3M1XA

Crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica, rhomobohedral form
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
126
structure length
125
Chain Sequence
SKLTVVASPLAPEAVGAYSQAIICNGVYCSGQIGLDRKTGDFAGKTIEEQSKQVMTNLKYVLEEAGSSMDKVVKTTCLLADIKDFGVFNGIYAEAFGNHKPARACFAAAALPKGALVEVECIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative endoribonuclease L-PSP from Entamoeba histolytica, rhomobohedral form
rcsb
source organism Entamoeba histolytica
molecule tags Unknown function
molecule keywords putative Endoribonuclease L-PSP
total genus 36
structure length 125
sequence length 126
ec nomenclature
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3m1xA00
3M4SA 3LYBA 5HP7A 3M1XA 2CHTA 2CW4A 1ONIA 3KJJA 3ZP4A 1UI9A 2CHSA 1ODEA 2DYYA 2OTMA 3MQWA 2B33A 3I7TA 3R0PA 1QD9A 2CVLA 1FNJA 1QU9A 3GTZA 3D01A 1XHOA 2EWCA 3L7QA 1UFYA 2CSLA 4NWOB 1J7HA 3VCZA 2UYPA 2UYJA 2UYNA 1NQ3A 2CWJA 3LMEA 2IG8A 3V4DA 3ZO8A 1XRGA 5HP8A 2UYNB 1DBFA 1QAHA 4ZK7A 3K12A 1X25A 3I3FA 2UYKA 3ZOPA 3KJKA 1PF5A 3K0TA 3ZP7A 3QUWA 1JD1A 1FNKA 1COMA
chains in the Genus database with same CATH superfamily
4O2BA 5HP7A 3S0WA 5GINC 1KNJA 4B5CA 1W581 3FBAA 4TUYB 1K9MH 1VQVA 2RHOA 1YJ9F 2BTOA 4G4YA 3CC7F 5CA0B 1SDSA 2N48A 3CB2A 3UT5A 5LOVB 1KC8H 4I55A 1DBFA 1TUBB 3K12A 2Z1UA 1H47A 1SA0A 5MN4A 5J2TB 3K0TA 4O4HB 4X20B 2VAMA 1RQ7A 1DT9A 3HKBA 3JVHA 3SIUA 2OTLF 4ZHQB 4O4HA 2KG4A 4I4TA 3I7TA 2EWCA 4EI7A 5GONA 2CSLA 2Z01A 5LP6A 3NK7A 3WGMA 2H8EA 2VAWA 3JALA 1X7OA 4YJ2B 3G71F 2HS0A 1VH8A 2RHLA 5HXZA 3JARB 3JAKA 5LP6B 3CCSF 5GONB 4TV8A 2OTJF 3ZOPA 1Z5VA 5G4VC 1JN1A 1YQNA 3VYUC 1FNKA 3JAWA 2BTQB 3LYBA 5A2QM 3WXMB 1X7PA 5HY1A 5MN6A 2VXYA 3F0DA 5LYJB 3K2XA 2HP0B 1W2BF 1E7KA 1SA0B 1XHOA 1R1MA 1YJNF 4BY9D 1NQ3A 3CMAF 2IAFA 3V4DA 1JY8A 3CCJF 3MBMA 1TVKA 1ZWZA 4B46A 2AIZP 2UYKA 3CCEF 3KJKA 3DC2A 2K1SA 1K8AH 1PF5A 2H6LA 3QHDA 4BW0B 4O4LB 2CZWA 4TUYA 5C8YB 5CA1A 1KNKA 3RYFB 2CHSA 4C8EA 3OW2F 3KE1A 1GO1A 3O85A 3NK6A 4X1IA 3CYPB 3D54A 4YJ3B 5HY2A 3I56F 3U0OA 4BT6A 2UYPA 5IJ0A 5JH7A 1VQ4F 1FFXB 5IYZB 1S72F 1VQPF 2RHHA 2HRUA 3RYIA 1VQ8F 3GYQA 3P0ZA 2VGMA 3CPWF 2ZVZA 5KMGA 1QAHA 5IJ9B 4WBNB 4BT5A 5JCOC 3VI6A 2YXZA 3JAMM 4O4IB 2R751 3WJRA 3F0GA 1H7MA 4NQ3A 1IV3A 4PWTA 3M4SA 4FFBB 5EO3A 4B62A 4O4LA 4G88A 1NMUB 1OAPA 5EWRA 2QA4F 5EAZA 3F0FA 4FFBA 3ESJA 4C81A 4IHJB 4LNUB 5IJ9A 4G4VA 3HKDA 5LXTB 4I50B 3I55F 5FNVB 4WBNA 1FFXA 1QVGF 3VO8A 5IYZA 3S03A 3I3FA 4YJ3A 1YHQF 4EI8A 5FJ4C 5HXUA 4G4WA 2CW4A 2DT4A 4X1KB 3C9TA 2DYYA 5DCVA 1VQ5F 5G4UC 4O2AA 1TVKB 3FFMA 2I6DA 3RYHB 1XBIA 3CG6A 2NMUA 3E20B 4TZZA 5J2UB 5JVDB 3CCLF 4EB6B 3LWQC 3V3TA 2KTVA 3M1XA 1YIJF 1UI9A 3JASA 2GZLA 3TD3A 1VQOF 4BVQA 3IMPA 2ZVYA 3VIUA 5HY4A 4ZHWA 3GTZA 4DRXB 3JAKB 2WALA 3NMUC 3HTNA 3L7QA 1Q7YH 2PHNA 5GIOC 1J7HA 3OBYA 5JQGA 2UYNA 4C8GA 5JQGB 1VQLF 2HVYD 1SZQA 3J80M 3T80A 4C82A 4YJ2A 3KHNA 4KWEA 1VQ6F 4B45A 3F0EA 3IKEA 3JALB 1W5EA 3V7QA 5BMVB 4BT7A 1JJ2F 4DRXA 4I4TB 4U3JB 3LFOA 1COMA 2CHTA 4BVSA 3KJJA 5KX5B 2Q1XA 3S0YA 4G4XA 4X1YA 3EORA 2V9YA 5CB4A 3WJQA 3HKBB 3HAXD 3P10A 3HWUA 1QD9A 2CVLA 3FD5A 1U43A 4E6EA 1XV2A 3HJWC 3OBWA 3VYTC 1RA4A 3WPWA 5BMVA 5LOVA 2CWJA 1CN7A 3M84A 1TUBA 4O2AB 5GANK 5CA0A 1OFUA 1Q81H 4TV9B 1M90H 4BT2A 3N2KB 3CC2F 3F6MA 3LWVC 3CXCF 5EB1B 2HX0A 3AGKA 1RLUA 2GLZA 2IQQA 2Z1EA 4BVRA 3DDNA 5EYPB 4ZHVA 1YJWF 4F6RA 1Q82H 4DXDA 4O2BB 3LWOC 4HNAA 3RYCB 3QTYA 5FNVA 4I50A 5AVMA 2QEXF 3CMEF 5JCOA 3HKEA 1JFFA 4IHJA 4IIJB 3MDOA 1YITF 2Z1TA 2R6R1 3RA5A 3ELCA 5GIPC 1W41A 2KTUA 4O4JA 4ZOLB 3VOAA 2GVIA 1U3LA 1IV1A 1W3EX 2LCAA 1ONIA 3J7AR 1VQNF 2BO1A 1N8RH 4C4WC 5LA6A 2FGYA 2QI2A 4BT4A 3LWPC 4M8IA 4X3MA 4LCKA 3J81M 1VQMF 2OZBA 3S0HA 3RA6A 5KMGB 2IG8A 1W55A 5HWEA 4ZHYB 2ZAUA 3KIZA 5IJ0B 3E22B 3WGLA 4HNAB 3RYCA 2LBWA 2LBTA 3RYFA 2AMTA 3C8LA 3HKCA 4LNUA 4F6RB 5CA1B 3V7EA 1GZ0A 1YGYA 3TD4A 4R40B 4XCQA 1VQKF 1W59A 2ZODA 3ERNA 4TV9A 3C9SA 2AIFA 3N2GA 5EIBC 4ZI7A 5ITZA 3MCQA 1QVFF 3WGNA 4IIJA 3C9RA 5LP6C 3IKFA 3JATA 3CCRF 5B8FA 2Q1YA 3WGKA 5JH7B 3ZP7A 5CB4B 3NVKE 1PXWA 5LYJA 4X1IB 5KX5A 1GO0A 2VAPA 1GX1A 5EYPA 1ODEA 2RB9A 3JAWB 4TV8B 3JARA 2B33A 2LBXA 3CYQA 1X52A 3N2KA 2JNBA 1W5AA 3VCZA 4BVTA 2QTPA 5EB0A 1XRGA 3CPQA 3QUWA 3CCVF 1Q8RA 1T0KB 3JCMM 1RQ2A 3PAFA 3S06A 1IPAA 4EB6A 5J2TA 2ALEA 3FPIA 1K73H 3Q8HA 4U3JA 3N4ZA 5IT9M 4I55B 3G6EF 1FNJA 3D01A 2ZOVA 2P6YA 3G4SF 3LWRC 3FD6A 3RE3A 3TD5A 3LDTA 4BT3A 3CD6F 1VHAA 2BTUA 5MN5A 1W5BA 2UYNB 1KD1H 3D00A 2OHWA 3OONA 1X25A 3NVIB 1M1KH 2FC3A 3ON1A 1VQ9F 1JD1A 1Q86H 4X1KA 4ERHA 2KGWA 3JASB 3P4EA 4ZHQA 3IEWA 3GHZA 5EIBD 3SIVA 1T0AA 2HRYA 4X20A 1QU9A 3K14A 4RQOA 3CCQF 4NWOB 3CCMF 5JVDA 1IV4A 5J2UA 3JATB 1W5FA 1W42A 3VMFB 3RYHA 3HKDB 5HP8A 4ZK7A 5ITZB 3N2GB 4ZI7B 2YYEA 3UT5B 5EZYA 3E1YA 1U40A 3WJPA 5FLXM 1FSZA 2F9ZC 1CLIA 3B6NA 1CK2A 4RHAA 3S02A 3CC4F 2HS4A 3BYQA 2W8BC 2HQSC 3ZP4A 2MQEA 4NUTA 3IR9A 3IEQA 4C8IA 2ZF8A 2OTMA 2Z1FA 3R0PA 2HS3A 3HKCB 3E22A 1VQ7F 3PLAC 2G9IA 2UYJA 3RYIB 1VK3A 3LMEA 3VTIC 3N4YA 3ZO8A 1Z5WA 5LXTA 1U3PA 5LA6B 4EI9A 3WGJA 3WPXA 3CCUF 1RLGA 1W40A 1W57A 5C8YA 2RHJA 5GAPK 4X3LA 5EZYB 3MQWA 2VGNA 1IV2A 4O4IA 1H48A 4ZOLA 1UFYA 4O4JB 3HKEB 1YI2F 1NJIH 2HP3A 4U39A 4G4ZA 2I6RA 3VYSC 2PMPA 1JFFB 1KQSF 2UZHA 3VOBA 3C9UA 2H8CA 2HP0A 2L26A 4X1YB 3MCAB 5HY0A
chains in the Genus database with same CATH topology
3M4SA 3LYBA 5HP7A 3M1XA 2CHTA 2CW4A 1ONIA 3KJJA 3ZP4A 1UI9A 2CHSA 1ODEA 2DYYA 2OTMA 3MQWA 2B33A 3I7TA 3R0PA 1QD9A 2CVLA 1FNJA 1QU9A 3GTZA 3D01A 1XHOA 2EWCA 3L7QA 1UFYA 2CSLA 4NWOB 1J7HA 3VCZA 2UYPA 2UYJA 2UYNA 1NQ3A 2CWJA 3LMEA 2IG8A 3V4DA 3ZO8A 1XRGA 5HP8A 2UYNB 1DBFA 1QAHA 4ZK7A 3K12A 1X25A 3I3FA 2UYKA 3ZOPA 3KJKA 1PF5A 3K0TA 3ZP7A 3QUWA 1JD1A 1FNKA 1COMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4S A;  3LYB A;  5HP7 A;  3M1X A;  2CHT A;  2CW4 A;  1ONI A;  3KJJ A;  3ZP4 A;  1UI9 A;  2CHS A;  1ODE A;  2DYY A;  2OTM A;  3MQW A;  2B33 A;  3I7T A;  3R0P A;  1QD9 A;  2CVL A;  1FNJ A;  1QU9 A;  3GTZ A;  3D01 A;  1XHO A;  2EWC A;  3L7Q A;  1UFY A;  2CSL A;  4NWO B;  1J7H A;  3VCZ A;  2UYP A;  2UYJ A;  2UYN A;  1NQ3 A;  2CWJ A;  3LME A;  2IG8 A;  3V4D A;  3ZO8 A;  1XRG A;  5HP8 A;  2UYN B;  1DBF A;  1QAH A;  4ZK7 A;  3K12 A;  1X25 A;  3I3F A;  2UYK A;  3ZOP A;  3KJK A;  1PF5 A;  3K0T A;  3ZP7 A;  3QUW A;  1JD1 A;  1FNK A;  1COM A; 
#chains in the Genus database with same CATH topology
 4O2B A;  5HP7 A;  3S0W A;  5GIN C;  1KNJ A;  4B5C A;  1W58 1;  3FBA A;  4TUY B;  1K9M H;  1VQV A;  2RHO A;  1YJ9 F;  2BTO A;  4G4Y A;  3CC7 F;  5CA0 B;  1SDS A;  2N48 A;  3CB2 A;  3UT5 A;  5LOV B;  1KC8 H;  4I55 A;  1DBF A;  1TUB B;  3K12 A;  2Z1U A;  1H47 A;  1SA0 A;  5MN4 A;  5J2T B;  3K0T A;  4O4H B;  4X20 B;  2VAM A;  1RQ7 A;  1DT9 A;  3HKB A;  3JVH A;  3SIU A;  2OTL F;  4ZHQ B;  4O4H A;  2KG4 A;  4I4T A;  3I7T A;  2EWC A;  4EI7 A;  5GON A;  2CSL A;  2Z01 A;  5LP6 A;  3NK7 A;  3WGM A;  2H8E A;  2VAW A;  3JAL A;  1X7O A;  4YJ2 B;  3G71 F;  2HS0 A;  1VH8 A;  2RHL A;  5HXZ A;  3JAR B;  3JAK A;  5LP6 B;  3CCS F;  5GON B;  4TV8 A;  2OTJ F;  3ZOP A;  1Z5V A;  5G4V C;  1JN1 A;  1YQN A;  3VYU C;  1FNK A;  3JAW A;  2BTQ B;  3LYB A;  5A2Q M;  3WXM B;  1X7P A;  5HY1 A;  5MN6 A;  2VXY A;  3F0D A;  5LYJ B;  3K2X A;  2HP0 B;  1W2B F;  1E7K A;  1SA0 B;  1XHO A;  1R1M A;  1YJN F;  4BY9 D;  1NQ3 A;  3CMA F;  2IAF A;  3V4D A;  1JY8 A;  3CCJ F;  3MBM A;  1TVK A;  1ZWZ A;  4B46 A;  2AIZ P;  2UYK A;  3CCE F;  3KJK A;  3DC2 A;  2K1S A;  1K8A H;  1PF5 A;  2H6L A;  3QHD A;  4BW0 B;  4O4L B;  2CZW A;  4TUY A;  5C8Y B;  5CA1 A;  1KNK A;  3RYF B;  2CHS A;  4C8E A;  3OW2 F;  3KE1 A;  1GO1 A;  3O85 A;  3NK6 A;  4X1I A;  3CYP B;  3D54 A;  4YJ3 B;  5HY2 A;  3I56 F;  3U0O A;  4BT6 A;  2UYP A;  5IJ0 A;  5JH7 A;  1VQ4 F;  1FFX B;  5IYZ B;  1S72 F;  1VQP F;  2RHH A;  2HRU A;  3RYI A;  1VQ8 F;  3GYQ A;  3P0Z A;  2VGM A;  3CPW F;  2ZVZ A;  5KMG A;  1QAH A;  5IJ9 B;  4WBN B;  4BT5 A;  5JCO C;  3VI6 A;  2YXZ A;  3JAM M;  4O4I B;  2R75 1;  3WJR A;  3F0G A;  1H7M A;  4NQ3 A;  1IV3 A;  4PWT A;  3M4S A;  4FFB B;  5EO3 A;  4B62 A;  4O4L A;  4G88 A;  1NMU B;  1OAP A;  5EWR A;  2QA4 F;  5EAZ A;  3F0F A;  4FFB A;  3ESJ A;  4C81 A;  4IHJ B;  4LNU B;  5IJ9 A;  4G4V A;  3HKD A;  5LXT B;  4I50 B;  3I55 F;  5FNV B;  4WBN A;  1FFX A;  1QVG F;  3VO8 A;  5IYZ A;  3S03 A;  3I3F A;  4YJ3 A;  1YHQ F;  4EI8 A;  5FJ4 C;  5HXU A;  4G4W A;  2CW4 A;  2DT4 A;  4X1K B;  3C9T A;  2DYY A;  5DCV A;  1VQ5 F;  5G4U C;  4O2A A;  1TVK B;  3FFM A;  2I6D A;  3RYH B;  1XBI A;  3CG6 A;  2NMU A;  3E20 B;  4TZZ A;  5J2U B;  5JVD B;  3CCL F;  4EB6 B;  3LWQ C;  3V3T A;  2KTV A;  3M1X A;  1YIJ F;  1UI9 A;  3JAS A;  2GZL A;  3TD3 A;  1VQO F;  4BVQ A;  3IMP A;  2ZVY A;  3VIU A;  5HY4 A;  4ZHW A;  3GTZ A;  4DRX B;  3JAK B;  2WAL A;  3NMU C;  3HTN A;  3L7Q A;  1Q7Y H;  2PHN A;  5GIO C;  1J7H A;  3OBY A;  5JQG A;  2UYN A;  4C8G A;  5JQG B;  1VQL F;  2HVY D;  1SZQ A;  3J80 M;  3T80 A;  4C82 A;  4YJ2 A;  3KHN A;  4KWE A;  1VQ6 F;  4B45 A;  3F0E A;  3IKE A;  3JAL B;  1W5E A;  3V7Q A;  5BMV B;  4BT7 A;  1JJ2 F;  4DRX A;  4I4T B;  4U3J B;  3LFO A;  1COM A;  2CHT A;  4BVS A;  3KJJ A;  5KX5 B;  2Q1X A;  3S0Y A;  4G4X A;  4X1Y A;  3EOR A;  2V9Y A;  5CB4 A;  3WJQ A;  3HKB B;  3HAX D;  3P10 A;  3HWU A;  1QD9 A;  2CVL A;  3FD5 A;  1U43 A;  4E6E A;  1XV2 A;  3HJW C;  3OBW A;  3VYT C;  1RA4 A;  3WPW A;  5BMV A;  5LOV A;  2CWJ A;  1CN7 A;  3M84 A;  1TUB A;  4O2A B;  5GAN K;  5CA0 A;  1OFU A;  1Q81 H;  4TV9 B;  1M90 H;  4BT2 A;  3N2K B;  3CC2 F;  3F6M A;  3LWV C;  3CXC F;  5EB1 B;  2HX0 A;  3AGK A;  1RLU A;  2GLZ A;  2IQQ A;  2Z1E A;  4BVR A;  3DDN A;  5EYP B;  4ZHV A;  1YJW F;  4F6R A;  1Q82 H;  4DXD A;  4O2B B;  3LWO C;  4HNA A;  3RYC B;  3QTY A;  5FNV A;  4I50 A;  5AVM A;  2QEX F;  3CME F;  5JCO A;  3HKE A;  1JFF A;  4IHJ A;  4IIJ B;  3MDO A;  1YIT F;  2Z1T A;  2R6R 1;  3RA5 A;  3ELC A;  5GIP C;  1W41 A;  2KTU A;  4O4J A;  4ZOL B;  3VOA A;  2GVI A;  1U3L A;  1IV1 A;  1W3E X;  2LCA A;  1ONI A;  3J7A R;  1VQN F;  2BO1 A;  1N8R H;  4C4W C;  5LA6 A;  2FGY A;  2QI2 A;  4BT4 A;  3LWP C;  4M8I A;  4X3M A;  4LCK A;  3J81 M;  1VQM F;  2OZB A;  3S0H A;  3RA6 A;  5KMG B;  2IG8 A;  1W55 A;  5HWE A;  4ZHY B;  2ZAU A;  3KIZ A;  5IJ0 B;  3E22 B;  3WGL A;  4HNA B;  3RYC A;  2LBW A;  2LBT A;  3RYF A;  2AMT A;  3C8L A;  3HKC A;  4LNU A;  4F6R B;  5CA1 B;  3V7E A;  1GZ0 A;  1YGY A;  3TD4 A;  4R40 B;  4XCQ A;  1VQK F;  1W59 A;  2ZOD A;  3ERN A;  4TV9 A;  3C9S A;  2AIF A;  3N2G A;  5EIB C;  4ZI7 A;  5ITZ A;  3MCQ A;  1QVF F;  3WGN A;  4IIJ A;  3C9R A;  5LP6 C;  3IKF A;  3JAT A;  3CCR F;  5B8F A;  2Q1Y A;  3WGK A;  5JH7 B;  3ZP7 A;  5CB4 B;  3NVK E;  1PXW A;  5LYJ A;  4X1I B;  5KX5 A;  1GO0 A;  2VAP A;  1GX1 A;  5EYP A;  1ODE A;  2RB9 A;  3JAW B;  4TV8 B;  3JAR A;  2B33 A;  2LBX A;  3CYQ A;  1X52 A;  3N2K A;  2JNB A;  1W5A A;  3VCZ A;  4BVT A;  2QTP A;  5EB0 A;  1XRG A;  3CPQ A;  3QUW A;  3CCV F;  1Q8R A;  1T0K B;  3JCM M;  1RQ2 A;  3PAF A;  3S06 A;  1IPA A;  4EB6 A;  5J2T A;  2ALE A;  3FPI A;  1K73 H;  3Q8H A;  4U3J A;  3N4Z A;  5IT9 M;  4I55 B;  3G6E F;  1FNJ A;  3D01 A;  2ZOV A;  2P6Y A;  3G4S F;  3LWR C;  3FD6 A;  3RE3 A;  3TD5 A;  3LDT A;  4BT3 A;  3CD6 F;  1VHA A;  2BTU A;  5MN5 A;  1W5B A;  2UYN B;  1KD1 H;  3D00 A;  2OHW A;  3OON A;  1X25 A;  3NVI B;  1M1K H;  2FC3 A;  3ON1 A;  1VQ9 F;  1JD1 A;  1Q86 H;  4X1K A;  4ERH A;  2KGW A;  3JAS B;  3P4E A;  4ZHQ A;  3IEW A;  3GHZ A;  5EIB D;  3SIV A;  1T0A A;  2HRY A;  4X20 A;  1QU9 A;  3K14 A;  4RQO A;  3CCQ F;  4NWO B;  3CCM F;  5JVD A;  1IV4 A;  5J2U A;  3JAT B;  1W5F A;  1W42 A;  3VMF B;  3RYH A;  3HKD B;  5HP8 A;  4ZK7 A;  5ITZ B;  3N2G B;  4ZI7 B;  2YYE A;  3UT5 B;  5EZY A;  3E1Y A;  1U40 A;  3WJP A;  5FLX M;  1FSZ A;  2F9Z C;  1CLI A;  3B6N A;  1CK2 A;  4RHA A;  3S02 A;  3CC4 F;  2HS4 A;  3BYQ A;  2W8B C;  2HQS C;  3ZP4 A;  2MQE A;  4NUT A;  3IR9 A;  3IEQ A;  4C8I A;  2ZF8 A;  2OTM A;  2Z1F A;  3R0P A;  2HS3 A;  3HKC B;  3E22 A;  1VQ7 F;  3PLA C;  2G9I A;  2UYJ A;  3RYI B;  1VK3 A;  3LME A;  3VTI C;  3N4Y A;  3ZO8 A;  1Z5W A;  5LXT A;  1U3P A;  5LA6 B;  4EI9 A;  3WGJ A;  3WPX A;  3CCU F;  1RLG A;  1W40 A;  1W57 A;  5C8Y A;  2RHJ A;  5GAP K;  4X3L A;  5EZY B;  3MQW A;  2VGN A;  1IV2 A;  4O4I A;  1H48 A;  4ZOL A;  1UFY A;  4O4J B;  3HKE B;  1YI2 F;  1NJI H;  2HP3 A;  4U39 A;  4G4Z A;  2I6R A;  3VYS C;  2PMP A;  1JFF B;  1KQS F;  2UZH A;  3VOB A;  3C9U A;  2H8C A;  2HP0 A;  2L26 A;  4X1Y B;  3MCA B;  5HY0 A; 
#chains in the Genus database with same CATH homology
 3M4S A;  3LYB A;  5HP7 A;  3M1X A;  2CHT A;  2CW4 A;  1ONI A;  3KJJ A;  3ZP4 A;  1UI9 A;  2CHS A;  1ODE A;  2DYY A;  2OTM A;  3MQW A;  2B33 A;  3I7T A;  3R0P A;  1QD9 A;  2CVL A;  1FNJ A;  1QU9 A;  3GTZ A;  3D01 A;  1XHO A;  2EWC A;  3L7Q A;  1UFY A;  2CSL A;  4NWO B;  1J7H A;  3VCZ A;  2UYP A;  2UYJ A;  2UYN A;  1NQ3 A;  2CWJ A;  3LME A;  2IG8 A;  3V4D A;  3ZO8 A;  1XRG A;  5HP8 A;  2UYN B;  1DBF A;  1QAH A;  4ZK7 A;  3K12 A;  1X25 A;  3I3F A;  2UYK A;  3ZOP A;  3KJK A;  1PF5 A;  3K0T A;  3ZP7 A;  3QUW A;  1JD1 A;  1FNK A;  1COM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...