3M1XA

Crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica, rhomobohedral form
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
126
structure length
125
Chain Sequence
SKLTVVASPLAPEAVGAYSQAIICNGVYCSGQIGLDRKTGDFAGKTIEEQSKQVMTNLKYVLEEAGSSMDKVVKTTCLLADIKDFGVFNGIYAEAFGNHKPARACFAAAALPKGALVEVECIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords putative Endoribonuclease L-PSP
publication title Crystal structure of a putative endoribonuclease L-PSP from Entamoeba histolytica, rhomobohedral form
rcsb
source organism Entamoeba histolytica
total genus 36
structure length 125
sequence length 126
ec nomenclature
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3m1xA00
1XHOA 3LYBA 3K12A 2UYNB 3L7QA 2UYPA 2OTMA 5HP7A 1FNKA 2CVLA 1DBFA 1QAHA 3D01A 1JD1A 2UYKA 2DYYA 3KJKA 3V4DA 2CHSA 2CW4A 3ZP7A 1PF5A 2UYJA 4NWOB 3ZP4A 2CHTA 3I3FA 1ODEA 1QU9A 3M4SA 3ZOPA 3QUWA 2CWJA 1QD9A 3ZO8A 1COMA 3K0TA 3M1XA 1ONIA 2EWCA 3KJJA 1J7HA 1FNJA 1UI9A 1NQ3A 1X25A 3I7TA 3LMEA 3MQWA 2UYNA 2IG8A 2CSLA 2B33A 3GTZA 1XRGA 3VCZA 3R0PA 4ZK7A 1UFYA 5HP8A
chains in the Genus database with same CATH superfamily
3CCQF 2PMPA 3E1YA 3S06A 4HNAB 3TD5A 3WGJA 2GZLA 4BVRA 1Q7YH 2KGWA 3G4SF 1K9MH 4O4LB 1W5FA 1RA4A 5GAPK 1IV2A 1U3LA 3E20B 3ZP7A 4IIJA 5C8YA 3VYSC 1X52A 4BT7A 1N8RH 5IT9M 5JVDA 1VQ5F 2EWCA 2HRUA 3CD6F 1CK2A 3AGKA 3CC4F 2HQSC 5LXTB 4BT2A 3VOAA 4EI8A 5CA0B 5IJ0A 5LP6B 3JALB 3OONA 3HKCA 3T80A 2HS3A 3IKFA 1YGYA 2CHSA 4BVTA 1R1MA 2UYJA 3ESJA 3EORA 4BT3A 3KE1A 1VQ7F 3KJJA 1VQNF 2B33A 4ZI7B 5JQGB 3RE3A 3UT5A 4BVSA 2VGMA 3VYUC 5EB0A 1YJWF 2UYPA 2GLZA 3WJPA 3IR9A 1W57A 3RYCB 1E7KA 5GINC 3WJRA 4C8GA 5IYZB 3Q8HA 5EWRA 5JH7A 3F6MA 3VI6A 1YI2F 5KX5B 2YXZA 4ZHWA 2N48A 1YQNA 3KIZA 3LDTA 4O4JB 1KD1H 3HKBA 1VQ8F 1H48A 3M1XA 1K73H 4IIJB 2IG8A 5C8YB 2HVYD 4ZHQA 5CA1A 2VGNA 5IJ9A 2H6LA 4U3JB 1XV2A 3FD6A 3ELCA 5MN6A 3IEWA 4B45A 4ZOLA 2RHOA 3F0FA 3C9TA 1PXWA 2Q1YA 1TVKB 3HKCB 3JAKA 4TV9A 5LYJA 3LWOC 4NWOB 2V9YA 3N2GA 4ZHYB 1COMA 5LA6B 2K1SA 2LBXA 3JVHA 2QI2A 5GONB 4M8IA 5AVMA 2OTLF 4G88A 1Q8RA 4BVQA 3LYBA 2KTVA 2HS4A 3CB2A 4I55A 2DT4A 4I4TA 3LWVC 1FSZA 2LBTA 2Z1EA 5BMVA 3SIUA 4X1IA 3CXCF 4G4YA 3CPWF 4F6RA 4R40B 2VAWA 2VAMA 3JATA 3RYHB 2CW4A 1PF5A 3S0HA 1JY8A 4C8IA 5LP6C 3CCMF 1CN7A 4FFBB 5EO3A 1QU9A 3F0DA 5JH7B 3F0EA 5CB4A 1W41A 3SIVA 1W40A 5ITZA 3R0PA 4X20A 3HKBB 1FFXA 2R751 1W59A 4O4HA 3I55F 3I56F 3WXMB 3QHDA 3VO8A 4O2BA 5HY2A 2OTMA 2HP0B 3D54A 3V7QA 5J2TA 5CA1B 4IHJA 5IJ9B 3NMUC 3CMAF 3C9SA 1IPAA 2I6DA 1JFFA 1JD1A 4O2AB 3J80M 3CCLF 2RHJA 4ZOLB 5HY4A 3RYFB 2VAPA 1VQOF 1QD9A 1VQLF 3N2GB 4PWTA 4O4IA 4B5CA 1CLIA 2QTPA 1NJIH 2BO1A 4B46A 2Q1XA 3NK6A 5HY1A 4X1YB 3N4YA 1SA0A 5EZYB 2RHLA 5LOVA 1U43A 4C4WC 1JJ2F 5GANK 3MDOA 4I55B 4TUYA 4I4TB 4YJ3A 4C82A 1X7PA 4X1IB 1NMUB 4WBNA 4F6RB 3HKEA 3LWQC 5J2UB 2RB9A 2CSLA 5MN5A 2BTOA 5CB4B 5GIOC 1IV4A 3N4ZA 2G9IA 3S0WA 5EYPA 3N2KA 3DDNA 1QVGF 4X20B 2NMUA 1FFXB 1Z5VA 4ZHVA 2FC3A 4EI7A 3CCJF 2RHHA 4O2BB 1JN1A 3RA5A 2QEXF 1TUBA 2PHNA 3CCUF 1ODEA 3RYIA 3LWRC 2AIZP 4DRXA 1YJ9F 3TD3A 5B8FA 1Z5WA 1YIJF 3I7TA 1XRGA 3WGNA 1RQ2A 1H7MA 5JVDB 3C9UA 3V3TA 5EIBD 3BYQA 3CCSF 3L7QA 4O4IB 3KHNA 4X1KA 3HKDA 3P4EA 5G4VC 1W55A 1KNKA 2CVLA 4TZZA 1DBFA 2ALEA 5IJ0B 3PAFA 5HY0A 2UYKA 3KJKA 3TD4A 1W5AA 4LNUA 5LOVB 2ZOVA 5KMGA 3F0GA 2OTJF 2HX0A 3QTYA 2ZF8A 3CCRF 3ZP4A 3I3FA 1IV1A 1VHAA 3G71F 1YHQF 4BT6A 4TUYB 3S02A 3G6EF 3K2XA 1S72F 4G4VA 1FNJA 1UI9A 5EB1B 3IMPA 4NUTA 3HTNA 3JAMM 3HJWC 1W5EA 2UZHA 3IKEA 4O4LA 2WALA 3GHZA 3K12A 2F9ZC 3GYQA 5HXZA 5HP7A 4BT4A 2H8CA 3RA6A 4RQOA 1Q82H 3UT5B 4G4WA 2Z01A 1H47A 1VQ6F 4ERHA 2CHTA 4BT5A 4EI9A 4RHAA 3NVIB 4BY9D 5LP6A 5CA0A 1VQVA 5JCOC 2LCAA 3JALA 2UYNA 3RYIB 2ZVYA 1SZQA 4ZK7A 1T0KB 3PLAC 2P6YA 4X3LA 1U40A 4ZHQB 2KG4A 4BW0B 1KQSF 1W5BA 3DC2A 1VH8A 3O85A 3FD5A 3FBAA 1RLUA 4C81A 3CC7F 3CCEF 1GX1A 2OZBA 3S03A 3JAKB 3ZO8A 2HRYA 3K0TA 4TV9B 1W42A 3JASA 5LYJB 2JNBA 5FJ4C 4XCQA 4TV8A 1VK3A 3CPQA 4E6EA 3RYCA 1M1KH 2AMTA 2FGYA 2W8BC 3E22A 3WPWA 5IYZA 2IQQA 1VQPF 3JAWA 1VQKF 3JARA 4EB6A 5FLXM 3C8LA 3VIUA 2ZODA 3CYPB 5GIPC 3VYTC 5KX5A 4O4JA 2Z1FA 3D00A 4YJ2A 2YYEA 5BMVB 3U0OA 3CMEF 3V7EA 1X7OA 3K14A 4U39A 2CWJA 5FNVA 3HWUA 3VMFB 4U3JA 3JATB 3OW2F 1NQ3A 3GTZA 4NQ3A 1ZWZA 5MN4A 5HP8A 1IV3A 2UYNB 2ZVZA 1M90H 3HAXD 1TVKA 4I50A 3VOBA 5ITZB 2Z1UA 3FFMA 3WPXA 1GZ0A 4O4HB 1QAHA 3D01A 1YJNF 5A2QM 2MQEA 3J81M 5LA6A 2ZAUA 3FPIA 5J2TB 4IHJB 2IAFA 1DT9A 5GONA 5G4UC 1OAPA 1JFFB 3OBWA 3JCMM 1VQ9F 2I6RA 1YITF 2QA4F 1Q81H 1U3PA 3P0ZA 1KNJA 3CCVF 3JASB 3B6NA 4DXDA 4TV8B 4G4XA 2CZWA 2R6R1 3WGLA 1OFUA 4G4ZA 3RYHA 3E22B 3CYQA 3LFOA 4FFBA 3JAWB 1VQMF 3V4DA 3JARB 1GO0A 1SA0B 4EB6B 2HS0A 3MCQA 2HP3A 3IEQA 4YJ2B 4YJ3B 1W581 1J7HA 1X25A 4X3MA 4WBNB 2HP0A 1VQ4F 3S0YA 4HNAA 4C8EA 3NVKE 5FNVB 3HKEB 1UFYA 4O2AA 3NK7A 3WGKA 3M84A 5EAZA 1FNKA 1W2BF 3J7AR 3P10A 3ON1A 1K8AH 3CC2F 5EYPB 3RYFA 1GO1A 4I50B 3N2KB 2BTQB 5HXUA 2L26A 1KC8H 4B62A 3MCAB 1T0AA 3M4SA 3ZOPA 3C9RA 3ERNA 5LXTA 4X1YA 3VCZA 1TUBB 2BTUA 2H8EA 5EZYA 5HWEA 1SDSA 1QVFF 4DRXB 5JCOA 1W3EX 1XHOA 3OBYA 3MBMA 4KWEA 3LWPC 1Q86H 2GVIA 1RQ7A 2DYYA 4LCKA 5DCVA 4X1KB 3HKDB 5J2UA 2Z1TA 3CG6A 2AIFA 3VTIC 4ZI7A 3QUWA 5JQGA 4LNUB 2VXYA 5KMGB 1RLGA 1ONIA 3MQWA 3LMEA 3WGMA 3WJQA 5EIBC 1XBIA 2LBWA 2OHWA 2KTUA
chains in the Genus database with same CATH topology
1XHOA 3LYBA 3K12A 2UYNB 3L7QA 2UYPA 2OTMA 5HP7A 1FNKA 2CVLA 1DBFA 1QAHA 3D01A 1JD1A 2UYKA 2DYYA 3KJKA 3V4DA 2CHSA 2CW4A 3ZP7A 1PF5A 2UYJA 4NWOB 3ZP4A 2CHTA 3I3FA 1ODEA 1QU9A 3M4SA 3ZOPA 3QUWA 2CWJA 1QD9A 3ZO8A 1COMA 3K0TA 3M1XA 1ONIA 2EWCA 3KJJA 1J7HA 1FNJA 1UI9A 1NQ3A 1X25A 3I7TA 3LMEA 3MQWA 2UYNA 2IG8A 2CSLA 2B33A 3GTZA 1XRGA 3VCZA 3R0PA 4ZK7A 1UFYA 5HP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XHO A;  3LYB A;  3K12 A;  2UYN B;  3L7Q A;  2UYP A;  2OTM A;  5HP7 A;  1FNK A;  2CVL A;  1DBF A;  1QAH A;  3D01 A;  1JD1 A;  2UYK A;  2DYY A;  3KJK A;  3V4D A;  2CHS A;  2CW4 A;  3ZP7 A;  1PF5 A;  2UYJ A;  4NWO B;  3ZP4 A;  2CHT A;  3I3F A;  1ODE A;  1QU9 A;  3M4S A;  3ZOP A;  3QUW A;  2CWJ A;  1QD9 A;  3ZO8 A;  1COM A;  3K0T A;  3M1X A;  1ONI A;  2EWC A;  3KJJ A;  1J7H A;  1FNJ A;  1UI9 A;  1NQ3 A;  1X25 A;  3I7T A;  3LME A;  3MQW A;  2UYN A;  2IG8 A;  2CSL A;  2B33 A;  3GTZ A;  1XRG A;  3VCZ A;  3R0P A;  4ZK7 A;  1UFY A;  5HP8 A; 
#chains in the Genus database with same CATH topology
 3CCQ F;  2PMP A;  3E1Y A;  3S06 A;  4HNA B;  3TD5 A;  3WGJ A;  2GZL A;  4BVR A;  1Q7Y H;  2KGW A;  3G4S F;  1K9M H;  4O4L B;  1W5F A;  1RA4 A;  5GAP K;  1IV2 A;  1U3L A;  3E20 B;  3ZP7 A;  4IIJ A;  5C8Y A;  3VYS C;  1X52 A;  4BT7 A;  1N8R H;  5IT9 M;  5JVD A;  1VQ5 F;  2EWC A;  2HRU A;  3CD6 F;  1CK2 A;  3AGK A;  3CC4 F;  2HQS C;  5LXT B;  4BT2 A;  3VOA A;  4EI8 A;  5CA0 B;  5IJ0 A;  5LP6 B;  3JAL B;  3OON A;  3HKC A;  3T80 A;  2HS3 A;  3IKF A;  1YGY A;  2CHS A;  4BVT A;  1R1M A;  2UYJ A;  3ESJ A;  3EOR A;  4BT3 A;  3KE1 A;  1VQ7 F;  3KJJ A;  1VQN F;  2B33 A;  4ZI7 B;  5JQG B;  3RE3 A;  3UT5 A;  4BVS A;  2VGM A;  3VYU C;  5EB0 A;  1YJW F;  2UYP A;  2GLZ A;  3WJP A;  3IR9 A;  1W57 A;  3RYC B;  1E7K A;  5GIN C;  3WJR A;  4C8G A;  5IYZ B;  3Q8H A;  5EWR A;  5JH7 A;  3F6M A;  3VI6 A;  1YI2 F;  5KX5 B;  2YXZ A;  4ZHW A;  2N48 A;  1YQN A;  3KIZ A;  3LDT A;  4O4J B;  1KD1 H;  3HKB A;  1VQ8 F;  1H48 A;  3M1X A;  1K73 H;  4IIJ B;  2IG8 A;  5C8Y B;  2HVY D;  4ZHQ A;  5CA1 A;  2VGN A;  5IJ9 A;  2H6L A;  4U3J B;  1XV2 A;  3FD6 A;  3ELC A;  5MN6 A;  3IEW A;  4B45 A;  4ZOL A;  2RHO A;  3F0F A;  3C9T A;  1PXW A;  2Q1Y A;  1TVK B;  3HKC B;  3JAK A;  4TV9 A;  5LYJ A;  3LWO C;  4NWO B;  2V9Y A;  3N2G A;  4ZHY B;  1COM A;  5LA6 B;  2K1S A;  2LBX A;  3JVH A;  2QI2 A;  5GON B;  4M8I A;  5AVM A;  2OTL F;  4G88 A;  1Q8R A;  4BVQ A;  3LYB A;  2KTV A;  2HS4 A;  3CB2 A;  4I55 A;  2DT4 A;  4I4T A;  3LWV C;  1FSZ A;  2LBT A;  2Z1E A;  5BMV A;  3SIU A;  4X1I A;  3CXC F;  4G4Y A;  3CPW F;  4F6R A;  4R40 B;  2VAW A;  2VAM A;  3JAT A;  3RYH B;  2CW4 A;  1PF5 A;  3S0H A;  1JY8 A;  4C8I A;  5LP6 C;  3CCM F;  1CN7 A;  4FFB B;  5EO3 A;  1QU9 A;  3F0D A;  5JH7 B;  3F0E A;  5CB4 A;  1W41 A;  3SIV A;  1W40 A;  5ITZ A;  3R0P A;  4X20 A;  3HKB B;  1FFX A;  2R75 1;  1W59 A;  4O4H A;  3I55 F;  3I56 F;  3WXM B;  3QHD A;  3VO8 A;  4O2B A;  5HY2 A;  2OTM A;  2HP0 B;  3D54 A;  3V7Q A;  5J2T A;  5CA1 B;  4IHJ A;  5IJ9 B;  3NMU C;  3CMA F;  3C9S A;  1IPA A;  2I6D A;  1JFF A;  1JD1 A;  4O2A B;  3J80 M;  3CCL F;  2RHJ A;  4ZOL B;  5HY4 A;  3RYF B;  2VAP A;  1VQO F;  1QD9 A;  1VQL F;  3N2G B;  4PWT A;  4O4I A;  4B5C A;  1CLI A;  2QTP A;  1NJI H;  2BO1 A;  4B46 A;  2Q1X A;  3NK6 A;  5HY1 A;  4X1Y B;  3N4Y A;  1SA0 A;  5EZY B;  2RHL A;  5LOV A;  1U43 A;  4C4W C;  1JJ2 F;  5GAN K;  3MDO A;  4I55 B;  4TUY A;  4I4T B;  4YJ3 A;  4C82 A;  1X7P A;  4X1I B;  1NMU B;  4WBN A;  4F6R B;  3HKE A;  3LWQ C;  5J2U B;  2RB9 A;  2CSL A;  5MN5 A;  2BTO A;  5CB4 B;  5GIO C;  1IV4 A;  3N4Z A;  2G9I A;  3S0W A;  5EYP A;  3N2K A;  3DDN A;  1QVG F;  4X20 B;  2NMU A;  1FFX B;  1Z5V A;  4ZHV A;  2FC3 A;  4EI7 A;  3CCJ F;  2RHH A;  4O2B B;  1JN1 A;  3RA5 A;  2QEX F;  1TUB A;  2PHN A;  3CCU F;  1ODE A;  3RYI A;  3LWR C;  2AIZ P;  4DRX A;  1YJ9 F;  3TD3 A;  5B8F A;  1Z5W A;  1YIJ F;  3I7T A;  1XRG A;  3WGN A;  1RQ2 A;  1H7M A;  5JVD B;  3C9U A;  3V3T A;  5EIB D;  3BYQ A;  3CCS F;  3L7Q A;  4O4I B;  3KHN A;  4X1K A;  3HKD A;  3P4E A;  5G4V C;  1W55 A;  1KNK A;  2CVL A;  4TZZ A;  1DBF A;  2ALE A;  5IJ0 B;  3PAF A;  5HY0 A;  2UYK A;  3KJK A;  3TD4 A;  1W5A A;  4LNU A;  5LOV B;  2ZOV A;  5KMG A;  3F0G A;  2OTJ F;  2HX0 A;  3QTY A;  2ZF8 A;  3CCR F;  3ZP4 A;  3I3F A;  1IV1 A;  1VHA A;  3G71 F;  1YHQ F;  4BT6 A;  4TUY B;  3S02 A;  3G6E F;  3K2X A;  1S72 F;  4G4V A;  1FNJ A;  1UI9 A;  5EB1 B;  3IMP A;  4NUT A;  3HTN A;  3JAM M;  3HJW C;  1W5E A;  2UZH A;  3IKE A;  4O4L A;  2WAL A;  3GHZ A;  3K12 A;  2F9Z C;  3GYQ A;  5HXZ A;  5HP7 A;  4BT4 A;  2H8C A;  3RA6 A;  4RQO A;  1Q82 H;  3UT5 B;  4G4W A;  2Z01 A;  1H47 A;  1VQ6 F;  4ERH A;  2CHT A;  4BT5 A;  4EI9 A;  4RHA A;  3NVI B;  4BY9 D;  5LP6 A;  5CA0 A;  1VQV A;  5JCO C;  2LCA A;  3JAL A;  2UYN A;  3RYI B;  2ZVY A;  1SZQ A;  4ZK7 A;  1T0K B;  3PLA C;  2P6Y A;  4X3L A;  1U40 A;  4ZHQ B;  2KG4 A;  4BW0 B;  1KQS F;  1W5B A;  3DC2 A;  1VH8 A;  3O85 A;  3FD5 A;  3FBA A;  1RLU A;  4C81 A;  3CC7 F;  3CCE F;  1GX1 A;  2OZB A;  3S03 A;  3JAK B;  3ZO8 A;  2HRY A;  3K0T A;  4TV9 B;  1W42 A;  3JAS A;  5LYJ B;  2JNB A;  5FJ4 C;  4XCQ A;  4TV8 A;  1VK3 A;  3CPQ A;  4E6E A;  3RYC A;  1M1K H;  2AMT A;  2FGY A;  2W8B C;  3E22 A;  3WPW A;  5IYZ A;  2IQQ A;  1VQP F;  3JAW A;  1VQK F;  3JAR A;  4EB6 A;  5FLX M;  3C8L A;  3VIU A;  2ZOD A;  3CYP B;  5GIP C;  3VYT C;  5KX5 A;  4O4J A;  2Z1F A;  3D00 A;  4YJ2 A;  2YYE A;  5BMV B;  3U0O A;  3CME F;  3V7E A;  1X7O A;  3K14 A;  4U39 A;  2CWJ A;  5FNV A;  3HWU A;  3VMF B;  4U3J A;  3JAT B;  3OW2 F;  1NQ3 A;  3GTZ A;  4NQ3 A;  1ZWZ A;  5MN4 A;  5HP8 A;  1IV3 A;  2UYN B;  2ZVZ A;  1M90 H;  3HAX D;  1TVK A;  4I50 A;  3VOB A;  5ITZ B;  2Z1U A;  3FFM A;  3WPX A;  1GZ0 A;  4O4H B;  1QAH A;  3D01 A;  1YJN F;  5A2Q M;  2MQE A;  3J81 M;  5LA6 A;  2ZAU A;  3FPI A;  5J2T B;  4IHJ B;  2IAF A;  1DT9 A;  5GON A;  5G4U C;  1OAP A;  1JFF B;  3OBW A;  3JCM M;  1VQ9 F;  2I6R A;  1YIT F;  2QA4 F;  1Q81 H;  1U3P A;  3P0Z A;  1KNJ A;  3CCV F;  3JAS B;  3B6N A;  4DXD A;  4TV8 B;  4G4X A;  2CZW A;  2R6R 1;  3WGL A;  1OFU A;  4G4Z A;  3RYH A;  3E22 B;  3CYQ A;  3LFO A;  4FFB A;  3JAW B;  1VQM F;  3V4D A;  3JAR B;  1GO0 A;  1SA0 B;  4EB6 B;  2HS0 A;  3MCQ A;  2HP3 A;  3IEQ A;  4YJ2 B;  4YJ3 B;  1W58 1;  1J7H A;  1X25 A;  4X3M A;  4WBN B;  2HP0 A;  1VQ4 F;  3S0Y A;  4HNA A;  4C8E A;  3NVK E;  5FNV B;  3HKE B;  1UFY A;  4O2A A;  3NK7 A;  3WGK A;  3M84 A;  5EAZ A;  1FNK A;  1W2B F;  3J7A R;  3P10 A;  3ON1 A;  1K8A H;  3CC2 F;  5EYP B;  3RYF A;  1GO1 A;  4I50 B;  3N2K B;  2BTQ B;  5HXU A;  2L26 A;  1KC8 H;  4B62 A;  3MCA B;  1T0A A;  3M4S A;  3ZOP A;  3C9R A;  3ERN A;  5LXT A;  4X1Y A;  3VCZ A;  1TUB B;  2BTU A;  2H8E A;  5EZY A;  5HWE A;  1SDS A;  1QVF F;  4DRX B;  5JCO A;  1W3E X;  1XHO A;  3OBY A;  3MBM A;  4KWE A;  3LWP C;  1Q86 H;  2GVI A;  1RQ7 A;  2DYY A;  4LCK A;  5DCV A;  4X1K B;  3HKD B;  5J2U A;  2Z1T A;  3CG6 A;  2AIF A;  3VTI C;  4ZI7 A;  3QUW A;  5JQG A;  4LNU B;  2VXY A;  5KMG B;  1RLG A;  1ONI A;  3MQW A;  3LME A;  3WGM A;  3WJQ A;  5EIB C;  1XBI A;  2LBW A;  2OHW A;  2KTU A; 
#chains in the Genus database with same CATH homology
 1XHO A;  3LYB A;  3K12 A;  2UYN B;  3L7Q A;  2UYP A;  2OTM A;  5HP7 A;  1FNK A;  2CVL A;  1DBF A;  1QAH A;  3D01 A;  1JD1 A;  2UYK A;  2DYY A;  3KJK A;  3V4D A;  2CHS A;  2CW4 A;  3ZP7 A;  1PF5 A;  2UYJ A;  4NWO B;  3ZP4 A;  2CHT A;  3I3F A;  1ODE A;  1QU9 A;  3M4S A;  3ZOP A;  3QUW A;  2CWJ A;  1QD9 A;  3ZO8 A;  1COM A;  3K0T A;  3M1X A;  1ONI A;  2EWC A;  3KJJ A;  1J7H A;  1FNJ A;  1UI9 A;  1NQ3 A;  1X25 A;  3I7T A;  3LME A;  3MQW A;  2UYN A;  2IG8 A;  2CSL A;  2B33 A;  3GTZ A;  1XRG A;  3VCZ A;  3R0P A;  4ZK7 A;  1UFY A;  5HP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...