0 A;  5EO3 A;  1Q7Y H;  3SIU A;  2FC3 A;  3LFO A;  1GZ0 A;  2CZW A;  3JCM M;  3WXM B;  5GIP C;  1M1K H;  2KTU A;  3PAF A;  5FLX M;  2OTL F;  3VMF B;  1T0K B;  3O85 A;  3CC7 F;  3NVI B;  3OW2 F;  3CC2 F;  2OZB A;  3G6E F;  1N8R H;  1M90 H;  2LBX A;  1W42 A;  3I56 F;  3CCJ F;  2QA4 F;  5GAP K;  4LCK A;  3OBY A;  1S72 F;  3ON1 A;  3J7A R;  1Q82 H;  2AIF A;  3FFM A;  3RA6 A;  3CC4 F;  1X7O A;  1VQL F;  3CD6 F;  1X7P A;  5GIO C;  4X3M A;  1W40 A;  2LBW A;  3N4Y A;  3E20 B;  3CMA F;  1Q81 H;  2QI2 A;  4NUT A;  3NK7 A;  1YJ9 F;  3CCR F;  5G4V C;  1X52 A;  2OHW A;  1VQ9 F;  3HAX D;  3LWV C;  1E7K A;  2VGM A;  1KD1 H;  5DCV A;  1VQP F;  1DT9 A;  1YJW F;  1VQ6 F;  5EWR A;  3E1Y A;  1VQM F;  1K8A H;  2KG4 A;  1W3E X;  3OBW A;  1VQ5 F;  3LWR C;  1RLG A;  2OTJ F;  1K73 H;  3I55 F;  1W41 A;  3G4S F;  1YIT F;  3CCU F;  1SDS A;  3CXC F;  1QVG F;  1H7M A;  5G4U C;  1VQ7 F;  3V7E A;  5IT9 M;  3VI6 A;  1CK2 A;  3GYQ A;  3CCM F;  3CME F;  1KQS F;  1PXW A;  2BO1 A;  3N4Z A;  1VQO F;  3G71 F;  3J81 M;  3LWP C;  3JAM M;  4TZZ A;  1YJN F;  1VQK F;  1W2B F;  1CN7 A;  3NK6 A;  1IPA A;  1VQN F;  1YHQ F;  1YI2 F;  2KTV A;  3CCQ F;  1K9M H;  1QVF F;  3LWQ C;  1NMU B;  3IR9 A;  3NMU C;  5GIN C;  4C4W C;  3HJW C;  3CCL F;  2HVY D;  2VGN A;  3SIV A;  2JNB A;  5A2Q M;  3PLA C;  1VQ4 F;  2WAL A;  1KC8 H;  2QEX F;  3J80 M;  3AGK A;  3CCE F;  1JJ2 F;  2ALE A;  4BY9 D;  1RA4 A;  1ZWZ A;  1XBI A;  1GO1 A;  3V7Q A;  3CPQ A;  4X3L A;  3NVK E; 
#chains in the Genus database with same CATH topology
 2V9Y A;  1W5E A;  1VQ8 F;  1QD9 A;  2VAW A;  4TV8 B;  3JAR A;  5IYZ A;  1Q86 H;  1NJI H;  4B62 A;  5FJ4 C;  5EO3 A;  5LXT B;  2YXZ A;  4BT4 A;  3MCQ A;  1Q7Y H;  4EI7 A;  3SIU A;  5LYJ A;  3LFO A;  4YJ3 A;  3WXM B;  4ZOL B;  1RLU A;  3PAF A;  2OTL F;  3M1X A;  3VMF B;  3LME A;  3O85 A;  4X1I B;  2IAF A;  1FFX B;  2DT4 A;  4TV8 A;  2OZB A;  2DYY A;  1KNK A;  2VXY A;  1M90 H;  1JFF B;  5LXT A;  1ONI A;  1Z5V A;  3WGJ A;  4TUY B;  3HWU A;  3ON1 A;  3LYB A;  4ZOL A;  3J7A R;  2HX0 A;  4X1I A;  4ERH A;  1FFX A;  1X7O A;  4G4Z A;  3RYI B;  3EOR A;  4X3M A;  1W40 A;  1JFF A;  1SA0 B;  1TVK B;  3F0E A;  4TUY A;  4FFB B;  1VQ9 F;  4U39 A;  3S06 A;  5C8Y B;  1OAP A;  3RYI A;  1DT9 A;  2PHN A;  3VYU C;  1SA0 A;  3E1Y A;  1TVK A;  4C81 A;  1VH8 A;  4FFB A;  4ZI7 B;  1QAH A;  5JH7 B;  2OTM A;  2OTJ F;  1K73 H;  1U3L A;  5MN4 A;  5C8Y A;  1YIT F;  4DRX B;  3QHD A;  5G4U C;  3V7E A;  5ITZ B;  5IT9 M;  4BT7 A;  5HP8 A;  3VI6 A;  4G4Y A;  3GYQ A;  4BVR A;  3RYC B;  2BO1 A;  3WGM A;  2HP0 B;  2CWJ A;  4ZI7 A;  4TZZ A;  5JH7 A;  1VQK F;  3KHN A;  4WBN B;  2MQE A;  5AVM A;  4DRX A;  3IKF A;  4C8E A;  5ITZ A;  2H8E A;  3NMU C;  2RHJ A;  5GIN C;  3RYC A;  2Z1T A;  1FNJ A;  2UZH A;  4C4W C;  5HY4 A;  4TV9 B;  3HKD B;  3HJW C;  2HVY D;  2VGN A;  1RQ2 A;  2HP0 A;  1FNK A;  1QU9 A;  4RHA A;  3R0P A;  5A2Q M;  1VQ4 F;  2FGY A;  4X1K B;  1W55 A;  3ERN A;  3K0T A;  4WBN A;  5LP6 B;  1KC8 H;  3CCE F;  3FBA A;  4BY9 D;  4EI9 A;  1ZWZ A;  2P6Y A;  5JCO C;  1GO1 A;  3KJK A;  3HTN A;  4ZHY B;  4TV9 A;  3HKD A;  1W5B A;  3CCV F;  3ELC A;  3HKE B;  3RYF B;  4BVQ A;  3LWO C;  3CCS F;  4X1K A;  5LP6 A;  5GAN K;  3CPW F;  4C8G A;  3TD5 A;  2I6D A;  1YIJ F;  1IV3 A;  1GO0 A;  5GON B;  1VQV A;  2CW4 A;  2FC3 A;  2ZVY A;  2BTU A;  2CZW A;  2W8B C;  1M1K H;  3JVH A;  5FLX M;  3ESJ A;  2ZAU A;  3HKE A;  3RYF A;  3CC7 F;  1JY8 A;  3NVI B;  5EB1 B;  5B8F A;  2AMT A;  3HKC B;  1OFU A;  4XCQ A;  3CCJ F;  4G88 A;  3CB2 A;  5GAP K;  3VOB A;  2PMP A;  5GON A;  4LCK A;  3OBY A;  1S72 F;  3E22 B;  3ZO8 A;  5IJ9 B;  1YQN A;  3M4S A;  5KMG A;  2ZOV A;  3FFM A;  3RA6 A;  3ZOP A;  3HKC A;  1YGY A;  2NMU A;  4I4T B;  5GIO C;  3MDO A;  4ZK7 A;  4EI8 A;  2LBW A;  3N4Y A;  3E20 B;  2HS4 A;  3CYQ A;  3E22 A;  3CMA F;  1Q81 H;  5IJ9 A;  1YJ9 F;  3C9S A;  3MQW A;  2CHS A;  1SZQ A;  3VO8 A;  4BT3 A;  1X52 A;  2HS3 A;  3LWV C;  3D54 A;  1R1M A;  2Q1Y A;  2UYP A;  4I4T A;  3B6N A;  1JN1 A;  3GTZ A;  1K8A H;  5CA0 B;  3V4D A;  2RHL A;  3VCZ A;  4KWE A;  1J7H A;  4M8I A;  3JAK B;  2G9I A;  5EAZ A;  4NWO B;  3CCU F;  3ZP4 A;  4ZHW A;  5MN6 A;  3IKE A;  1QVG F;  2RHO A;  1PXW A;  4R40 B;  3N4Z A;  1Z5W A;  5CA0 A;  3LWP C;  2YYE A;  3I7T A;  1YJN F;  5LA6 B;  3JAK A;  1CN7 A;  2HS0 A;  1IPA A;  1VQN F;  1YHQ F;  1YI2 F;  3CCQ F;  3LDT A;  3IR9 A;  5FNV B;  2ZVZ A;  2RB9 A;  4O4I B;  3WJQ A;  3WGN A;  4LNU B;  5LA6 A;  4HNA B;  3PLA C;  2WAL A;  1W5A A;  2BTQ B;  1ODE A;  4O2A B;  4F6R B;  1W58 1;  2HRY A;  2ALE A;  3F6M A;  5FNV A;  4O4I A;  1VHA A;  4X3L A;  2UYK A;  3V7Q A;  2IQQ A;  1DBF A;  5J2U B;  5HWE A;  2ZF8 A;  4LNU A;  4HNA A;  4G4X A;  4NQ3 A;  3P10 A;  1PF5 A;  1U40 A;  2R75 1;  3RA5 A;  4O2A A;  4F6R A;  1T0A A;  3N2G B;  1GZ0 A;  3S0W A;  2RHH A;  2AIZ P;  3JAW B;  3JCM M;  1XHO A;  1IV1 A;  3JAS B;  3C8L A;  5J2U A;  4X1Y B;  3S0H A;  3CC2 F;  1KNJ A;  5BMV B;  3G6E F;  1N8R H;  4C8I A;  4G4V A;  5LOV B;  5HY0 A;  2GZL A;  2LBX A;  1W42 A;  3I56 F;  2VAP A;  2QA4 F;  1JD1 A;  2CHT A;  3U0O A;  3N2G A;  3JAW A;  4EB6 B;  3IEW A;  3M84 A;  3JAS A;  1Q82 H;  4X1Y A;  2AIF A;  5BMV A;  1VQL F;  5LOV A;  3CD6 F;  3VOA A;  2VAM A;  1W5F A;  4IIJ B;  5KMG B;  2QI2 A;  4NUT A;  3NK7 A;  3CCR F;  4BT2 A;  4EB6 A;  3F0F A;  5G4V C;  2OHW A;  5CB4 B;  5EYP B;  4O4H B;  3ZP7 A;  2L26 A;  1KD1 H;  5HXZ A;  5J2T B;  1NQ3 A;  2F9Z C;  1VQP F;  3TD3 A;  3D01 A;  1YJW F;  1VQ6 F;  1W59 A;  4C82 A;  4IIJ A;  4I50 B;  1TUB B;  3D00 A;  2HQS C;  4O4L B;  5IJ0 B;  2KGW A;  3K2X A;  3WGL A;  3LWR C;  1RLG A;  3P0Z A;  5CB4 A;  3TD4 A;  5EYP A;  3I55 F;  1IV2 A;  3K14 A;  4O4H A;  3WGK A;  1SDS A;  3CXC F;  5J2T A;  2CVL A;  1H7M A;  1XV2 A;  3CCM F;  1VK3 A;  3CME F;  3F0G A;  1KQS F;  4I50 A;  1TUB A;  3S02 A;  4O4L A;  3WJR A;  3G71 F;  5EZY B;  3J81 M;  5IJ0 A;  1IV4 A;  3N2K B;  2HP3 A;  5EIB D;  3Q8H A;  1Q8R A;  4G4W A;  3CYP B;  3NK6 A;  2KTV A;  3FD5 A;  4B46 A;  3LWQ C;  1NMU B;  3JAT B;  3QUW A;  1U3P A;  3WPW A;  2Z1F A;  3DDN A;  1GX1 A;  3CCL F;  5EZY A;  4DXD A;  3N2K A;  2JNB A;  4ZHQ B;  3RE3 A;  2K1S A;  3OON A;  2QEX F;  3J80 M;  1JJ2 F;  4RQO A;  3JAT A;  5JCO A;  3NVK E;  1UFY A;  2GLZ A;  1X25 A;  4PWT A;  4ZHV A;  5LP6 C;  4BW0 B;  4ZHQ A;  3MCA B;  3VYT C;  3CG6 A;  3WJP A;  3VTI C;  5HP7 A;  3L7Q A;  2BTO A;  4E6E A;  3KE1 A;  5GIP C;  2H6L A;  2KTU A;  2LCA A;  2N48 A;  1T0K B;  3C9U A;  4BT5 A;  3OW2 F;  2Z1U A;  5HY1 A;  3F0D A;  3RYH B;  5KX5 B;  2Q1X A;  3JAL B;  3FPI A;  5CA1 B;  2ZOD A;  1XRG A;  3S03 A;  3CC4 F;  3IEQ A;  3T80 A;  4O4J B;  1X7P A;  4YJ2 B;  1U43 A;  3VYS C;  1H48 A;  3RYH A;  5KX5 A;  3DC2 A;  3HKB B;  5HY2 A;  1CLI A;  3JAL A;  4IHJ B;  2HRU A;  2UYN B;  5CA1 A;  3HAX D;  3C9R A;  3GHZ A;  4BVT A;  5HXU A;  2IG8 A;  1E7K A;  2VGM A;  5DCV A;  5MN5 A;  4X20 B;  4O4J A;  4B5C A;  3S0Y A;  2H8C A;  2Z01 A;  2B33 A;  4YJ2 A;  3K12 A;  5EWR A;  3QTY A;  3IMP A;  1VQM F;  2KG4 A;  5JVD B;  3HKB A;  1W3E X;  3OBW A;  4IHJ A;  2LBT A;  1VQ5 F;  2UYN A;  2Z1E A;  3P4E A;  1W41 A;  4BT6 A;  3G4S F;  4BVS A;  3WPX A;  4X20 A;  4O2B B;  4B45 A;  1VQ7 F;  3MBM A;  1CK2 A;  5EB0 A;  1VQO F;  5JVD A;  4U3J B;  5EIB C;  3JAM M;  1RQ7 A;  1W2B F;  5JQG B;  1QVF F;  1K9M H;  4O2B A;  2GVI A;  3UT5 B;  1H47 A;  2EWC A;  2QTP A;  3C9T A;  3VIU A;  3I3F A;  4I55 B;  4U3J A;  1FSZ A;  3SIV A;  1UI9 A;  1COM A;  3JAR B;  5JQG A;  5IYZ B;  1W57 A;  3AGK A;  3FD6 A;  2UYJ A;  3BYQ A;  3UT5 A;  1RA4 A;  5LYJ B;  1XBI A;  3V3T A;  3CPQ A;  2R6R 1;  4YJ3 B;  2CSL A;  3KIZ A;  3KJJ A;  2I6R A;  4I55 A; 
#chains in the Genus database with same CATH homology
 3CCV F;  5HWE A;  4BVQ A;  1VQ8 F;  4BW0 B;  3LWO C;  3CCS F;  5GAN K;  3MCA B;  4NQ3 A;  3CPW F;  1Q86 H;  3CG6 A;  1NJI H;  2I6D A;  3RA5 A;  1YIJ F;  5FJ4 C;  1GO0 A;  5EO3 A;  1Q7Y H;  4EI7 A;  3SIU A;  2FC3 A;  3LFO A;  1GZ0 A;  2CZW A;  3JCM M;  3WXM B;  5GIP C;  1M1K H;  2KTU A;  3PAF A;  5FLX M;  2OTL F;  3VMF B;  1T0K B;  3O85 A;  3CC7 F;  3NVI B;  3OW2 F;  3CC2 F;  2OZB A;  3G6E F;  1N8R H;  5HY0 A;  1M90 H;  4XCQ A;  2LBX A;  1W42 A;  3I56 F;  5HY1 A;  3CCJ F;  2QA4 F;  5GAP K;  4LCK A;  3OBY A;  1S72 F;  3ON1 A;  3J7A R;  1Q82 H;  2AIF A;  3FFM A;  3RA6 A;  3CC4 F;  1X7O A;  1VQL F;  3CD6 F;  1X7P A;  4X3M A;  5GIO C;  1W40 A;  4EI8 A;  2LBW A;  3N4Y A;  3E20 B;  3CMA F;  1Q81 H;  2QI2 A;  5HY2 A;  4NUT A;  3NK7 A;  1YJ9 F;  3CCR F;  5G4V C;  1X52 A;  2OHW A;  1VQ9 F;  3HAX D;  4BVT A;  5HXU A;  3LWV C;  1E7K A;  2VGM A;  1KD1 H;  5DCV A;  5HXZ A;  2F9Z C;  1VQP F;  1DT9 A;  1YJW F;  1VQ6 F;  5EWR A;  3E1Y A;  1VQM F;  1K8A H;  2KG4 A;  3D00 A;  1W3E X;  3OBW A;  1VQ5 F;  3LWR C;  1RLG A;  2OTJ F;  1K73 H;  3I55 F;  1W41 A;  3G4S F;  4BVS A;  1YIT F;  3CCU F;  1SDS A;  3CXC F;  1QVG F;  1H7M A;  5G4U C;  1VQ7 F;  3V7E A;  5IT9 M;  3VI6 A;  1CK2 A;  3GYQ A;  4BVR A;  3CCM F;  3CME F;  1KQS F;  1PXW A;  2BO1 A;  3N4Z A;  1VQO F;  3G71 F;  3J81 M;  3LWP C;  3JAM M;  4TZZ A;  1YJN F;  1VQK F;  1W2B F;  1CN7 A;  3NK6 A;  1IPA A;  1VQN F;  1YHQ F;  1YI2 F;  2KTV A;  3CCQ F;  1K9M H;  1QVF F;  3LWQ C;  1NMU B;  3IR9 A;  3NMU C;  5GIN C;  4C4W C;  5HY4 A;  3HJW C;  3CCL F;  2HVY D;  2VGN A;  3SIV A;  2JNB A;  5A2Q M;  3PLA C;  1VQ4 F;  2FGY A;  2WAL A;  1KC8 H;  2QEX F;  3J80 M;  3AGK A;  3CCE F;  1JJ2 F;  2ALE A;  4BY9 D;  4EI9 A;  1RA4 A;  1ZWZ A;  1XBI A;  3V3T A;  1GO1 A;  3V7Q A;  3CPQ A;  4X3L A;  3NVK E;  2GLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...