3M1XA

Crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica, rhomobohedral form
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
126
structure length
125
Chain Sequence
b'SKLTVVASPLAPEAVGAYSQAIICNGVYCSGQIGLDRKTGDFAGKTIEEQSKQVMTNLKYVLEEAGSSMDKVVKTTCLLADIKDFGVFNGIYAEAFGNHKPARACFAAAALPKGALVEVECIATL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Endoribonuclease L-PSP
publication title Crystal structure of a putative endoribonuclease L-PSP from Entamoeba histolytica, rhomobohedral form
rcsb
source organism Entamoeba histolytica
molecule tags Unknown function
total genus 36
structure length 125
sequence length 126
ec nomenclature
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3m1xA00
1QD9A 3GTZA 1XHOA 2CHSA 4NWOB 3ZP7A 3D01A 2UYJA 1COMA 1JD1A 3M4SA 2OTMA 1QU9A 3ZP4A 3K0TA 1UI9A 1ODEA 2CHTA 4ZK7A 1J7HA 3ZO8A 3M1XA 2B33A 3V4DA 3VCZA 3ZOPA 2CWJA 2CW4A 2UYNA 3KJKA 3K12A 1X25A 2UYNB 1FNJA 3MQWA 3I7TA 3I3FA 1XRGA 3L7QA 1FNKA 1ONIA 3LYBA 2CVLA 1PF5A 1NQ3A 1QAHA 2UYKA 3LMEA 1UFYA 3KJJA 2IG8A 5HP8A 2UYPA 3QUWA 2DYYA 1DBFA 3R0PA 2CSLA 2EWCA 5HP7A
chains in the Genus database with same CATH superfamily
1VQ5F 3U0OA 2HRYA 2VAPA 2MQEA 4ZOLB 1Q7YH 5JCOA 3WJPA 3C9UA 4BVQA 1R1MA 3LWRC 2OTJF 1VQLF 2KGWA 3ZOPA 1H7MA 2Z1TA 4O2BA 1JJ2F 3K12A 4EI8A 3N2GB 5FJ4C 1IPAA 3I3FA 2IQQA 2R751 5LA6A 5EWRA 5MN6A 1VH8A 4U39A 5LOVA 1DBFA 1RQ2A 4WBNB 1TUBB 4B45A 1XHOA 5IJ9A 3S0YA 3MDOA 4X1YA 5ITZA 3VI6A 5HY2A 5HY4A 3IEWA 3CC4F 1U43A 3N4ZA 3VOAA 3WJRA 3UT5A 1GZ0A 5MN4A 2BO1A 3FD5A 5LA6B 1YI2F 3NK6A 3CCSF 3CPWF 2BTOA 5LOVB 3MCAB 1VQKF 3MCQA 1UFYA 2IG8A 4BT5A 3LWVC 5GINC 4NWOB 2F9ZC 5J2TA 5IJ9B 1W581 3RYCA 2HP0A 3D00A 4X1YB 3WPXA 5ITZB 2CHTA 2CWJA 3VIUA 3IMPA 4LNUA 5LXTB 3UT5B 1W5EA 1VQOF 2BTQB 1ONIA 2WALA 3WGNA 5EYPA 2CVLA 3VO8A 1PF5A 1SDSA 4G4WA 4O4IA 3QUWA 3I55F 3VCZA 4TV9A 3IKEA 5GANK 1W3EX 2DT4A 4B62A 5J2TB 1W5BA 4C8GA 1YJNF 3RYCB 2HP0B 5LP6C 4YJ2B 1S72F 4G4YA 1OFUA 5BMVA 4BY9D 1XV2A 2AIZP 2GZLA 3E22B 3ESJA 3HKBB 5AVMA 3S06A 3JAKA 4ZHYB 5HWEA 1TVKA 2UYNA 3HKEA 2RHOA 3KJKA 4C4WC 1Z5VA 4LNUB 3CD6F 2Q1YA 5FNVA 5EYPB 4TZZA 5HXUA 2AMTA 1VQVA 3KJJA 3OBYA 5JQGA 4O4IB 1K8AH 5HY0A 5HY1A 3OONA 4TV9B 3JCMM 3CCMF 1GX1A 4G88A 3T80A 3ELCA 4EI9A 1VQNF 3G6EF 2UYJA 2QI2A 4C8IA 2I6RA 3P4EA 5C8YB 4IHJA 5BMVB 3TD5A 2JNBA 2H8EA 5IYZA 1KD1H 3JAKB 2YYEA 1TVKB 5GIPC 4U3JB 5CA0A 1FFXA 3DDNA 3JALA 3FFMA 4BVTA 5FNVB 5LYJA 1SZQA 3WGLA 2UYKA 2ALEA 5G4UC 2PMPA 5JQGB 2DYYA 2ZOVA 3NMUC 1YJWF 4C8EA 2RHJA 3CG6A 2CHSA 3CC2F 3ZP7A 3F6MA 3J7AR 1QU9A 4G4VA 1QVGF 2I6DA 1CK2A 3CC7F 3E20B 1YGYA 4IHJB 2FC3A 2ZVYA 1RLUA 5IYZB 3JARA 3Q8HA 1FNJA 4ERHA 3I7TA 5CB4B 4ZHVA 5CA0B 1FNKA 1NMUB 3JALB 2ZVZA 1GO0A 2HS4A 4RHAA 3LMEA 3F0EA 1YITF 1KNJA 2W8BC 3WGMA 1ZWZA 2K1SA 3FD6A 1CN7A 4X1KA 3S0WA 1NJIH 1JD1A 3NVIB 3LWQC 4F6RA 1RQ7A 5LP6A 2QA4F 3KE1A 1E7KA 3JAWA 4DRXA 2HS3A 3RYHA 2VGMA 5IJ0A 4C82A 4O2BB 4O4JA 3V3TA 4C81A 2OZBA 2UZHA 4I4TA 3RA5A 3J80M 1W40A 4BT6A 3S03A 3N4YA 2RHLA 3AGKA 2LBXA 5HP8A 1Z5WA 5J2UA 3WGJA 2H6LA 3VYSC 3R0PA 3FPIA 1IV3A 3I56F 4X1KB 4BW0B 3VOBA 1W55A 5A2QM 2VAWA 3RYFA 4F6RB 5LP6B 1VHAA 1X7OA 1W57A 5FLXM 3JAWB 3C9RA 3LWPC 3C9TA 3SIVA 3RYHB 5IJ0B 3PAFA 4O4JB 3HTNA 3SIUA 2YXZA 4I4TB 5EZYA 3LYBA 4B46A 1XBIA 4BT7A 3G71F 2H8CA 2Z01A 1VK3A 1H48A 1W59A 3OW2F 3RYFB 3CPQA 4EI7A 1U3LA 5GONA 3TD4A 4ZHWA 1VQMF 1KC8H 3OBWA 4TUYA 1M90H 3EORA 2FGYA 1T0AA 5EZYB 5KX5A 3CCQF 2IAFA 1JFFA 1W5AA 4O4HA 2UYPA 3FBAA 5KMGA 3ERNA 4X3MA 1K9MH 3GTZA 1U3PA 3C8LA 3O85A 2HP3A 4O2AA 1K73H 4ZHQA 1J7HA 3GHZA 5EB0A 2V9YA 3HKDA 3N2KA 4X1IA 1N8RH 2G9IA 1QVFF 5GONB 4EB6A 2HX0A 4X20A 2UYNB 3HKEB 3WXMB 1VQ8F 5HXZA 2HS0A 3C9SA 5KX5B 3CCVF 1QAHA 3RYIA 1JFFB 4R40B 5EIBD 3CB2A 3V7QA 4LCKA 3ON1A 2CSLA 3E1YA 3RA6A 4G4ZA 5MN5A 1VQ7F 2HQSC 4O2AB 2AIFA 3M4SA 4ZHQB 1JY8A 5DCVA 3HKDB 3N2KB 4X1IB 3TD3A 4NQ3A 4EB6B 3IR9A 1X7PA 1IV1A 4I50A 3P0ZA 4X20B 4B5CA 3G4SF 1FFXB 3LDTA 2OHWA 5LYJB 1VQ4F 3RYIB 3CMEF 3PLAC 3QTYA 3VTIC 1VQ9F 1U40A 2Z1FA 4FFBA 2VXYA 1H47A 1RA4A 3J81M 5EIBC 3K0TA 1ODEA 3WJQA 3ZO8A 2B33A 3JAMM 1YIJF 4BT3A 3RE3A 4I50B 3JARB 1IV4A 3MQWA 1KQSF 2Q1XA 5EAZA 2L26A 2LCAA 2LBTA 5JVDA 5CA1A 2OTLF 1FSZA 1YQNA 3HWUA 5GIOC 3CCJF 2ZAUA 5HP7A 4FFBB 1QD9A 4DXDA 2ZF8A 1IV2A 5G4VC 3CCLF 4I55A 3M1XA 5B8FA 2PHNA 3CCRF 1KNKA 2GLZA 3D54A 2ZODA 3WGKA 4DRXB 3QHDA 2NMUA 1OAPA 5LXTA 2VAMA 2QEXF 3LFOA 1W5FA 3LWOC 3JVHA 2HRUA 4M8IA 3KIZA 1CLIA 2VGNA 5JVDB 2P6YA 5CA1B 1NQ3A 3VMFB 5J2UB 3CCEF 5JCOC 1COMA 4BVRA 1Q8RA 2CZWA 4YJ2A 1UI9A 3JASA 3K14A 4O4LA 4ZK7A 3CMAF 4I55B 3E22A 1PXWA 4NUTA 3V4DA 2QTPA 5JH7A 3HKBA 3CCUF 1VQ6F 5EB1B 1X25A 2KG4A 2Z1UA 4G4XA 4BT4A 1X52A 3HKCA 3MBMA 3VYTC 3M84A 4BT2A 4ZI7A 3B6NA 4YJ3A 1DT9A 3S0HA 1Q86H 2OTMA 5C8YA 3F0DA 3JASB 4O4LB 2LBWA 1SA0A 4IIJA 1VQPF 5JH7B 1W2BF 4U3JA 4BVSA 1RLGA 4RQOA 4HNAA 4PWTA 4TUYB 3BYQA 4XCQA 1XRGA 4TV8A 3CYQA 2R6R1 3HJWC 3F0FA 3HKCB 2GVIA 3VYUC 2Z1EA 3NVKE 2RB9A 1Q81H 3JATA 4O4HB 2N48A 1YHQF 3IEQA 2HVYD 5KMGB 3DC2A 3V7EA 3IKFA 4ZI7B 3D01A 4YJ3B 2BTUA 3KHNA 4ZOLA 3CXCF 3CYPB 3ZP4A 4X3LA 2KTVA 5EO3A 1SA0B 4IIJB 5GAPK 4KWEA 1T0KB 3S02A 3K2XA 1M1KH 1Q82H 2CW4A 3HAXD 1YJ9F 3N2GA 4HNAB 5CB4A 1W42A 3P10A 4E6EA 2RHHA 3L7QA 4TV8B 5IT9M 1W41A 3GYQA 1GO1A 3F0GA 2KTUA 3WPWA 1JN1A 3JATB 3NK7A 2EWCA 4WBNA 1TUBA
chains in the Genus database with same CATH topology
1QD9A 3GTZA 1XHOA 2CHSA 4NWOB 3ZP7A 3D01A 2UYJA 1COMA 1JD1A 3M4SA 2OTMA 1QU9A 3ZP4A 3K0TA 1UI9A 1ODEA 2CHTA 4ZK7A 1J7HA 3ZO8A 3M1XA 2B33A 3V4DA 3VCZA 3ZOPA 2CWJA 2CW4A 2UYNA 3KJKA 3K12A 1X25A 2UYNB 1FNJA 3MQWA 3I7TA 3I3FA 1XRGA 3L7QA 1FNKA 1ONIA 3LYBA 2CVLA 1PF5A 1NQ3A 1QAHA 2UYKA 3LMEA 1UFYA 3KJJA 2IG8A 5HP8A 2UYPA 3QUWA 2DYYA 1DBFA 3R0PA 2CSLA 2EWCA 5HP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QD9 A;  3GTZ A;  1XHO A;  2CHS A;  4NWO B;  3ZP7 A;  3D01 A;  2UYJ A;  1COM A;  1JD1 A;  3M4S A;  2OTM A;  1QU9 A;  3ZP4 A;  3K0T A;  1UI9 A;  1ODE A;  2CHT A;  4ZK7 A;  1J7H A;  3ZO8 A;  3M1X A;  2B33 A;  3V4D A;  3VCZ A;  3ZOP A;  2CWJ A;  2CW4 A;  2UYN A;  3KJK A;  3K12 A;  1X25 A;  2UYN B;  1FNJ A;  3MQW A;  3I7T A;  3I3F A;  1XRG A;  3L7Q A;  1FNK A;  1ONI A;  3LYB A;  2CVL A;  1PF5 A;  1NQ3 A;  1QAH A;  2UYK A;  3LME A;  1UFY A;  3KJJ A;  2IG8 A;  5HP8 A;  2UYP A;  3QUW A;  2DYY A;  1DBF A;  3R0P A;  2CSL A;  2EWC A;  5HP7 A; 
#chains in the Genus database with same CATH topology
 1VQ5 F;  3U0O A;  2HRY A;  2VAP A;  2MQE A;  4ZOL B;  1Q7Y H;  5JCO A;  3WJP A;  3C9U A;  4BVQ A;  1R1M A;  3LWR C;  2OTJ F;  1VQL F;  2KGW A;  3ZOP A;  1H7M A;  2Z1T A;  4O2B A;  1JJ2 F;  3K12 A;  4EI8 A;  3N2G B;  5FJ4 C;  1IPA A;  3I3F A;  2IQQ A;  2R75 1;  5LA6 A;  5EWR A;  5MN6 A;  1VH8 A;  4U39 A;  5LOV A;  1DBF A;  1RQ2 A;  4WBN B;  1TUB B;  4B45 A;  1XHO A;  5IJ9 A;  3S0Y A;  3MDO A;  4X1Y A;  5ITZ A;  3VI6 A;  5HY2 A;  5HY4 A;  3IEW A;  3CC4 F;  1U43 A;  3N4Z A;  3VOA A;  3WJR A;  3UT5 A;  1GZ0 A;  5MN4 A;  2BO1 A;  3FD5 A;  5LA6 B;  1YI2 F;  3NK6 A;  3CCS F;  3CPW F;  2BTO A;  5LOV B;  3MCA B;  1VQK F;  3MCQ A;  1UFY A;  2IG8 A;  4BT5 A;  3LWV C;  5GIN C;  4NWO B;  2F9Z C;  5J2T A;  5IJ9 B;  1W58 1;  3RYC A;  2HP0 A;  3D00 A;  4X1Y B;  3WPX A;  5ITZ B;  2CHT A;  2CWJ A;  3VIU A;  3IMP A;  4LNU A;  5LXT B;  3UT5 B;  1W5E A;  1VQO F;  2BTQ B;  1ONI A;  2WAL A;  3WGN A;  5EYP A;  2CVL A;  3VO8 A;  1PF5 A;  1SDS A;  4G4W A;  4O4I A;  3QUW A;  3I55 F;  3VCZ A;  4TV9 A;  3IKE A;  5GAN K;  1W3E X;  2DT4 A;  4B62 A;  5J2T B;  1W5B A;  4C8G A;  1YJN F;  3RYC B;  2HP0 B;  5LP6 C;  4YJ2 B;  1S72 F;  4G4Y A;  1OFU A;  5BMV A;  4BY9 D;  1XV2 A;  2AIZ P;  2GZL A;  3E22 B;  3ESJ A;  3HKB B;  5AVM A;  3S06 A;  3JAK A;  4ZHY B;  5HWE A;  1TVK A;  2UYN A;  3HKE A;  2RHO A;  3KJK A;  4C4W C;  1Z5V A;  4LNU B;  3CD6 F;  2Q1Y A;  5FNV A;  5EYP B;  4TZZ A;  5HXU A;  2AMT A;  1VQV A;  3KJJ A;  3OBY A;  5JQG A;  4O4I B;  1K8A H;  5HY0 A;  5HY1 A;  3OON A;  4TV9 B;  3JCM M;  3CCM F;  1GX1 A;  4G88 A;  3T80 A;  3ELC A;  4EI9 A;  1VQN F;  3G6E F;  2UYJ A;  2QI2 A;  4C8I A;  2I6R A;  3P4E A;  5C8Y B;  4IHJ A;  5BMV B;  3TD5 A;  2JNB A;  2H8E A;  5IYZ A;  1KD1 H;  3JAK B;  2YYE A;  1TVK B;  5GIP C;  4U3J B;  5CA0 A;  1FFX A;  3DDN A;  3JAL A;  3FFM A;  4BVT A;  5FNV B;  5LYJ A;  1SZQ A;  3WGL A;  2UYK A;  2ALE A;  5G4U C;  2PMP A;  5JQG B;  2DYY A;  2ZOV A;  3NMU C;  1YJW F;  4C8E A;  2RHJ A;  3CG6 A;  2CHS A;  3CC2 F;  3ZP7 A;  3F6M A;  3J7A R;  1QU9 A;  4G4V A;  1QVG F;  2I6D A;  1CK2 A;  3CC7 F;  3E20 B;  1YGY A;  4IHJ B;  2FC3 A;  2ZVY A;  1RLU A;  5IYZ B;  3JAR A;  3Q8H A;  1FNJ A;  4ERH A;  3I7T A;  5CB4 B;  4ZHV A;  5CA0 B;  1FNK A;  1NMU B;  3JAL B;  2ZVZ A;  1GO0 A;  2HS4 A;  4RHA A;  3LME A;  3F0E A;  1YIT F;  1KNJ A;  2W8B C;  3WGM A;  1ZWZ A;  2K1S A;  3FD6 A;  1CN7 A;  4X1K A;  3S0W A;  1NJI H;  1JD1 A;  3NVI B;  3LWQ C;  4F6R A;  1RQ7 A;  5LP6 A;  2QA4 F;  3KE1 A;  1E7K A;  3JAW A;  4DRX A;  2HS3 A;  3RYH A;  2VGM A;  5IJ0 A;  4C82 A;  4O2B B;  4O4J A;  3V3T A;  4C81 A;  2OZB A;  2UZH A;  4I4T A;  3RA5 A;  3J80 M;  1W40 A;  4BT6 A;  3S03 A;  3N4Y A;  2RHL A;  3AGK A;  2LBX A;  5HP8 A;  1Z5W A;  5J2U A;  3WGJ A;  2H6L A;  3VYS C;  3R0P A;  3FPI A;  1IV3 A;  3I56 F;  4X1K B;  4BW0 B;  3VOB A;  1W55 A;  5A2Q M;  2VAW A;  3RYF A;  4F6R B;  5LP6 B;  1VHA A;  1X7O A;  1W57 A;  5FLX M;  3JAW B;  3C9R A;  3LWP C;  3C9T A;  3SIV A;  3RYH B;  5IJ0 B;  3PAF A;  4O4J B;  3HTN A;  3SIU A;  2YXZ A;  4I4T B;  5EZY A;  3LYB A;  4B46 A;  1XBI A;  4BT7 A;  3G71 F;  2H8C A;  2Z01 A;  1VK3 A;  1H48 A;  1W59 A;  3OW2 F;  3RYF B;  3CPQ A;  4EI7 A;  1U3L A;  5GON A;  3TD4 A;  4ZHW A;  1VQM F;  1KC8 H;  3OBW A;  4TUY A;  1M90 H;  3EOR A;  2FGY A;  1T0A A;  5EZY B;  5KX5 A;  3CCQ F;  2IAF A;  1JFF A;  1W5A A;  4O4H A;  2UYP A;  3FBA A;  5KMG A;  3ERN A;  4X3M A;  1K9M H;  3GTZ A;  1U3P A;  3C8L A;  3O85 A;  2HP3 A;  4O2A A;  1K73 H;  4ZHQ A;  1J7H A;  3GHZ A;  5EB0 A;  2V9Y A;  3HKD A;  3N2K A;  4X1I A;  1N8R H;  2G9I A;  1QVF F;  5GON B;  4EB6 A;  2HX0 A;  4X20 A;  2UYN B;  3HKE B;  3WXM B;  1VQ8 F;  5HXZ A;  2HS0 A;  3C9S A;  5KX5 B;  3CCV F;  1QAH A;  3RYI A;  1JFF B;  4R40 B;  5EIB D;  3CB2 A;  3V7Q A;  4LCK A;  3ON1 A;  2CSL A;  3E1Y A;  3RA6 A;  4G4Z A;  5MN5 A;  1VQ7 F;  2HQS C;  4O2A B;  2AIF A;  3M4S A;  4ZHQ B;  1JY8 A;  5DCV A;  3HKD B;  3N2K B;  4X1I B;  3TD3 A;  4NQ3 A;  4EB6 B;  3IR9 A;  1X7P A;  1IV1 A;  4I50 A;  3P0Z A;  4X20 B;  4B5C A;  3G4S F;  1FFX B;  3LDT A;  2OHW A;  5LYJ B;  1VQ4 F;  3RYI B;  3CME F;  3PLA C;  3QTY A;  3VTI C;  1VQ9 F;  1U40 A;  2Z1F A;  4FFB A;  2VXY A;  1H47 A;  1RA4 A;  3J81 M;  5EIB C;  3K0T A;  1ODE A;  3WJQ A;  3ZO8 A;  2B33 A;  3JAM M;  1YIJ F;  4BT3 A;  3RE3 A;  4I50 B;  3JAR B;  1IV4 A;  3MQW A;  1KQS F;  2Q1X A;  5EAZ A;  2L26 A;  2LCA A;  2LBT A;  5JVD A;  5CA1 A;  2OTL F;  1FSZ A;  1YQN A;  3HWU A;  5GIO C;  3CCJ F;  2ZAU A;  5HP7 A;  4FFB B;  1QD9 A;  4DXD A;  2ZF8 A;  1IV2 A;  5G4V C;  3CCL F;  4I55 A;  3M1X A;  5B8F A;  2PHN A;  3CCR F;  1KNK A;  2GLZ A;  3D54 A;  2ZOD A;  3WGK A;  4DRX B;  3QHD A;  2NMU A;  1OAP A;  5LXT A;  2VAM A;  2QEX F;  3LFO A;  1W5F A;  3LWO C;  3JVH A;  2HRU A;  4M8I A;  3KIZ A;  1CLI A;  2VGN A;  5JVD B;  2P6Y A;  5CA1 B;  1NQ3 A;  3VMF B;  5J2U B;  3CCE F;  5JCO C;  1COM A;  4BVR A;  1Q8R A;  2CZW A;  4YJ2 A;  1UI9 A;  3JAS A;  3K14 A;  4O4L A;  4ZK7 A;  3CMA F;  4I55 B;  3E22 A;  1PXW A;  4NUT A;  3V4D A;  2QTP A;  5JH7 A;  3HKB A;  3CCU F;  1VQ6 F;  5EB1 B;  1X25 A;  2KG4 A;  2Z1U A;  4G4X A;  4BT4 A;  1X52 A;  3HKC A;  3MBM A;  3VYT C;  3M84 A;  4BT2 A;  4ZI7 A;  3B6N A;  4YJ3 A;  1DT9 A;  3S0H A;  1Q86 H;  2OTM A;  5C8Y A;  3F0D A;  3JAS B;  4O4L B;  2LBW A;  1SA0 A;  4IIJ A;  1VQP F;  5JH7 B;  1W2B F;  4U3J A;  4BVS A;  1RLG A;  4RQO A;  4HNA A;  4PWT A;  4TUY B;  3BYQ A;  4XCQ A;  1XRG A;  4TV8 A;  3CYQ A;  2R6R 1;  3HJW C;  3F0F A;  3HKC B;  2GVI A;  3VYU C;  2Z1E A;  3NVK E;  2RB9 A;  1Q81 H;  3JAT A;  4O4H B;  2N48 A;  1YHQ F;  3IEQ A;  2HVY D;  5KMG B;  3DC2 A;  3V7E A;  3IKF A;  4ZI7 B;  3D01 A;  4YJ3 B;  2BTU A;  3KHN A;  4ZOL A;  3CXC F;  3CYP B;  3ZP4 A;  4X3L A;  2KTV A;  5EO3 A;  1SA0 B;  4IIJ B;  5GAP K;  4KWE A;  1T0K B;  3S02 A;  3K2X A;  1M1K H;  1Q82 H;  2CW4 A;  3HAX D;  1YJ9 F;  3N2G A;  4HNA B;  5CB4 A;  1W42 A;  3P10 A;  4E6E A;  2RHH A;  3L7Q A;  4TV8 B;  5IT9 M;  1W41 A;  3GYQ A;  1GO1 A;  3F0G A;  2KTU A;  3WPW A;  1JN1 A;  3JAT B;  3NK7 A;  2EWC A;  4WBN A;  1TUB A; 
#chains in the Genus database with same CATH homology
 1QD9 A;  3GTZ A;  1XHO A;  2CHS A;  4NWO B;  3ZP7 A;  3D01 A;  2UYJ A;  1COM A;  1JD1 A;  3M4S A;  2OTM A;  1QU9 A;  3ZP4 A;  3K0T A;  1UI9 A;  1ODE A;  2CHT A;  4ZK7 A;  1J7H A;  3ZO8 A;  3M1X A;  2B33 A;  3V4D A;  3VCZ A;  3ZOP A;  2CWJ A;  2CW4 A;  2UYN A;  3KJK A;  3K12 A;  1X25 A;  2UYN B;  1FNJ A;  3MQW A;  3I7T A;  3I3F A;  1XRG A;  3L7Q A;  1FNK A;  1ONI A;  3LYB A;  2CVL A;  1PF5 A;  1NQ3 A;  1QAH A;  2UYK A;  3LME A;  1UFY A;  3KJJ A;  2IG8 A;  5HP8 A;  2UYP A;  3QUW A;  2DYY A;  1DBF A;  3R0P A;  2CSL A;  2EWC A;  5HP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...