3M1XA

Crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica, rhomobohedral form
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
126
structure length
125
Chain Sequence
SKLTVVASPLAPEAVGAYSQAIICNGVYCSGQIGLDRKTGDFAGKTIEEQSKQVMTNLKYVLEEAGSSMDKVVKTTCLLADIKDFGVFNGIYAEAFGNHKPARACFAAAALPKGALVEVECIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Endoribonuclease L-PSP
publication title Crystal structure of a putative endoribonuclease L-PSP from Entamoeba histolytica, rhomobohedral form
rcsb
source organism Entamoeba histolytica
molecule tags Unknown function
total genus 36
structure length 125
sequence length 126
ec nomenclature
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3m1xA00
3GTZA 4ZK7A 1ONIA 2CHTA 3L7QA 3ZO8A 1JD1A 1UFYA 2UYKA 3K12A 2UYJA 1FNKA 3D01A 3K0TA 2CHSA 1XRGA 1X25A 1J7HA 2UYPA 1ODEA 2UYNB 3KJKA 3M4SA 1QAHA 2CW4A 1UI9A 1DBFA 2CVLA 3QUWA 3R0PA 3ZP4A 3V4DA 3I7TA 2CWJA 1NQ3A 1COMA 2B33A 2DYYA 3ZP7A 1XHOA 2OTMA 1QD9A 3VCZA 4NWOB 5HP8A 5HP7A 3M1XA 3LMEA 1FNJA 1QU9A 2CSLA 3LYBA 2EWCA 3MQWA 3ZOPA 2IG8A 3KJJA 3I3FA 2UYNA 1PF5A
chains in the Genus database with same CATH superfamily
4TV9A 4C82A 4IIJB 1W5BA 3IR9A 3CCVF 5LOVB 3CPWF 3S03A 3K0TA 5LXTA 3N2GA 2LBXA 4NQ3A 2UYPA 3FD5A 3HKCB 3M84A 3JASA 1YHQF 1M90H 3DC2A 4DXDA 1OAPA 5GANK 4HNAA 1TUBB 2N48A 2L26A 4LNUB 5IJ0A 3M1XA 1FFXA 3JAWB 5JH7A 3ZOPA 2AMTA 2UYNA 3G71F 2RHLA 3HKEB 1ONIA 2CHTA 4TUYB 4G4YA 5LYJA 1CK2A 4EI9A 4M8IA 3D54A 3LWVC 3J7AR 2HS3A 3WGJA 4O2AB 5A2QM 1X52A 2G9IA 5J2UB 4ZHVA 3P0ZA 4WBNA 2VAMA 1VQKF 5EB0A 3E22B 3Q8HA 4O4LB 1H48A 2OTJF 3JAMM 1JY8A 2AIZP 1XHOA 2I6DA 1SA0A 4I4TB 5LOVA 2AIFA 3J80M 5CB4A 1VH8A 1W581 2LCAA 2GLZA 1Q81H 1U43A 4BW0B 3CC4F 3D00A 3VO8A 3NVKE 2K1SA 3G4SF 3CC2F 4BVTA 5EIBD 3NMUC 5KX5B 2ZODA 3KE1A 2F9ZC 5HXUA 2NMUA 2VXYA 3KJKA 5GIOC 1TUBA 4BT5A 1NJIH 4I55B 4U39A 3S0WA 3K2XA 4E6EA 3ZP4A 1Q86H 2HVYD 4EI7A 2B33A 3MDOA 3JARB 4O4JB 3BYQA 3HKEA 1GZ0A 5HY4A 3N2KB 1H47A 1TVKB 2OTLF 2KTVA 1YJ9F 2ZVYA 4O2AA 4EB6B 3VTIC 5MN6A 5J2UA 2LBTA 2KGWA 3E22A 4O4LA 3VYUC 2HQSC 3HTNA 3VOAA 2DT4A 2UYJA 1VQNF 2HP0A 3S0HA 2QI2A 1K73H 1H7MA 1Z5WA 3C9RA 3GYQA 3SIVA 3LWQC 5FJ4C 5IJ9A 1GX1A 4I4TA 2Q1XA 3AGKA 3F0GA 3QUWA 3WGNA 4BT7A 4EI8A 1YIJF 3F6MA 3RYCB 1IV3A 1RQ7A 3RYIB 1IV1A 5LXTB 3N2GB 4NWOB 3N4YA 1U3LA 5KX5A 5MN4A 3JASB 3FFMA 3GTZA 5C8YB 4I55A 3JATB 1UFYA 5FNVB 4X1YB 5GINC 3HKBA 1FFXB 1RA4A 3U0OA 3WJPA 3JARA 4O4JA 5JH7B 2UYNB 1W59A 2P6YA 4YJ2B 4C4WC 1TVKA 1DBFA 4B45A 5FLXM 3T80A 4EB6A 3WGMA 3WJRA 5ITZB 2GVIA 2ZVZA 5EB1B 2QEXF 1XV2A 4BVSA 1SZQA 4ERHA 1W5FA 5LA6A 3HKDA 4ZHYB 1KNKA 1SA0B 3E1YA 3FPIA 1ZWZA 5HY1A 3S02A 3RYCA 5CB4B 3RYIA 1X25A 3G6EF 1SDSA 5HY2A 4BT3A 2CWJA 1VQLF 2HX0A 3J81M 1N8RH 5C8YA 3JATA 4F6RA 5FNVA 2KG4A 1W5EA 4X1YA 3LYBA 3RYFA 4C81A 4YJ3A 3MCQA 3LDTA 1VK3A 4BT6A 4YJ2A 3UT5B 1VQ9F 2R751 2I6RA 2Z01A 4B46A 3CYQA 1VQ4F 5ITZA 3C9UA 3HWUA 3C8LA 1VQVA 2H6LA 3C9TA 3ON1A 1W42A 1NQ3A 3WGLA 2HP0B 1T0KB 5G4VC 5IJ9B 1FNJA 1QU9A 3I3FA 5BMVB 3FD6A 3VMFB 1W41A 3QHDA 3CCLF 3LFOA 5G4UC 3FBAA 3RE3A 2UYKA 2Z1FA 3KIZA 1IPAA 1FNKA 3PLAC 5B8FA 2FC3A 3WPXA 2ZAUA 3VYTC 3ERNA 5JCOA 3LWOC 3P4EA 1KNJA 1U40A 3HKBB 2DYYA 1VQ5F 1T0AA 3UT5A 3CCJF 2GZLA 3F0DA 2YXZA 5J2TB 1NMUB 5JCOC 2Z1TA 1X7PA 5EO3A 3ELCA 3IMPA 4FFBB 4G4XA 3JCMM 5MN5A 3L7QA 4XCQA 1X7OA 5EAZA 1W57A 3WGKA 3RA6A 2Q1YA 3M4SA 3VIUA 5LA6B 2CVLA 3HKDB 4X3LA 4ZHWA 1Q82H 1Q7YH 3IEQA 5BMVA 2HS0A 5JVDA 2FGYA 3ZP7A 2PMPA 3CMAF 1YI2F 1KD1H 2EWCA 3RYHB 4O4IB 3VYSC 4I50B 1GO1A 2VAWA 3NK7A 3CCQF 4X1KA 1PXWA 2H8CA 4F6RB 3MBMA 2CHSA 3RYFB 4X20B 4YJ3B 3NVIB 3R0PA 3CB2A 5J2TA 3MCAB 4R40B 2HRUA 2LBWA 4ZOLB 4KWEA 3IEWA 4BT4A 4FFBA 2OZBA 2HRYA 4BVRA 4BT2A 1CLIA 1FSZA 5HP7A 2JNBA 4IHJB 2IG8A 3KJJA 3JVHA 2HP3A 5EYPA 1IV2A 4ZI7A 1YJNF 3P10A 5HY0A 1U3PA 2ALEA 3D01A 1VQOF 3JALB 1XRGA 2R6R1 4RQOA 4ZHQB 3PAFA 3IKFA 5KMGB 1RLUA 4G4ZA 3RYHA 4O4IA 1QVGF 1S72F 3VCZA 3O85A 4I50A 5GONA 3TD5A 2IAFA 3QTYA 3TD4A 4O2BB 1YQNA 3V7QA 4X20A 3EORA 4G88A 5CA1A 2Z1EA 4ZOLA 3V7EA 1OFUA 1QAHA 2MQEA 4RHAA 2CW4A 2VGMA 5LP6A 4IHJA 4X1IA 2VGNA 1W5AA 1M1KH 3VI6A 2QTPA 1W55A 3DDNA 2OTMA 1VQ7F 3WJQA 3WPWA 2OHWA 2UZHA 3CCSF 3IKEA 5LP6C 3S0YA 4DRXA 5GAPK 3JALA 3WXMB 5JVDB 3OBWA 4X3MA 4ZHQA 3ZO8A 1JD1A 3CC7F 3C9SA 5KMGA 2BTQB 5IYZB 3CCMF 4C8GA 3OW2F 1VQ8F 2RHHA 4TV8A 4B62A 4NUTA 1JFFB 4G4VA 4PWTA 1E7KA 1RLGA 4O2BA 4X1KB 3HAXD 5HWEA 2HS4A 3B6NA 3OBYA 4IIJA 3ESJA 4TZZA 5EWRA 5HP8A 3CXCF 2BO1A 2PHNA 3JAKB 1YJWF 2ZF8A 1KC8H 2VAPA 3TD3A 3HKCA 3CCUF 1RQ2A 2RHOA 1Z5VA 3V3TA 3CD6F 3I55F 2BTOA 3K12A 2KTUA 2W8BC 3CCEF 4C8IA 1XBIA 5HXZA 1VQMF 4LNUA 3OONA 5CA0B 4B5CA 2ZOVA 5EYPB 3JAWA 3CMEF 4O4HB 4ZI7B 5JQGB 1W2BF 1VQ6F 3SIUA 3CYPB 4LCKA 4U3JB 4BY9D 5DCVA 3CPQA 4TUYA 3HJWC 3LWPC 3NK6A 3LMEA 5IYZA 2CSLA 3MQWA 1W40A 1R1MA 1PF5A 4G4WA 1JFFA 1K8AH 3CG6A 3N4ZA 3VOBA 3F0EA 5EZYB 5GONB 4C8EA 5IT9M 2WALA 3KHNA 2V9YA 4TV9B 1YITF 1YGYA 3JAKA 1KQSF 2RHJA 5CA1B 1QD9A 2Z1UA 1CN7A 5LP6B 5AVMA 4X1IB 3K14A 2RB9A 4BVQA 5GIPC 3CCRF 4HNAB 4ZK7A 1W3EX 5CA0A 3E20B 3S06A 3LWRC 1DT9A 5IJ0B 3I56F 2QA4F 2CZWA 4O4HA 5JQGA 2H8EA 3RA5A 2IQQA 4U3JA 1Q8RA 4DRXB 1J7HA 1ODEA 3N2KA 2BTUA 1VQPF 2YYEA 1GO0A 1UI9A 5LYJB 3GHZA 3I7TA 3V4DA 1K9MH 1COMA 1VHAA 1JJ2F 5EIBC 3F0FA 4WBNB 4TV8B 5EZYA 1JN1A 1IV4A 1QVFF
chains in the Genus database with same CATH topology
3GTZA 4ZK7A 1ONIA 2CHTA 3L7QA 3ZO8A 1JD1A 1UFYA 2UYKA 3K12A 2UYJA 1FNKA 3D01A 3K0TA 2CHSA 1XRGA 1X25A 1J7HA 2UYPA 1ODEA 2UYNB 3KJKA 3M4SA 1QAHA 2CW4A 1UI9A 1DBFA 2CVLA 3QUWA 3R0PA 3ZP4A 3V4DA 3I7TA 2CWJA 1NQ3A 1COMA 2B33A 2DYYA 3ZP7A 1XHOA 2OTMA 1QD9A 3VCZA 4NWOB 5HP8A 5HP7A 3M1XA 3LMEA 1FNJA 1QU9A 2CSLA 3LYBA 2EWCA 3MQWA 3ZOPA 2IG8A 3KJJA 3I3FA 2UYNA 1PF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTZ A;  4ZK7 A;  1ONI A;  2CHT A;  3L7Q A;  3ZO8 A;  1JD1 A;  1UFY A;  2UYK A;  3K12 A;  2UYJ A;  1FNK A;  3D01 A;  3K0T A;  2CHS A;  1XRG A;  1X25 A;  1J7H A;  2UYP A;  1ODE A;  2UYN B;  3KJK A;  3M4S A;  1QAH A;  2CW4 A;  1UI9 A;  1DBF A;  2CVL A;  3QUW A;  3R0P A;  3ZP4 A;  3V4D A;  3I7T A;  2CWJ A;  1NQ3 A;  1COM A;  2B33 A;  2DYY A;  3ZP7 A;  1XHO A;  2OTM A;  1QD9 A;  3VCZ A;  4NWO B;  5HP8 A;  5HP7 A;  3M1X A;  3LME A;  1FNJ A;  1QU9 A;  2CSL A;  3LYB A;  2EWC A;  3MQW A;  3ZOP A;  2IG8 A;  3KJJ A;  3I3F A;  2UYN A;  1PF5 A; 
#chains in the Genus database with same CATH topology
 4TV9 A;  4C82 A;  4IIJ B;  1W5B A;  3IR9 A;  3CCV F;  5LOV B;  3CPW F;  3S03 A;  3K0T A;  5LXT A;  3N2G A;  2LBX A;  4NQ3 A;  2UYP A;  3FD5 A;  3HKC B;  3M84 A;  3JAS A;  1YHQ F;  1M90 H;  3DC2 A;  4DXD A;  1OAP A;  5GAN K;  4HNA A;  1TUB B;  2N48 A;  2L26 A;  4LNU B;  5IJ0 A;  3M1X A;  1FFX A;  3JAW B;  5JH7 A;  3ZOP A;  2AMT A;  2UYN A;  3G71 F;  2RHL A;  3HKE B;  1ONI A;  2CHT A;  4TUY B;  4G4Y A;  5LYJ A;  1CK2 A;  4EI9 A;  4M8I A;  3D54 A;  3LWV C;  3J7A R;  2HS3 A;  3WGJ A;  4O2A B;  5A2Q M;  1X52 A;  2G9I A;  5J2U B;  4ZHV A;  3P0Z A;  4WBN A;  2VAM A;  1VQK F;  5EB0 A;  3E22 B;  3Q8H A;  4O4L B;  1H48 A;  2OTJ F;  3JAM M;  1JY8 A;  2AIZ P;  1XHO A;  2I6D A;  1SA0 A;  4I4T B;  5LOV A;  2AIF A;  3J80 M;  5CB4 A;  1VH8 A;  1W58 1;  2LCA A;  2GLZ A;  1Q81 H;  1U43 A;  4BW0 B;  3CC4 F;  3D00 A;  3VO8 A;  3NVK E;  2K1S A;  3G4S F;  3CC2 F;  4BVT A;  5EIB D;  3NMU C;  5KX5 B;  2ZOD A;  3KE1 A;  2F9Z C;  5HXU A;  2NMU A;  2VXY A;  3KJK A;  5GIO C;  1TUB A;  4BT5 A;  1NJI H;  4I55 B;  4U39 A;  3S0W A;  3K2X A;  4E6E A;  3ZP4 A;  1Q86 H;  2HVY D;  4EI7 A;  2B33 A;  3MDO A;  3JAR B;  4O4J B;  3BYQ A;  3HKE A;  1GZ0 A;  5HY4 A;  3N2K B;  1H47 A;  1TVK B;  2OTL F;  2KTV A;  1YJ9 F;  2ZVY A;  4O2A A;  4EB6 B;  3VTI C;  5MN6 A;  5J2U A;  2LBT A;  2KGW A;  3E22 A;  4O4L A;  3VYU C;  2HQS C;  3HTN A;  3VOA A;  2DT4 A;  2UYJ A;  1VQN F;  2HP0 A;  3S0H A;  2QI2 A;  1K73 H;  1H7M A;  1Z5W A;  3C9R A;  3GYQ A;  3SIV A;  3LWQ C;  5FJ4 C;  5IJ9 A;  1GX1 A;  4I4T A;  2Q1X A;  3AGK A;  3F0G A;  3QUW A;  3WGN A;  4BT7 A;  4EI8 A;  1YIJ F;  3F6M A;  3RYC B;  1IV3 A;  1RQ7 A;  3RYI B;  1IV1 A;  5LXT B;  3N2G B;  4NWO B;  3N4Y A;  1U3L A;  5KX5 A;  5MN4 A;  3JAS B;  3FFM A;  3GTZ A;  5C8Y B;  4I55 A;  3JAT B;  1UFY A;  5FNV B;  4X1Y B;  5GIN C;  3HKB A;  1FFX B;  1RA4 A;  3U0O A;  3WJP A;  3JAR A;  4O4J A;  5JH7 B;  2UYN B;  1W59 A;  2P6Y A;  4YJ2 B;  4C4W C;  1TVK A;  1DBF A;  4B45 A;  5FLX M;  3T80 A;  4EB6 A;  3WGM A;  3WJR A;  5ITZ B;  2GVI A;  2ZVZ A;  5EB1 B;  2QEX F;  1XV2 A;  4BVS A;  1SZQ A;  4ERH A;  1W5F A;  5LA6 A;  3HKD A;  4ZHY B;  1KNK A;  1SA0 B;  3E1Y A;  3FPI A;  1ZWZ A;  5HY1 A;  3S02 A;  3RYC A;  5CB4 B;  3RYI A;  1X25 A;  3G6E F;  1SDS A;  5HY2 A;  4BT3 A;  2CWJ A;  1VQL F;  2HX0 A;  3J81 M;  1N8R H;  5C8Y A;  3JAT A;  4F6R A;  5FNV A;  2KG4 A;  1W5E A;  4X1Y A;  3LYB A;  3RYF A;  4C81 A;  4YJ3 A;  3MCQ A;  3LDT A;  1VK3 A;  4BT6 A;  4YJ2 A;  3UT5 B;  1VQ9 F;  2R75 1;  2I6R A;  2Z01 A;  4B46 A;  3CYQ A;  1VQ4 F;  5ITZ A;  3C9U A;  3HWU A;  3C8L A;  1VQV A;  2H6L A;  3C9T A;  3ON1 A;  1W42 A;  1NQ3 A;  3WGL A;  2HP0 B;  1T0K B;  5G4V C;  5IJ9 B;  1FNJ A;  1QU9 A;  3I3F A;  5BMV B;  3FD6 A;  3VMF B;  1W41 A;  3QHD A;  3CCL F;  3LFO A;  5G4U C;  3FBA A;  3RE3 A;  2UYK A;  2Z1F A;  3KIZ A;  1IPA A;  1FNK A;  3PLA C;  5B8F A;  2FC3 A;  3WPX A;  2ZAU A;  3VYT C;  3ERN A;  5JCO A;  3LWO C;  3P4E A;  1KNJ A;  1U40 A;  3HKB B;  2DYY A;  1VQ5 F;  1T0A A;  3UT5 A;  3CCJ F;  2GZL A;  3F0D A;  2YXZ A;  5J2T B;  1NMU B;  5JCO C;  2Z1T A;  1X7P A;  5EO3 A;  3ELC A;  3IMP A;  4FFB B;  4G4X A;  3JCM M;  5MN5 A;  3L7Q A;  4XCQ A;  1X7O A;  5EAZ A;  1W57 A;  3WGK A;  3RA6 A;  2Q1Y A;  3M4S A;  3VIU A;  5LA6 B;  2CVL A;  3HKD B;  4X3L A;  4ZHW A;  1Q82 H;  1Q7Y H;  3IEQ A;  5BMV A;  2HS0 A;  5JVD A;  2FGY A;  3ZP7 A;  2PMP A;  3CMA F;  1YI2 F;  1KD1 H;  2EWC A;  3RYH B;  4O4I B;  3VYS C;  4I50 B;  1GO1 A;  2VAW A;  3NK7 A;  3CCQ F;  4X1K A;  1PXW A;  2H8C A;  4F6R B;  3MBM A;  2CHS A;  3RYF B;  4X20 B;  4YJ3 B;  3NVI B;  3R0P A;  3CB2 A;  5J2T A;  3MCA B;  4R40 B;  2HRU A;  2LBW A;  4ZOL B;  4KWE A;  3IEW A;  4BT4 A;  4FFB A;  2OZB A;  2HRY A;  4BVR A;  4BT2 A;  1CLI A;  1FSZ A;  5HP7 A;  2JNB A;  4IHJ B;  2IG8 A;  3KJJ A;  3JVH A;  2HP3 A;  5EYP A;  1IV2 A;  4ZI7 A;  1YJN F;  3P10 A;  5HY0 A;  1U3P A;  2ALE A;  3D01 A;  1VQO F;  3JAL B;  1XRG A;  2R6R 1;  4RQO A;  4ZHQ B;  3PAF A;  3IKF A;  5KMG B;  1RLU A;  4G4Z A;  3RYH A;  4O4I A;  1QVG F;  1S72 F;  3VCZ A;  3O85 A;  4I50 A;  5GON A;  3TD5 A;  2IAF A;  3QTY A;  3TD4 A;  4O2B B;  1YQN A;  3V7Q A;  4X20 A;  3EOR A;  4G88 A;  5CA1 A;  2Z1E A;  4ZOL A;  3V7E A;  1OFU A;  1QAH A;  2MQE A;  4RHA A;  2CW4 A;  2VGM A;  5LP6 A;  4IHJ A;  4X1I A;  2VGN A;  1W5A A;  1M1K H;  3VI6 A;  2QTP A;  1W55 A;  3DDN A;  2OTM A;  1VQ7 F;  3WJQ A;  3WPW A;  2OHW A;  2UZH A;  3CCS F;  3IKE A;  5LP6 C;  3S0Y A;  4DRX A;  5GAP K;  3JAL A;  3WXM B;  5JVD B;  3OBW A;  4X3M A;  4ZHQ A;  3ZO8 A;  1JD1 A;  3CC7 F;  3C9S A;  5KMG A;  2BTQ B;  5IYZ B;  3CCM F;  4C8G A;  3OW2 F;  1VQ8 F;  2RHH A;  4TV8 A;  4B62 A;  4NUT A;  1JFF B;  4G4V A;  4PWT A;  1E7K A;  1RLG A;  4O2B A;  4X1K B;  3HAX D;  5HWE A;  2HS4 A;  3B6N A;  3OBY A;  4IIJ A;  3ESJ A;  4TZZ A;  5EWR A;  5HP8 A;  3CXC F;  2BO1 A;  2PHN A;  3JAK B;  1YJW F;  2ZF8 A;  1KC8 H;  2VAP A;  3TD3 A;  3HKC A;  3CCU F;  1RQ2 A;  2RHO A;  1Z5V A;  3V3T A;  3CD6 F;  3I55 F;  2BTO A;  3K12 A;  2KTU A;  2W8B C;  3CCE F;  4C8I A;  1XBI A;  5HXZ A;  1VQM F;  4LNU A;  3OON A;  5CA0 B;  4B5C A;  2ZOV A;  5EYP B;  3JAW A;  3CME F;  4O4H B;  4ZI7 B;  5JQG B;  1W2B F;  1VQ6 F;  3SIU A;  3CYP B;  4LCK A;  4U3J B;  4BY9 D;  5DCV A;  3CPQ A;  4TUY A;  3HJW C;  3LWP C;  3NK6 A;  3LME A;  5IYZ A;  2CSL A;  3MQW A;  1W40 A;  1R1M A;  1PF5 A;  4G4W A;  1JFF A;  1K8A H;  3CG6 A;  3N4Z A;  3VOB A;  3F0E A;  5EZY B;  5GON B;  4C8E A;  5IT9 M;  2WAL A;  3KHN A;  2V9Y A;  4TV9 B;  1YIT F;  1YGY A;  3JAK A;  1KQS F;  2RHJ A;  5CA1 B;  1QD9 A;  2Z1U A;  1CN7 A;  5LP6 B;  5AVM A;  4X1I B;  3K14 A;  2RB9 A;  4BVQ A;  5GIP C;  3CCR F;  4HNA B;  4ZK7 A;  1W3E X;  5CA0 A;  3E20 B;  3S06 A;  3LWR C;  1DT9 A;  5IJ0 B;  3I56 F;  2QA4 F;  2CZW A;  4O4H A;  5JQG A;  2H8E A;  3RA5 A;  2IQQ A;  4U3J A;  1Q8R A;  4DRX B;  1J7H A;  1ODE A;  3N2K A;  2BTU A;  1VQP F;  2YYE A;  1GO0 A;  1UI9 A;  5LYJ B;  3GHZ A;  3I7T A;  3V4D A;  1K9M H;  1COM A;  1VHA A;  1JJ2 F;  5EIB C;  3F0F A;  4WBN B;  4TV8 B;  5EZY A;  1JN1 A;  1IV4 A;  1QVF F; 
#chains in the Genus database with same CATH homology
 3GTZ A;  4ZK7 A;  1ONI A;  2CHT A;  3L7Q A;  3ZO8 A;  1JD1 A;  1UFY A;  2UYK A;  3K12 A;  2UYJ A;  1FNK A;  3D01 A;  3K0T A;  2CHS A;  1XRG A;  1X25 A;  1J7H A;  2UYP A;  1ODE A;  2UYN B;  3KJK A;  3M4S A;  1QAH A;  2CW4 A;  1UI9 A;  1DBF A;  2CVL A;  3QUW A;  3R0P A;  3ZP4 A;  3V4D A;  3I7T A;  2CWJ A;  1NQ3 A;  1COM A;  2B33 A;  2DYY A;  3ZP7 A;  1XHO A;  2OTM A;  1QD9 A;  3VCZ A;  4NWO B;  5HP8 A;  5HP7 A;  3M1X A;  3LME A;  1FNJ A;  1QU9 A;  2CSL A;  3LYB A;  2EWC A;  3MQW A;  3ZOP A;  2IG8 A;  3KJJ A;  3I3F A;  2UYN A;  1PF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...