1DBFA

Chorismate mutase from bacillus subtilis at 1.30 angstrom
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
127
structure length
127
Chain Sequence
MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVLRPDLSLTKNTEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PROTEIN (CHORISMATE MUTASE)
publication title The 1.30 A resolution structure of the Bacillus subtilis chorismate mutase catalytic homotrimer.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 34
structure length 127
sequence length 127
chains with identical sequence B, C
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 1999-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1dbfA00
3R0PA 1COMA 3M4SA 2CSLA 1FNKA 1XHOA 3GTZA 2UYNA 3MQWA 3L7QA 3I7TA 3LMEA 2CWJA 3KJJA 3M1XA 3QUWA 1UI9A 1XRGA 5HP8A 1NQ3A 3ZP7A 2CHTA 3V4DA 1DBFA 1ONIA 2CHSA 2DYYA 1QAHA 2UYJA 3ZOPA 3D01A 3I3FA 4ZK7A 2CVLA 5HP7A 3VCZA 1J7HA 2B33A 3K0TA 1PF5A 2OTMA 1ODEA 1X25A 4NWOB 2UYPA 1QU9A 3LYBA 3ZO8A 2UYNB 1UFYA 3ZP4A 3K12A 2UYKA 3KJKA 2CW4A 1JD1A 2EWCA 1QD9A 1FNJA 2IG8A
chains in the Genus database with same CATH superfamily
2HP0B 3LWRC 3J80M 3TD5A 3LDTA 3CC7F 4ZHQA 2VXYA 3CB2A 2KG4A 3V4DA 3IR9A 3WJRA 2QA4F 4O2BA 4ZOLB 3F0DA 3JATA 5GAPK 3K0TA 3LWQC 5FJ4C 2Z1EA 4G4YA 1JFFB 5GIPC 2G9IA 3JAMM 4ZI7B 1VQ4F 3WGNA 5HY0A 1GX1A 5DCVA 2QTPA 4BY9D 1Q86H 1PXWA 3ELCA 1RLGA 4O4LA 3LWOC 2WALA 2PHNA 2OHWA 2Z1UA 1VQMF 3G4SF 1RA4A 3IMPA 4X1IA 3VYSC 4ERHA 4ZK7A 4I55B 3CCLF 3NK6A 3N4YA 3HKCA 2YYEA 4RQOA 3E22B 2VAPA 4O4IA 3ZO8A 4B5CA 3HKBA 5HXUA 5J2TB 5MN4A 3EORA 1W2BF 4I4TA 2RB9A 1N8RH 3TD3A 2LBXA 5GIOC 2BO1A 3JARB 3DC2A 2HRYA 3CC2F 2H6LA 3C9TA 4C8IA 3CCEF 1X52A 3QTYA 2HS0A 4B45A 1KNKA 3S03A 1VQ6F 5C8YA 1PF5A 4BVTA 3F0GA 3VYTC 2VAWA 2IQQA 3LYBA 4IHJA 3G6EF 1M90H 1QD9A 3K14A 4X20A 1NMUB 3RYCA 3CYQA 1X7OA 3MCAB 3RYIB 1T0KB 4DRXA 1VQNF 1KC8H 4C81A 3V3TA 5ITZA 3SIUA 1RLUA 5J2UB 4TUYB 3CCQF 2RHJA 5JCOC 2RHLA 3HKDB 3JAKB 1YI2F 5BMVA 2AIZP 2VGMA 5LP6A 4F6RB 2Z1FA 3K12A 4BVSA 3S06A 2NMUA 4ZHQB 3WPXA 1JD1A 1FNJA 2KTUA 4YJ2A 3M4SA 3G71F 1IV3A 4O2BB 4ZHVA 3JAWA 1SA0A 3L7QA 4LNUB 3JATB 1W40A 1TUBA 3P0ZA 4EI8A 4NUTA 3T80A 4E6EA 1ONIA 2VGNA 3JASA 2LBWA 3MDOA 1RQ2A 4FFBA 4TV8A 5AVMA 2BTOA 1YJNF 3HJWC 2OZBA 5LXTA 2VAMA 3HTNA 2F9ZC 3DDNA 2UYPA 5KMGA 4G88A 5EZYA 1Q82H 4RHAA 3HKEA 1H47A 5IT9M 5LOVB 3CYPB 1CN7A 3UT5A 3WGMA 1Z5WA 1IV4A 4WBNB 2YXZA 3F6MA 3JALB 2ZVYA 3QUWA 5HY1A 1UI9A 4XCQA 4ZHYB 3NVIB 3S0WA 5HP8A 5IJ0B 1H48A 1VQ7F 2CZWA 4O4IB 4IIJB 1QVFF 1X7PA 2CVLA 3E1YA 4I4TB 1W5BA 3AGKA 5EIBC 5CB4A 5JH7B 2GZLA 4R40B 2I6DA 3KJKA 2LCAA 1DT9A 3CMEF 5G4VC 5JQGB 1GO1A 1W3EX 3CCMF 1K73H 3KJJA 2KGWA 5C8YB 3CG6A 1S72F 5LYJB 1W5FA 2UZHA 4O2AA 5GINC 1Q7YH 3JCMM 4BT3A 1R1MA 4B46A 3ZOPA 3WXMB 1TVKA 3GYQA 3VCZA 4DXDA 3C9RA 1GO0A 3N2GB 1VQ9F 2ZODA 3V7QA 3RYCB 2Z01A 2HS4A 4X3MA 3MCQA 2CSLA 4O4HA 5EYPB 1W41A 5ITZB 3RA6A 5GONA 4I50A 4EB6A 4G4WA 1YJ9F 1VQ5F 2Z1TA 1NQ3A 5BMVB 5LP6B 2FGYA 2ZVZA 5CA0A 2L26A 3QHDA 5A2QM 3D00A 2OTMA 4U3JA 4O4JA 5IYZB 4ZOLA 2QI2A 1U3PA 4BW0B 5GANK 3KHNA 1TUBB 2V9YA 3WGLA 3CCSF 2ZF8A 4U39A 1XHOA 4X1KB 3TD4A 4ZI7A 3CD6F 1IV1A 4FFBB 4KWEA 4TV8B 3CCUF 1W5EA 1SDSA 2HRUA 4M8IA 5LP6C 3P4EA 4TV9A 2AMTA 5JVDA 5LXTB 3CPQA 3HAXD 4C8EA 2CHSA 1QAHA 3D01A 3HKEB 5IJ9A 2JNBA 3ON1A 5CA1B 1J7HA 4X1YA 2W8BC 3UT5B 2ZOVA 2DT4A 1X25A 1FFXA 3GHZA 1W42A 1GZ0A 1KNJA 1U43A 2UYKA 2R6R1 3E22A 4G4VA 1W55A 5B8FA 1VK3A 2GLZA 1M1KH 3LWVC 5J2TA 1U40A 2UYNA 4TZZA 4X3LA 3NVKE 1VQLF 5EAZA 3FD6A 5EWRA 4C82A 5CB4B 2MQEA 5FNVA 1E7KA 1YITF 3OBYA 3FPIA 1VH8A 3ERNA 2R751 1VQPF 3RA5A 2BTUA 1UFYA 3NMUC 1VQ8F 3CCJF 4O4LB 3WJPA 4O2AB 2FC3A 3N2KA 3I56F 5HXZA 5JCOA 5EO3A 1CLIA 3I7TA 3M1XA 4X1IB 3CC4F 3WGJA 2HP3A 1JJ2F 3HKCB 3PAFA 3F0FA 4BT5A 1NJIH 3HKBB 5FLXM 4YJ3A 5MN6A 2ZAUA 2B33A 3RYFA 3OW2F 1IPAA 4NWOB 1W5AA 2ALEA 1YGYA 3WPWA 3BYQA 1U3LA 5LA6A 3IKEA 2CW4A 2K1SA 4TUYA 3HKDA 2LBTA 3JAKA 5MN5A 4G4XA 5CA0B 3GTZA 4F6RA 1K9MH 3IEQA 1OAPA 3S0YA 1SZQA 1XRGA 3OONA 1Z5VA 3M84A 4O4JB 4U3JB 3U0OA 1VQKF 1RQ7A 3LFOA 3I3FA 4IHJB 4LNUA 5HP7A 3C8LA 2Q1XA 2IAFA 2AIFA 1JY8A 3B6NA 3FFMA 5G4UC 1YHQF 5HWEA 1ZWZA 4X20B 5KX5A 3RYHA 1OFUA 2RHHA 4TV9B 5JVDB 4DRXB 3E20B 4HNAA 1VQOF 1Q8RA 5EB0A 5IJ9B 4BVQA 4PWTA 5LOVA 4NQ3A 4X1YB 4ZHWA 2N48A 2HP0A 3ZP7A 2HS3A 2CHTA 4C8GA 1FFXB 4WBNA 3OBWA 2DYYA 3VIUA 2I6RA 3JALA 1YJWF 2KTVA 2OTJF 5IJ0A 4YJ2B 2RHOA 1QU9A 4IIJA 1XV2A 2UYNB 3VI6A 3D54A 2H8CA 3PLAC 3JAWB 1SA0B 4G4ZA 2PMPA 1W57A 2Q1YA 3K2XA 2QEXF 3CCVF 3CMAF 3CCRF 5JH7A 1COMA 3RE3A 2GVIA 5FNVB 3VYUC 1W59A 1JFFA 3ESJA 3VOAA 3KE1A 5HY4A 3JASB 3LMEA 1YIJF 1XBIA 5JQGA 3MBMA 3VMFB 1QVGF 3S0HA 3N4ZA 5KMGB 3C9UA 5HY2A 5EB1B 1CK2A 5EZYB 5LYJA 4BT4A 1K8AH 3N2KB 3J81M 1H7MA 2HQSC 4I55A 4EI9A 2EWCA 2BTQB 3N2GA 2H8EA 3R0PA 3FD5A 4C4WC 1VQVA 3O85A 3MQWA 4YJ3B 4BT6A 1T0AA 3I55F 3RYFB 3P10A 3WJQA 1FSZA 5EYPA 3JARA 3IEWA 3IKFA 4BVRA 3V7EA 1DBFA 5EIBD 2UYJA 3NK7A 2HVYD 1W581 5LA6B 2P6YA 1YQNA 2HX0A 4B62A 3CXCF 1IV2A 3ZP4A 4BT2A 3LWPC 3WGKA 3CPWF 1ODEA 2CWJA 3SIVA 3VTIC 1FNKA 5IYZA 3VOBA 4BT7A 1VHAA 3KIZA 3JVHA 1TVKB 1KD1H 3J7AR 4X1KA 5KX5B 3S02A 3RYHB 3HWUA 1JN1A 3RYIA 1Q81H 3F0EA 3C9SA 2OTLF 4HNAB 3FBAA 4O4HB 4LCKA 5CA1A 3VO8A 3Q8HA 5GONB 4I50B 4EI7A 4EB6B 5J2UA 1KQSF 2IG8A
chains in the Genus database with same CATH topology
3R0PA 1COMA 3M4SA 2CSLA 1FNKA 1XHOA 3GTZA 2UYNA 3MQWA 3L7QA 3I7TA 3LMEA 2CWJA 3KJJA 3M1XA 3QUWA 1UI9A 1XRGA 5HP8A 1NQ3A 3ZP7A 2CHTA 3V4DA 1DBFA 1ONIA 2CHSA 2DYYA 1QAHA 2UYJA 3ZOPA 3D01A 3I3FA 4ZK7A 2CVLA 5HP7A 3VCZA 1J7HA 2B33A 3K0TA 1PF5A 2OTMA 1ODEA 1X25A 4NWOB 2UYPA 1QU9A 3LYBA 3ZO8A 2UYNB 1UFYA 3ZP4A 3K12A 2UYKA 3KJKA 2CW4A 1JD1A 2EWCA 1QD9A 1FNJA 2IG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R0P A;  1COM A;  3M4S A;  2CSL A;  1FNK A;  1XHO A;  3GTZ A;  2UYN A;  3MQW A;  3L7Q A;  3I7T A;  3LME A;  2CWJ A;  3KJJ A;  3M1X A;  3QUW A;  1UI9 A;  1XRG A;  5HP8 A;  1NQ3 A;  3ZP7 A;  2CHT A;  3V4D A;  1DBF A;  1ONI A;  2CHS A;  2DYY A;  1QAH A;  2UYJ A;  3ZOP A;  3D01 A;  3I3F A;  4ZK7 A;  2CVL A;  5HP7 A;  3VCZ A;  1J7H A;  2B33 A;  3K0T A;  1PF5 A;  2OTM A;  1ODE A;  1X25 A;  4NWO B;  2UYP A;  1QU9 A;  3LYB A;  3ZO8 A;  2UYN B;  1UFY A;  3ZP4 A;  3K12 A;  2UYK A;  3KJK A;  2CW4 A;  1JD1 A;  2EWC A;  1QD9 A;  1FNJ A;  2IG8 A; 
#chains in the Genus database with same CATH topology
 2HP0 B;  3LWR C;  3J80 M;  3TD5 A;  3LDT A;  3CC7 F;  4ZHQ A;  2VXY A;  3CB2 A;  2KG4 A;  3V4D A;  3IR9 A;  3WJR A;  2QA4 F;  4O2B A;  4ZOL B;  3F0D A;  3JAT A;  5GAP K;  3K0T A;  3LWQ C;  5FJ4 C;  2Z1E A;  4G4Y A;  1JFF B;  5GIP C;  2G9I A;  3JAM M;  4ZI7 B;  1VQ4 F;  3WGN A;  5HY0 A;  1GX1 A;  5DCV A;  2QTP A;  4BY9 D;  1Q86 H;  1PXW A;  3ELC A;  1RLG A;  4O4L A;  3LWO C;  2WAL A;  2PHN A;  2OHW A;  2Z1U A;  1VQM F;  3G4S F;  1RA4 A;  3IMP A;  4X1I A;  3VYS C;  4ERH A;  4ZK7 A;  4I55 B;  3CCL F;  3NK6 A;  3N4Y A;  3HKC A;  2YYE A;  4RQO A;  3E22 B;  2VAP A;  4O4I A;  3ZO8 A;  4B5C A;  3HKB A;  5HXU A;  5J2T B;  5MN4 A;  3EOR A;  1W2B F;  4I4T A;  2RB9 A;  1N8R H;  3TD3 A;  2LBX A;  5GIO C;  2BO1 A;  3JAR B;  3DC2 A;  2HRY A;  3CC2 F;  2H6L A;  3C9T A;  4C8I A;  3CCE F;  1X52 A;  3QTY A;  2HS0 A;  4B45 A;  1KNK A;  3S03 A;  1VQ6 F;  5C8Y A;  1PF5 A;  4BVT A;  3F0G A;  3VYT C;  2VAW A;  2IQQ A;  3LYB A;  4IHJ A;  3G6E F;  1M90 H;  1QD9 A;  3K14 A;  4X20 A;  1NMU B;  3RYC A;  3CYQ A;  1X7O A;  3MCA B;  3RYI B;  1T0K B;  4DRX A;  1VQN F;  1KC8 H;  4C81 A;  3V3T A;  5ITZ A;  3SIU A;  1RLU A;  5J2U B;  4TUY B;  3CCQ F;  2RHJ A;  5JCO C;  2RHL A;  3HKD B;  3JAK B;  1YI2 F;  5BMV A;  2AIZ P;  2VGM A;  5LP6 A;  4F6R B;  2Z1F A;  3K12 A;  4BVS A;  3S06 A;  2NMU A;  4ZHQ B;  3WPX A;  1JD1 A;  1FNJ A;  2KTU A;  4YJ2 A;  3M4S A;  3G71 F;  1IV3 A;  4O2B B;  4ZHV A;  3JAW A;  1SA0 A;  3L7Q A;  4LNU B;  3JAT B;  1W40 A;  1TUB A;  3P0Z A;  4EI8 A;  4NUT A;  3T80 A;  4E6E A;  1ONI A;  2VGN A;  3JAS A;  2LBW A;  3MDO A;  1RQ2 A;  4FFB A;  4TV8 A;  5AVM A;  2BTO A;  1YJN F;  3HJW C;  2OZB A;  5LXT A;  2VAM A;  3HTN A;  2F9Z C;  3DDN A;  2UYP A;  5KMG A;  4G88 A;  5EZY A;  1Q82 H;  4RHA A;  3HKE A;  1H47 A;  5IT9 M;  5LOV B;  3CYP B;  1CN7 A;  3UT5 A;  3WGM A;  1Z5W A;  1IV4 A;  4WBN B;  2YXZ A;  3F6M A;  3JAL B;  2ZVY A;  3QUW A;  5HY1 A;  1UI9 A;  4XCQ A;  4ZHY B;  3NVI B;  3S0W A;  5HP8 A;  5IJ0 B;  1H48 A;  1VQ7 F;  2CZW A;  4O4I B;  4IIJ B;  1QVF F;  1X7P A;  2CVL A;  3E1Y A;  4I4T B;  1W5B A;  3AGK A;  5EIB C;  5CB4 A;  5JH7 B;  2GZL A;  4R40 B;  2I6D A;  3KJK A;  2LCA A;  1DT9 A;  3CME F;  5G4V C;  5JQG B;  1GO1 A;  1W3E X;  3CCM F;  1K73 H;  3KJJ A;  2KGW A;  5C8Y B;  3CG6 A;  1S72 F;  5LYJ B;  1W5F A;  2UZH A;  4O2A A;  5GIN C;  1Q7Y H;  3JCM M;  4BT3 A;  1R1M A;  4B46 A;  3ZOP A;  3WXM B;  1TVK A;  3GYQ A;  3VCZ A;  4DXD A;  3C9R A;  1GO0 A;  3N2G B;  1VQ9 F;  2ZOD A;  3V7Q A;  3RYC B;  2Z01 A;  2HS4 A;  4X3M A;  3MCQ A;  2CSL A;  4O4H A;  5EYP B;  1W41 A;  5ITZ B;  3RA6 A;  5GON A;  4I50 A;  4EB6 A;  4G4W A;  1YJ9 F;  1VQ5 F;  2Z1T A;  1NQ3 A;  5BMV B;  5LP6 B;  2FGY A;  2ZVZ A;  5CA0 A;  2L26 A;  3QHD A;  5A2Q M;  3D00 A;  2OTM A;  4U3J A;  4O4J A;  5IYZ B;  4ZOL A;  2QI2 A;  1U3P A;  4BW0 B;  5GAN K;  3KHN A;  1TUB B;  2V9Y A;  3WGL A;  3CCS F;  2ZF8 A;  4U39 A;  1XHO A;  4X1K B;  3TD4 A;  4ZI7 A;  3CD6 F;  1IV1 A;  4FFB B;  4KWE A;  4TV8 B;  3CCU F;  1W5E A;  1SDS A;  2HRU A;  4M8I A;  5LP6 C;  3P4E A;  4TV9 A;  2AMT A;  5JVD A;  5LXT B;  3CPQ A;  3HAX D;  4C8E A;  2CHS A;  1QAH A;  3D01 A;  3HKE B;  5IJ9 A;  2JNB A;  3ON1 A;  5CA1 B;  1J7H A;  4X1Y A;  2W8B C;  3UT5 B;  2ZOV A;  2DT4 A;  1X25 A;  1FFX A;  3GHZ A;  1W42 A;  1GZ0 A;  1KNJ A;  1U43 A;  2UYK A;  2R6R 1;  3E22 A;  4G4V A;  1W55 A;  5B8F A;  1VK3 A;  2GLZ A;  1M1K H;  3LWV C;  5J2T A;  1U40 A;  2UYN A;  4TZZ A;  4X3L A;  3NVK E;  1VQL F;  5EAZ A;  3FD6 A;  5EWR A;  4C82 A;  5CB4 B;  2MQE A;  5FNV A;  1E7K A;  1YIT F;  3OBY A;  3FPI A;  1VH8 A;  3ERN A;  2R75 1;  1VQP F;  3RA5 A;  2BTU A;  1UFY A;  3NMU C;  1VQ8 F;  3CCJ F;  4O4L B;  3WJP A;  4O2A B;  2FC3 A;  3N2K A;  3I56 F;  5HXZ A;  5JCO A;  5EO3 A;  1CLI A;  3I7T A;  3M1X A;  4X1I B;  3CC4 F;  3WGJ A;  2HP3 A;  1JJ2 F;  3HKC B;  3PAF A;  3F0F A;  4BT5 A;  1NJI H;  3HKB B;  5FLX M;  4YJ3 A;  5MN6 A;  2ZAU A;  2B33 A;  3RYF A;  3OW2 F;  1IPA A;  4NWO B;  1W5A A;  2ALE A;  1YGY A;  3WPW A;  3BYQ A;  1U3L A;  5LA6 A;  3IKE A;  2CW4 A;  2K1S A;  4TUY A;  3HKD A;  2LBT A;  3JAK A;  5MN5 A;  4G4X A;  5CA0 B;  3GTZ A;  4F6R A;  1K9M H;  3IEQ A;  1OAP A;  3S0Y A;  1SZQ A;  1XRG A;  3OON A;  1Z5V A;  3M84 A;  4O4J B;  4U3J B;  3U0O A;  1VQK F;  1RQ7 A;  3LFO A;  3I3F A;  4IHJ B;  4LNU A;  5HP7 A;  3C8L A;  2Q1X A;  2IAF A;  2AIF A;  1JY8 A;  3B6N A;  3FFM A;  5G4U C;  1YHQ F;  5HWE A;  1ZWZ A;  4X20 B;  5KX5 A;  3RYH A;  1OFU A;  2RHH A;  4TV9 B;  5JVD B;  4DRX B;  3E20 B;  4HNA A;  1VQO F;  1Q8R A;  5EB0 A;  5IJ9 B;  4BVQ A;  4PWT A;  5LOV A;  4NQ3 A;  4X1Y B;  4ZHW A;  2N48 A;  2HP0 A;  3ZP7 A;  2HS3 A;  2CHT A;  4C8G A;  1FFX B;  4WBN A;  3OBW A;  2DYY A;  3VIU A;  2I6R A;  3JAL A;  1YJW F;  2KTV A;  2OTJ F;  5IJ0 A;  4YJ2 B;  2RHO A;  1QU9 A;  4IIJ A;  1XV2 A;  2UYN B;  3VI6 A;  3D54 A;  2H8C A;  3PLA C;  3JAW B;  1SA0 B;  4G4Z A;  2PMP A;  1W57 A;  2Q1Y A;  3K2X A;  2QEX F;  3CCV F;  3CMA F;  3CCR F;  5JH7 A;  1COM A;  3RE3 A;  2GVI A;  5FNV B;  3VYU C;  1W59 A;  1JFF A;  3ESJ A;  3VOA A;  3KE1 A;  5HY4 A;  3JAS B;  3LME A;  1YIJ F;  1XBI A;  5JQG A;  3MBM A;  3VMF B;  1QVG F;  3S0H A;  3N4Z A;  5KMG B;  3C9U A;  5HY2 A;  5EB1 B;  1CK2 A;  5EZY B;  5LYJ A;  4BT4 A;  1K8A H;  3N2K B;  3J81 M;  1H7M A;  2HQS C;  4I55 A;  4EI9 A;  2EWC A;  2BTQ B;  3N2G A;  2H8E A;  3R0P A;  3FD5 A;  4C4W C;  1VQV A;  3O85 A;  3MQW A;  4YJ3 B;  4BT6 A;  1T0A A;  3I55 F;  3RYF B;  3P10 A;  3WJQ A;  1FSZ A;  5EYP A;  3JAR A;  3IEW A;  3IKF A;  4BVR A;  3V7E A;  1DBF A;  5EIB D;  2UYJ A;  3NK7 A;  2HVY D;  1W58 1;  5LA6 B;  2P6Y A;  1YQN A;  2HX0 A;  4B62 A;  3CXC F;  1IV2 A;  3ZP4 A;  4BT2 A;  3LWP C;  3WGK A;  3CPW F;  1ODE A;  2CWJ A;  3SIV A;  3VTI C;  1FNK A;  5IYZ A;  3VOB A;  4BT7 A;  1VHA A;  3KIZ A;  3JVH A;  1TVK B;  1KD1 H;  3J7A R;  4X1K A;  5KX5 B;  3S02 A;  3RYH B;  3HWU A;  1JN1 A;  3RYI A;  1Q81 H;  3F0E A;  3C9S A;  2OTL F;  4HNA B;  3FBA A;  4O4H B;  4LCK A;  5CA1 A;  3VO8 A;  3Q8H A;  5GON B;  4I50 B;  4EI7 A;  4EB6 B;  5J2U A;  1KQS F;  2IG8 A; 
#chains in the Genus database with same CATH homology
 3R0P A;  1COM A;  3M4S A;  2CSL A;  1FNK A;  1XHO A;  3GTZ A;  2UYN A;  3MQW A;  3L7Q A;  3I7T A;  3LME A;  2CWJ A;  3KJJ A;  3M1X A;  3QUW A;  1UI9 A;  1XRG A;  5HP8 A;  1NQ3 A;  3ZP7 A;  2CHT A;  3V4D A;  1DBF A;  1ONI A;  2CHS A;  2DYY A;  1QAH A;  2UYJ A;  3ZOP A;  3D01 A;  3I3F A;  4ZK7 A;  2CVL A;  5HP7 A;  3VCZ A;  1J7H A;  2B33 A;  3K0T A;  1PF5 A;  2OTM A;  1ODE A;  1X25 A;  4NWO B;  2UYP A;  1QU9 A;  3LYB A;  3ZO8 A;  2UYN B;  1UFY A;  3ZP4 A;  3K12 A;  2UYK A;  3KJK A;  2CW4 A;  1JD1 A;  2EWC A;  1QD9 A;  1FNJ A;  2IG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...