1QVGF

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1qvgF00
3OW2F 1Q82H 1GO0A 1K8AH 5IT9M 2OHWA 1W41A 3CMEF 1M90H 1VQLF 1DT9A 1CN7A 3G71F 1VQ8F 4C4WC 1YITF 3CCMF 3V7EA 1XBIA 1GZ0A 3V7QA 3NVKE 1VQ5F 5FLXM 2BO1A 3NK7A 1YJNF 3IR9A 1RLGA 5GINC 3O85A 4NUTA 1JJ2F 2VGNA 3CPWF 1YI2F 1K9MH 5GAPK 1NMUB 5DCVA 3CC4F 3JCMM 3E20B 3GYQA 3J81M 5G4UC 3VI6A 3E1YA 1YJWF 2KG4A 2OZBA 3NVIB 1KD1H 2VGMA 2QA4F 1QVGF 1M1KH 3PAFA 1ZWZA 2CZWA 3OBWA 1SDSA 1VQKF 2OTLF 3LFOA 2ALEA 3MCAB 3SIVA 1W3EX 1W42A 1RA4A 3ON1A 1YHQF 3J7AR 2I6DA 3AGKA 4X3MA 3HAXD 3CPQA 3CCJF 5GANK 1VQ9F 1E7KA 3CCLF 1PXWA 5GIPC 3CXCF 2KTVA 3CCQF 2LBWA 3N4YA 2LBXA 2FC3A 1X7PA 5EO3A 2KTUA 3LWQC 2AIFA 1GO1A 3CCVF 3LWPC 3I55F 2JNBA 1Q86H 2OTJF 5FJ4C 1VQ6F 1VQNF 1X52A 2QI2A 5GIOC 1IPAA 4BW0B 1CK2A 3LWVC 2HVYD 2QEXF 3SIUA 3OBYA 3CC7F 5A2QM 5G4VC 1KC8H 1VQOF 1VQ7F 3CMAF 1NJIH 3CD6F 1S72F 3CG6A 4TZZA 3NK6A 3CCEF 1KQSF 3G4SF 1VQMF 1VQ4F 1Q81H 1VQPF 1QVFF 3N4ZA 3J80M 2WALA 3CC2F 3VMFB 3FFMA 1Q7YH 1K73H 4LCKA 3LWOC 1W2BF 4X3LA 1YIJF 1H7MA 3PLAC 3CCUF 3RA5A 1X7OA 4BY9D 3HJWC 3I56F 3CCSF 3WXMB 3CCRF 3LWRC 1N8RH 5EWRA 3G6EF 1YJ9F 3RA6A 1W40A 3NMUC 3JAMM 1T0KB
chains in the Genus database with same CATH superfamily
5KX5A 2GZLA 3ZO8A 3L7QA 3V3TA 2OHWA 3JAKB 4O4HB 1VQ8F 1YITF 2HS0A 3RYHB 4TUYB 1RQ7A 1VQ5F 2BO1A 2KGWA 5GINC 5EAZA 4NUTA 2F9ZC 3JAKA 4O4HA 3M4SA 3C9TA 3JCMM 5G4UC 4TV8A 1VQVA 1YJWF 2OZBA 2FGYA 3NVIB 2QA4F 4RQOA 1QVGF 1M1KH 3WJRA 1ZWZA 3OBWA 2DT4A 1W55A 3B6NA 1XV2A 4C81A 2ALEA 2CVLA 3S0HA 4ZHYB 4ZK7A 2B33A 2Z1EA 1KNKA 4BT6A 2CW4A 5HY2A 1W5EA 1TUBB 3JAWB 5LXTB 4X3MA 4B62A 3ZP7A 5GONB 5JQGB 5GANK 3F0FA 3HTNA 3F0EA 3CCLF 3VYUC 1QU9A 3ZOPA 4IIJB 3I7TA 4YJ3A 2UYJA 3CCQF 3JAWA 3P4EA 4G4XA 3P10A 5KMGB 1GO1A 3CCVF 4I4TB 2H8EA 4EB6B 5JQGA 3LWPC 3I55F 3WGMA 4IHJB 1X52A 4IIJA 3ESJA 2RHLA 5HY0A 1IPAA 4B45A 5GIOC 3CC7F 5A2QM 5KMGA 1VQOF 1VQ7F 1NJIH 3V4DA 4X20B 3CG6A 3S03A 2L26A 4IHJA 5LA6B 2VAWA 2H6LA 1W5BA 5CB4B 2OTMA 2WALA 3DC2A 3CC2F 3VMFB 3FFMA 2RB9A 1X25A 3M84A 3VOAA 1Q7YH 3TD5A 4LCKA 2ZVYA 3HKCA 4X20A 4X1KB 4X3LA 3WJPA 4HNAB 3PLAC 4M8IA 3IEWA 3F0GA 5AVMA 5LA6A 1W5FA 5CB4A 2Q1XA 1N8RH 1W57A 2VXYA 5JH7A 3MQWA 5B8FA 4X1KA 4B46A 4HNAA 4X1IB 4PWTA 5JCOA 1Q82H 1K8AH 3N2GB 2LBTA 4ZHWA 2V9YA 1M90H 1W41A 3CMEF 3LMEA 2UZHA 1DBFA 3G71F 3C9UA 3M1XA 2VAPA 3WGNA 2VAMA 3NVKE 5FLXM 4LNUB 1IV3A 3N2GA 2VGNA 5LP6A 1YI2F 1YQNA 5GAPK 1QD9A 2AIZP 3J81M 2GVIA 1YGYA 5HY4A 2Z1TA 3E1YA 2VGMA 1Z5WA 2Z1FA 4LNUA 4E6EA 1R1MA 2CZWA 4X1YB 1VQKF 1GX1A 3JATB 2R751 3IEQA 3LYBA 1W3EX 4TV8B 4ZHVA 3S0WA 4G4VA 2K1SA 2I6DA 5EB0A 3KJKA 3HKBA 4X1YA 3HAXD 3U0OA 4O2AB 4O4JB 4NQ3A 5LYJA 2RHHA 3CCJF 3JATA 3OONA 2HRUA 1E7KA 3JVHA 1PXWA 4WBNB 1XRGA 1ODEA 2RHJA 3N4YA 3WGJA 3IKEA 2BTOA 2LBXA 2FC3A 3RYIB 3TD4A 1X7PA 2AIFA 4O2AA 4O4JA 4I55B 2YYEA 4WBNA 1FNJA 1Q8RA 4YJ3B 3LWVC 4ZHQA 2LCAA 3C9RA 5J2UB 1KC8H 3ZP4A 3RYIA 4BVTA 3CD6F 4I55A 4TZZA 4DRXA 1KQSF 1COMA 4XCQA 1Q81H 3VTIC 2Z1UA 5J2UA 5IYZB 2HS4A 3HKEB 5HP7A 3WPXA 3DDNA 4EI8A 3S06A 3VYSC 3RA5A 1X7OA 3CCSF 2CSLA 2N48A 3N2KB 2HS3A 3LWRC 1IV4A 5EYPB 5IYZA 3I3FA 3HKEA 4BT3A 1W40A 3IKFA 5EZYB 3HKCB 1T0KB 1RQ2A 3OW2F 4TV9B 4C8IA 5IT9M 3N2KA 2H8CA 2HX0A 5HXUA 1CN7A 2ZODA 3FBAA 3C8LA 5EYPA 4C4WC 5JH7B 5EZYA 3K0TA 3KHNA 1GZ0A 3V7QA 2ZOVA 3IMPA 3NK7A 1W59A 1YJNF 1RLGA 5JCOC 2ZAUA 1RLUA 4G88A 3D00A 4TV9A 3VIUA 4ZI7B 1K9MH 5DCVA 3E20B 4DXDA 1U3PA 5ITZA 4C8EA 2HRYA 3VI6A 2KG4A 4G4ZA 3JASB 4ZOLB 1KD1H 1H48A 2HP0B 5HY1A 4G4YA 1VH8A 1SDSA 5LP6B 4RHAA 3F6MA 2PHNA 3P0ZA 3WJQA 3LFOA 4ZI7A 1QAHA 3SIVA 3JASA 4ZOLA 5JVDA 1W42A 2HP0A 1RA4A 3J7AR 4G4WA 4BT2A 1VHAA 3FD5A 3K14A 1SA0B 3T80A 4BVSA 1VQ9F 3JALA 4NWOB 4EI9A 5GIPC 2UYNA 2UYKA 2LBWA 3QTYA 1TVKB 5EIBC 2NMUA 3BYQA 3VYTC 1J7HA 3HKBB 1SA0A 3LWQC 1U43A 2CHTA 5LYJB 3RYCB 3C9SA 2OTJF 2JNBA 3CYQA 1VQ6F 3VO8A 5IJ0B 2DYYA 3TD3A 1VQNF 3MCQA 2QI2A 4BW0B 1W581 2HVYD 2QEXF 1T0AA 3OBYA 5BMVA 1IV2A 1TVKA 5G4VC 3JARA 3CMAF 3WGLA 3RYCA 1XHOA 3UT5B 1S72F 3NK6A 1JFFA 1JD1A 5IJ0A 5CA1A 3G4SF 1VQMF 1KNJA 1QVFF 4ZHQB 3HKDB 1OAPA 3F0DA 4YJ2A 3KJJA 2EWCA 3LDTA 3N4ZA 3CYPB 1JN1A 4BT4A 3FPIA 4BT7A 2ZF8A 3UT5A 1YIJF 4DRXB 3CCUF 3E22A 4BY9D 3ELCA 3RE3A 3I56F 3QHDA 3HWUA 5EIBD 3MBMA 3HKDA 5EWRA 3G6EF 3RA6A 2Z01A 3RYHA 1NQ3A 4TUYA 3JAMM 2ZVZA 1GO0A 4O4IB 5J2TB 5MN5A 1VQLF 2IG8A 3S02A 1DT9A 4O2BB 4O4LB 3CCMF 1U3LA 3EORA 1XBIA 2CWJA 3V7EA 3WGKA 1ONIA 2QTPA 2RHOA 4U39A 3IR9A 1FFXB 1Z5VA 2PMPA 4O4IA 1UI9A 3O85A 5J2TA 1JJ2F 3K12A 3CPWF 1NMUB 1PF5A 4O2BA 2YXZA 4O4LA 3GYQA 3CC4F 5IJ9B 3RYFB 5HXZA 3FD6A 2UYPA 1FFXA 1W5AA 3PAFA 2HQSC 1TUBA 2BTUA 5LXTA 5FNVB 3D54A 1H47A 3GTZA 2OTLF 2IQQA 5GONA 3MCAB 5IJ9A 3RYFA 4EI7A 3R0PA 1JY8A 2G9IA 2IAFA 3QUWA 4KWEA 3VCZA 4ERHA 5CA0B 3ON1A 1YHQF 1FNKA 5MN4A 2BTQB 2I6RA 3KE1A 3AGKA 5FNVA 3K2XA 3CPQA 4I4TA 2R6R1 4EB6A 4BVRA 3MDOA 4F6RB 4B5CA 3CB2A 3GHZA 5C8YB 3S0YA 3CXCF 2P6YA 3KIZA 2KTVA 5JVDB 5CA0A 3Q8HA 5LOVB 4I50B 3VOBA 5EO3A 2KTUA 2Q1YA 5LP6C 1SZQA 4C82A 5FJ4C 1Q86H 5C8YA 3JALB 4BT5A 2AMTA 4F6RA 2MQEA 4U3JB 4C8GA 5HP8A 2UYNB 3WPWA 1CK2A 1U40A 5HWEA 4FFBB 3SIUA 5LOVA 4I50A 5MN6A 2GLZA 3CCEF 1OFUA 4U3JA 2CHSA 3D01A 2W8BC 1VQ4F 1VQPF 4FFBA 5BMVB 3J80M 3ERNA 1VK3A 3JARB 1K73H 3LWOC 1W2BF 1H7MA 2HP3A 4X1IA 3HJWC 1JFFB 5EB1B 5ITZB 1IV1A 5CA1B 5KX5B 3WXMB 1FSZA 3CCRF 4YJ2B 1CLIA 1YJ9F 4R40B 4BVQA 3NMUC 1UFYA 3E22B
chains in the Genus database with same CATH topology
3OW2F 1Q82H 1GO0A 1K8AH 5IT9M 3V3TA 2OHWA 1W41A 3CMEF 1M90H 1VQLF 1DT9A 5HXUA 1CN7A 3G71F 1VQ8F 4C4WC 1YITF 3CCMF 3V7EA 1XBIA 1GZ0A 3V7QA 3NVKE 1VQ5F 5FLXM 2BO1A 3NK7A 1YJNF 3IR9A 1RLGA 5GINC 3O85A 3D00A 4NUTA 1JJ2F 2VGNA 2F9ZC 3CPWF 1YI2F 1K9MH 5GAPK 1NMUB 5DCVA 3CC4F 3JCMM 3E20B 3GYQA 3J81M 5G4UC 5HXZA 5HY4A 3VI6A 3E1YA 1YJWF 2KG4A 2OZBA 2FGYA 3NVIB 1KD1H 2VGMA 2QA4F 5HY1A 1QVGF 1M1KH 3PAFA 1ZWZA 2CZWA 3OBWA 1SDSA 1VQKF 2OTLF 3LFOA 2ALEA 3MCAB 3SIVA 4EI7A 1W3EX 1W42A 1RA4A 3ON1A 1YHQF 5HY2A 3J7AR 2I6DA 3AGKA 4X3MA 3HAXD 3CPQA 3CCJF 4NQ3A 5GANK 4BVSA 4BVRA 1VQ9F 1E7KA 4EI9A 3CCLF 1PXWA 5GIPC 3CXCF 2KTVA 3CCQF 2LBWA 3N4YA 2LBXA 2FC3A 1X7PA 5EO3A 2KTUA 3LWQC 2AIFA 1GO1A 3CCVF 3LWPC 3I55F 2JNBA 1Q86H 2OTJF 5FJ4C 1VQ6F 1VQNF 1X52A 2QI2A 1IPAA 4BW0B 5HY0A 1CK2A 5HWEA 5GIOC 3LWVC 2QEXF 3OBYA 2HVYD 3SIUA 3CC7F 5A2QM 5G4VC 1KC8H 1VQOF 1VQ7F 4BVTA 3CMAF 1NJIH 2GLZA 3CD6F 1S72F 3CG6A 4TZZA 3NK6A 3CCEF 1KQSF 3G4SF 1VQMF 4XCQA 1Q81H 1VQPF 1VQ4F 1QVFF 3N4ZA 3J80M 2WALA 3CC2F 3VMFB 3FFMA 1Q7YH 1K73H 4LCKA 3LWOC 4EI8A 4X3LA 1W2BF 1YIJF 1H7MA 3PLAC 3CCUF 3RA5A 1X7OA 4BY9D 3HJWC 3I56F 3CCSF 3WXMB 3CCRF 3LWRC 1N8RH 5EWRA 3G6EF 1YJ9F 3RA6A 4BVQA 1W40A 3NMUC 3JAMM 1T0KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 F;  1Q82 H;  1GO0 A;  1K8A H;  5IT9 M;  2OHW A;  1W41 A;  3CME F;  1M90 H;  1VQL F;  1DT9 A;  1CN7 A;  3G71 F;  1VQ8 F;  4C4W C;  1YIT F;  3CCM F;  3V7E A;  1XBI A;  1GZ0 A;  3V7Q A;  3NVK E;  1VQ5 F;  5FLX M;  2BO1 A;  3NK7 A;  1YJN F;  3IR9 A;  1RLG A;  5GIN C;  3O85 A;  4NUT A;  1JJ2 F;  2VGN A;  3CPW F;  1YI2 F;  1K9M H;  5GAP K;  1NMU B;  5DCV A;  3CC4 F;  3JCM M;  3E20 B;  3GYQ A;  3J81 M;  5G4U C;  3VI6 A;  3E1Y A;  1YJW F;  2KG4 A;  2OZB A;  3NVI B;  1KD1 H;  2VGM A;  2QA4 F;  1QVG F;  1M1K H;  3PAF A;  1ZWZ A;  2CZW A;  3OBW A;  1SDS A;  1VQK F;  2OTL F;  3LFO A;  2ALE A;  3MCA B;  3SIV A;  1W3E X;  1W42 A;  1RA4 A;  3ON1 A;  1YHQ F;  3J7A R;  2I6D A;  3AGK A;  4X3M A;  3HAX D;  3CPQ A;  3CCJ F;  5GAN K;  1VQ9 F;  1E7K A;  3CCL F;  1PXW A;  5GIP C;  3CXC F;  2KTV A;  3CCQ F;  2LBW A;  3N4Y A;  2LBX A;  2FC3 A;  1X7P A;  5EO3 A;  2KTU A;  3LWQ C;  2AIF A;  1GO1 A;  3CCV F;  3LWP C;  3I55 F;  2JNB A;  1Q86 H;  2OTJ F;  5FJ4 C;  1VQ6 F;  1VQN F;  1X52 A;  2QI2 A;  5GIO C;  1IPA A;  4BW0 B;  1CK2 A;  3LWV C;  2HVY D;  2QEX F;  3SIU A;  3OBY A;  3CC7 F;  5A2Q M;  5G4V C;  1KC8 H;  1VQO F;  1VQ7 F;  3CMA F;  1NJI H;  3CD6 F;  1S72 F;  3CG6 A;  4TZZ A;  3NK6 A;  3CCE F;  1KQS F;  3G4S F;  1VQM F;  1VQ4 F;  1Q81 H;  1VQP F;  1QVF F;  3N4Z A;  3J80 M;  2WAL A;  3CC2 F;  3VMF B;  3FFM A;  1Q7Y H;  1K73 H;  4LCK A;  3LWO C;  1W2B F;  4X3L A;  1YIJ F;  1H7M A;  3PLA C;  3CCU F;  3RA5 A;  1X7O A;  4BY9 D;  3HJW C;  3I56 F;  3CCS F;  3WXM B;  3CCR F;  3LWR C;  1N8R H;  5EWR A;  3G6E F;  1YJ9 F;  3RA6 A;  1W40 A;  3NMU C;  3JAM M;  1T0K B; 
#chains in the Genus database with same CATH topology
 5KX5 A;  2GZL A;  3ZO8 A;  3L7Q A;  3V3T A;  2OHW A;  3JAK B;  4O4H B;  1VQ8 F;  1YIT F;  2HS0 A;  3RYH B;  4TUY B;  1RQ7 A;  1VQ5 F;  2BO1 A;  2KGW A;  5GIN C;  5EAZ A;  4NUT A;  2F9Z C;  3JAK A;  4O4H A;  3M4S A;  3C9T A;  3JCM M;  5G4U C;  4TV8 A;  1VQV A;  1YJW F;  2OZB A;  2FGY A;  3NVI B;  2QA4 F;  4RQO A;  1QVG F;  1M1K H;  3WJR A;  1ZWZ A;  3OBW A;  2DT4 A;  1W55 A;  3B6N A;  1XV2 A;  4C81 A;  2ALE A;  2CVL A;  3S0H A;  4ZHY B;  4ZK7 A;  2B33 A;  2Z1E A;  1KNK A;  4BT6 A;  2CW4 A;  5HY2 A;  1W5E A;  1TUB B;  3JAW B;  5LXT B;  4X3M A;  4B62 A;  3ZP7 A;  5GON B;  5JQG B;  5GAN K;  3F0F A;  3HTN A;  3F0E A;  3CCL F;  3VYU C;  1QU9 A;  3ZOP A;  4IIJ B;  3I7T A;  4YJ3 A;  2UYJ A;  3CCQ F;  3JAW A;  3P4E A;  4G4X A;  3P10 A;  5KMG B;  1GO1 A;  3CCV F;  4I4T B;  2H8E A;  4EB6 B;  5JQG A;  3LWP C;  3I55 F;  3WGM A;  4IHJ B;  1X52 A;  4IIJ A;  3ESJ A;  2RHL A;  5HY0 A;  1IPA A;  4B45 A;  5GIO C;  3CC7 F;  5A2Q M;  5KMG A;  1VQO F;  1VQ7 F;  1NJI H;  3V4D A;  4X20 B;  3CG6 A;  3S03 A;  2L26 A;  4IHJ A;  5LA6 B;  2VAW A;  2H6L A;  1W5B A;  5CB4 B;  2OTM A;  2WAL A;  3DC2 A;  3CC2 F;  3VMF B;  3FFM A;  2RB9 A;  1X25 A;  3M84 A;  3VOA A;  1Q7Y H;  3TD5 A;  4LCK A;  2ZVY A;  3HKC A;  4X20 A;  4X1K B;  4X3L A;  3WJP A;  4HNA B;  3PLA C;  4M8I A;  3IEW A;  3F0G A;  5AVM A;  5LA6 A;  1W5F A;  5CB4 A;  2Q1X A;  1N8R H;  1W57 A;  2VXY A;  5JH7 A;  3MQW A;  5B8F A;  4X1K A;  4B46 A;  4HNA A;  4X1I B;  4PWT A;  5JCO A;  1Q82 H;  1K8A H;  3N2G B;  2LBT A;  4ZHW A;  2V9Y A;  1M90 H;  1W41 A;  3CME F;  3LME A;  2UZH A;  1DBF A;  3G71 F;  3C9U A;  3M1X A;  2VAP A;  3WGN A;  2VAM A;  3NVK E;  5FLX M;  4LNU B;  1IV3 A;  3N2G A;  2VGN A;  5LP6 A;  1YI2 F;  1YQN A;  5GAP K;  1QD9 A;  2AIZ P;  3J81 M;  2GVI A;  1YGY A;  5HY4 A;  2Z1T A;  3E1Y A;  2VGM A;  1Z5W A;  2Z1F A;  4LNU A;  4E6E A;  1R1M A;  2CZW A;  4X1Y B;  1VQK F;  1GX1 A;  3JAT B;  2R75 1;  3IEQ A;  3LYB A;  1W3E X;  4TV8 B;  4ZHV A;  3S0W A;  4G4V A;  2K1S A;  2I6D A;  5EB0 A;  3KJK A;  3HKB A;  4X1Y A;  3HAX D;  3U0O A;  4O2A B;  4O4J B;  4NQ3 A;  5LYJ A;  2RHH A;  3CCJ F;  3JAT A;  3OON A;  2HRU A;  1E7K A;  3JVH A;  1PXW A;  4WBN B;  1XRG A;  1ODE A;  2RHJ A;  3N4Y A;  3WGJ A;  3IKE A;  2BTO A;  2LBX A;  2FC3 A;  3RYI B;  3TD4 A;  1X7P A;  2AIF A;  4O2A A;  4O4J A;  4I55 B;  2YYE A;  4WBN A;  1FNJ A;  1Q8R A;  4YJ3 B;  3LWV C;  4ZHQ A;  2LCA A;  3C9R A;  5J2U B;  1KC8 H;  3ZP4 A;  3RYI A;  4BVT A;  3CD6 F;  4I55 A;  4TZZ A;  4DRX A;  1KQS F;  1COM A;  4XCQ A;  1Q81 H;  3VTI C;  2Z1U A;  5J2U A;  5IYZ B;  2HS4 A;  3HKE B;  5HP7 A;  3WPX A;  3DDN A;  4EI8 A;  3S06 A;  3VYS C;  3RA5 A;  1X7O A;  3CCS F;  2CSL A;  2N48 A;  3N2K B;  2HS3 A;  3LWR C;  1IV4 A;  5EYP B;  5IYZ A;  3I3F A;  3HKE A;  4BT3 A;  1W40 A;  3IKF A;  5EZY B;  3HKC B;  1T0K B;  1RQ2 A;  3OW2 F;  4TV9 B;  4C8I A;  5IT9 M;  3N2K A;  2H8C A;  2HX0 A;  5HXU A;  1CN7 A;  2ZOD A;  3FBA A;  3C8L A;  5EYP A;  4C4W C;  5JH7 B;  5EZY A;  3K0T A;  3KHN A;  1GZ0 A;  3V7Q A;  2ZOV A;  3IMP A;  3NK7 A;  1W59 A;  1YJN F;  1RLG A;  5JCO C;  2ZAU A;  1RLU A;  4G88 A;  3D00 A;  4TV9 A;  3VIU A;  4ZI7 B;  1K9M H;  5DCV A;  3E20 B;  4DXD A;  1U3P A;  5ITZ A;  4C8E A;  2HRY A;  3VI6 A;  2KG4 A;  4G4Z A;  3JAS B;  4ZOL B;  1KD1 H;  1H48 A;  2HP0 B;  5HY1 A;  4G4Y A;  1VH8 A;  1SDS A;  5LP6 B;  4RHA A;  3F6M A;  2PHN A;  3P0Z A;  3WJQ A;  3LFO A;  4ZI7 A;  1QAH A;  3SIV A;  3JAS A;  4ZOL A;  5JVD A;  1W42 A;  2HP0 A;  1RA4 A;  3J7A R;  4G4W A;  4BT2 A;  1VHA A;  3FD5 A;  3K14 A;  1SA0 B;  3T80 A;  4BVS A;  1VQ9 F;  3JAL A;  4NWO B;  4EI9 A;  5GIP C;  2UYN A;  2UYK A;  2LBW A;  3QTY A;  1TVK B;  5EIB C;  2NMU A;  3BYQ A;  3VYT C;  1J7H A;  3HKB B;  1SA0 A;  3LWQ C;  1U43 A;  2CHT A;  5LYJ B;  3RYC B;  3C9S A;  2OTJ F;  2JNB A;  3CYQ A;  1VQ6 F;  3VO8 A;  5IJ0 B;  2DYY A;  3TD3 A;  1VQN F;  3MCQ A;  2QI2 A;  4BW0 B;  1W58 1;  2HVY D;  2QEX F;  1T0A A;  3OBY A;  5BMV A;  1IV2 A;  1TVK A;  5G4V C;  3JAR A;  3CMA F;  3WGL A;  3RYC A;  1XHO A;  3UT5 B;  1S72 F;  3NK6 A;  1JFF A;  1JD1 A;  5IJ0 A;  5CA1 A;  3G4S F;  1VQM F;  1KNJ A;  1QVF F;  4ZHQ B;  3HKD B;  1OAP A;  3F0D A;  4YJ2 A;  3KJJ A;  2EWC A;  3LDT A;  3N4Z A;  3CYP B;  1JN1 A;  4BT4 A;  3FPI A;  4BT7 A;  2ZF8 A;  3UT5 A;  1YIJ F;  4DRX B;  3CCU F;  3E22 A;  4BY9 D;  3ELC A;  3RE3 A;  3I56 F;  3QHD A;  3HWU A;  5EIB D;  3MBM A;  3HKD A;  5EWR A;  3G6E F;  3RA6 A;  2Z01 A;  3RYH A;  1NQ3 A;  4TUY A;  3JAM M;  2ZVZ A;  1GO0 A;  4O4I B;  5J2T B;  5MN5 A;  1VQL F;  2IG8 A;  3S02 A;  1DT9 A;  4O2B B;  4O4L B;  3CCM F;  1U3L A;  3EOR A;  1XBI A;  2CWJ A;  3V7E A;  3WGK A;  1ONI A;  2QTP A;  2RHO A;  4U39 A;  3IR9 A;  1FFX B;  1Z5V A;  2PMP A;  4O4I A;  1UI9 A;  3O85 A;  5J2T A;  1JJ2 F;  3K12 A;  3CPW F;  1NMU B;  1PF5 A;  4O2B A;  2YXZ A;  4O4L A;  3GYQ A;  3CC4 F;  5IJ9 B;  3RYF B;  5HXZ A;  3FD6 A;  2UYP A;  1FFX A;  1W5A A;  3PAF A;  2HQS C;  1TUB A;  2BTU A;  5LXT A;  5FNV B;  3D54 A;  1H47 A;  3GTZ A;  2OTL F;  2IQQ A;  5GON A;  3MCA B;  5IJ9 A;  3RYF A;  4EI7 A;  3R0P A;  1JY8 A;  2G9I A;  2IAF A;  3QUW A;  4KWE A;  3VCZ A;  4ERH A;  5CA0 B;  3ON1 A;  1YHQ F;  1FNK A;  5MN4 A;  2BTQ B;  2I6R A;  3KE1 A;  3AGK A;  5FNV A;  3K2X A;  3CPQ A;  4I4T A;  2R6R 1;  4EB6 A;  4BVR A;  3MDO A;  4F6R B;  4B5C A;  3CB2 A;  3GHZ A;  5C8Y B;  3S0Y A;  3CXC F;  2P6Y A;  3KIZ A;  2KTV A;  5JVD B;  5CA0 A;  3Q8H A;  5LOV B;  4I50 B;  3VOB A;  5EO3 A;  2KTU A;  2Q1Y A;  5LP6 C;  1SZQ A;  4C82 A;  5FJ4 C;  1Q86 H;  5C8Y A;  3JAL B;  4BT5 A;  2AMT A;  4F6R A;  2MQE A;  4U3J B;  4C8G A;  5HP8 A;  2UYN B;  3WPW A;  1CK2 A;  1U40 A;  5HWE A;  4FFB B;  3SIU A;  5LOV A;  4I50 A;  5MN6 A;  2GLZ A;  3CCE F;  1OFU A;  4U3J A;  2CHS A;  3D01 A;  2W8B C;  1VQ4 F;  1VQP F;  4FFB A;  5BMV B;  3J80 M;  3ERN A;  1VK3 A;  3JAR B;  1K73 H;  3LWO C;  1W2B F;  1H7M A;  2HP3 A;  4X1I A;  3HJW C;  1JFF B;  5EB1 B;  5ITZ B;  1IV1 A;  5CA1 B;  5KX5 B;  3WXM B;  1FSZ A;  3CCR F;  4YJ2 B;  1CLI A;  1YJ9 F;  4R40 B;  4BVQ A;  3NMU C;  1UFY A;  3E22 B; 
#chains in the Genus database with same CATH homology
 3OW2 F;  1Q82 H;  1GO0 A;  1K8A H;  5IT9 M;  3V3T A;  2OHW A;  1W41 A;  3CME F;  1M90 H;  1VQL F;  1DT9 A;  5HXU A;  1CN7 A;  3G71 F;  1VQ8 F;  4C4W C;  1YIT F;  3CCM F;  3V7E A;  1XBI A;  1GZ0 A;  3V7Q A;  3NVK E;  1VQ5 F;  5FLX M;  2BO1 A;  3NK7 A;  1YJN F;  3IR9 A;  1RLG A;  5GIN C;  3O85 A;  3D00 A;  4NUT A;  1JJ2 F;  2VGN A;  2F9Z C;  3CPW F;  1YI2 F;  1K9M H;  5GAP K;  1NMU B;  5DCV A;  3CC4 F;  3JCM M;  3E20 B;  3GYQ A;  3J81 M;  5G4U C;  5HXZ A;  5HY4 A;  3VI6 A;  3E1Y A;  1YJW F;  2KG4 A;  2OZB A;  2FGY A;  3NVI B;  1KD1 H;  2VGM A;  2QA4 F;  5HY1 A;  1QVG F;  1M1K H;  3PAF A;  1ZWZ A;  2CZW A;  3OBW A;  1SDS A;  1VQK F;  2OTL F;  3LFO A;  2ALE A;  3MCA B;  3SIV A;  4EI7 A;  1W3E X;  1W42 A;  1RA4 A;  3ON1 A;  1YHQ F;  5HY2 A;  3J7A R;  2I6D A;  3AGK A;  4X3M A;  3HAX D;  3CPQ A;  3CCJ F;  4NQ3 A;  5GAN K;  4BVS A;  4BVR A;  1VQ9 F;  1E7K A;  4EI9 A;  3CCL F;  1PXW A;  5GIP C;  3CXC F;  2KTV A;  3CCQ F;  2LBW A;  3N4Y A;  2LBX A;  2FC3 A;  1X7P A;  5EO3 A;  2KTU A;  3LWQ C;  2AIF A;  1GO1 A;  3CCV F;  3LWP C;  3I55 F;  2JNB A;  1Q86 H;  2OTJ F;  5FJ4 C;  1VQ6 F;  1VQN F;  1X52 A;  2QI2 A;  1IPA A;  4BW0 B;  5HY0 A;  1CK2 A;  5HWE A;  5GIO C;  3LWV C;  2QEX F;  3OBY A;  2HVY D;  3SIU A;  3CC7 F;  5A2Q M;  5G4V C;  1KC8 H;  1VQO F;  1VQ7 F;  4BVT A;  3CMA F;  1NJI H;  2GLZ A;  3CD6 F;  1S72 F;  3CG6 A;  4TZZ A;  3NK6 A;  3CCE F;  1KQS F;  3G4S F;  1VQM F;  4XCQ A;  1Q81 H;  1VQP F;  1VQ4 F;  1QVF F;  3N4Z A;  3J80 M;  2WAL A;  3CC2 F;  3VMF B;  3FFM A;  1Q7Y H;  1K73 H;  4LCK A;  3LWO C;  4EI8 A;  4X3L A;  1W2B F;  1YIJ F;  1H7M A;  3PLA C;  3CCU F;  3RA5 A;  1X7O A;  4BY9 D;  3HJW C;  3I56 F;  3CCS F;  3WXM B;  3CCR F;  3LWR C;  1N8R H;  5EWR A;  3G6E F;  1YJ9 F;  3RA6 A;  4BVQ A;  1W40 A;  3NMU C;  3JAM M;  1T0K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...