1DBFA

Chorismate mutase from bacillus subtilis at 1.30 angstrom
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
127
structure length
127
Chain Sequence
MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVLRPDLSLTKNTEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CHORISMATE MUTASE)
publication title The 1.30 A resolution structure of the Bacillus subtilis chorismate mutase catalytic homotrimer.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 34
structure length 127
sequence length 127
chains with identical sequence B, C
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 1999-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1dbfA00
3R0PA 5HP8A 1DBFA 1ODEA 1COMA 3KJKA 1ONIA 2CHSA 3QUWA 2UYNA 3I3FA 3LYBA 1QD9A 3M1XA 3K12A 1FNKA 2CWJA 1FNJA 1QAHA 1XHOA 2DYYA 1PF5A 3MQWA 5HP7A 1QU9A 3VCZA 1J7HA 2UYJA 2UYPA 2CSLA 3ZO8A 3ZOPA 3ZP7A 2UYNB 4ZK7A 2OTMA 1UI9A 3K0TA 3V4DA 3LMEA 2UYKA 3M4SA 1JD1A 1X25A 3ZP4A 3KJJA 2CW4A 1UFYA 3I7TA 2CVLA 1XRGA 3GTZA 2IG8A 2B33A 1NQ3A 4NWOB 2CHTA 3L7QA 3D01A 2EWCA
chains in the Genus database with same CATH superfamily
1VQ5F 3S0YA 1DBFA 3MBMA 3GYQA 3HKDB 2UYNA 4TV9B 4G4WA 3S0HA 5JCOC 3CCJF 3CCMF 1YI2F 1VQNF 3CYQA 3G4SF 2UYNB 1XV2A 2Q1XA 2JNBA 3K2XA 2ALEA 3M4SA 1U40A 1H48A 4TUYA 1VQ7F 1ZWZA 1XBIA 2I6DA 2ZOVA 2DT4A 2EWCA 3KIZA 1W2BF 2HS4A 4O4HA 4YJ3A 1KNJA 3P10A 5CA0A 5KX5A 3WGKA 4TUYB 2HX0A 1YJNF 1K8AH 3HKEB 1YITF 1VQVA 3FPIA 4O4HB 4YJ3B 1TUBA 2UYJA 5EZYA 5CA0B 5GONA 5KX5B 4BW0B 2BTOA 2AMTA 4BVRA 4F6RB 2WALA 5LA6A 5HXUA 1KC8H 3C9TA 5EIBD 5HY1A 3ESJA 4BT4A 4C81A 3OBYA 5LXTA 1TUBB 2F9ZC 5GONB 3I7TA 4E6EA 3HWUA 1IV3A 5LA6B 3CCLF 3BYQA 3IMPA 2OHWA 2IAFA 3VO8A 1RQ2A 2RB9A 5LXTB 1KQSF 1COMA 1H7MA 4BY9D 4X1IA 3CC4F 1W59A 3RYFB 3ERNA 1VQ9F 3I56F 1W581 2CZWA 3WPXA 5HP7A 4ZHWA 5LYJB 3V7QA 3ZOPA 3MCAB 3G71F 1U3LA 3DDNA 2OTMA 1CK2A 2HS3A 3ZP4A 3TD3A 4BT6A 1Z5VA 4BVTA 4LNUA 2Z01A 3C8LA 1W5AA 3HKBA 1QVGF 2R751 3ON1A 2HQSC 4BVSA 1VQ6F 2Z1EA 1ONIA 4LNUB 5LP6C 1N8RH 2LCAA 3JAKA 1SA0A 2ZAUA 1Q82H 1J7HA 3VCZA 3E22A 2ZVYA 3PLAC 5EB1B 4BT3A 4BT5A 5EYPA 1SZQA 4O2AB 1RLGA 3JAKB 3VOAA 5LOVA 1SA0B 5HY2A 5J2UA 2Z1FA 4R40B 1Z5WA 3E22B 4YJ2A 2OZBA 4X20A 5EYPB 1RQ7A 5DCVA 5LOVB 1GX1A 5J2UB 2LBXA 3RE3A 2H6LA 3MCQA 4YJ2B 4X3MA 3NK6A 3JALA 4X20B 3RYHB 2CWJA 1VQLF 3IKFA 1VQMF 1TVKA 3JALB 5GINC 4G4YA 1CN7A 1FSZA 3K0TA 1VH8A 3HTNA 4U39A 2K1SA 1Q7YH 5CB4A 3CC7F 2B33A 2NMUA 4I55A 2CHTA 3LWVC 2AIZP 4C8GA 5HXZA 1T0AA 4ZHYB 5CB4B 3D00A 4X3LA 4U3JA 4O4IA 3M1XA 3TD5A 4I55B 2KTUA 3HAXD 3CMEF 3CYPB 4C8IA 5GIOC 4ZHVA 3QHDA 4U3JB 4O4IB 3P0ZA 1R1MA 2VAMA 5EAZA 3CB2A 1M90H 4FFBA 3C9SA 3JVHA 3WJQA 4EI7A 4B46A 2MQEA 3F0DA 5IT9M 2VAPA 4X1KA 3HKEA 2UZHA 3QTYA 4FFBB 1VK3A 5IJ0B 4B5CA 5HY0A 3WXMB 3OW2F 3LYBA 2H8CA 2G9IA 3HKCB 2BTUA 4F6RA 4I4TB 3VOBA 4BVQA 4NQ3A 4X1KB 4HNAA 3E20B 3CPWF 3J81M 3C9RA 1YIJF 2VGNA 3JASA 4G4ZA 4EB6A 3AGKA 4HNAB 1X25A 5GANK 3JAMM 3OONA 2CW4A 4KWEA 3M84A 3JASB 2IG8A 4I50A 2HP0B 4IHJA 3L7QA 4EB6B 1W57A 2KTVA 2QTPA 5HWEA 3RYFA 1JFFB 5HP8A 4EI8A 1ODEA 5LYJA 4I50B 3I55F 4IHJB 2I6RA 1XHOA 3ELCA 4B45A 2GLZA 2QI2A 3MQWA 1T0KB 3LFOA 1IV1A 3P4EA 1JJ2F 3CD6F 1W5EA 2RHLA 2YXZA 2ZVZA 1W42A 2PHNA 2V9YA 4DXDA 1JD1A 5HY4A 2P6YA 5FLXM 5IYZB 3CC2F 2H8EA 3WJRA 3FD5A 1VQKF 3F0GA 5AVMA 5EB0A 1X7OA 2ZF8A 3QUWA 1FFXA 1X7PA 4XCQA 3CPQA 1YHQF 1DT9A 5FJ4C 4O2AA 3VYUC 2UYPA 3ZO8A 2GZLA 1FFXB 2QEXF 1SDSA 4RHAA 1VQ8F 2KG4A 3K14A 3V4DA 1W55A 4ERHA 2UYKA 3TD4A 2IQQA 1UFYA 3JAWB 3EORA 3F0EA 3DC2A 5G4VC 3RYHA 1OFUA 1X52A 3WGMA 3CG6A 4ZI7A 1KD1H 3R0PA 3K12A 1VQOF 5JQGA 5GAPK 4ZOLA 1K73H 2HS0A 3NVKE 2BTQB 3KHNA 4ZI7B 1W5BA 3N2KB 4TZZA 3SIUA 5ITZA 5JQGB 3JATA 4ZOLB 5BMVA 3S06A 4C4WC 5GIPC 4X1YA 3T80A 5J2TA 5ITZB 3JATB 4PWTA 2FGYA 5BMVB 1PXWA 2RHHA 3LWPC 3VYTC 4C8EA 4X1YB 3J80M 4DRXA 3I3FA 2Z1UA 5J2TB 1GO0A 2Q1YA 3LWQC 2AIFA 3RYCA 1QAHA 3U0OA 3HJWC 4O4LB 3RYIA 3ZP7A 4DRXB 1VQPF 4G4XA 3IEWA 3RYCB 3O85A 3LMEA 1RLUA 3CCUF 4O2BA 3RYIB 5IJ0A 1XRGA 3RA5A 1NQ3A 2L26A 3HKCA 2HVYD 4I4TA 3S02A 4WBNB 5EIBC 5MN6A 1W40A 2Z1TA 5JCOA 4O2BB 3KJKA 5C8YA 5MN5A 4BT7A 2OTJF 1YJWF 2VGMA 1QU9A 3IKEA 2CSLA 3S0WA 1E7KA 4ZHQA 3VI6A 5EWRA 1H47A 5JH7A 5C8YB 2HP0A 5IJ9A 1U3PA 1QVFF 2HRYA 2ZODA 3RA6A 2OTLF 2LBWA 1JFFA 4ZHQB 5MN4A 5JH7B 5IJ9B 2KGWA 1JN1A 3CCRF 1VQ4F 2PMPA 1FNKA 2W8BC 3D54A 2VAWA 3VIUA 3G6EF 3F6MA 5B8FA 2BO1A 3VMFB 3WGJA 4C82A 5IYZA 3WPWA 4ZK7A 3SIVA 5G4UC 1RA4A 5EZYB 1U43A 1GO1A 3KE1A 3GTZA 1JY8A 3N4ZA 2GVIA 4EI9A 5KMGA 1K9MH 1OAPA 3FBAA 1M1KH 1Q86H 3J7AR 1FNJA 1VHAA 5KMGB 2FC3A 4G88A 3JAWA 5EO3A 4X1IB 1W5FA 3NVIB 3F0FA 4O4JA 2N48A 4G4VA 3FFMA 2LBTA 1Q8RA 3B6NA 1W3EX 1IV2A 2QA4F 3IEQA 5LP6A 4O4JB 3V3TA 3CCSF 4RQOA 3N2KA 3HKBB 1QD9A 1YGYA 1GZ0A 3OBWA 4IIJA 5LP6B 1W41A 1PF5A 4LCKA 3UT5A 3CCQF 1UI9A 2RHJA 4TV8A 2R6R1 3CCVF 4IIJB 3JCMM 3UT5B 3VYSC 1YJ9F 3Q8HA 2CVLA 1KNKA 3LWOC 3FD6A 4NUTA 3NK7A 3D01A 4M8IA 3N2GA 4TV8B 4B62A 3JARA 2HRUA 2RHOA 3LDTA 5CA1A 2HP3A 3VTIC 5A2QM 2VXYA 2CHSA 4O4LA 3LWRC 3CXCF 1IV4A 3N2GB 3GHZA 3WGLA 2YYEA 2DYYA 3S03A 3JARB 1YQNA 5CA1B 1NMUB 3C9UA 1IPAA 3MDOA 5JVDA 1NJIH 3N4YA 3CCEF 3IR9A 5FNVA 3CMAF 3KJJA 1TVKB 3NMUC 4WBNA 5JVDB 3HKDA 4BT2A 1Q81H 3E1YA 4TV9A 3WGNA 3V7EA 1CLIA 3PAFA 4NWOB 5FNVB 3WJPA 1S72F
chains in the Genus database with same CATH topology
3R0PA 5HP8A 1DBFA 1ODEA 1COMA 3KJKA 1ONIA 2CHSA 3QUWA 2UYNA 3I3FA 3LYBA 1QD9A 3M1XA 3K12A 1FNKA 2CWJA 1FNJA 1QAHA 1XHOA 2DYYA 1PF5A 3MQWA 5HP7A 1QU9A 3VCZA 1J7HA 2UYJA 2UYPA 2CSLA 3ZO8A 3ZOPA 3ZP7A 2UYNB 4ZK7A 2OTMA 1UI9A 3K0TA 3V4DA 3LMEA 2UYKA 3M4SA 1JD1A 1X25A 3ZP4A 3KJJA 2CW4A 1UFYA 3I7TA 2CVLA 1XRGA 3GTZA 2IG8A 2B33A 1NQ3A 4NWOB 2CHTA 3L7QA 3D01A 2EWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R0P A;  5HP8 A;  1DBF A;  1ODE A;  1COM A;  3KJK A;  1ONI A;  2CHS A;  3QUW A;  2UYN A;  3I3F A;  3LYB A;  1QD9 A;  3M1X A;  3K12 A;  1FNK A;  2CWJ A;  1FNJ A;  1QAH A;  1XHO A;  2DYY A;  1PF5 A;  3MQW A;  5HP7 A;  1QU9 A;  3VCZ A;  1J7H A;  2UYJ A;  2UYP A;  2CSL A;  3ZO8 A;  3ZOP A;  3ZP7 A;  2UYN B;  4ZK7 A;  2OTM A;  1UI9 A;  3K0T A;  3V4D A;  3LME A;  2UYK A;  3M4S A;  1JD1 A;  1X25 A;  3ZP4 A;  3KJJ A;  2CW4 A;  1UFY A;  3I7T A;  2CVL A;  1XRG A;  3GTZ A;  2IG8 A;  2B33 A;  1NQ3 A;  4NWO B;  2CHT A;  3L7Q A;  3D01 A;  2EWC A; 
#chains in the Genus database with same CATH topology
 1VQ5 F;  3S0Y A;  1DBF A;  3MBM A;  3GYQ A;  3HKD B;  2UYN A;  4TV9 B;  4G4W A;  3S0H A;  5JCO C;  3CCJ F;  3CCM F;  1YI2 F;  1VQN F;  3CYQ A;  3G4S F;  2UYN B;  1XV2 A;  2Q1X A;  2JNB A;  3K2X A;  2ALE A;  3M4S A;  1U40 A;  1H48 A;  4TUY A;  1VQ7 F;  1ZWZ A;  1XBI A;  2I6D A;  2ZOV A;  2DT4 A;  2EWC A;  3KIZ A;  1W2B F;  2HS4 A;  4O4H A;  4YJ3 A;  1KNJ A;  3P10 A;  5CA0 A;  5KX5 A;  3WGK A;  4TUY B;  2HX0 A;  1YJN F;  1K8A H;  3HKE B;  1YIT F;  1VQV A;  3FPI A;  4O4H B;  4YJ3 B;  1TUB A;  2UYJ A;  5EZY A;  5CA0 B;  5GON A;  5KX5 B;  4BW0 B;  2BTO A;  2AMT A;  4BVR A;  4F6R B;  2WAL A;  5LA6 A;  5HXU A;  1KC8 H;  3C9T A;  5EIB D;  5HY1 A;  3ESJ A;  4BT4 A;  4C81 A;  3OBY A;  5LXT A;  1TUB B;  2F9Z C;  5GON B;  3I7T A;  4E6E A;  3HWU A;  1IV3 A;  5LA6 B;  3CCL F;  3BYQ A;  3IMP A;  2OHW A;  2IAF A;  3VO8 A;  1RQ2 A;  2RB9 A;  5LXT B;  1KQS F;  1COM A;  1H7M A;  4BY9 D;  4X1I A;  3CC4 F;  1W59 A;  3RYF B;  3ERN A;  1VQ9 F;  3I56 F;  1W58 1;  2CZW A;  3WPX A;  5HP7 A;  4ZHW A;  5LYJ B;  3V7Q A;  3ZOP A;  3MCA B;  3G71 F;  1U3L A;  3DDN A;  2OTM A;  1CK2 A;  2HS3 A;  3ZP4 A;  3TD3 A;  4BT6 A;  1Z5V A;  4BVT A;  4LNU A;  2Z01 A;  3C8L A;  1W5A A;  3HKB A;  1QVG F;  2R75 1;  3ON1 A;  2HQS C;  4BVS A;  1VQ6 F;  2Z1E A;  1ONI A;  4LNU B;  5LP6 C;  1N8R H;  2LCA A;  3JAK A;  1SA0 A;  2ZAU A;  1Q82 H;  1J7H A;  3VCZ A;  3E22 A;  2ZVY A;  3PLA C;  5EB1 B;  4BT3 A;  4BT5 A;  5EYP A;  1SZQ A;  4O2A B;  1RLG A;  3JAK B;  3VOA A;  5LOV A;  1SA0 B;  5HY2 A;  5J2U A;  2Z1F A;  4R40 B;  1Z5W A;  3E22 B;  4YJ2 A;  2OZB A;  4X20 A;  5EYP B;  1RQ7 A;  5DCV A;  5LOV B;  1GX1 A;  5J2U B;  2LBX A;  3RE3 A;  2H6L A;  3MCQ A;  4YJ2 B;  4X3M A;  3NK6 A;  3JAL A;  4X20 B;  3RYH B;  2CWJ A;  1VQL F;  3IKF A;  1VQM F;  1TVK A;  3JAL B;  5GIN C;  4G4Y A;  1CN7 A;  1FSZ A;  3K0T A;  1VH8 A;  3HTN A;  4U39 A;  2K1S A;  1Q7Y H;  5CB4 A;  3CC7 F;  2B33 A;  2NMU A;  4I55 A;  2CHT A;  3LWV C;  2AIZ P;  4C8G A;  5HXZ A;  1T0A A;  4ZHY B;  5CB4 B;  3D00 A;  4X3L A;  4U3J A;  4O4I A;  3M1X A;  3TD5 A;  4I55 B;  2KTU A;  3HAX D;  3CME F;  3CYP B;  4C8I A;  5GIO C;  4ZHV A;  3QHD A;  4U3J B;  4O4I B;  3P0Z A;  1R1M A;  2VAM A;  5EAZ A;  3CB2 A;  1M90 H;  4FFB A;  3C9S A;  3JVH A;  3WJQ A;  4EI7 A;  4B46 A;  2MQE A;  3F0D A;  5IT9 M;  2VAP A;  4X1K A;  3HKE A;  2UZH A;  3QTY A;  4FFB B;  1VK3 A;  5IJ0 B;  4B5C A;  5HY0 A;  3WXM B;  3OW2 F;  3LYB A;  2H8C A;  2G9I A;  3HKC B;  2BTU A;  4F6R A;  4I4T B;  3VOB A;  4BVQ A;  4NQ3 A;  4X1K B;  4HNA A;  3E20 B;  3CPW F;  3J81 M;  3C9R A;  1YIJ F;  2VGN A;  3JAS A;  4G4Z A;  4EB6 A;  3AGK A;  4HNA B;  1X25 A;  5GAN K;  3JAM M;  3OON A;  2CW4 A;  4KWE A;  3M84 A;  3JAS B;  2IG8 A;  4I50 A;  2HP0 B;  4IHJ A;  3L7Q A;  4EB6 B;  1W57 A;  2KTV A;  2QTP A;  5HWE A;  3RYF A;  1JFF B;  5HP8 A;  4EI8 A;  1ODE A;  5LYJ A;  4I50 B;  3I55 F;  4IHJ B;  2I6R A;  1XHO A;  3ELC A;  4B45 A;  2GLZ A;  2QI2 A;  3MQW A;  1T0K B;  3LFO A;  1IV1 A;  3P4E A;  1JJ2 F;  3CD6 F;  1W5E A;  2RHL A;  2YXZ A;  2ZVZ A;  1W42 A;  2PHN A;  2V9Y A;  4DXD A;  1JD1 A;  5HY4 A;  2P6Y A;  5FLX M;  5IYZ B;  3CC2 F;  2H8E A;  3WJR A;  3FD5 A;  1VQK F;  3F0G A;  5AVM A;  5EB0 A;  1X7O A;  2ZF8 A;  3QUW A;  1FFX A;  1X7P A;  4XCQ A;  3CPQ A;  1YHQ F;  1DT9 A;  5FJ4 C;  4O2A A;  3VYU C;  2UYP A;  3ZO8 A;  2GZL A;  1FFX B;  2QEX F;  1SDS A;  4RHA A;  1VQ8 F;  2KG4 A;  3K14 A;  3V4D A;  1W55 A;  4ERH A;  2UYK A;  3TD4 A;  2IQQ A;  1UFY A;  3JAW B;  3EOR A;  3F0E A;  3DC2 A;  5G4V C;  3RYH A;  1OFU A;  1X52 A;  3WGM A;  3CG6 A;  4ZI7 A;  1KD1 H;  3R0P A;  3K12 A;  1VQO F;  5JQG A;  5GAP K;  4ZOL A;  1K73 H;  2HS0 A;  3NVK E;  2BTQ B;  3KHN A;  4ZI7 B;  1W5B A;  3N2K B;  4TZZ A;  3SIU A;  5ITZ A;  5JQG B;  3JAT A;  4ZOL B;  5BMV A;  3S06 A;  4C4W C;  5GIP C;  4X1Y A;  3T80 A;  5J2T A;  5ITZ B;  3JAT B;  4PWT A;  2FGY A;  5BMV B;  1PXW A;  2RHH A;  3LWP C;  3VYT C;  4C8E A;  4X1Y B;  3J80 M;  4DRX A;  3I3F A;  2Z1U A;  5J2T B;  1GO0 A;  2Q1Y A;  3LWQ C;  2AIF A;  3RYC A;  1QAH A;  3U0O A;  3HJW C;  4O4L B;  3RYI A;  3ZP7 A;  4DRX B;  1VQP F;  4G4X A;  3IEW A;  3RYC B;  3O85 A;  3LME A;  1RLU A;  3CCU F;  4O2B A;  3RYI B;  5IJ0 A;  1XRG A;  3RA5 A;  1NQ3 A;  2L26 A;  3HKC A;  2HVY D;  4I4T A;  3S02 A;  4WBN B;  5EIB C;  5MN6 A;  1W40 A;  2Z1T A;  5JCO A;  4O2B B;  3KJK A;  5C8Y A;  5MN5 A;  4BT7 A;  2OTJ F;  1YJW F;  2VGM A;  1QU9 A;  3IKE A;  2CSL A;  3S0W A;  1E7K A;  4ZHQ A;  3VI6 A;  5EWR A;  1H47 A;  5JH7 A;  5C8Y B;  2HP0 A;  5IJ9 A;  1U3P A;  1QVF F;  2HRY A;  2ZOD A;  3RA6 A;  2OTL F;  2LBW A;  1JFF A;  4ZHQ B;  5MN4 A;  5JH7 B;  5IJ9 B;  2KGW A;  1JN1 A;  3CCR F;  1VQ4 F;  2PMP A;  1FNK A;  2W8B C;  3D54 A;  2VAW A;  3VIU A;  3G6E F;  3F6M A;  5B8F A;  2BO1 A;  3VMF B;  3WGJ A;  4C82 A;  5IYZ A;  3WPW A;  4ZK7 A;  3SIV A;  5G4U C;  1RA4 A;  5EZY B;  1U43 A;  1GO1 A;  3KE1 A;  3GTZ A;  1JY8 A;  3N4Z A;  2GVI A;  4EI9 A;  5KMG A;  1K9M H;  1OAP A;  3FBA A;  1M1K H;  1Q86 H;  3J7A R;  1FNJ A;  1VHA A;  5KMG B;  2FC3 A;  4G88 A;  3JAW A;  5EO3 A;  4X1I B;  1W5F A;  3NVI B;  3F0F A;  4O4J A;  2N48 A;  4G4V A;  3FFM A;  2LBT A;  1Q8R A;  3B6N A;  1W3E X;  1IV2 A;  2QA4 F;  3IEQ A;  5LP6 A;  4O4J B;  3V3T A;  3CCS F;  4RQO A;  3N2K A;  3HKB B;  1QD9 A;  1YGY A;  1GZ0 A;  3OBW A;  4IIJ A;  5LP6 B;  1W41 A;  1PF5 A;  4LCK A;  3UT5 A;  3CCQ F;  1UI9 A;  2RHJ A;  4TV8 A;  2R6R 1;  3CCV F;  4IIJ B;  3JCM M;  3UT5 B;  3VYS C;  1YJ9 F;  3Q8H A;  2CVL A;  1KNK A;  3LWO C;  3FD6 A;  4NUT A;  3NK7 A;  3D01 A;  4M8I A;  3N2G A;  4TV8 B;  4B62 A;  3JAR A;  2HRU A;  2RHO A;  3LDT A;  5CA1 A;  2HP3 A;  3VTI C;  5A2Q M;  2VXY A;  2CHS A;  4O4L A;  3LWR C;  3CXC F;  1IV4 A;  3N2G B;  3GHZ A;  3WGL A;  2YYE A;  2DYY A;  3S03 A;  3JAR B;  1YQN A;  5CA1 B;  1NMU B;  3C9U A;  1IPA A;  3MDO A;  5JVD A;  1NJI H;  3N4Y A;  3CCE F;  3IR9 A;  5FNV A;  3CMA F;  3KJJ A;  1TVK B;  3NMU C;  4WBN A;  5JVD B;  3HKD A;  4BT2 A;  1Q81 H;  3E1Y A;  4TV9 A;  3WGN A;  3V7E A;  1CLI A;  3PAF A;  4NWO B;  5FNV B;  3WJP A;  1S72 F; 
#chains in the Genus database with same CATH homology
 3R0P A;  5HP8 A;  1DBF A;  1ODE A;  1COM A;  3KJK A;  1ONI A;  2CHS A;  3QUW A;  2UYN A;  3I3F A;  3LYB A;  1QD9 A;  3M1X A;  3K12 A;  1FNK A;  2CWJ A;  1FNJ A;  1QAH A;  1XHO A;  2DYY A;  1PF5 A;  3MQW A;  5HP7 A;  1QU9 A;  3VCZ A;  1J7H A;  2UYJ A;  2UYP A;  2CSL A;  3ZO8 A;  3ZOP A;  3ZP7 A;  2UYN B;  4ZK7 A;  2OTM A;  1UI9 A;  3K0T A;  3V4D A;  3LME A;  2UYK A;  3M4S A;  1JD1 A;  1X25 A;  3ZP4 A;  3KJJ A;  2CW4 A;  1UFY A;  3I7T A;  2CVL A;  1XRG A;  3GTZ A;  2IG8 A;  2B33 A;  1NQ3 A;  4NWO B;  2CHT A;  3L7Q A;  3D01 A;  2EWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...