1QVGF

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1qvgF00
3CCSF 3CXCF 3CPQA 1CK2A 3VMFB 3E20B 2KG4A 3OBWA 3LWRC 1VQ7F 2OZBA 5GANK 3PAFA 1KD1H 5GIOC 1X7PA 3PLAC 5EO3A 4BW0B 5GINC 3CMAF 2OTLF 3NK7A 1W41A 1VQNF 2HVYD 3J81M 1X7OA 1YI2F 3NVKE 5DCVA 1YJNF 1Q81H 1VQ8F 1N8RH 3E1YA 3G4SF 3G71F 1H7MA 2BO1A 2QEXF 1ZWZA 1YITF 3LWQC 3SIVA 1VQMF 3LFOA 3HAXD 1VQ4F 1IPAA 1YIJF 5IT9M 2KTUA 4LCKA 3O85A 1VQ5F 5FJ4C 1X52A 3VI6A 2QI2A 1VQOF 2CZWA 3IR9A 3CCEF 3NK6A 3J7AR 2AIFA 2FC3A 1QVFF 3NVIB 1VQ6F 1M1KH 1M90H 3CCUF 1E7KA 2JNBA 1K9MH 1W42A 5FLXM 3OBYA 3I56F 2VGMA 4X3MA 3CC7F 3CD6F 1W40A 2LBXA 3FFMA 4C4WC 1GO1A 3NMUC 3N4YA 1NMUB 3N4ZA 4TZZA 3CMEF 3CCJF 3SIUA 3RA5A 1Q7YH 1GZ0A 5A2QM 1Q82H 1W2BF 3AGKA 1RLGA 3ON1A 1NJIH 2WALA 3G6EF 1QVGF 3LWVC 5GIPC 1S72F 3JAMM 3V7EA 3CG6A 2QA4F 3CC2F 1K73H 2ALEA 1KQSF 3GYQA 3J80M 4NUTA 3CPWF 3CCMF 3CCLF 3I55F 3LWOC 1SDSA 1GO0A 1DT9A 2OHWA 1T0KB 3HJWC 2VGNA 3MCAB 3CC4F 4BY9D 1VQLF 1Q86H 5G4UC 1XBIA 1W3EX 2LBWA 5G4VC 3OW2F 1JJ2F 3CCRF 2I6DA 1YJWF 1KC8H 5EWRA 1PXWA 1YHQF 2OTJF 2KTVA 3V7QA 3WXMB 5GAPK 1CN7A 1VQPF 4X3LA 1VQKF 3JCMM 3RA6A 1YJ9F 1VQ9F 3CCVF 3LWPC 3CCQF 1K8AH 1RA4A
chains in the Genus database with same CATH superfamily
2H8EA 3N2KA 4X1KA 5KX5B 4O4IB 4I4TA 4RHAA 3IEWA 3I7TA 5LOVA 5FNVA 3LWRC 4WBNB 3WGNA 3LDTA 5J2TA 1KD1H 5JCOC 3VYTC 5GIOC 5EIBC 4BW0B 3E22B 1H47A 5LP6A 1U3LA 3NK7A 1W41A 3IKEA 3F0DA 1W581 3J81M 1VQNF 3NVKE 4O4HB 5LOVB 2HQSC 1W55A 3KJKA 1YITF 5IJ9B 2HX0A 2RHJA 3Q8HA 1VQMF 3HKBA 4O4LB 1W59A 2NMUA 4I55B 4NWOB 4TV9B 3N2KB 4IIJB 4O4JB 1VQ4F 5CA1A 2GVIA 4BT3A 4LCKA 3O85A 1H48A 2Z01A 2QI2A 2EWCA 2ZAUA 3WGLA 2AIFA 4IHJB 1VQ6F 1M1KH 1M90H 4O4LA 3CCUF 3IKFA 1W42A 3WJQA 1W5EA 5IYZB 5KMGA 5ITZB 3VO8A 4X3MA 3CC7F 3RE3A 4ZHVA 4X1IB 2BTOA 3IMPA 4G4VA 5LA6B 4C4WC 4TZZA 5LP6C 3CMEF 3CCJF 3I3FA 3SIUA 3RA5A 3V4DA 4O2AA 2UYKA 5EYPB 1VK3A 3HKDA 2CHSA 3AGKA 3UT5B 2WALA 4I4TB 1S72F 1JN1A 4X1KB 3C8LA 3T80A 3JAMM 2CHTA 3GYQA 3J80M 3CPWF 3CCMF 5C8YA 1GO0A 1TVKB 1KNKA 2HP0B 3TD3A 5KMGB 3C9SA 3S02A 1T0KB 3GHZA 3V3TA 3ZO8A 4TV8B 4ZHQA 5IJ9A 2HS3A 2VXYA 1UI9A 1XRGA 2LBWA 4BT2A 2ZVZA 4IHJA 3HTNA 4B5CA 1UFYA 3OW2F 5JH7A 3VYUC 3OONA 3HWUA 1PXWA 3JALA 5LXTA 2Q1XA 4C81A 2RHLA 3WXMB 1J7HA 4TV9A 5LYJA 2UYJA 3CCQF 4BT7A 5HY2A 1RA4A 5HY1A 3CYPB 3ESJA 4KWEA 3MCQA 4EI7A 3UT5A 3D54A 2KG4A 1X25A 2GZLA 1SZQA 3PAFA 4X1IA 1W57A 3VYSC 4ZI7B 3PLAC 5GINC 3VIUA 3C9RA 1SA0B 2HVYD 4EI9A 1YJNF 3TD5A 1Q81H 1QU9A 1VQ8F 3ZOPA 3G4SF 3HKDB 3QHDA 1ZWZA 2IQQA 4I50B 3GTZA 3LFOA 4G4YA 1OFUA 4TUYB 3K14A 4HNAB 1VH8A 3HAXD 2Z1FA 2H8CA 4G88A 3ZP7A 4U3JA 1VQ5F 5FJ4C 1X52A 5BMVA 5J2UA 3IR9A 3K2XA 1FFXB 2YXZA 3NK6A 5IJ0A 2UYPA 3K0TA 4YJ2B 3CB2A 2KGWA 2RHHA 1K9MH 5EZYA 3HKCA 4E6EA 3DDNA 3CD6F 3L7QA 1KNJA 4F6RA 2ZOVA 5LP6B 2LBXA 1Z5WA 3WGJA 1GO1A 3NMUC 3N4YA 1NMUB 3RYIB 4C82A 3D01A 4O4IA 2F9ZC 5LYJB 5GONB 1Q7YH 1GZ0A 1Q82H 1W2BF 4R40B 3KJJA 1JY8A 2YYEA 3M4SA 5FNVB 1NJIH 1QVGF 3LWVC 2R6R1 3V7EA 1IV4A 3S0HA 2QA4F 3JAKA 1T0AA 4X1YA 3K12A 1K73H 1KQSF 5HP7A 1DBFA 3CCLF 3I55F 3LWOC 3RYHA 3WJPA 2CW4A 2Q1YA 4B45A 2VGNA 3F0GA 4BY9D 4G4ZA 5MN4A 1RQ7A 2BTUA 5CA0A 1PF5A 4I55A 5G4VC 3M1XA 3F0EA 4O4JA 3RYCA 3CCRF 1YJWF 4ZOLA 5HY0A 3ELCA 2LCAA 5EB0A 5EYPA 3V7QA 4BT4A 1U43A 4O2AB 5GAPK 3RYFA 1YJ9F 4ZHWA 3LWPC 2HRUA 4O2BA 1K8AH 5HXZA 3RYIA 4BVSA 2IG8A 1CK2A 2G9IA 3S06A 3E20B 4NQ3A 3VCZA 3QUWA 3HKCB 1TVKA 3VTIC 5GANK 5C8YB 4O2BB 4C8GA 1X7PA 4FFBA 3EORA 5EO3A 1ONIA 3KE1A 2VAWA 1YI2F 1U40A 5DCVA 3RYCB 5EIBD 2HS4A 3JATA 3E1YA 1H7MA 2BO1A 2QEXF 1U3PA 3SIVA 5JH7B 3ERNA 5CA0B 1W5BA 4EB6B 3MQWA 1R1MA 5IT9M 4DXDA 2AMTA 1NQ3A 3M84A 3F0FA 3VI6A 1VQOF 3CCEF 1GX1A 3J7AR 1QVFF 3RYHB 3NVIB 5JVDB 1E7KA 2HP0A 3OBYA 3I56F 5EAZA 1FSZA 2VGMA 3WPXA 3S0WA 4BT5A 2K1SA 5AVMA 1SA0A 4BVTA 1IV2A 3D00A 3FBAA 3N4ZA 4X20A 4YJ3B 5HP8A 3VOAA 3LYBA 5A2QM 2I6RA 2P6YA 3HKEA 1QD9A 3ON1A 2DYYA 4ZI7A 3IEQA 3S0YA 2B33A 3S03A 3JARA 5BMVB 4NUTA 3RYFB 1DT9A 5MN6A 1FFXA 5CB4A 5JQGB 2OHWA 3HJWC 3N2GB 3KIZA 2CWJA 4BVRA 3MCAB 5KX5A 1VHAA 2AIZP 1Q86H 2R751 5EZYB 5G4UC 1TUBA 1FNJA 3JAWB 2QTPA 2V9YA 3KHNA 3U0OA 1KC8H 5EWRA 5J2UB 5B8FA 2KTVA 3LMEA 4EB6A 4ERHA 1CN7A 1VQPF 1VQKF 1JFFA 1IV3A 3JCMM 1TUBB 3BYQA 3RA6A 4LNUA 3P0ZA 3CCVF 4G4WA 3JATB 1OAPA 3CCSF 3CYQA 5EB1B 4X1YB 4YJ3A 3CXCF 3CPQA 4ZK7A 5HWEA 3HKEB 3VMFB 1XV2A 4C8EA 3C9UA 2CVLA 1IV1A 3OBWA 2UZHA 2OZBA 3QTYA 1VQ7F 3B6NA 3WGKA 2DT4A 5JCOA 5GONA 3WPWA 4X20B 3FPIA 4ZHYB 3CMAF 2OTLF 5LA6A 4F6RB 1X7OA 1Z5VA 3R0PA 5HXUA 1ODEA 4DRXB 4BVQA 1N8RH 1CLIA 1YGYA 2Z1EA 5IYZA 3G71F 4M8IA 5LXTB 3LWQC 4TV8A 5IJ0B 3P10A 2OTMA 4YJ2A 2Z1UA 4PWTA 1IPAA 4DRXA 1RLUA 2Z1TA 2IAFA 3JAWA 1YIJF 2KTUA 3JALB 3JAKB 2ZVYA 2CZWA 3WJRA 4I50A 5CB4B 4U39A 5JQGA 2FC3A 2VAPA 4TUYA 2ZF8A 3N2GA 2JNBA 2VAMA 5FLXM 1FNKA 2LBTA 1YQNA 4FFBB 1RQ2A 1W40A 4ZHQB 3HKBB 3JARB 3FFMA 4BT6A 3FD6A 2UYNA 3WGMA 3E22A 1W5FA 1QAHA 2MQEA 3JASA 4LNUB 1RLGA 1JFFB 2HRYA 4WBNA 3G6EF 5GIPC 2UYNB 3DC2A 1VQVA 3CG6A 3JASB 5MN5A 1Q8RA 3CC2F 4B46A 2ALEA 4EI8A 2RHOA 2L26A 5CA1B 3MBMA 4IIJA 4RQOA 1SDSA 2RB9A 2FGYA 2HP3A 4HNAA 5HY4A 3P4EA 4ZOLB 5JVDA 2BTQB 3ZP4A 2GLZA 3JVHA 4XCQA 3CC4F 2HS0A 2W8BC 3TD4A 1VQLF 1JD1A 2PMPA 2H6LA 5ITZA 2CSLA 1XHOA 1XBIA 1W3EX 2N48A 1JJ2F 4O4HA 2I6DA 4C8IA 2PHNA 3F6MA 1W5AA 1YHQF 2OTJF 3FD5A 2ZODA 4G4XA 4X3LA 3MDOA 1VQ9F 4U3JB 1COMA 5J2TB 3C9TA 4B62A 3VOBA
chains in the Genus database with same CATH topology
3CCSF 5HY1A 4BVSA 3CXCF 4EI7A 3CPQA 1CK2A 5HWEA 3VMFB 3E20B 4NQ3A 2KG4A 3OBWA 3LWRC 1VQ7F 2OZBA 5GANK 3PAFA 1KD1H 1X7PA 5GIOC 3PLAC 5EO3A 4BW0B 5GINC 3CMAF 2OTLF 3NK7A 1W41A 1VQNF 2HVYD 3J81M 1X7OA 1YI2F 3NVKE 4EI9A 5DCVA 1YJNF 5HXUA 1Q81H 1VQ8F 4BVQA 1N8RH 3E1YA 3G4SF 3G71F 1H7MA 2BO1A 2QEXF 1ZWZA 1YITF 3LWQC 3SIVA 1VQMF 3LFOA 3HAXD 1VQ4F 1IPAA 1YIJF 5IT9M 2KTUA 4LCKA 3O85A 1VQ5F 5FJ4C 1X52A 3VI6A 2QI2A 1VQOF 2CZWA 3IR9A 3CCEF 3NK6A 3J7AR 2AIFA 2FC3A 1QVFF 3NVIB 1VQ6F 1M1KH 1M90H 3CCUF 1E7KA 2JNBA 1K9MH 1W42A 5FLXM 3OBYA 3I56F 2VGMA 4X3MA 3CC7F 3CD6F 1W40A 2LBXA 3FFMA 4C4WC 1GO1A 4BVTA 3NMUC 3D00A 1NMUB 3N4YA 3N4ZA 4TZZA 3CMEF 3CCJF 3SIUA 2F9ZC 3RA5A 1Q7YH 1GZ0A 5A2QM 1Q82H 1W2BF 3AGKA 1RLGA 3ON1A 1NJIH 2WALA 3G6EF 1QVGF 3LWVC 5GIPC 1S72F 3JAMM 3V7EA 3CG6A 2QA4F 3CC2F 1K73H 2ALEA 4EI8A 1KQSF 3GYQA 3J80M 4NUTA 3CPWF 3CCMF 3CCLF 3I55F 3LWOC 1SDSA 1GO0A 1DT9A 2FGYA 2OHWA 1T0KB 5HY4A 3HJWC 2VGNA 2GLZA 4XCQA 3MCAB 4BVRA 3CC4F 3V3TA 4BY9D 1VQLF 1Q86H 5G4UC 1XBIA 1W3EX 2LBWA 5G4VC 1K8AH 3OW2F 1JJ2F 3CCRF 2I6DA 1YJWF 1KC8H 5EWRA 5HY0A 1PXWA 1YHQF 2OTJF 2KTVA 3V7QA 3WXMB 5GAPK 1CN7A 1VQPF 4X3LA 1VQKF 3JCMM 3RA6A 1YJ9F 1VQ9F 3CCVF 3LWPC 3CCQF 5HY2A 5HXZA 1RA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS F;  3CXC F;  3CPQ A;  1CK2 A;  3VMF B;  3E20 B;  2KG4 A;  3OBW A;  3LWR C;  1VQ7 F;  2OZB A;  5GAN K;  3PAF A;  1KD1 H;  5GIO C;  1X7P A;  3PLA C;  5EO3 A;  4BW0 B;  5GIN C;  3CMA F;  2OTL F;  3NK7 A;  1W41 A;  1VQN F;  2HVY D;  3J81 M;  1X7O A;  1YI2 F;  3NVK E;  5DCV A;  1YJN F;  1Q81 H;  1VQ8 F;  1N8R H;  3E1Y A;  3G4S F;  3G71 F;  1H7M A;  2BO1 A;  2QEX F;  1ZWZ A;  1YIT F;  3LWQ C;  3SIV A;  1VQM F;  3LFO A;  3HAX D;  1VQ4 F;  1IPA A;  1YIJ F;  5IT9 M;  2KTU A;  4LCK A;  3O85 A;  1VQ5 F;  5FJ4 C;  1X52 A;  3VI6 A;  2QI2 A;  1VQO F;  2CZW A;  3IR9 A;  3CCE F;  3NK6 A;  3J7A R;  2AIF A;  2FC3 A;  1QVF F;  3NVI B;  1VQ6 F;  1M1K H;  1M90 H;  3CCU F;  1E7K A;  2JNB A;  1K9M H;  1W42 A;  5FLX M;  3OBY A;  3I56 F;  2VGM A;  4X3M A;  3CC7 F;  3CD6 F;  1W40 A;  2LBX A;  3FFM A;  4C4W C;  1GO1 A;  3NMU C;  3N4Y A;  1NMU B;  3N4Z A;  4TZZ A;  3CME F;  3CCJ F;  3SIU A;  3RA5 A;  1Q7Y H;  1GZ0 A;  5A2Q M;  1Q82 H;  1W2B F;  3AGK A;  1RLG A;  3ON1 A;  1NJI H;  2WAL A;  3G6E F;  1QVG F;  3LWV C;  5GIP C;  1S72 F;  3JAM M;  3V7E A;  3CG6 A;  2QA4 F;  3CC2 F;  1K73 H;  2ALE A;  1KQS F;  3GYQ A;  3J80 M;  4NUT A;  3CPW F;  3CCM F;  3CCL F;  3I55 F;  3LWO C;  1SDS A;  1GO0 A;  1DT9 A;  2OHW A;  1T0K B;  3HJW C;  2VGN A;  3MCA B;  3CC4 F;  4BY9 D;  1VQL F;  1Q86 H;  5G4U C;  1XBI A;  1W3E X;  2LBW A;  5G4V C;  3OW2 F;  1JJ2 F;  3CCR F;  2I6D A;  1YJW F;  1KC8 H;  5EWR A;  1PXW A;  1YHQ F;  2OTJ F;  2KTV A;  3V7Q A;  3WXM B;  5GAP K;  1CN7 A;  1VQP F;  4X3L A;  1VQK F;  3JCM M;  3RA6 A;  1YJ9 F;  1VQ9 F;  3CCV F;  3LWP C;  3CCQ F;  1K8A H;  1RA4 A; 
#chains in the Genus database with same CATH topology
 2H8E A;  3N2K A;  4X1K A;  5KX5 B;  4O4I B;  4I4T A;  4RHA A;  3IEW A;  3I7T A;  5LOV A;  5FNV A;  3LWR C;  4WBN B;  3WGN A;  3LDT A;  5J2T A;  1KD1 H;  5JCO C;  3VYT C;  5GIO C;  5EIB C;  4BW0 B;  3E22 B;  1H47 A;  5LP6 A;  1U3L A;  3NK7 A;  1W41 A;  3IKE A;  3F0D A;  1W58 1;  3J81 M;  1VQN F;  3NVK E;  4O4H B;  5LOV B;  2HQS C;  1W55 A;  3KJK A;  1YIT F;  5IJ9 B;  2HX0 A;  2RHJ A;  3Q8H A;  1VQM F;  3HKB A;  4O4L B;  1W59 A;  2NMU A;  4I55 B;  4NWO B;  4TV9 B;  3N2K B;  4IIJ B;  4O4J B;  1VQ4 F;  5CA1 A;  2GVI A;  4BT3 A;  4LCK A;  3O85 A;  1H48 A;  2Z01 A;  2QI2 A;  2EWC A;  2ZAU A;  3WGL A;  2AIF A;  4IHJ B;  1VQ6 F;  1M1K H;  1M90 H;  4O4L A;  3CCU F;  3IKF A;  1W42 A;  3WJQ A;  1W5E A;  5IYZ B;  5KMG A;  5ITZ B;  3VO8 A;  4X3M A;  3CC7 F;  3RE3 A;  4ZHV A;  4X1I B;  2BTO A;  3IMP A;  4G4V A;  5LA6 B;  4C4W C;  4TZZ A;  5LP6 C;  3CME F;  3CCJ F;  3I3F A;  3SIU A;  3RA5 A;  3V4D A;  4O2A A;  2UYK A;  5EYP B;  1VK3 A;  3HKD A;  2CHS A;  3AGK A;  3UT5 B;  2WAL A;  4I4T B;  1S72 F;  1JN1 A;  4X1K B;  3C8L A;  3T80 A;  3JAM M;  2CHT A;  3GYQ A;  3J80 M;  3CPW F;  3CCM F;  5C8Y A;  1GO0 A;  1TVK B;  1KNK A;  2HP0 B;  3TD3 A;  5KMG B;  3C9S A;  3S02 A;  1T0K B;  3GHZ A;  3V3T A;  3ZO8 A;  4TV8 B;  4ZHQ A;  5IJ9 A;  2HS3 A;  2VXY A;  1UI9 A;  1XRG A;  2LBW A;  4BT2 A;  2ZVZ A;  4IHJ A;  3HTN A;  4B5C A;  1UFY A;  3OW2 F;  5JH7 A;  3VYU C;  3OON A;  3HWU A;  1PXW A;  3JAL A;  5LXT A;  2Q1X A;  4C81 A;  2RHL A;  3WXM B;  1J7H A;  4TV9 A;  5LYJ A;  2UYJ A;  3CCQ F;  4BT7 A;  5HY2 A;  1RA4 A;  5HY1 A;  3CYP B;  3ESJ A;  4KWE A;  3MCQ A;  4EI7 A;  3UT5 A;  3D54 A;  2KG4 A;  1X25 A;  2GZL A;  1SZQ A;  3PAF A;  4X1I A;  1W57 A;  3VYS C;  4ZI7 B;  3PLA C;  5GIN C;  3VIU A;  3C9R A;  1SA0 B;  2HVY D;  4EI9 A;  1YJN F;  3TD5 A;  1Q81 H;  1QU9 A;  1VQ8 F;  3ZOP A;  3G4S F;  3HKD B;  3QHD A;  1ZWZ A;  2IQQ A;  4I50 B;  3GTZ A;  3LFO A;  4G4Y A;  1OFU A;  4TUY B;  3K14 A;  4HNA B;  1VH8 A;  3HAX D;  2Z1F A;  2H8C A;  4G88 A;  3ZP7 A;  4U3J A;  1VQ5 F;  5FJ4 C;  1X52 A;  5BMV A;  5J2U A;  3IR9 A;  3K2X A;  1FFX B;  2YXZ A;  3NK6 A;  5IJ0 A;  2UYP A;  3K0T A;  4YJ2 B;  3CB2 A;  2KGW A;  2RHH A;  1K9M H;  5EZY A;  3HKC A;  4E6E A;  3DDN A;  3CD6 F;  3L7Q A;  1KNJ A;  4F6R A;  2ZOV A;  5LP6 B;  2LBX A;  1Z5W A;  3WGJ A;  1GO1 A;  3NMU C;  3N4Y A;  1NMU B;  3RYI B;  4C82 A;  3D01 A;  4O4I A;  2F9Z C;  5LYJ B;  5GON B;  1Q7Y H;  1GZ0 A;  1Q82 H;  1W2B F;  4R40 B;  3KJJ A;  1JY8 A;  2YYE A;  3M4S A;  5FNV B;  1NJI H;  1QVG F;  3LWV C;  2R6R 1;  3V7E A;  1IV4 A;  3S0H A;  2QA4 F;  3JAK A;  1T0A A;  4X1Y A;  3K12 A;  1K73 H;  1KQS F;  5HP7 A;  1DBF A;  3CCL F;  3I55 F;  3LWO C;  3RYH A;  3WJP A;  2CW4 A;  2Q1Y A;  4B45 A;  2VGN A;  3F0G A;  4BY9 D;  4G4Z A;  5MN4 A;  1RQ7 A;  2BTU A;  5CA0 A;  1PF5 A;  4I55 A;  5G4V C;  3M1X A;  3F0E A;  4O4J A;  3RYC A;  3CCR F;  1YJW F;  4ZOL A;  5HY0 A;  3ELC A;  2LCA A;  5EB0 A;  5EYP A;  3V7Q A;  4BT4 A;  1U43 A;  4O2A B;  5GAP K;  3RYF A;  1YJ9 F;  4ZHW A;  3LWP C;  2HRU A;  4O2B A;  1K8A H;  5HXZ A;  3RYI A;  4BVS A;  2IG8 A;  1CK2 A;  2G9I A;  3S06 A;  3E20 B;  4NQ3 A;  3VCZ A;  3QUW A;  3HKC B;  1TVK A;  3VTI C;  5GAN K;  5C8Y B;  4O2B B;  4C8G A;  1X7P A;  4FFB A;  3EOR A;  5EO3 A;  1ONI A;  3KE1 A;  2VAW A;  1YI2 F;  1U40 A;  5DCV A;  3RYC B;  5EIB D;  2HS4 A;  3JAT A;  3E1Y A;  1H7M A;  2BO1 A;  2QEX F;  1U3P A;  3SIV A;  5JH7 B;  3ERN A;  5CA0 B;  1W5B A;  4EB6 B;  3MQW A;  1R1M A;  5IT9 M;  4DXD A;  2AMT A;  1NQ3 A;  3M84 A;  3F0F A;  3VI6 A;  1VQO F;  3CCE F;  1GX1 A;  3J7A R;  1QVF F;  3RYH B;  3NVI B;  5JVD B;  1E7K A;  2HP0 A;  3OBY A;  3I56 F;  5EAZ A;  1FSZ A;  2VGM A;  3WPX A;  3S0W A;  4BT5 A;  2K1S A;  5AVM A;  1SA0 A;  4BVT A;  1IV2 A;  3D00 A;  3FBA A;  3N4Z A;  4X20 A;  4YJ3 B;  5HP8 A;  3VOA A;  3LYB A;  5A2Q M;  2I6R A;  2P6Y A;  3HKE A;  1QD9 A;  3ON1 A;  2DYY A;  4ZI7 A;  3IEQ A;  3S0Y A;  2B33 A;  3S03 A;  3JAR A;  5BMV B;  4NUT A;  3RYF B;  1DT9 A;  5MN6 A;  1FFX A;  5CB4 A;  5JQG B;  2OHW A;  3HJW C;  3N2G B;  3KIZ A;  2CWJ A;  4BVR A;  3MCA B;  5KX5 A;  1VHA A;  2AIZ P;  1Q86 H;  2R75 1;  5EZY B;  5G4U C;  1TUB A;  1FNJ A;  3JAW B;  2QTP A;  2V9Y A;  3KHN A;  3U0O A;  1KC8 H;  5EWR A;  5J2U B;  5B8F A;  2KTV A;  3LME A;  4EB6 A;  4ERH A;  1CN7 A;  1VQP F;  1VQK F;  1JFF A;  1IV3 A;  3JCM M;  1TUB B;  3BYQ A;  3RA6 A;  4LNU A;  3P0Z A;  3CCV F;  4G4W A;  3JAT B;  1OAP A;  3CCS F;  3CYQ A;  5EB1 B;  4X1Y B;  4YJ3 A;  3CXC F;  3CPQ A;  4ZK7 A;  5HWE A;  3HKE B;  3VMF B;  1XV2 A;  4C8E A;  3C9U A;  2CVL A;  1IV1 A;  3OBW A;  2UZH A;  2OZB A;  3QTY A;  1VQ7 F;  3B6N A;  3WGK A;  2DT4 A;  5JCO A;  5GON A;  3WPW A;  4X20 B;  3FPI A;  4ZHY B;  3CMA F;  2OTL F;  5LA6 A;  4F6R B;  1X7O A;  1Z5V A;  3R0P A;  5HXU A;  1ODE A;  4DRX B;  4BVQ A;  1N8R H;  1CLI A;  1YGY A;  2Z1E A;  5IYZ A;  3G71 F;  4M8I A;  5LXT B;  3LWQ C;  4TV8 A;  5IJ0 B;  3P10 A;  2OTM A;  4YJ2 A;  2Z1U A;  4PWT A;  1IPA A;  4DRX A;  1RLU A;  2Z1T A;  2IAF A;  3JAW A;  1YIJ F;  2KTU A;  3JAL B;  3JAK B;  2ZVY A;  2CZW A;  3WJR A;  4I50 A;  5CB4 B;  4U39 A;  5JQG A;  2FC3 A;  2VAP A;  4TUY A;  2ZF8 A;  3N2G A;  2JNB A;  2VAM A;  5FLX M;  1FNK A;  2LBT A;  1YQN A;  4FFB B;  1RQ2 A;  1W40 A;  4ZHQ B;  3HKB B;  3JAR B;  3FFM A;  4BT6 A;  3FD6 A;  2UYN A;  3WGM A;  3E22 A;  1W5F A;  1QAH A;  2MQE A;  3JAS A;  4LNU B;  1RLG A;  1JFF B;  2HRY A;  4WBN A;  3G6E F;  5GIP C;  2UYN B;  3DC2 A;  1VQV A;  3CG6 A;  3JAS B;  5MN5 A;  1Q8R A;  3CC2 F;  4B46 A;  2ALE A;  4EI8 A;  2RHO A;  2L26 A;  5CA1 B;  3MBM A;  4IIJ A;  4RQO A;  1SDS A;  2RB9 A;  2FGY A;  2HP3 A;  4HNA A;  5HY4 A;  3P4E A;  4ZOL B;  5JVD A;  2BTQ B;  3ZP4 A;  2GLZ A;  3JVH A;  4XCQ A;  3CC4 F;  2HS0 A;  2W8B C;  3TD4 A;  1VQL F;  1JD1 A;  2PMP A;  2H6L A;  5ITZ A;  2CSL A;  1XHO A;  1XBI A;  1W3E X;  2N48 A;  1JJ2 F;  4O4H A;  2I6D A;  4C8I A;  2PHN A;  3F6M A;  1W5A A;  1YHQ F;  2OTJ F;  3FD5 A;  2ZOD A;  4G4X A;  4X3L A;  3MDO A;  1VQ9 F;  4U3J B;  1COM A;  5J2T B;  3C9T A;  4B62 A;  3VOB A; 
#chains in the Genus database with same CATH homology
 3CCS F;  5HY1 A;  4BVS A;  3CXC F;  4EI7 A;  3CPQ A;  1CK2 A;  5HWE A;  3VMF B;  3E20 B;  4NQ3 A;  2KG4 A;  3OBW A;  3LWR C;  1VQ7 F;  2OZB A;  5GAN K;  3PAF A;  1KD1 H;  1X7P A;  5GIO C;  3PLA C;  5EO3 A;  4BW0 B;  5GIN C;  3CMA F;  2OTL F;  3NK7 A;  1W41 A;  1VQN F;  2HVY D;  3J81 M;  1X7O A;  1YI2 F;  3NVK E;  4EI9 A;  5DCV A;  1YJN F;  5HXU A;  1Q81 H;  1VQ8 F;  4BVQ A;  1N8R H;  3E1Y A;  3G4S F;  3G71 F;  1H7M A;  2BO1 A;  2QEX F;  1ZWZ A;  1YIT F;  3LWQ C;  3SIV A;  1VQM F;  3LFO A;  3HAX D;  1VQ4 F;  1IPA A;  1YIJ F;  5IT9 M;  2KTU A;  4LCK A;  3O85 A;  1VQ5 F;  5FJ4 C;  1X52 A;  3VI6 A;  2QI2 A;  1VQO F;  2CZW A;  3IR9 A;  3CCE F;  3NK6 A;  3J7A R;  2AIF A;  2FC3 A;  1QVF F;  3NVI B;  1VQ6 F;  1M1K H;  1M90 H;  3CCU F;  1E7K A;  2JNB A;  1K9M H;  1W42 A;  5FLX M;  3OBY A;  3I56 F;  2VGM A;  4X3M A;  3CC7 F;  3CD6 F;  1W40 A;  2LBX A;  3FFM A;  4C4W C;  1GO1 A;  4BVT A;  3NMU C;  3D00 A;  1NMU B;  3N4Y A;  3N4Z A;  4TZZ A;  3CME F;  3CCJ F;  3SIU A;  2F9Z C;  3RA5 A;  1Q7Y H;  1GZ0 A;  5A2Q M;  1Q82 H;  1W2B F;  3AGK A;  1RLG A;  3ON1 A;  1NJI H;  2WAL A;  3G6E F;  1QVG F;  3LWV C;  5GIP C;  1S72 F;  3JAM M;  3V7E A;  3CG6 A;  2QA4 F;  3CC2 F;  1K73 H;  2ALE A;  4EI8 A;  1KQS F;  3GYQ A;  3J80 M;  4NUT A;  3CPW F;  3CCM F;  3CCL F;  3I55 F;  3LWO C;  1SDS A;  1GO0 A;  1DT9 A;  2FGY A;  2OHW A;  1T0K B;  5HY4 A;  3HJW C;  2VGN A;  2GLZ A;  4XCQ A;  3MCA B;  4BVR A;  3CC4 F;  3V3T A;  4BY9 D;  1VQL F;  1Q86 H;  5G4U C;  1XBI A;  1W3E X;  2LBW A;  5G4V C;  1K8A H;  3OW2 F;  1JJ2 F;  3CCR F;  2I6D A;  1YJW F;  1KC8 H;  5EWR A;  5HY0 A;  1PXW A;  1YHQ F;  2OTJ F;  2KTV A;  3V7Q A;  3WXM B;  5GAP K;  1CN7 A;  1VQP F;  4X3L A;  1VQK F;  3JCM M;  3RA6 A;  1YJ9 F;  1VQ9 F;  3CCV F;  3LWP C;  3CCQ F;  5HY2 A;  5HXZ A;  1RA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...