1DBFA

Chorismate mutase from bacillus subtilis at 1.30 angstrom
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
127
structure length
127
Chain Sequence
b'MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVLRPDLSLTKNTEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CHORISMATE MUTASE)
molecule tags Isomerase
source organism Bacillus subtilis
publication title The 1.30 A resolution structure of the Bacillus subtilis chorismate mutase catalytic homotrimer.
pubmed doi rcsb
total genus 34
structure length 127
sequence length 127
chains with identical sequence B, C
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 1999-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1dbfA00
3ZP4A 1FNKA 3M4SA 1XRGA 4NWOB 2CWJA 2CHSA 1DBFA 1PF5A 3MQWA 2CVLA 2CSLA 1NQ3A 2UYNA 1J7HA 3R0PA 3V4DA 2B33A 2DYYA 5HP8A 3K0TA 2OTMA 1JD1A 3KJJA 1X25A 1COMA 3ZOPA 2IG8A 3I3FA 1QD9A 1UI9A 1QU9A 3KJKA 2UYJA 3M1XA 5HP7A 1XHOA 3L7QA 3I7TA 3LMEA 3VCZA 3ZP7A 2CHTA 2EWCA 3K12A 1QAHA 1FNJA 3D01A 2UYNB 3GTZA 1UFYA 2UYKA 1ONIA 1ODEA 3ZO8A 4ZK7A 3QUWA 2UYPA 3LYBA 2CW4A
chains in the Genus database with same CATH superfamily
4DXDA 3HKEB 5GIPC 5C8YA 4F6RA 2OTJF 3UT5A 5CB4B 5LYJB 1YI2F 3MCQA 2LBTA 3FPIA 3V4DA 2B33A 4TV8A 2I6DA 5BMVA 5KX5B 4X1IA 1X25A 3JCMM 2IG8A 3ERNA 1W5AA 4O4IA 3SIVA 1RLGA 3M1XA 2AMTA 2HP0B 3HTNA 4LNUA 3RYIA 5CA1B 5IT9M 2FGYA 1VQMF 2QTPA 5JCOC 3LDTA 1JFFB 2OTLF 3ZP7A 1QVGF 3VTIC 5HWEA 3D54A 4U3JA 5EB1B 1K8AH 1U3PA 4G4ZA 1PF5A 3E20B 5IYZB 1KNJA 3QHDA 1VH8A 2ZAUA 5JVDA 3WGMA 2MQEA 4BT3A 3CB2A 5FLXM 1IPAA 2OTMA 1JD1A 5DCVA 5IYZA 3SIUA 1CK2A 5JVDB 3HJWC 4NUTA 2HQSC 4BY9D 2HP3A 5FNVB 4YJ3A 2IAFA 4X3MA 3T80A 1GX1A 3S02A 3LWOC 1SA0A 5LOVA 3OBWA 2L26A 1VQ9F 3J81M 4NWOB 1YGYA 3JASB 4U3JB 2CVLA 1NQ3A 2UYNA 4ZHQA 4X3LA 3FFMA 4HNAB 4NQ3A 4YJ2B 1E7KA 1QVFF 1W5EA 3OONA 1SZQA 5MN4A 3WPXA 3VOBA 2EWCA 3V7EA 2RB9A 3RA5A 2HX0A 1VQ6F 3CYPB 4WBNA 3ELCA 2CW4A 3I3FA 1FNKA 4O2AA 1S72F 1W42A 3CPQA 1W3EX 4G4VA 1RA4A 2AIFA 3G71F 1KNKA 4O4JB 3WPWA 1FFXA 4I4TB 4B46A 3K0TA 2F9ZC 5LP6C 4X20B 4EI9A 4ZHWA 1NMUB 2PHNA 3C8LA 2H8EA 2PMPA 3N2GB 4WBNB 2JNBA 1Q7YH 2OHWA 3VCZA 2V9YA 1W40A 2RHLA 2H6LA 4O2AB 1FNJA 2Z1EA 3E22B 3D01A 4ZHYB 2UYKA 4X1KB 1ODEA 3C9RA 3VI6A 3QUWA 3ZO8A 3CCUF 1RQ7A 5GONB 3Q8HA 4EB6A 3VIUA 3RYCB 3RE3A 3G4SF 3BYQA 3K2XA 3N4YA 2QEXF 4EI7A 3IKFA 4I55A 3NK6A 1VQ5F 5EIBC 1Q8RA 1QD9A 1YQNA 1GO1A 5EIBD 4LNUB 5CA1A 2LBWA 2K1SA 4X1YA 3S06A 5IJ9B 3HWUA 3RA6A 3J7AR 4FFBA 4TUYB 1KQSF 3LWVC 2HP0A 3RYIB 2ZVZA 3ZP4A 2RHHA 4HNAA 4YJ2A 3RYFB 2BTUA 3CC2F 1VQPF 3JAKA 3IEWA 1K73H 1TUBB 3CCEF 1Q81H 3CD6F 3C9SA 4DRXA 4ZHVA 2YYEA 3VYUC 3IMPA 4I55B 3CPWF 3N2KA 3HKDB 3LMEA 3JAMM 4O4JA 4FFBB 3VO8A 3MCAB 2QI2A 3CC7F 3JATA 1YJNF 4B45A 2HRUA 1T0AA 2IQQA 1YIJF 1RLUA 5HY1A 2CHSA 1YJ9F 4TV8B 5B8FA 5HXZA 4XCQA 4C81A 1FSZA 4R40B 3TD4A 2R751 3CCJF 1VK3A 2Z1UA 3DDNA 5LA6B 4O4IB 3E1YA 3K14A 3JALB 3NK7A 4RQOA 3KJJA 4C4WC 3AGKA 3S0HA 1W5FA 4LCKA 1Z5VA 3WGNA 1YJWF 1GO0A 5HXUA 4ZOLB 5EZYB 1QAHA 4C8GA 4O2BB 4E6EA 4TV9B 4BT5A 2BTQB 3LWRC 4G4WA 3GHZA 3HKCB 3CYQA 3O85A 2BTOA 5EYPB 1J7HA 2R6R1 3MDOA 2I6RA 3WXMB 3C9TA 2ZOVA 4IHJB 3FBAA 3RYFA 5HY4A 2Z1FA 1IV3A 2OZBA 2Q1XA 1NJIH 1TUBA 2KTUA 3EORA 1W55A 2CHTA 5EO3A 3GTZA 4BVSA 1JY8A 5ITZB 2GVIA 3D00A 2BO1A 5EYPA 5JH7B 1DBFA 1KC8H 1T0KB 3S0WA 5GAPK 3HKCA 1VQVA 3PAFA 1Q86H 3WGKA 3R0PA 3F6MA 3V3TA 1IV2A 3ZOPA 4BT6A 1XBIA 1W2BF 5A2QM 1VQ7F 2GZLA 3PLAC 1DT9A 2P6YA 3C9UA 4BT7A 3P0ZA 5GANK 5JQGA 2RHOA 4U39A 5GIOC 3CCQF 1ZWZA 3TD5A 3ON1A 5CB4A 4G88A 4ZOLA 1Q82H 2Z1TA 4X20A 1H48A 5MN5A 3OBYA 1W59A 4YJ3B 4I50B 1YITF 3IR9A 4ZHQB 3NVIB 1W581 3JASA 1VQKF 1M1KH 3MBMA 3I55F 5JCOA 3WGJA 5CA0B 1W41A 2HRYA 3IEQA 3QTYA 5JQGB 3LFOA 4BW0B 2KGWA 5KMGA 5GINC 2VGNA 1U40A 3F0FA 2Q1YA 1JN1A 2YXZA 2LCAA 2HS0A 5IJ0A 5LXTB 1VQNF 5JH7A 1W5BA 3FD6A 1TVKB 4F6RB 2DYYA 5C8YB 3CMEF 5FJ4C 3KHNA 4X1YB 3VMFB 1IV1A 1UI9A 3FD5A 3ESJA 3L7QA 2KG4A 3I7TA 5ITZA 1X52A 5HY2A 1SA0B 4C8EA 1ONIA 4O4HA 1CLIA 4G4XA 1VQ8F 2ZVYA 4RHAA 5HY0A 3S0YA 3J80M 2UYPA 1CN7A 1OFUA 5LOVB 3NVKE 3GYQA 2WALA 2AIZP 3JARA 3N2GA 5G4VC 2FC3A 4ZI7A 5LP6B 1H47A 3F0GA 1R1MA 2GLZA 1X7OA 1N8RH 3TD3A 1M90H 3CCRF 3CCSF 3KJKA 4O4HB 5GONA 3I56F 2ZODA 1XV2A 1VQ4F 1FFXB 4I4TA 3RYCA 2H8CA 2VAPA 2RHJA 1U3LA 4O4LB 3LYBA 3M4SA 3NMUC 3B6NA 4BVQA 1VQOF 5LP6A 3IKEA 4B5CA 1K9MH 2W8BC 3N4ZA 4X1KA 5LXTA 5LYJA 3UT5B 4O2BA 2ALEA 3HKDA 3P4EA 1TVKA 3VYSC 5BMVB 2UYJA 3OW2F 5KMGB 3V7QA 4O4LA 3U0OA 4BVRA 2G9IA 3JATB 3KIZA 5MN6A 4BT2A 4DRXB 2ZF8A 4EI8A 3JVHA 1JFFA 4I50A 4C82A 3CCVF 4IIJB 1GZ0A 2HS3A 2VAWA 3RYHA 5J2TA 3P10A 1RQ2A 3LWPC 3JALA 4M8IA 5FNVA 1QU9A 1X7PA 3JAKB 5HP7A 3CCLF 4ZI7B 2VAMA 2VGMA 4X1IB 4ERHA 3HAXD 1W57A 3K12A 1OAPA 3JARB 2N48A 4BVTA 5J2UB 1YHQF 2LBXA 5EAZA 1JJ2F 3M84A 3MQWA 3VOAA 4C8IA 2HS4A 2CSLA 2DT4A 3WJPA 3CMAF 3RYHB 4B62A 3VYTC 3JAWB 3N2KB 4EB6B 5J2TB 2QA4F 4IIJA 5HP8A 1VHAA 2UZHA 3E22A 4TZZA 1Z5WA 3KE1A 1XHOA 5J2UA 3JAWA 3S03A 5G4UC 2Z01A 3CC4F 3F0DA 1PXWA 4BT4A 3CCMF 5IJ9A 5EWRA 1UFYA 1H7MA 3WJRA 4ZK7A 3HKEA 3HKBB 5LA6A 4TUYA 4IHJA 1XRGA 5AVMA 2CWJA 2NMUA 4KWEA 4PWTA 5EZYA 2HVYD 4G4YA 1VQLF 5CA0A 2CZWA 3DC2A 3CXCF 3LWQC 1COMA 1SDSA 1U43A 1KD1H 3F0EA 5KX5A 3G6EF 5EB0A 3WGLA 3HKBA 3WJQA 3CG6A 1IV4A 2UYNB 5IJ0B 2KTVA 2VXYA 4TV9A
chains in the Genus database with same CATH topology
3ZP4A 1FNKA 3M4SA 1XRGA 4NWOB 2CWJA 2CHSA 1DBFA 1PF5A 3MQWA 2CVLA 2CSLA 1NQ3A 2UYNA 1J7HA 3R0PA 3V4DA 2B33A 2DYYA 5HP8A 3K0TA 2OTMA 1JD1A 3KJJA 1X25A 1COMA 3ZOPA 2IG8A 3I3FA 1QD9A 1UI9A 1QU9A 3KJKA 2UYJA 3M1XA 5HP7A 1XHOA 3L7QA 3I7TA 3LMEA 3VCZA 3ZP7A 2CHTA 2EWCA 3K12A 1QAHA 1FNJA 3D01A 2UYNB 3GTZA 1UFYA 2UYKA 1ONIA 1ODEA 3ZO8A 4ZK7A 3QUWA 2UYPA 3LYBA 2CW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZP4 A;  1FNK A;  3M4S A;  1XRG A;  4NWO B;  2CWJ A;  2CHS A;  1DBF A;  1PF5 A;  3MQW A;  2CVL A;  2CSL A;  1NQ3 A;  2UYN A;  1J7H A;  3R0P A;  3V4D A;  2B33 A;  2DYY A;  5HP8 A;  3K0T A;  2OTM A;  1JD1 A;  3KJJ A;  1X25 A;  1COM A;  3ZOP A;  2IG8 A;  3I3F A;  1QD9 A;  1UI9 A;  1QU9 A;  3KJK A;  2UYJ A;  3M1X A;  5HP7 A;  1XHO A;  3L7Q A;  3I7T A;  3LME A;  3VCZ A;  3ZP7 A;  2CHT A;  2EWC A;  3K12 A;  1QAH A;  1FNJ A;  3D01 A;  2UYN B;  3GTZ A;  1UFY A;  2UYK A;  1ONI A;  1ODE A;  3ZO8 A;  4ZK7 A;  3QUW A;  2UYP A;  3LYB A;  2CW4 A; 
#chains in the Genus database with same CATH topology
 4DXD A;  3HKE B;  5GIP C;  5C8Y A;  4F6R A;  2OTJ F;  3UT5 A;  5CB4 B;  5LYJ B;  1YI2 F;  3MCQ A;  2LBT A;  3FPI A;  3V4D A;  2B33 A;  4TV8 A;  2I6D A;  5BMV A;  5KX5 B;  4X1I A;  1X25 A;  3JCM M;  2IG8 A;  3ERN A;  1W5A A;  4O4I A;  3SIV A;  1RLG A;  3M1X A;  2AMT A;  2HP0 B;  3HTN A;  4LNU A;  3RYI A;  5CA1 B;  5IT9 M;  2FGY A;  1VQM F;  2QTP A;  5JCO C;  3LDT A;  1JFF B;  2OTL F;  3ZP7 A;  1QVG F;  3VTI C;  5HWE A;  3D54 A;  4U3J A;  5EB1 B;  1K8A H;  1U3P A;  4G4Z A;  1PF5 A;  3E20 B;  5IYZ B;  1KNJ A;  3QHD A;  1VH8 A;  2ZAU A;  5JVD A;  3WGM A;  2MQE A;  4BT3 A;  3CB2 A;  5FLX M;  1IPA A;  2OTM A;  1JD1 A;  5DCV A;  5IYZ A;  3SIU A;  1CK2 A;  5JVD B;  3HJW C;  4NUT A;  2HQS C;  4BY9 D;  2HP3 A;  5FNV B;  4YJ3 A;  2IAF A;  4X3M A;  3T80 A;  1GX1 A;  3S02 A;  3LWO C;  1SA0 A;  5LOV A;  3OBW A;  2L26 A;  1VQ9 F;  3J81 M;  4NWO B;  1YGY A;  3JAS B;  4U3J B;  2CVL A;  1NQ3 A;  2UYN A;  4ZHQ A;  4X3L A;  3FFM A;  4HNA B;  4NQ3 A;  4YJ2 B;  1E7K A;  1QVF F;  1W5E A;  3OON A;  1SZQ A;  5MN4 A;  3WPX A;  3VOB A;  2EWC A;  3V7E A;  2RB9 A;  3RA5 A;  2HX0 A;  1VQ6 F;  3CYP B;  4WBN A;  3ELC A;  2CW4 A;  3I3F A;  1FNK A;  4O2A A;  1S72 F;  1W42 A;  3CPQ A;  1W3E X;  4G4V A;  1RA4 A;  2AIF A;  3G71 F;  1KNK A;  4O4J B;  3WPW A;  1FFX A;  4I4T B;  4B46 A;  3K0T A;  2F9Z C;  5LP6 C;  4X20 B;  4EI9 A;  4ZHW A;  1NMU B;  2PHN A;  3C8L A;  2H8E A;  2PMP A;  3N2G B;  4WBN B;  2JNB A;  1Q7Y H;  2OHW A;  3VCZ A;  2V9Y A;  1W40 A;  2RHL A;  2H6L A;  4O2A B;  1FNJ A;  2Z1E A;  3E22 B;  3D01 A;  4ZHY B;  2UYK A;  4X1K B;  1ODE A;  3C9R A;  3VI6 A;  3QUW A;  3ZO8 A;  3CCU F;  1RQ7 A;  5GON B;  3Q8H A;  4EB6 A;  3VIU A;  3RYC B;  3RE3 A;  3G4S F;  3BYQ A;  3K2X A;  3N4Y A;  2QEX F;  4EI7 A;  3IKF A;  4I55 A;  3NK6 A;  1VQ5 F;  5EIB C;  1Q8R A;  1QD9 A;  1YQN A;  1GO1 A;  5EIB D;  4LNU B;  5CA1 A;  2LBW A;  2K1S A;  4X1Y A;  3S06 A;  5IJ9 B;  3HWU A;  3RA6 A;  3J7A R;  4FFB A;  4TUY B;  1KQS F;  3LWV C;  2HP0 A;  3RYI B;  2ZVZ A;  3ZP4 A;  2RHH A;  4HNA A;  4YJ2 A;  3RYF B;  2BTU A;  3CC2 F;  1VQP F;  3JAK A;  3IEW A;  1K73 H;  1TUB B;  3CCE F;  1Q81 H;  3CD6 F;  3C9S A;  4DRX A;  4ZHV A;  2YYE A;  3VYU C;  3IMP A;  4I55 B;  3CPW F;  3N2K A;  3HKD B;  3LME A;  3JAM M;  4O4J A;  4FFB B;  3VO8 A;  3MCA B;  2QI2 A;  3CC7 F;  3JAT A;  1YJN F;  4B45 A;  2HRU A;  1T0A A;  2IQQ A;  1YIJ F;  1RLU A;  5HY1 A;  2CHS A;  1YJ9 F;  4TV8 B;  5B8F A;  5HXZ A;  4XCQ A;  4C81 A;  1FSZ A;  4R40 B;  3TD4 A;  2R75 1;  3CCJ F;  1VK3 A;  2Z1U A;  3DDN A;  5LA6 B;  4O4I B;  3E1Y A;  3K14 A;  3JAL B;  3NK7 A;  4RQO A;  3KJJ A;  4C4W C;  3AGK A;  3S0H A;  1W5F A;  4LCK A;  1Z5V A;  3WGN A;  1YJW F;  1GO0 A;  5HXU A;  4ZOL B;  5EZY B;  1QAH A;  4C8G A;  4O2B B;  4E6E A;  4TV9 B;  4BT5 A;  2BTQ B;  3LWR C;  4G4W A;  3GHZ A;  3HKC B;  3CYQ A;  3O85 A;  2BTO A;  5EYP B;  1J7H A;  2R6R 1;  3MDO A;  2I6R A;  3WXM B;  3C9T A;  2ZOV A;  4IHJ B;  3FBA A;  3RYF A;  5HY4 A;  2Z1F A;  1IV3 A;  2OZB A;  2Q1X A;  1NJI H;  1TUB A;  2KTU A;  3EOR A;  1W55 A;  2CHT A;  5EO3 A;  3GTZ A;  4BVS A;  1JY8 A;  5ITZ B;  2GVI A;  3D00 A;  2BO1 A;  5EYP A;  5JH7 B;  1DBF A;  1KC8 H;  1T0K B;  3S0W A;  5GAP K;  3HKC A;  1VQV A;  3PAF A;  1Q86 H;  3WGK A;  3R0P A;  3F6M A;  3V3T A;  1IV2 A;  3ZOP A;  4BT6 A;  1XBI A;  1W2B F;  5A2Q M;  1VQ7 F;  2GZL A;  3PLA C;  1DT9 A;  2P6Y A;  3C9U A;  4BT7 A;  3P0Z A;  5GAN K;  5JQG A;  2RHO A;  4U39 A;  5GIO C;  3CCQ F;  1ZWZ A;  3TD5 A;  3ON1 A;  5CB4 A;  4G88 A;  4ZOL A;  1Q82 H;  2Z1T A;  4X20 A;  1H48 A;  5MN5 A;  3OBY A;  1W59 A;  4YJ3 B;  4I50 B;  1YIT F;  3IR9 A;  4ZHQ B;  3NVI B;  1W58 1;  3JAS A;  1VQK F;  1M1K H;  3MBM A;  3I55 F;  5JCO A;  3WGJ A;  5CA0 B;  1W41 A;  2HRY A;  3IEQ A;  3QTY A;  5JQG B;  3LFO A;  4BW0 B;  2KGW A;  5KMG A;  5GIN C;  2VGN A;  1U40 A;  3F0F A;  2Q1Y A;  1JN1 A;  2YXZ A;  2LCA A;  2HS0 A;  5IJ0 A;  5LXT B;  1VQN F;  5JH7 A;  1W5B A;  3FD6 A;  1TVK B;  4F6R B;  2DYY A;  5C8Y B;  3CME F;  5FJ4 C;  3KHN A;  4X1Y B;  3VMF B;  1IV1 A;  1UI9 A;  3FD5 A;  3ESJ A;  3L7Q A;  2KG4 A;  3I7T A;  5ITZ A;  1X52 A;  5HY2 A;  1SA0 B;  4C8E A;  1ONI A;  4O4H A;  1CLI A;  4G4X A;  1VQ8 F;  2ZVY A;  4RHA A;  5HY0 A;  3S0Y A;  3J80 M;  2UYP A;  1CN7 A;  1OFU A;  5LOV B;  3NVK E;  3GYQ A;  2WAL A;  2AIZ P;  3JAR A;  3N2G A;  5G4V C;  2FC3 A;  4ZI7 A;  5LP6 B;  1H47 A;  3F0G A;  1R1M A;  2GLZ A;  1X7O A;  1N8R H;  3TD3 A;  1M90 H;  3CCR F;  3CCS F;  3KJK A;  4O4H B;  5GON A;  3I56 F;  2ZOD A;  1XV2 A;  1VQ4 F;  1FFX B;  4I4T A;  3RYC A;  2H8C A;  2VAP A;  2RHJ A;  1U3L A;  4O4L B;  3LYB A;  3M4S A;  3NMU C;  3B6N A;  4BVQ A;  1VQO F;  5LP6 A;  3IKE A;  4B5C A;  1K9M H;  2W8B C;  3N4Z A;  4X1K A;  5LXT A;  5LYJ A;  3UT5 B;  4O2B A;  2ALE A;  3HKD A;  3P4E A;  1TVK A;  3VYS C;  5BMV B;  2UYJ A;  3OW2 F;  5KMG B;  3V7Q A;  4O4L A;  3U0O A;  4BVR A;  2G9I A;  3JAT B;  3KIZ A;  5MN6 A;  4BT2 A;  4DRX B;  2ZF8 A;  4EI8 A;  3JVH A;  1JFF A;  4I50 A;  4C82 A;  3CCV F;  4IIJ B;  1GZ0 A;  2HS3 A;  2VAW A;  3RYH A;  5J2T A;  3P10 A;  1RQ2 A;  3LWP C;  3JAL A;  4M8I A;  5FNV A;  1QU9 A;  1X7P A;  3JAK B;  5HP7 A;  3CCL F;  4ZI7 B;  2VAM A;  2VGM A;  4X1I B;  4ERH A;  3HAX D;  1W57 A;  3K12 A;  1OAP A;  3JAR B;  2N48 A;  4BVT A;  5J2U B;  1YHQ F;  2LBX A;  5EAZ A;  1JJ2 F;  3M84 A;  3MQW A;  3VOA A;  4C8I A;  2HS4 A;  2CSL A;  2DT4 A;  3WJP A;  3CMA F;  3RYH B;  4B62 A;  3VYT C;  3JAW B;  3N2K B;  4EB6 B;  5J2T B;  2QA4 F;  4IIJ A;  5HP8 A;  1VHA A;  2UZH A;  3E22 A;  4TZZ A;  1Z5W A;  3KE1 A;  1XHO A;  5J2U A;  3JAW A;  3S03 A;  5G4U C;  2Z01 A;  3CC4 F;  3F0D A;  1PXW A;  4BT4 A;  3CCM F;  5IJ9 A;  5EWR A;  1UFY A;  1H7M A;  3WJR A;  4ZK7 A;  3HKE A;  3HKB B;  5LA6 A;  4TUY A;  4IHJ A;  1XRG A;  5AVM A;  2CWJ A;  2NMU A;  4KWE A;  4PWT A;  5EZY A;  2HVY D;  4G4Y A;  1VQL F;  5CA0 A;  2CZW A;  3DC2 A;  3CXC F;  3LWQ C;  1COM A;  1SDS A;  1U43 A;  1KD1 H;  3F0E A;  5KX5 A;  3G6E F;  5EB0 A;  3WGL A;  3HKB A;  3WJQ A;  3CG6 A;  1IV4 A;  2UYN B;  5IJ0 B;  2KTV A;  2VXY A;  4TV9 A; 
#chains in the Genus database with same CATH homology
 3ZP4 A;  1FNK A;  3M4S A;  1XRG A;  4NWO B;  2CWJ A;  2CHS A;  1DBF A;  1PF5 A;  3MQW A;  2CVL A;  2CSL A;  1NQ3 A;  2UYN A;  1J7H A;  3R0P A;  3V4D A;  2B33 A;  2DYY A;  5HP8 A;  3K0T A;  2OTM A;  1JD1 A;  3KJJ A;  1X25 A;  1COM A;  3ZOP A;  2IG8 A;  3I3F A;  1QD9 A;  1UI9 A;  1QU9 A;  3KJK A;  2UYJ A;  3M1X A;  5HP7 A;  1XHO A;  3L7Q A;  3I7T A;  3LME A;  3VCZ A;  3ZP7 A;  2CHT A;  2EWC A;  3K12 A;  1QAH A;  1FNJ A;  3D01 A;  2UYN B;  3GTZ A;  1UFY A;  2UYK A;  1ONI A;  1ODE A;  3ZO8 A;  4ZK7 A;  3QUW A;  2UYP A;  3LYB A;  2CW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...