3M1XA

Crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica, rhomobohedral form
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
126
structure length
125
Chain Sequence
SKLTVVASPLAPEAVGAYSQAIICNGVYCSGQIGLDRKTGDFAGKTIEEQSKQVMTNLKYVLEEAGSSMDKVVKTTCLLADIKDFGVFNGIYAEAFGNHKPARACFAAAALPKGALVEVECIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Endoribonuclease L-PSP
publication title Crystal structure of a putative endoribonuclease L-PSP from Entamoeba histolytica, rhomobohedral form
rcsb
source organism Entamoeba histolytica
molecule tags Unknown function
total genus 36
structure length 125
sequence length 126
ec nomenclature
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3m1xA00
3ZOPA 1J7HA 1JD1A 1ONIA 3K12A 3I3FA 3L7QA 3LMEA 1NQ3A 1XRGA 3LYBA 1DBFA 1QD9A 3K0TA 3ZP4A 4NWOB 2UYJA 1UFYA 3QUWA 3ZP7A 3MQWA 2EWCA 2OTMA 2CW4A 3V4DA 1QU9A 3ZO8A 3M4SA 1FNJA 2UYNB 2UYKA 3D01A 1COMA 2CHSA 1PF5A 1UI9A 2B33A 1QAHA 3GTZA 1ODEA 5HP7A 3R0PA 3KJJA 1XHOA 1X25A 2CHTA 2UYNA 2DYYA 2UYPA 3I7TA 3VCZA 3M1XA 4ZK7A 3KJKA 1FNKA 2CVLA 2CWJA 2CSLA 2IG8A 5HP8A
chains in the Genus database with same CATH superfamily
4E6EA 1W581 2V9YA 1JD1A 5GAPK 5CA0A 5LYJB 2F9ZC 2RHOA 5JVDB 3CYPB 3K0TA 1K8AH 4IHJB 1U43A 2CZWA 3LWVC 4BVSA 2OTMA 1YIJF 3F0FA 5EO3A 4YJ3B 3N4ZA 4TUYA 4BVTA 1IPAA 2BTOA 4ZOLB 1CK2A 1XHOA 2VAPA 2ZOVA 1IV4A 3C9SA 4O4HB 2VAWA 1KC8H 3MCQA 2OTJF 3LWQC 5IYZB 3GHZA 3PLAC 3O85A 2OTLF 2NMUA 4YJ2B 1K73H 3D00A 2IQQA 3LWOC 5DCVA 3RYIA 4IHJA 3S06A 3VOAA 3JAKB 1COMA 1FFXB 3S02A 1VQLF 2GLZA 2GVIA 3Q8HA 5A2QM 4BT6A 3HKCA 3V7QA 5LOVA 2YXZA 5EYPA 3FPIA 3RYFB 2HQSC 1SDSA 3I55F 3E22B 5G4UC 3F0GA 1NMUB 4X1KA 5LXTB 4YJ2A 4I4TB 2UYNB 1U40A 1UI9A 2B33A 5HP7A 2MQEA 3JAKA 4O2AB 3KJJA 3T80A 5EZYB 4O4IA 1FFXA 3CG6A 5LA6B 3I7TA 1RA4A 2LBXA 3NK6A 4O2BA 3KJKA 1GO0A 5KX5B 5JH7B 2ZAUA 3K2XA 2L26A 4B45A 4BT2A 1IV2A 1GO1A 3P0ZA 4FFBA 3LMEA 3J81M 3RYFA 2W8BC 3VO8A 1UFYA 2Q1YA 5CB4A 1SA0B 3E22A 1KNKA 3CMEF 2Z1TA 5GONA 3C9RA 4O4JA 5FNVB 3JARB 5LXTA 2HRYA 5FJ4C 4I4TA 1VQOF 2CHTA 2Q1XA 3NVIB 1W40A 3GYQA 4O2AA 3CB2A 5EZYA 3HKEA 3WGKA 5MN4A 4I50B 1JN1A 1JFFA 5KX5A 3SIUA 3G6EF 5JCOA 5LP6A 1VQ8F 2YYEA 5EIBD 1VQVA 5CA1B 3ZP7A 1VH8A 2HS4A 5J2UB 3VYTC 1VQKF 2HS3A 1W57A 3ZO8A 3U0OA 1H7MA 1ODEA 1M1KH 3JARA 3F0EA 4IIJA 2JNBA 4EB6A 5EAZA 3HJWC 4NQ3A 1Q7YH 1NJIH 4O4LA 1IV1A 3IKEA 5GIOC 3D54A 2VGNA 5BMVA 3N2GA 2HP0A 1DT9A 3HKDB 4TV8B 3RYCA 1ONIA 3SIVA 1XRGA 1W55A 5HY0A 3HKBB 3G71F 1KNJA 4RHAA 3MQWA 1K9MH 1QVFF 4HNAB 3S0YA 3LDTA 5CA1A 4LNUA 3K14A 3F6MA 3OBYA 1FSZA 3GTZA 1Q8RA 2Z1EA 4C8GA 5HY2A 5JQGB 1FNKA 2KG4A 3ESJA 3CCEF 2FGYA 4TZZA 1U3LA 1W5AA 3CXCF 3LWRC 1VQ9F 3MDOA 1DBFA 1IV3A 1TVKB 4TV8A 4NWOB 4C8IA 3CCMF 1Q86H 1ZWZA 2PHNA 5LYJA 1QU9A 3HKBA 5JVDA 3CMAF 2BTUA 4HNAA 4BT3A 1VQMF 3VMFB 2R6R1 4YJ3A 2HX0A 4EI8A 2H8CA 2QTPA 1X7OA 1VQ4F 2I6DA 4G88A 1Q81H 2RHJA 4ZHWA 4BY9D 4ZOLA 4B5CA 5HWEA 5JQGA 5HP8A 4B62A 4B46A 4G4WA 5HY4A 5J2TB 4O4HA 5ITZB 3CPWF 3WXMB 3FD6A 5IYZA 2FC3A 1XV2A 1VQ7F 2EWCA 3ON1A 3V3TA 2QEXF 1QVGF 4ZHVA 3MBMA 5HY1A 1S72F 4G4YA 2QA4F 2CHSA 4ZHQB 4F6RB 1VQNF 4BVRA 3ERNA 3OONA 1VQ5F 3JATB 4C4WC 1W3EX 4WBNB 4X1YB 5KMGB 2AMTA 1CLIA 5GIPC 2ZVZA 3IEQA 3KHNA 1J7HA 3V7EA 4U3JB 5G4VC 3JALB 4NUTA 3CD6F 3N2KB 2K1SA 3QUWA 4RQOA 3HWUA 1W5BA 3G4SF 2ZVYA 5HXZA 3M4SA 3RYHB 3WGLA 3WGMA 1YJWF 1RLGA 1YQNA 2OZBA 2UYNA 2H6LA 2DYYA 3UT5B 3WPXA 2UYPA 4F6RA 3CCLF 2UZHA 4ZK7A 3B6NA 5IJ0B 5LA6A 2KTUA 2KTVA 5LP6C 4DRXB 3NK7A 2LBTA 3L7QA 5EB1B 4EI9A 1PXWA 1NQ3A 5JH7A 1YJ9F 5EIBC 1T0KB 2P6YA 3QTYA 5IJ9B 1X7PA 1W42A 1RLUA 2UYKA 1SA0A 3KE1A 3JAWB 4ERHA 3HAXD 3OW2F 3RYHA 5FNVA 4ZI7B 3VYUC 1YI2F 2IAFA 1Z5VA 3FBAA 5CA0B 2HVYD 3CCJF 2QI2A 2BO1A 3E20B 3LWPC 3I56F 2VAMA 2DT4A 1JJ2F 2AIFA 3VYSC 3OBWA 3N4YA 4I50A 2RB9A 2G9IA 1VQ6F 3V4DA 1T0AA 3FD5A 5IJ9A 5EB0A 4X3MA 2I6RA 3D01A 1YITF 4DXDA 5IT9M 4M8IA 5J2UA 3S0WA 1OAPA 2BTQB 3J80M 1W5EA 3TD3A 3EORA 2IG8A 3LYBA 3P10A 1XBIA 1TUBB 2OHWA 4BW0B 4BT7A 3RYIB 1CN7A 3ZP4A 3C9TA 2Z1FA 3HKDA 1H48A 3CC7F 3C9UA 4BVQA 2CW4A 1X52A 1YJNF 3HKCB 3WGJA 1QAHA 3WJQA 5LOVB 5EYPB 5MN6A 3QHDA 4BT4A 2ALEA 4G4VA 3RA6A 2HS0A 1Z5WA 2CVLA 1RQ7A 2H8EA 1VHAA 3JVHA 2WALA 3CPQA 1RQ2A 3C8LA 4X1KB 4C82A 3K12A 1SZQA 1QD9A 1KD1H 1E7KA 1TUBA 2HRUA 3BYQA 3P4EA 4TV9B 1YGYA 4C8EA 3CC4F 1W41A 4U39A 1TVKA 1W59A 1GZ0A 4O4IB 3J7AR 4G4ZA 1PF5A 2LCAA 4O2BB 1JY8A 3PAFA 2LBWA 5HXUA 3F0DA 3RA5A 3CCSF 3KIZA 3RE3A 3TD5A 5B8FA 3NVKE 4FFBB 1W5FA 1VQPF 4X20B 5GINC 2CSLA 3VIUA 3CCRF 1R1MA 3LFOA 2PMPA 1YHQF 5CB4B 3MCAB 4KWEA 3CCQF 3I3FA 3IR9A 3CCVF 3WGNA 5GONB 4O4JB 5MN5A 5J2TA 1OFUA 5ITZA 3VTIC 3CCUF 4TV9A 4R40B 1Q82H 5GANK 3S03A 2GZLA 2Z01A 2N48A 4X1IB 3VI6A 3HKEB 4EI7A 1X25A 3VCZA 4ZHQA 1JFFB 3M1XA 4BT5A 5LP6B 2CWJA 3JATA 3DC2A 3S0HA 4WBNA 4X1YA 5KMGA 1N8RH 4X20A 3FFMA 2VXYA 4X3LA 5JCOC 3TD4A 2Z1UA 2ZF8A 3WJRA 3CYQA 4U3JA 3JASB 3JALA 2AIZP 3N2KA 4IIJB 4EB6B 1FNJA 2HP3A 5C8YB 4O4LB 4I55B 2ZODA 3JAMM 3ELCA 5BMVB 3N2GB 2HP0B 3VOBA 4G4XA 2R751 4X1IA 3IKFA 1VK3A 3RYCB 4PWTA 1H47A 4LCKA 3UT5A 4ZHYB 3IMPA 3JCMM 3ZOPA 3DDNA 5FLXM 2KGWA 3M84A 5IJ0A 1U3PA 2RHLA 1W2BF 4LNUB 4C81A 2RHHA 1GX1A 2UYJA 4DRXA 4TUYB 5EWRA 3WPWA 3CC2F 3WJPA 3JASA 3E1YA 3NMUC 5C8YA 3R0PA 4XCQA 3AGKA 2VGMA 3HTNA 4I55A 3JAWA 5AVMA 1M90H 1KQSF 3IEWA 4ZI7A
chains in the Genus database with same CATH topology
3ZOPA 1J7HA 1JD1A 1ONIA 3K12A 3I3FA 3L7QA 3LMEA 1NQ3A 1XRGA 3LYBA 1DBFA 1QD9A 3K0TA 3ZP4A 4NWOB 2UYJA 1UFYA 3QUWA 3ZP7A 3MQWA 2EWCA 2OTMA 2CW4A 3V4DA 1QU9A 3ZO8A 3M4SA 1FNJA 2UYNB 2UYKA 3D01A 1COMA 2CHSA 1PF5A 1UI9A 2B33A 1QAHA 3GTZA 1ODEA 5HP7A 3R0PA 3KJJA 1XHOA 1X25A 2CHTA 2UYNA 2DYYA 2UYPA 3I7TA 3VCZA 3M1XA 4ZK7A 3KJKA 1FNKA 2CVLA 2CWJA 2CSLA 2IG8A 5HP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZOP A;  1J7H A;  1JD1 A;  1ONI A;  3K12 A;  3I3F A;  3L7Q A;  3LME A;  1NQ3 A;  1XRG A;  3LYB A;  1DBF A;  1QD9 A;  3K0T A;  3ZP4 A;  4NWO B;  2UYJ A;  1UFY A;  3QUW A;  3ZP7 A;  3MQW A;  2EWC A;  2OTM A;  2CW4 A;  3V4D A;  1QU9 A;  3ZO8 A;  3M4S A;  1FNJ A;  2UYN B;  2UYK A;  3D01 A;  1COM A;  2CHS A;  1PF5 A;  1UI9 A;  2B33 A;  1QAH A;  3GTZ A;  1ODE A;  5HP7 A;  3R0P A;  3KJJ A;  1XHO A;  1X25 A;  2CHT A;  2UYN A;  2DYY A;  2UYP A;  3I7T A;  3VCZ A;  3M1X A;  4ZK7 A;  3KJK A;  1FNK A;  2CVL A;  2CWJ A;  2CSL A;  2IG8 A;  5HP8 A; 
#chains in the Genus database with same CATH topology
 4E6E A;  1W58 1;  2V9Y A;  1JD1 A;  5GAP K;  5CA0 A;  5LYJ B;  2F9Z C;  2RHO A;  5JVD B;  3CYP B;  3K0T A;  1K8A H;  4IHJ B;  1U43 A;  2CZW A;  3LWV C;  4BVS A;  2OTM A;  1YIJ F;  3F0F A;  5EO3 A;  4YJ3 B;  3N4Z A;  4TUY A;  4BVT A;  1IPA A;  2BTO A;  4ZOL B;  1CK2 A;  1XHO A;  2VAP A;  2ZOV A;  1IV4 A;  3C9S A;  4O4H B;  2VAW A;  1KC8 H;  3MCQ A;  2OTJ F;  3LWQ C;  5IYZ B;  3GHZ A;  3PLA C;  3O85 A;  2OTL F;  2NMU A;  4YJ2 B;  1K73 H;  3D00 A;  2IQQ A;  3LWO C;  5DCV A;  3RYI A;  4IHJ A;  3S06 A;  3VOA A;  3JAK B;  1COM A;  1FFX B;  3S02 A;  1VQL F;  2GLZ A;  2GVI A;  3Q8H A;  5A2Q M;  4BT6 A;  3HKC A;  3V7Q A;  5LOV A;  2YXZ A;  5EYP A;  3FPI A;  3RYF B;  2HQS C;  1SDS A;  3I55 F;  3E22 B;  5G4U C;  3F0G A;  1NMU B;  4X1K A;  5LXT B;  4YJ2 A;  4I4T B;  2UYN B;  1U40 A;  1UI9 A;  2B33 A;  5HP7 A;  2MQE A;  3JAK A;  4O2A B;  3KJJ A;  3T80 A;  5EZY B;  4O4I A;  1FFX A;  3CG6 A;  5LA6 B;  3I7T A;  1RA4 A;  2LBX A;  3NK6 A;  4O2B A;  3KJK A;  1GO0 A;  5KX5 B;  5JH7 B;  2ZAU A;  3K2X A;  2L26 A;  4B45 A;  4BT2 A;  1IV2 A;  1GO1 A;  3P0Z A;  4FFB A;  3LME A;  3J81 M;  3RYF A;  2W8B C;  3VO8 A;  1UFY A;  2Q1Y A;  5CB4 A;  1SA0 B;  3E22 A;  1KNK A;  3CME F;  2Z1T A;  5GON A;  3C9R A;  4O4J A;  5FNV B;  3JAR B;  5LXT A;  2HRY A;  5FJ4 C;  4I4T A;  1VQO F;  2CHT A;  2Q1X A;  3NVI B;  1W40 A;  3GYQ A;  4O2A A;  3CB2 A;  5EZY A;  3HKE A;  3WGK A;  5MN4 A;  4I50 B;  1JN1 A;  1JFF A;  5KX5 A;  3SIU A;  3G6E F;  5JCO A;  5LP6 A;  1VQ8 F;  2YYE A;  5EIB D;  1VQV A;  5CA1 B;  3ZP7 A;  1VH8 A;  2HS4 A;  5J2U B;  3VYT C;  1VQK F;  2HS3 A;  1W57 A;  3ZO8 A;  3U0O A;  1H7M A;  1ODE A;  1M1K H;  3JAR A;  3F0E A;  4IIJ A;  2JNB A;  4EB6 A;  5EAZ A;  3HJW C;  4NQ3 A;  1Q7Y H;  1NJI H;  4O4L A;  1IV1 A;  3IKE A;  5GIO C;  3D54 A;  2VGN A;  5BMV A;  3N2G A;  2HP0 A;  1DT9 A;  3HKD B;  4TV8 B;  3RYC A;  1ONI A;  3SIV A;  1XRG A;  1W55 A;  5HY0 A;  3HKB B;  3G71 F;  1KNJ A;  4RHA A;  3MQW A;  1K9M H;  1QVF F;  4HNA B;  3S0Y A;  3LDT A;  5CA1 A;  4LNU A;  3K14 A;  3F6M A;  3OBY A;  1FSZ A;  3GTZ A;  1Q8R A;  2Z1E A;  4C8G A;  5HY2 A;  5JQG B;  1FNK A;  2KG4 A;  3ESJ A;  3CCE F;  2FGY A;  4TZZ A;  1U3L A;  1W5A A;  3CXC F;  3LWR C;  1VQ9 F;  3MDO A;  1DBF A;  1IV3 A;  1TVK B;  4TV8 A;  4NWO B;  4C8I A;  3CCM F;  1Q86 H;  1ZWZ A;  2PHN A;  5LYJ A;  1QU9 A;  3HKB A;  5JVD A;  3CMA F;  2BTU A;  4HNA A;  4BT3 A;  1VQM F;  3VMF B;  2R6R 1;  4YJ3 A;  2HX0 A;  4EI8 A;  2H8C A;  2QTP A;  1X7O A;  1VQ4 F;  2I6D A;  4G88 A;  1Q81 H;  2RHJ A;  4ZHW A;  4BY9 D;  4ZOL A;  4B5C A;  5HWE A;  5JQG A;  5HP8 A;  4B62 A;  4B46 A;  4G4W A;  5HY4 A;  5J2T B;  4O4H A;  5ITZ B;  3CPW F;  3WXM B;  3FD6 A;  5IYZ A;  2FC3 A;  1XV2 A;  1VQ7 F;  2EWC A;  3ON1 A;  3V3T A;  2QEX F;  1QVG F;  4ZHV A;  3MBM A;  5HY1 A;  1S72 F;  4G4Y A;  2QA4 F;  2CHS A;  4ZHQ B;  4F6R B;  1VQN F;  4BVR A;  3ERN A;  3OON A;  1VQ5 F;  3JAT B;  4C4W C;  1W3E X;  4WBN B;  4X1Y B;  5KMG B;  2AMT A;  1CLI A;  5GIP C;  2ZVZ A;  3IEQ A;  3KHN A;  1J7H A;  3V7E A;  4U3J B;  5G4V C;  3JAL B;  4NUT A;  3CD6 F;  3N2K B;  2K1S A;  3QUW A;  4RQO A;  3HWU A;  1W5B A;  3G4S F;  2ZVY A;  5HXZ A;  3M4S A;  3RYH B;  3WGL A;  3WGM A;  1YJW F;  1RLG A;  1YQN A;  2OZB A;  2UYN A;  2H6L A;  2DYY A;  3UT5 B;  3WPX A;  2UYP A;  4F6R A;  3CCL F;  2UZH A;  4ZK7 A;  3B6N A;  5IJ0 B;  5LA6 A;  2KTU A;  2KTV A;  5LP6 C;  4DRX B;  3NK7 A;  2LBT A;  3L7Q A;  5EB1 B;  4EI9 A;  1PXW A;  1NQ3 A;  5JH7 A;  1YJ9 F;  5EIB C;  1T0K B;  2P6Y A;  3QTY A;  5IJ9 B;  1X7P A;  1W42 A;  1RLU A;  2UYK A;  1SA0 A;  3KE1 A;  3JAW B;  4ERH A;  3HAX D;  3OW2 F;  3RYH A;  5FNV A;  4ZI7 B;  3VYU C;  1YI2 F;  2IAF A;  1Z5V A;  3FBA A;  5CA0 B;  2HVY D;  3CCJ F;  2QI2 A;  2BO1 A;  3E20 B;  3LWP C;  3I56 F;  2VAM A;  2DT4 A;  1JJ2 F;  2AIF A;  3VYS C;  3OBW A;  3N4Y A;  4I50 A;  2RB9 A;  2G9I A;  1VQ6 F;  3V4D A;  1T0A A;  3FD5 A;  5IJ9 A;  5EB0 A;  4X3M A;  2I6R A;  3D01 A;  1YIT F;  4DXD A;  5IT9 M;  4M8I A;  5J2U A;  3S0W A;  1OAP A;  2BTQ B;  3J80 M;  1W5E A;  3TD3 A;  3EOR A;  2IG8 A;  3LYB A;  3P10 A;  1XBI A;  1TUB B;  2OHW A;  4BW0 B;  4BT7 A;  3RYI B;  1CN7 A;  3ZP4 A;  3C9T A;  2Z1F A;  3HKD A;  1H48 A;  3CC7 F;  3C9U A;  4BVQ A;  2CW4 A;  1X52 A;  1YJN F;  3HKC B;  3WGJ A;  1QAH A;  3WJQ A;  5LOV B;  5EYP B;  5MN6 A;  3QHD A;  4BT4 A;  2ALE A;  4G4V A;  3RA6 A;  2HS0 A;  1Z5W A;  2CVL A;  1RQ7 A;  2H8E A;  1VHA A;  3JVH A;  2WAL A;  3CPQ A;  1RQ2 A;  3C8L A;  4X1K B;  4C82 A;  3K12 A;  1SZQ A;  1QD9 A;  1KD1 H;  1E7K A;  1TUB A;  2HRU A;  3BYQ A;  3P4E A;  4TV9 B;  1YGY A;  4C8E A;  3CC4 F;  1W41 A;  4U39 A;  1TVK A;  1W59 A;  1GZ0 A;  4O4I B;  3J7A R;  4G4Z A;  1PF5 A;  2LCA A;  4O2B B;  1JY8 A;  3PAF A;  2LBW A;  5HXU A;  3F0D A;  3RA5 A;  3CCS F;  3KIZ A;  3RE3 A;  3TD5 A;  5B8F A;  3NVK E;  4FFB B;  1W5F A;  1VQP F;  4X20 B;  5GIN C;  2CSL A;  3VIU A;  3CCR F;  1R1M A;  3LFO A;  2PMP A;  1YHQ F;  5CB4 B;  3MCA B;  4KWE A;  3CCQ F;  3I3F A;  3IR9 A;  3CCV F;  3WGN A;  5GON B;  4O4J B;  5MN5 A;  5J2T A;  1OFU A;  5ITZ A;  3VTI C;  3CCU F;  4TV9 A;  4R40 B;  1Q82 H;  5GAN K;  3S03 A;  2GZL A;  2Z01 A;  2N48 A;  4X1I B;  3VI6 A;  3HKE B;  4EI7 A;  1X25 A;  3VCZ A;  4ZHQ A;  1JFF B;  3M1X A;  4BT5 A;  5LP6 B;  2CWJ A;  3JAT A;  3DC2 A;  3S0H A;  4WBN A;  4X1Y A;  5KMG A;  1N8R H;  4X20 A;  3FFM A;  2VXY A;  4X3L A;  5JCO C;  3TD4 A;  2Z1U A;  2ZF8 A;  3WJR A;  3CYQ A;  4U3J A;  3JAS B;  3JAL A;  2AIZ P;  3N2K A;  4IIJ B;  4EB6 B;  1FNJ A;  2HP3 A;  5C8Y B;  4O4L B;  4I55 B;  2ZOD A;  3JAM M;  3ELC A;  5BMV B;  3N2G B;  2HP0 B;  3VOB A;  4G4X A;  2R75 1;  4X1I A;  3IKF A;  1VK3 A;  3RYC B;  4PWT A;  1H47 A;  4LCK A;  3UT5 A;  4ZHY B;  3IMP A;  3JCM M;  3ZOP A;  3DDN A;  5FLX M;  2KGW A;  3M84 A;  5IJ0 A;  1U3P A;  2RHL A;  1W2B F;  4LNU B;  4C81 A;  2RHH A;  1GX1 A;  2UYJ A;  4DRX A;  4TUY B;  5EWR A;  3WPW A;  3CC2 F;  3WJP A;  3JAS A;  3E1Y A;  3NMU C;  5C8Y A;  3R0P A;  4XCQ A;  3AGK A;  2VGM A;  3HTN A;  4I55 A;  3JAW A;  5AVM A;  1M90 H;  1KQS F;  3IEW A;  4ZI7 A; 
#chains in the Genus database with same CATH homology
 3ZOP A;  1J7H A;  1JD1 A;  1ONI A;  3K12 A;  3I3F A;  3L7Q A;  3LME A;  1NQ3 A;  1XRG A;  3LYB A;  1DBF A;  1QD9 A;  3K0T A;  3ZP4 A;  4NWO B;  2UYJ A;  1UFY A;  3QUW A;  3ZP7 A;  3MQW A;  2EWC A;  2OTM A;  2CW4 A;  3V4D A;  1QU9 A;  3ZO8 A;  3M4S A;  1FNJ A;  2UYN B;  2UYK A;  3D01 A;  1COM A;  2CHS A;  1PF5 A;  1UI9 A;  2B33 A;  1QAH A;  3GTZ A;  1ODE A;  5HP7 A;  3R0P A;  3KJJ A;  1XHO A;  1X25 A;  2CHT A;  2UYN A;  2DYY A;  2UYP A;  3I7T A;  3VCZ A;  3M1X A;  4ZK7 A;  3KJK A;  1FNK A;  2CVL A;  2CWJ A;  2CSL A;  2IG8 A;  5HP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...