1JFFB

Refined structure of alpha-beta tubulin from zinc-induced sheets stabilized with taxol
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
426
structure length
426
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structure of alpha beta-tubulin at 3.5 A resolution.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords tubulin alpha chain
total genus 113
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2001-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1jffB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1jffB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1jffB01
5CB4B 3VO8A 3RYCB 3N2KA 1TVKA 3VPAA 2BTQA 4X1YB 5J2UB 5IJ9A 1W5AA 5JH7B 2RHLA 2VAPA 5JQGA 3JAWB 5GONA 4ZI7B 3RB8A 1JFFA 2VAMA 4X20A 5J2TB 4IIJB 3RYHA 4ZHQB 2RHJA 5BMVA 5IJ0A 5MN6A 3RYIB 4XCQA 4TUYA 5EYPB 5LXTB 1Z5WA 4U39A 5C8YB 3HKEB 5CB4A 4ZOLA 4I55A 1FFXA 4YJ2B 2VXYA 3RYFA 3E22B 3WGKA 5KX5B 5LP6A 2RHOA 5CA0B 1TVKB 3M8KA 4ZI7A 5EZYA 3C8LA 3HKDB 3RYIA 5LOVB 3JAWA 3VOAA 4O4HB 5MN4A 5J2TA 1W581 4O2AA 3JASA 3VOBA 5C8YA 5LP6C 4HNAA 3JARA 4EI9A 3RYFB 4DRXA 4X20B 5IJ9B 5MN5A 1RQ2A 4F6RB 4O4LA 2RHHA 5ITZB 3ZBPA 3UT5A 4E6EA 3HKBA 4I50B 4IIJA 1RLUA 4M8IA 4O4JA 3HKEA 1TUBB 5LYJB 5LOVA 4O4IB 3HKCB 1OFUA 4B46A 3JASB 1W5BA 3ZIDA 5CA1B 4YJ3B 3R4VA 1FFXB 4YJ2A 1W5EA 1W5FA 1SA0A 2VAWA 4EI8A 4EI7A 3JALA 4LNUB 3WGNA 4O4LB 4WBNA 4IHJA 2R751 5FNVA 3HKBB 5JVDB 5IYZB 3M89A 5EIBD 4DRXB 3JAKA 4KWEA 4F6RA 4EB6A 4O2BB 3V3TA 4I4TA 3VO9A 3ZBQA 4O4IA 3JARB 3N2GB 4TV8B 5LA6B 4O2AB 4TV9A 5KMGB 4X1KB 4DXDA 1TUBA 5LYJA 3JATB 2Q1XA 4HNAB 5ITZA 4X1IB 4FFBA 3N2KB 3UT5B 3HKCA 4U3JA 4I50A 3JALB 2GVIA 4YJ3A 5EIBC 5JH7A 1RQ7A 4IHJB 2BTQB 4X1YA 5J2UA 4O4JB 5CA1A 5IJ0B 1Z5VA 3WGLA 5FNVB 5JVDA 3WGMA 5JCOC 5LXTA 3JAKB 1FSZA 4EB6B 5BMVB 1SA0B 2BTOA 3WGJA 4TUYB 5EYPA 4LNUA 3JATA 3RYCA 4ZOLB 4TV8A 5JQGB 4TV9B 1JFFB 5KMGA 4O2BA 5KX5A 4WBNB 5LP6B 2R6R1 4I55B 5M7EA 5GONB 5IYZA 4U3JB 1W59A 3E22A 3N2GA 5LA6A 4B45A 5EZYB 3RYHB 4ZHQA 3HKDA 4I4TB 2XKAA 5CA0A 2Q1YA 5JCOA 4FFBB 4X1IA 4O4HA 2XKBA 4X1KA 3CB2A
chains in the Genus database with same CATH superfamily
2LFRA 5CYGA 2GSMB 2UXDB 3W9UA 3R24A 3UBMA 4G4SP 621PA 5L40A 3FYCA 1BA3A 2QG4A 3FR7A 1MX3A 1K7XB 1G41A 1CF9A 1IHUA 3KT6A 1F6WA 2I8LA 4MKIA 3KU4A 2CL5A 4R5HA 4UBNA 4F56A 4BMYA 1K9SA 5C93A 5BSRA 4AJPA 4CLDA 4EA7A 1VF6C 1BQZA 3KKKA 1HYHA 4K5QA 2LTAA 2PZMA 4QUIA 4ZV7A 1JNXX 1PZMA 2HDNB 2NVOA 4FEEA 4HNGA 3ETEA 1G1MA 3G8CA 1QVRA 4U7TB 4DMKA 3F7YC 4ZQHA 1Z15A 4FLEA 5LGUA 5CCXA 1KYYA 4DCNA 1MEEA 3A3NA 5CA1F 4CG2A 3O9MA 2ZRGA 1OXMA 3OWXA 4K3UA 2B20A 4ZQGA 3W2HA 4OGLA 2KS6A 4RY8A 4S3MA 1BXKA 1WMAA 1TT5B 5LMUO 1GQSA 4RCVA 2QVZX 1ZKMA 1TCAA 2X5NA 3B9BA 2PVCA 1JIVA 2H51A 2WW8A 1QTNA 4DLWA 2JARA 2MMCA 3LAWA 3K0TA 4IY1A 1FF9A 1I7NA 4LJ4A 2VCYA 1NBME 2MR6A 3QVLA 4X61A 4TQDA 3I5AA 1R6XA 3U7GA 5AUOB 4L8GA 1QIJA 2A5YB 3G49A 5CM2Z 1KDOA 3MB8A 4L3WA 5DDIP 1PJ4A 2RGYA 2RC5A 4XVUA 3NHLA 3UPUA 2ZJFA 3TKAA 1UP4A 2VYVD 4JLNA 5KTTA 3HFSA 2Z6QA 4HQFA 3P10A 1V5WA 1XF1A 5JANA 3HKEA 1ZAUA 3PLAC 2I6QA 4RADA 3CCQF 2VHWA 4RIHA 1HKUA 2HP8A 4CT5A 3HR4A 1KR2A 2D7CA 4KMRA 3S44A 3ZN1A 3WHLA 1I4LD 3H17A 2NZ2A 4KO3S 2VRZA 5KHJA 5FIUA 2QT0A 4PGMA 3C45A 1Q0SA 2WM2A 3OM1A 3PQ3A 5LBUA 2GZRA 1UMCA 3P9SA 4D6YA 2FUG6 1V8ZA 1MC4A 1NLZA 2E4ZA 3R6LA 4MYDA 3RSCA 2MT9A 4YHHO 4MJXA 3U16A 3OQOA 4NYKA 2IYQA 4PYKA 3D54A 2G1KA 2JCXA 2PXCA 1SBCA 4YJFB 3ZVMA 2GK3A 3ZWBA 3WFIA 4KRGA 5DBGA 3ZYCA 4LYDA 3TECE 2L6LA 3PSHA 3ZS8C 2Q3EA 3L0SA 4N1AA 1TTTA 2ZZMA 5CLLA 1KQSU 4PZAA 5B7PA 4JTAB 5H02A 2P7TC 4UVCA 2YY6A 4EFMA 1BRMA 5KTRA 3OP1A 3KZ1E 5EK0A 1UDBA 4LYEA 3TBHA 3WIBA 2DYSC 1E1LA 2YXEA 1NP6A 3P45A 4RKFA 2ZRHA 4UEQA 1F38A 1SC1A 4M6WA 3H65A 4J7JA 3IUJA 1GNPA 1ZD9A 1PV4A 1E2BA 1ULAA 1SOAA 4OD0A 1MC8A 5GADl 2O6LA 4LFBO 5HXZA 1PS8A 3OE4A 3Q9SA 3KCXA 4P86A 1U11A 4CKCB 2E21A 3WWCA 4Y2QA 2XTNA 3AVTA 4JB0A 5FR1A 2HO5A 1Q77A 1XDZA 3D64A 1GM8A 3ZMTA 1P4SA 3P8ZA 4LY6A 2Z1TA 1QLNA 4NUTA 5G1PA 2OWEA 2F17A 5F1PA 3RV4A 4AG3A 4MV4A 3IEMA 4WBNB 3QELB 4Q4JB 4W4LA 2YICA 1N2BA 2XWQA 2BMDA 2XRMA 2VTEA 2YWEA 4GOKA 3Q8MA 4D7AA 3X3HA 2AI1A 1XTBA 1F0KA 1K73H 1LBTA 3FLEA 4Y1GA 5GZ6A 5CEEA 1F7VA 2YTZA 2QPTA 4Y6QA 3F78A 3ILYA 3ANLA 5DCVA 4B3JA 3BD8A 4NBSA 5HNKA 2JZCA 1M66A 4UHCA 1MGPA 2O4CA 4BEVA 3NXKA 2GM5A 3CMEV 1UM8A 1X7WB 2EWVA 3IT2A 1P5ZB 1VPVA 2CWJA 4AS2A 4WQMA 3VPDA 1P45A 1C80A 2NV6A 4J2HA 2VAMA 4PZUA 3BWVA 1PZGA 4GP6A 4IOKA 4BYGA 1ICIA 2R65A 4MP3A 3RK0A 2AFHE 4F45A 3JD4A 4F4JA 3L7NA 1K9VF 2F3UA 2J5BA 3S02A 2V6MA 2A0XA 1JHQA 1YBHA 4Q0MA 1RWXA 2V6IA 5DMHA 4L16A 5JT1A 3RAEC 1XKTA 5GINC 4CETA 1YI2F 4YJHA 4DMUB 3GLGE 1I7PA 5JISA 5E6SA 5TQJA 5C1DA 4YXFA 5F2VO 4OQNA 1JN0A 3AEIA 3VYTC 1P2UA 1V7ZA 3W2EA 1F23A 2R1ZA 1P91A 3NKFA 1RXSA 5LQNA 4GX2A 3WRWA 2PDAA 3ZOKA 3FFAA 2O52A 1IH8A 3I5MA 2I78A 3RRFA 1ZN7A 1YRAA 1ONOA 2PSFA 3X2FA 3SX2A 2IS1A 1P7BA 5B1BB 4ZU6X 2X2EA 4A03A 5EZSA 1KERA 3LY5A 2FPGA 1QR8A 3SYKA 1B6TA 3WTCA 1RRGA 4UFOA 4KDRA 2G38A 1KS9A 3CF4G 3DE5X 5TX7A 3QEMA 3M5WA 1FDRA 3DWFA 1EM8A 4G56A 4NULA 1IBKO 4FW8A 1BHJA 3T3GA 2EF1A 2XOKG 1G4HA 1KEKA 4JAUA 2CK3A 4E14A 1WX1A 4IT5A 4UDOA 2P6NA 2BFWA 3BSSA 4YLEA 4R2LA 1ESNA 1DAMA 3AFNA 3Q0IA 4RABA 3M6XA 3R7LA 1ZQ1A 2GERA 2FR8A 4FHZA 4BEJA 5I4CA 1OCRC 3BCCH 2BJVA 3HI4A 1LV7A 1UBMS 5BOVA 5HG0A 3AM3A 2GHRA 5FNVF 2NO0A 3ZDZB 3SY8A 4U3FH 1U2ZA 2V5VA 3OGCC 4IMIB 4GOJA 2FNAA 4UD6A 3T34A 4F1KA 1EDEA 3K8ZA 5B1YA 4ZTUB 1RRKA 1QRSA 3N75A 4FGLA 3FMVA 2LE0A 3V4LA 1WHTB 4I6GA 3IUMA 3D2AA 1UK9A 1KKDA 2ZJ7A 4MGKR 5C0OE 2OCCB 3V3TA 1SBTA 1XFDA 2FPPB 3AR2A 1X8JA 4N12A 4QELA 3DAYA 4Y6SA 2J9ZB 4EFBA 1HZZC 2A84A 4IHJF 5C3UA 5IT9A 4RHTA 4BQIA 4GYJA 1DDIA 2CV0A 5BR7A 1LBIA 4AO8A 1E9CA 4LZNA 1G8GA 1E6CA 1GEGA 4OPHA 1T4GA 2HA4A 2QRGA 4WKCA 3TQIA 2VNJA 2X7XA 1DO0A 2IH1C 1USVA 3VPCA 4BB5A 5BNTA 4LQ4A 3NC4A 3ZLVA 2NUAB 2E9SA 2QTNA 2QX9A 3Q3GE 3KEQA 4OYRA 4ZKEA 3GLFE 3IVAA 4QT0A 3MCWA 4UXJA 1EHCA 1F1BA 1BS1A 2IV2X 1PM9A 2PTMA 1V8FA 5TJHA 4DVJA 4OU4A 4PC6A 3HAXD 3VVCA 3KXPA 5I7OA 2C3MA 2V7UA 1CLEA 3VR4H 3U39A 2XQFA 3OCYA 2VA8A 4FMCB 4PE5B 4DV3O 2WZBA 4LFAB 4MS1A 1KI2A 1YCHA 4ZREA 1ST3A 3G9QA 2VYND 4I0XB 4JYMA 3B13B 1B42A 3M1IA 3IRVA 4J4BA 1KJZA 4UE3S 1XALA 2NWQA 2BDTA 3EY9A 4ZT7A 2Z2IA 3JZDA 2FWPA 4WKBA 2CC2A 3JZIA 2FKXA 3PEVA 4RYDA 4XX0A 1W73A 3DP9A 1SK9A 3GGDA 4Y7CA 1LDMA 2YINC 5K1XA 3E8HA 3BXEA 4KKVA 4PZ9A 5EP2A 1B8UA 5D3KA 4KAFA 2J41A 4RY2A 3HJHA 1YB4A 3V7UA 1WF6A 4Q9AA 2UU9B 4H7KA 3EZLA 3UXHA 5B3SB 4ESEA 3AVYA 4XCQA 3QLJA 1NLMA 3MMZA 1O97C 1F17A 2EZOA 4X8AA 3EWIA 5LSAA 3ED5A 1PI3A 3WMFA 2P62A 4DZZA 2QRQA 3EG9A 1N1EA 2XB6A 2AWNA 5D84A 3DDHA 1FFXA 1QIKA 2XMDA 5SYAA 1YHQF 1BGVA 1TAHA 1YB7A 1DLIA 1YS9A 1QNFA 1ZLYA 2JIOA 3CLSD 1DT3A 2KKWA 4X9QA 2ZJ8A 1NBOA 3HN2A 1A98A 1NU8A 1OFIA 2R87A 4DV0B 2A58A 1N8RH 1M8KA 2GCEA 4EMUA 3GRKA 4GC9A 4UM8B 2DYRB 3BDAA 3J81A 1JJVA 4GSLA 3H1LH 2VS0A 1ACMA 2OOKA 4KZKA 3K32A 2Z1FA 5BSTA 2R4UA 4UQPA 4BT7A 1AUPA 1VKZA 3R9IA 3VGJA 4IYHA 1MZFA 2FPWA 2Q5HA 3P27A 3SKXA 3C6YA 3VU3A 4WNYA 4D0NA 5KTYA 3MHTA 1BEZA 3V6LA 1D0SA 4DR7O 2R6GA 4Q4AA 1NHGA 2JFQA 1KJWA 3DF9A 3DJFA 5KHKA 3OQJA 1W5SA 4RK0A 4DXAA 2HIGA 2RKOA 3M5PA 4C7XA 1T91A 1WB9A 4YRCA 3MWGA 3ZQ4A 5HKLA 3HFRA 1CRPA 1QONA 2O2SA 2HUPA 5IHXA 3RV3A 2OBMA 4P36A 3GZTB 4PFSA 4Q1EA 5EL0A 5IWAO 3V9PA 4D8YA 3OQBA 4GW3A 2IH2A 4RTMA 3W6ZA 4AN4A 2O2EA 1AUQA 1Q0HA 5EHGA 5FLXN 1HURA 1ZTEA 2YS6A 3A1VA 4HZ3A 4RGQA 3O8CA 2ZUEA 1E3QA 1D2HA 2HLNA 3BK7A 4FSHA 5TGZA 2QBYA 2YR0A 1NH2D 3M84A 1EESA 1POXA 3RDPA 5IU6A 4NR1A 1Z07A 2PUTA 2HDOA 4K2HA 3AG1B 3TEJA 4AY6A 1F2UA 3HP1A 2GPSA 3U7QB 4EKGA 4ND7A 5CFZA 9LDBA 4DA6A 4Z2YA 3KQLA 4IXNA 2DAPA 3RFXA 3VNVA 1K63A 3H2ZA 1RAHA 1V16B 3ML0A 4MR9B 1N7GA 2BHRA 1KORA 3IGFA 2X19A 1ODIA 5JS1A 2SCUB 3NDJA 4HMQA 4JOQA 4QLOA 3SR0A 3TVTA 5LGTA 1H2HA 4HRVA 4MV7A 2C2YA 3AV3A 1OILA 4QUBA 1VP3A 3QVWA 3SYCA 1XTTA 1RKVA 2P30A 2Z2YA 5C32A 2I4MA 1PL6A 2BUBA 2PKQO 1NURA 3NP9A 3TZLA 3DLCA 2IIQA 2EULA 1O5OA 3H9EO 3K9BA 1AI5A 3IOEA 1FCJA 2XUFA 3O4FA 5EP4A 4HFMA 3U7EB 4YFYA 1YUMA 3MN1A 5KWJA 3THOA 3HJWC 1KDTA 1VPLA 1HR0B 1WQ4A 2IWRA 2HO4A 3H5WA 2NNWB 4FZ5A 3EQZA 3V8EA 1ZD4A 3UWMA 5IT5A 1KJQA 5IEBA 4IX9A 1D6NA 1ADJA 3OBWA 2YV1A 3THYA 1RYEA 3H42B 5HKKD 1P7GA 2PRZA 3TR5A 4C4XA 1PEYA 2R6R1 4AK9A 3ABTA 2W6JD 3GH1A 2UZHA 4YAUA 1SRQA 1JSXA 2FXVA 2DOSA 3CISA 4BQNA 1XZ8A 1Z8HA 3KU1A 3PI7A 3G2IA 4GRIA 3FOFC 1AV6A 4R1MA 2ATVA 1CS4C 3M1XA 3A1DA 4BVQA 3KHSA 4Q9DA 3Q5DA 3ANTA 4AYXA 2DTXA 2H6LA 5BWNA 1AP5A 2O50A 3FCAA 4LF7O 1WQ1R 3A6HA 3SDZA 2CDNA 2IYSA 3OEED 4S1NA 3DL2A 5JI3E 4RV4A 1XHLA 5JH7B 4BJ5A 2XZLA 4DO2A 1GG9A 5LQJA 3Q7PA 1RLTA 2Q8QA 4Q15A 3ZC3A 3VOTA 2OLJA 3GGSA 5H5JA 1TVEA 4PA6A 1ND6A 4DREA 1ILEA 1ABBA 3WA7A 4MCAA 5T4HA 4DV6B 2XT6A 3KQTA 3C8ZA 2ZTVA 3NHJA 1H65A 2XYRA 3V4FA 5CB4A 5CLQA 1SRRA 4EB8A 1CEXA 2WM3A 1B14A 3N8DA 5HFJA 1JTFA 2C03A 1NMEA 1AQUA 4BP9A 3F6PA 4W9MC 3NHSA 3LHSA 1A71A 1Y7LA 4R2HA 3OZXA 4UXHA 4NS4A 4LRSB 1JQ0A 3B4SA 4HTFA 2SHKA 4F97A 1JJAA 4AECA 1VSTA 2BKLA 4BGDA 2WLHA 4UU1A 1ISFA 1SF9A 1JHDA 1IN8A 4HC4A 2M98A 2H00A 3K0BA 2QRJA 4Q9LA 3VOBA 3CRZA 2BJHA 4UEKA 3X1WA 3B8EA 3O3NB 4PC7A 4MQFA 5KC9A 3OM3B 1A8IA 1CG6A 2XUQA 3FB5C 5IJ9B 1BO6A 4KQ9A 1VHLA 4M89A 2QM8A 5GMOA 3RQIA 2YXBA 5DCLA 3F96A 4RVDA 4ARZB 3GJ7A 4BNWA 4C7JA 1I0LA 3IHKA 2UU9O 3QFHA 1K6EA 3IURA 4DR2O 2VAXA 4QARA 2PT5A 4YUVA 2BEVB 1D2EA 2QSZA 2V65A 4ZK2A 3L8YA 4GXQA 4BFZA 1A0OA 4RMNA 2KLBA 1HNWB 4JN6B 3FD5A 5SICE 2DCUA 1VLLA 1SPXA 2IBMA 2DJIA 3FOBA 1FDIA 1E2FA 1F7UA 4EELA 3QKRB 2PJUA 4B9EA 3UKOA 2YYEA 4TQ9A 1D4FA 1JVNA 1E3EA 1LRKA 2QT1A 3I6MA 1JYFA 1SU8A 2ZS9A 3E81A 2I80A 5AXAA 1K8AW 1ZVJA 2XE4A 3B2QA 3BDIA 3ZCXA 5B1OA 5EQJB 1TGYA 1Y74B 4JYYA 1NR5A 3C7KA 4DLRA 1SKAA 5H70A 2R9RB 5GANK 2PXAA 5TS2A 3OEEA 4C76A 4HF7A 3MS7A 3F9IA 7ABPA 4DXDA 3A3OA 2WJZB 3AL2A 4D9HA 1SBIA 1IJFA 4LE1A 2XUPA 2ZVPX 2MCFA 1O8BA 1DX9A 1NTOA 1O2DA 5TNXA 4EFKA 2CVZA 2DYRC 4BNYA 5IMBA 5HGJA 2DCMA 5IHPA 3OMIB 3UJBA 5BP7A 1QC5B 4Y2VA 3SFTA 3HVHA 2ID4A 3MMSA 3EMVA 4EY8A 4TYYA 2Z8ZA 3PN1A 3N1UA 5JROA 1WP8A 1QNMA 2D13A 1TPZA 4L6CA 1JV2B 3TG2A 4GGOA 1K6JA 4EHHA 4K26A 3TCNA 1JHUA 4KAXA 4KO1S 3RROA 2VPIA 4GMHA 2CH7A 1FL9A 5BMOA 2IVZA 4NI5A 4ZI2A 5KSYA 5L45A 5K0TA 3KSAC 1JXOA 4BNFA 3K4HA 4E94A 1TZMA 2TECE 1KMHA 2Y1LA 4IQFA 4V0MA 3S2EA 5GIPE 1LPBB 1K8RA 3E22A 5JCZA 1NF2A 2IYPA 3NBAA 4R69A 5TY0A 2HU5A 1KJ8A 2EGGA 2O0JA 3F8TA 1JQAA 3P2YA 1XDCA 1S2IA 3AEQB 4RD4A 5FB3A 5BURA 2PS9A 3OZRA 1R0WA 1TT5A 3MS2A 2V6JA 4KXFB 4F4HA 5BN3B 2PJRA 3PP8A 3C5VA 1QO0D 4G3XA 1FPOA 3CYFA 3C4VA 2CFOA 3K59A 4J6EA 4PYLA 1KNJA 2EBUA 2P6YA 1FFHA 4JI4B 1UDAA 5I5GA 2C7VA 1KA9H 3BFVA 4C0QC 3WVNA 3MHPA 4NX2A 1R3KC 3CJQA 1JFFA 4QBGB 1EP9A 4JAVA 2PUHA 3SXUA 5DNAA 3AONB 3GVXA 3I01A 2XEDA 3D1JA 4IZ6A 4LYHA 3LL4A 3BFKA 2ILMA 1DL5A 3IV7A 1XBIA 5E9QA 5BV2P 3N4ZA 1OB2A 1Z6PA 3G0OA 3KALA 3MGBA 4ISBA 4YIPA 1EZ4A 1NQUA 1TQDA 2ORYA 1Z6ZA 2WILA 5EXDA 3SIXA 3W1WA 4ZOLA 2O8DB 4R40A 5I7FA 1N4CA 4RORA 3TQTA 4K1XA 2FQXA 1HLFA 3GRAA 4LZOA 2G82A 2GB4A 1R3IC 2Q2QA 3L7LA 3WHPA 4XQGA 3AVXA 3FKSG 4X7MA 5TPWB 5ADVA 4DKJA 2IZ7A 5CGZA 1HQYE 5JJNB 3PFIA 3WNDA 2JD2A 4F5WA 1Q1BA 4YJDA 3AVUA 5LOVB 4J7XA 3ME5A 1MW9X 3QXSA 2AQKA 3ZHXA 1PG2A 3F2IA 4A16A 2ZTMA 3O0DA 2F3SA 3N2YA 3DDZX 4LDRA 4AJLA 2HG5C 4ASUG 1BE0A 5KOJA 2AMVA 3NHWA 3T35A 1JZQA 2GBGA 1RXVA 3DAPA 2PUSA 4HGRA 1GN3A 3T4UA 3TE6A 2GCOB 1NP7A 3JD0A 1HFKA 4WA8A 1UBJS 1KXZA 4ENSA 4OGKA 4NWOB 3C3SA 2F1MA 2J4FA 2QRLA 2ZUCA 3LO8A 3O26A 4M2LA 3AW9A 3EYWA 4BIUA 4JAVC 4OHUA 4ZIRA 1TUBB 5LYJB 2HMTA 4YB8A 2Q5QA 1PQPA 4TMFA 4YGYA 5F77A 5J43A 2NU6A 1NMSA 1EK5A 2IYUA 2R6FA 4DYHA 3LWPC 1ADBA 2YN0A 5LUBA 3ZNPA 4YTEA 2WUGA 4YV7A 2P40A 1XMQO 1HI9A 1Q7EA 2CF6A 4R81A 4ZVLA 2ZGVA 3ML1A 1EUCB 2EP7A 2QDXA 4YXWD 2YHAA 4H1WA 2YC0A 3BK2A 2A7XA 2DECA 4GF5A 4WN9B 2CL6X 5A4IS 3VU8A 2BCCH 1A5AB 3NAMA 4QUDA 4M7PA 3NVKI 1H4TA 2OO7A 1ENPA 3SQMA 3LYAA 4QPDA 1YGYA 2HNAA 5C52B 1GA4A 1ZNWA 3ITDA 3LOQA 3VZCA 3SPJA 3I5DA 1IUOA 1TUEA 5K3OA 1ZJWA 3C16C 2I3GA 3BXFA 2QGNA 1HDZA 2EBFX 2HCFA 1L3CA 3EH2A 4KP4A 3LI2A 3TEFA 3U7JA 3V2GA 3A11A 3UW3A 3ILVA 3HKCA 3VKWA 5EIXA 1CQIB 3B48A 3OQ1A 1XCMA 4X3PA 2H9IA 4U0KA 2R72A 3I56V 2P3LA 3CQ9A 3OSZA 2E85A 2IV3A 3TYXA 3GROA 1RXUA 4C0LA 4F3NA 3IQZA 3M9XA 2XMCA 4B9AA 1KVQA 2O7VA 4BNIA 5BWLA 5J47A 4D4GA 2X41A 4Z4CA 4EA8A 4UMFA 1H8HD 3T7JA 2PY6A 3I2HA 1WMSA 4OJYA 2BEUB 5J4HA 1EGAA 1UBNA 3HFJA 3DT9A 4MQ5A 4BOYA 3MJRA 4RZ2A 3QQPA 2BTOA 1WNFA 1FLNA 3GL9A 4YWHA 4YMHA 4J0FA 3BHMA 1UIMA 3L5KA 3V1NA 3VHQA 1EK6A 2GA8A 3F0EA 1QCCA 2PUAA 4TL9A 5CIWA 1Y63A 1N5IA 4DT1B 3LY8A 4LRXA 3KELA 3SHTA 1ZMOA 2H1OA 2QKCA 4E6PA 4NBUA 2ZNJA 2EW8A 1QHYA 1L5HA 5DTJA 4ER0A 1Z2AA 4CGZA 2TRSB 4IGEA 5LZ9A 1ZNZA 3BICA 4PLHA 1VJCA 4UULA 4HY3A 3TGUH 1FKAO 2PBFA 4J07A 3VR3D 2CGEA 4DSOA 2JRIA 1PFUA 2JCYA 1JDBC 3D7RA 5CVCA 2WWYA 2BZGA 3PNKA 4FLTA 1NJ8A 4W1PA 1MO6A 1LBQA 1NN3A 1QZXA 2NZYA 2WICA 2P9JA 4HEHA 4ND4A 4PHGA 4D1YA 5DMXA 3EGXA 1ZGHA 3EGCA 1K0FA 2HM7A 4DY4A 2YOFA 3C98A 1UBFA 3D4OA 4ER3A 1ODLA 4EB3A 2D1RA 1ESEA 1QLEC 1LUAA 4D8XA 3B8NA 4ZYZA 5KZMB 2ZDIC 3LCVB 3FA2A 4FMDF 4B4VA 4HK4A 4ADSG 1RCTE 1QYWA 3JSNA 1GQQA 1RKUA 1YZVA 4AZWA 3D8BA 1IATA 3V7YA 1CUHA 1W4RA 1JFLA 2YWDA 3NHFA 3Q88A 2IZZA 3LUFA 3QLTA 2QWNB 4KLZA 3BWMA 4TT8A 4X7RA 4DRZA 4G27B 1CB0A 1QRDA 2NYAA 2ZXEA 3FPCA 3GEPA 3ISTA 3Q10A 1VQOF 3SCZA 2DC1A 3JXEA 1O54A 4L9WA 5K8JB 5T5QA 4H37A 1DC7A 4C6TB 2VSFA 1RAGA 2IA5A 4X44A 4EF5A 2W43A 5CCBA 5B6JA 5EWJB 3RRJA 1U2RA 2WHPB 1KI3A 1G2PA 3NEAA 1PJ3A 2FSHA 2X5XA 3EBPA 4XA8A 1PL0A 1MABA 5B6PA 1ISSA 821PA 3RUIA 3RI3A 5JZVA 2M7WA 2RAUA 3L0IB 3CD6F 4C7VA 2FFQA 4FWBA 3LNNA 4ZI7F 2RJ3A 3B20A 1AROP 1XZEA 2YIJA 3FKJA 3L06A 4FW9A 4KBFA 3DBRA 4FK8A 4B2LA 4C7KA 4ECAA 1H2NA 1Y1TA 1RLUA 2ZYSA 4L22A 4IIBA 1QFYA 1DJQA 1ZPDA 2V96A 5JPCA 4DV2O 4DWWA 1ZRHA 3SE7A 3MA0A 3FUXA 1YHQV 1G21B 1X1QA 3M6FA 1V1RB 2N75A 1PQWA 1ZA2A 4H6VA 1JJ7A 4NLLA 1ANKA 3JCZA 1K89A 4QQFA 1W5FA 1XOUA 1T5TA 3MTIA 3L7OA 3N59A 4R7GA 2G6TA 1NGSA 5A4DA 2WQ6A 1JLHA 3E35A 1J6UA 1Q6UA 2X4LA 4AJIA 3IHWA 1WA8B 3ZWAA 3GLIB 3E03A 4NV3A 4PAQA 3WDKA 3I62A 3KJHA 2HA7A 5DEOA 1Z28A 1ZWZA 2WUFA 4ND5A 3UG7A 2ZQMA 3RGWS 2Q0AA 3HZHA 2N05A 4DMMA 4G8CA 4JGGA 3VSEA 3WMRA 5MGBA 2P7IA 1J97A 1E0DA 5D2CA 2Q3MA 4E5SA 2A3QA 4CZZA 2RGUA 4PHFA 3OMAB 2Z4SA 4MKGA 3L7BA 1FPQA 1RYHA 3FTCA 1QU3A 4LNAA 3V4RA 1JXAA 4JMLA 4JAAA 3MFYA 2CVPA 1CYDA 4IDBA 4C14A 1ODTC 4I7ZB 5HMLA 5AW2A 1Z6XA 4NTYA 4D3XA 1I1HA 1CS0A 1IYZA 4M7RA 2CE7A 3KB2A 2YC4C 3BQNB 4KQMA 3SD7A 5BVGA 4P1ZA 1S9HA 3IEKA 5CLFA 1TJ4A 3B89A 4ZEWA 4DBLC 1DB3A 4P83A 1E64A 5LMNO 3F0DA 4CW7A 1ECGA 4RVOA 3S0JA 3K0SA 2AR7A 1OZAA 2CLLB 1C3OA 1NQAO 5FBQB 3VR4D 5JMTA 3OE7G 3CRRA 4JI0B 1XO1A 3DVQX 4UCQA 4FSDA 4M22A 2VSNA 1PF7E 1SB9A 1KAGA 2TSYB 3BRWA 1PUJA 2DFNA 4A0QA 5T6BA 4RYLA 4NFSA 1WETA 3PLNA 3NK7A 3CCCA 2G1PA 5G2OA 5KVVA 4L73A 2VSYA 4HRAA 5E7JA 4FCTA 2BTQA 1YI8A 1H3EA 4LRTB 2ZXUA 1LY1A 1NOIA 2PWPA 1QK4A 1K6IA 2PTGA 3GLFB 3A2FA 1LV8A 2G9QA 3BHPA 4FN5A 1W3EX 1JG4A 3DBLA 2QA5A 2DT5A 4X90A 1T9CA 3L1IA 4DCUA 1XL6A 3DCNA 2GXSA 4N41A 4P98A 1F06A 2ZM5A 4L2IB 4JI2B 1T5BA 3BL5A 5B5SA 1QGED 1MKYA 3IQDB 3U3OA 2D2EA 1VQ4V 3QH4A 2AHOA 2EJBA 4BBZA 5J2TF 4JNKA 1VB3A 1DWPA 1RI4A 1CP9A 2O7SA 4C6HA 1GFZA 1U1DA 3BMCB 3RUAA 5EJ2A 1QV6A 1HSZA 3IULA 4RF3A 4BB9A 3JWIA 2QZPA 1WHSA 4TVBA 1E79A 3LFHA 2O2CA 3BRWD 2CY0A 5DRTA 5L3DA 1A76A 4DA8A 4JI7B 3NC0C 1N77A 1E3DA 3IAAA 1RQLA 4EGJA 4ZWNA 1M34A 2E82A 4P30A 1HYQA 4OQDA 1VCHA 3B85A 3MJFA 4ER5A 1JSLA 1GPLA 2W5UA 3ZD9A 1WZ2A 4CNBA 4I9WA 1N5OX 1Q0RA 4UUAA 3ISJA 2GAAA 4J3NA 1XEFA 3RODA 1JEYA 4EPYA 1YJNV 1IHPA 1DG3A 3A6EA 1JEDA 3LPAA 1XYYA 2C3OA 1O9HA 4BVSA 1DZ3A 1K5GA 4IVPA 5CFLA 1HLDA 2P69A 3I6QA 3UN1A 1RA4A 2QAIA 2R7MA 3I0NA 5FQNA 4A2CA 3K7EA 3V8VA 3PC6A 2V7QG 3VYUB 1ZL8A 1J1IA 1GN9A 4L74A 4PY2A 4JZ2A 1XTUA 5BV8A 4DR5O 3ZY4A 4CLHA 2JD1A 3OR7C 4B3SO 1JDUA 3C48A 5ARBA 3AG1C 1CZOA 5EIFA 4A23A 1Y3DE 3NM6B 5GGYA 4QTYA 1VJ5A 4IZOA 2ODQA 2Q9AA 1XTRA 1XLUA 4TMZA 2DPXA 4ZT2A 3ICEA 4Q6GA 3GNLA 1WMFA 2I71A 3PF9A 3MMXA 5K8UA 4FOTA 3U7RA 3P4EA 3H2GA 3T5AA 3MJHA 2FEAA 3C3DA 3I4FA 3AUKA 1GKFA 3RBZA 2R6HA 3FDZA 5BQFA 5JD6A 4YJKA 3IR5A 3UKJA 4P2ZA 4BPRA 4AM8A 2GXQA 4K0KO 1J2YA 4DXHA 2HL6A 5C9ZA 4NFHA 5CXSA 1P1JA 3JATB 3WAKA 2XOEA 2JAHA 3Q11A 3N2KB 4LTDA 4EZIA 1E1YA 1I3LA 5EE1A 3CE2A 3LC0A 3UUWA 5HQ3B 3KQOA 2ODEA 1QP0A 1UMCB 4GMFA 3ZZNA 3CYOA 4FD2A 4N0QA 3VC7A 2OHWA 1XAGA 2G1AA 5E2IA 4XLZA 1JDJA 3OIDA 5A1JA 1DQYA 2Q6VA 2HBYA 1KF0A 1ONIA 1RZVA 1CR2A 3A6LA 4G0NA 1VKOA 2EDCA 2FN7A 3GPIA 4IQ4A 4OUDB 2NZJA 3L9XA 3WWZA 2WJYA 1TJNA 3IUYA 4OAPA 3L4JA 2BYTA 5ARCA 3H2KA 2G3YA 2CLMB 3HZZA 4HOYA 2YW2A 4IDAA 5FEUA 5AI6A 2E5LO 4GOLD 1RPAA 2Y76A 4GU5A 4LBVA 4B2PA 1AX9A 2X40A 3WY9A 4TKMA 4F9EA 4Z7JA 3S03A 1GZ7A 2WVAA 2NAFA 5BZBA 3NJ4A 4OFWA 1SD5A 2HPHA 3TR0A 1NQOA 3VZSA 4UCXA 4HBNA 4AICA 2X8AA 2BM1A 2JIZA 3DMTA 1T5EA 2EQ5A 4PIVA 4JL5A 3B1VA 3N2EA 4KR3A 3MELA 2PD6A 4JBLA 1SVSA 2M6SA 3FTQA 1Z88A 2Q4BA 1B3QA 4K9KA 4YQEA 4O29A 5EVJA 2V1UA 1A4UA 1P19A 3EQ9A 4H13B 4NIMA 4D42A 5MN6A 2ES4A 4H7DA 3V80A 3SVTA 1Q1NA 3B6JA 1G0NA 5BW5A 3N58A 1KPIA 3OOJA 3PC2A 4NH0A 4LVCA 2ZUTA 4XBFA 2H1SA 3QPBA 2QT9A 3ET4A 2CJFA 2V55B 5M34A 1SEPA 1XB2A 3Q7TA 2BM9A 3OF3A 3TLMA 1E1CA 5EVCA 3USES 1SCUB 1E61A 3M6LA 3PXDA 3SX0A 3WX0A 2RHCA 2ZYUX 2OBFA 5HXAA 2P9GA 4D4JA 1FNSA 4N01A 1LXCA 1NSFA 1VCIA 2KSQA 3H6HA 3Q3HA 1VLHA 2Q3CA 2XCLA 2YWFA 4J0GA 4UE2A 3ONFA 3R6WA 1Q5OA 3FI0A 1ZK0A 4G0OA 4QULA 2J0QA 3MJCA 4LS3A 4FJ0A 4YIOA 1B74A 1IG0A 4HCJA 5K3FB 3RT3C 3RJTA 1QVGU 3PUZA 1HL7A 3F1LA 2P4VA 4GSKA 1F7YA 1JDZA 2IY8A 2OHIA 1GLNA 3CR3C 3GJ4A 4R71A 4PFQA 2VRNA 4FFNA 4RCZA 2ONCA 3TL3A 1KO4A 5TQ0A 2ZR0A 4LMAA 4WLUA 3D5EA 4ZXFA 1RPNA 3J80A 3W05A 5BYKA 3TCKA 2AOTA 2GYVA 1T9HA 5IT9M 1R9MA 2R8XA 2H1WA 2AC2A 2P8JA 4L6AA 2BUAA 1GO1A 5H83A 5MFZA 1KI6B 3HR8A 4K9OA 3S3TA 2CKDA 4P3XA 1QP7A 1WCIB 4G1MB 4CMEA 4UM9D 4U1RA 1W75A 5AHRA 4BFUA 3BD6A 2J8ZA 3JQ9C 1SG6A 3CX5F 1TQ4A 2QA4F 4KMSA 3NHKA 4KB5A 4OXRA 1UEJA 3JQAD 3AHGA 2P9CA 1N7JA 2G76A 4KPYA 1KZ6A 1DK1A 4RH1A 4KRXA 3SFZA 3MSXA 4HVLA 1K97A 5E0KB 5LP6F 1H4QA 5E6UB 1N9GB 4ZVPA 1E5XA 4KGDA 3ZIUA 4FPPA 1HSOA 1IE3A 1UKEA 3B40A 2ANCA 2V9CA 2C61A 3O4JA 4TKVB 1E9DA 3IEQA 1VKHA 2DQSA 3USCS 1AS0A 3AEUA 1SCIA 1QP8A 1TCCA 3BVPA 4JOBA 3CW8X 5JH7A 3PFKA 1LNZA 1K7CA 3LM8A 2PLNA 2VP6A 1E3JA 3GBVA 3HPRA 4U8HA 2JIQA 4WCFA 3NBXX 5CVDA 3U5ZB 3X2EA 5JJBA 3MJ4A 2XGOA 4OQZA 4QTUB 4AZTA 2VZ9A 2INGX 3A2NA 1HEIA 3HWUA 2CNKA 2FW1A 3IPRA 4EB6B 1FFTB 2ERXA 4JB3A 1EUZA 3BL6A 3EY4A 3PHLA 4BNLA 4BBAA 5KNCA 3ASOB 2FMTA 5J4VA 1E5VA 1KVSA 3JR3A 1JAHA 3AL0C 1KQSF 4PR0A 5DM70 2VLIA 2Z58A 4FOLA 2A9HA 1ESDA 1NLFA 4EP1A 1NUHA 4JEMA 5BSFA 2NT4A 1RTTA 2DKFA 3LA6A 4Q00A 3HSSA 2P2CA 5FULA 1KE2A 5J3JA 2B4KA 3KBOA 3W2GA 4F3RA 5F5LA 3B5EA 2J59A 3PXCX 4JXZA 3HCNA 2C3UA 4K0RA 4ZICA 4GE3A 4NOJA 5F9MA 4KQFA 1G42A 2QYHA 1TZCA 1VQLF 1E3TA 3MCVA 4H0LB 3QBTA 3ZI0A 4ZGWA 1UK8A 5IW8A 4EL5A 2ZSJA 3GWGA 3L77A 1GR1A 2R9AA 2JGNA 5EB1B 1NNSA 2W6CX 3DW1X 3L8EA 2DWOA 2AK2A 3LNCA 3L4SO 3TBKA 2FMKA 1O0BA 5GWXA 1G1AA 5JPDA 2QVYX 2C4TA 4EFDA 3HO1A 3CZQA 4C4SA 3K1AA 4DAEA 4LFBB 3NETA 3FXAA 5AW7A 5JXJA 4U39A 4ML3A 4B71A 3K06A 2I8AA 1JWLA 2NW6A 4R05A 2OFFA 3TI7A 1AIPA 1L5NA 3IC9A 3W06A 2PZKA 2WPDD 3UFXB 3IDZA 3CC4V 2QTRA 4PQRA 3AUTA 3O0TA 1SH7A 3AHHA 1C8LA 1XIVA 3LGSA 3C8DA 3VZRA 3O95A 3QVSA 1HR0O 2JI7A 3UW1A 3L7MA 4FT2A 3ZHBA 4DL9A 4F7DA 1K3TA 3FNQA 1U3FA 2W2OA 3OCCA 4BJ1A 2QTGA 5E4FA 1F2VA 1MV5A 2WAXA 4H6WA 1AQLA 3R7DA 2R7KA 2A94A 3FVTA 4BO3A 3DT8A 5HEKA 4X3MA 1R3DA 2HJHA 4BVAA 1ZM4A 4CLEA 1C14A 2PRJA 5JC1A 2RH4A 3WHIA 5L3QA 4UAGA 2LCAA 2OP1A 3R0PA 4EDHA 5A9SA 1D5AA 1Z17A 5BWMA 3NYIA 3WQHA 1DDGA 1EN6A 3OIUA 5LWHA 4BLQA 1CPYA 2WOJA 3G1TA 4X6YA 2HQRA 3ZX5A 5C7OO 1CQIA 1MO5A 1PTKA 1A4XA 1VE1A 2PTHA 2VHYA 1YO6A 3A37A 3EDQA 4X24A 4H16A 1JI3A 1KAHA 1YJ9V 1VCOA 2F43A 4OXXA 4EPXA 2FK8A 3AYZB 2BCGY 1FB5A 3PGMA 3TZHA 2DUUA 4DDTA 1DDOA 3ND5A 3PXBA 1KQOA 3SPCA 4YJ3B 3E84A 2B21A 2ZAUA 1HDCA 1QAMA 5IDJA 3VAZA 1X86B 1P7WA 3CS3A 1Q86W 5HF6A 2BR4A 4I9GA 4WBNA 3I12A 2PUDA 2VT3A 1E94E 2A5GA 1AVTA 3BXOA 4HNVA 3HWSA 2HMYB 1R0KA 1P1HA 1FXWA 4IEEA 4LA4A 3RS5A 2X0RA 1Z9BA 1E1KA 2G8LA 4GNKA 3THRA 3VISA 4CKYA 1JHMA 4V0LA 4EKIA 2XWBF 1RYFA 4NYMQ 4UM5A 3O93A 4Y0AA 421PA 4ZC8A 1KYQA 4DW8A 3PQ8A 3DOOA 1MU0A 4LWQA 3ZMVA 1WUTA 4R68A 2PH1A 3ROGA 4QNRA 1SU7A 2DBYA 3CPEA 3ZYZA 4Q3KA 3NIFB 4GLJA 7YASA 3MG9A 4DMLA 2IU0A 1C3XA 2ZT5A 1CVLA 3CLUD 3ICXA 3EFBA 3OLYA 1P7CA 1LPAB 2ENUA 4NCJA 5AJHA 1B16A 2JGAA 3L02A 2CVHA 4X8LA 4LK2A 3SIPA 4C6SA 3UGTA 2J6CA 4KIJA 4CFSA 4IVNA 4C87A 1N0WA 5FH9A 1L7RA 4IDCA 2FOIA 1M0WA 2DY0A 2FGJA 4JS0A 4DYLA 5CURA 2OM6A 3BIWA 1GZ5A 1BCRA 1XVVA 1DOZA 5ENZA 1IBMB 1XDSA 1KO7A 1T3ZA 2I91A 4PA9A 3BGSA 4R7ZA 3FYIB 2GS9A 3RK1A 1KNQA 1SOVA 1GG5A 1K08A 2BFFB 4CU2A 2QM3A 2VJBA 1PK8A 4UASA 3K9WA 4XIYA 3ENVA 3NHBA 5CD1A 1R50A 1TKAA 3A31A 4GM4A 4EEZA 4NAHA 4Z1MG 2IOQA 1MV8A 4EF6A 1ODFA 3LDDA 5DNYB 5KDLA 3SIUA 5P8WA 4JKIA 1QCEA 5T3YA 1NR7A 4C4WC 1U8YA 1YIOA 2OCAA 3O9OA 3MDOA 2DSNA 2WJJA 1O96B 3KAKA 4IQ0A 4XLLA 4YUYA 5JNWA 1DJOA 1YCGA 3PL1A 4A82A 4PO3X 2WT9A 3ZCPA 4DDKA 2WIDA 1NVDA 4UU0A 1KK2A 2IUYA 2D54A 2WU3A 1AGNA 3GRPA 2FOXA 4H08A 1X3SA 4M1ZA 1H8HA 4RENA 3SPHA 1YA4A 2QW8A 4POOA 1SBZA 1HLGA 4AW9A 3DFFA 2NUAA 1ML3A 1YTLA 2Y2UA 4NZZA 3H16A 3T3IA 3ZDDA 1EB8A 1CQJB 2XGMA 4LHSA 4U8GA 5F1KA 1AK9A 3F74A 3P2OA 3PL5A 4C4OA 3A32A 4V39A 2UZ4A 1HK7A 3RYFA 1IFXA 5FI3A 2IELA 4PSDA 3KCYA 1TA8A 2WPDG 1G2QA 3R3WA 5GIPC 2CZGA 1V1RA 4GD3Q 1IBRA 1Q0QA 3SYTA 3NTXA 5KYKA 1SULA 1NUUA 1QCDA 3GGPA 1PT8A 2CV2A 1ZK3A 1U2DC 5FPTA 3HLKA 3PNQA 2A7QA 1QYCA 3TOZA 3DDUA 3UPDA 5FYQA 2GKGA 1GD1O 2I99A 3DBVO 4QUJA 4YAWA 3NUZA 3P71T 4NJOA 2YI8A 3EGEA 4LJ6A 2B9VA 1H8ED 5FV7A 4QRIA 4W1RA 3T9BA 4FHEA 1UT6A 2XTAA 4PZ0A 3QUTA 2LBXA 1KYIA 4UNRA 3QOWA 2QR5A 1EX6A 1CZKA 3IVRA 4NBRA 4ZV9A 2H9AA 5ALPA 1DS6A 1RWMA 4JYAB 3KP1A 3A70A 4RO0A 4U02A 3T1YO 2PUJA 4GOOD 4QEZA 1KYWA 4KQJA 1CVRA 4HDMA 5AXBA 1RWPA 2OFOA 3A4YA 4O4LF 3C8MA 5IZCA 3FLAA 1B15A 5CX1B 2RH5A 3T52A 1W5BA 6Q21A 3H4MA 3N0RA 1M6WA 1JR3A 2V3CC 3QG5A 1UKAA 3MB5A 1CLIA 4JBNA 1NI5A 3W8NA 1D03A 3CHXA 3GNTA 3GD5A 5FWXA 1OCOB 3DEJA 1NTRA 1SVWA 2VHTA 3T5MA 2EKLA 4CR7A 2A9PA 3FKSA 2XVMA 2BF4A 4TWKA 5B1AB 2EIHA 3GUUA 3SNHA 4EPRA 1QKJA 4R7CA 2OVFA 3P2MA 2XT9A 2GWRA 1XA4A 4UPDA 2PE5A 1QVAA 2UXCB 2OBYA 3NC1C 3RJ5A 1TD1A 5EWLB 3W3AD 5CT9A 3WA6A 3S2GA 2GZLA 2CUTA 2K5UA 1CJSA 3BXZA 4IIDA 3THYB 2HNKA 2P0EA 2AC7A 4WZAA 4BX0A 4X3LA 3IIJA 1PJ2A 2XJ4A 1SR8A 3LH5A 2H0QA 1BC5A 2PSEA 3FRIA 5AHWA 3SC2B 1W85B 2FC3A 1CFZA 3BF7A 3R0JA 3NNSA 3MK31 4OB6A 4TX1A 4YALA 1YJWF 3F6BX 4CV1A 3AR5A 5FADA 5AW4A 4HO1X 5AD1A 6AT1A 1U04A 5G40A 5TGDA 4C08A 1MVNA 4MAFA 3PJDA 4EAQA 2QWQB 4ICGA 5NULA 3H2IA 4BX9A 3BGIA 4JWTA 5JOQA 1ZH4A 2OKCA 3OTFA 1G8YA 5ALHA 1VYTA 3HPLC 2P5UA 1T0KB 2RAVA 3L0YA 2P75A 1ABEA 4LFCB 1LLFA 1KC1A 3OWOA 4JEUA 2HNBA 5UKDA 4B79A 4Q12A 1NTKH 4EJSA 1SUSA 2JS5A 3KKZA 4BLWA 1WOYA 5BR8B 2WIJA 5AJXA 3ESYA 2HGSA 3MCAA 4FU0A 4Q3OA 4QTXA 4BRWA 3WL7A 2BGJA 1B43A 1EGQA 3NJRA 3OCXA 4MEJA 4CKCA 1XYGA 2EJRA 3A3KA 4WLEA 4WY5A 2YIMA 2ZWOA 4ZVKA 3PX3A 2CH7B 1IY0A 2BKXA 3PCTA 2QTVB 3OCJA 4N21A 1TJYA 3I3SR 1GGKA 1HGXA 2YW9A 4FQ7A 4M6WB 4Z3KA 3VBBA 3RWOA 1NBAA 3VHXB 2DPGA 3KJIA 1JZTA 1ZJ6A 1IVYA 1G9SA 1HFJA 2FWNA 4RO2A 1VI6A 2VPYA 3PRKE 1D07A 4GZMA 5FUWA 1EH5A 1TX4B 1XU9A 3H04A 1YZUA 1PGNA 4TS9A 4BFYA 3OLXA 2FMUA 4H33A 2DUMA 4CM3A 1TK3A 3IKJA 4HEJA 2Y0CA 4AF8A 4GBJA 3N8GA 2KBEA 2ZR9A 3ODGA 2G70A 3GRFA 4KO4S 4MS3B 1PSWA 2C57A 2NQ2C 3S68A 4Z1MA 1D2DA 4CM5A 7GPBA 4U2BA 3WBKA 1XMIA 2AFIB 2H7XA 3S06A 1YQDA 3J81M 3CUVA 3HB5X 3N70A 4RH0A 2Y8EA 1AA6A 2CNWA 2A92A 4URHA 3HA5A 1UFYA 4D9KA 4LSGA 1M73E 3A9UA 2PKEA 3IKMB 3OAAA 5J9FA 4CBVA 1PX2A 2GK6A 3ORSA 4PZCA 4R31A 4ZP1A 5FNZA 1PLLA 2FR8C 2H5EA 3O3CA 4I0WB 1PGJA 3OIWA 5ENVA 2A9KA 4OBEA 2GARA 4JX9A 3PFWO 1S8AA 1GTOA 3AHJA 5ULLA 3U10A 1ZITA 3GAZA 1RLIA 2BH2A 5FXMA 5I51A 2NUPA 4R4JA 3PUKA 5L51A 4IKOA 3IXQA 1U0EA 2I2DA 2Q28A 3PKZA 5LLSA 3UJHA 2K2WA 4U7HA 2AUTA 3D0KA 5CD9A 1NZDA 4A0GA 1KQ3A 1N6PA 4OQFA 5LOVA 3QMVA 3AK2A 3QKUA 3GQVA 1RMTA 4MTFA 3MQ2A 3IOYA 4IF4A 4NU5A 1ZUD1 1VQ9F 4CIWA 2JFFA 2V59A 2IKSA 1YI2V 2P9EA 2VA9A 2WUWE 4TS3A 4WY2A 1YRWA 3SQOA 2HRZA 2Y6UA 4M38A 5DWQA 3TQOA 3WBBA 3JVHA 3CNNA 2IYNA 3M6UA 2X6RA 1M2VA 1UBEA 3G17A 3KV1A 4IRXA 1Q7GA 1WW8A 2RJNA 3CT6A 1NW5A 4Z0PA 3TTVA 1CU1A 1A8PA 4DLPA 3W90A 1GPDG 1CE8B 1Y8RB 1A27A 1GYPA 1YZBA 1PDOA 5CDGA 4LOKA 4HQ6A 3VJKA 3F1KA 4BGIA 1X9HA 1YHNA 2BGLA 4RPLA 3ZW7A 2BZSA 1YS2X 3EA5A 1FOEB 1P1KA 3CCRV 3NRCA 5JJEB 1AXEA 2JJ8A 3B53X 2PYZA 2REBA 2VJCA 2V9PA 3AEQA 3NDIA 5HE8A 5JCPA 2B4RO 2CTRA 2WWIA 4D4HA 3ZTYA 1BN6A 5EMLA 1H9CA 1IEVA 1UC5B 3O74A 3JYLA 3M2TA 3BRCA 1NQ3A 2YASA 2F66C 4NL4H 4CI0B 1RHQA 2I4IA 2VUHB 1CIPA 1V37A 3LS2A 4QQ8A 5CTJA 4A10A 4HNQA 3O9VA 2HU8A 4KH1A 5JCXA 1YZ3A 1JJFA 1JAZA 3PR3A 2FPPA 4E21A 4XDLA 1X15A 3MIZA 5ANRB 3NV7A 4MRAA 2FPIA 2J07A 1QB7A 3HZOA 1ODEA 3DGEA 1XPRA 3EF0A 3OR6C 1GUZA 1L7AA 4ARAA 2C0QA 4JA0A 1EJ2A 4QYMA 4D6PA 5KOHA 2V9YA 1ZW1A 2BGUA 1B1AA 3ASNC 2GZ1A 3GLKA 2BI7A 3BFXA 4GNRA 4BNJA 4ZDWA 4R9RA 3HY6A 4Z7OB 3ZHRA 2FX3A 3PDUA 1M57C 3WJPA 4ZJPA 1VF7A 1W88A 4Z4HA 3B6KA 3E8BA 3CCMV 2Z83A 1XD9A 1G0OA 1R3JC 3RSLA 3CB4A 1WD7A 4MI3A 5FBLB 2XW6A 2OCYC 1XKXA 3CKYA 3ORYA 3FMGA 2MSWA 3BMNB 3LKVA 1A8HA 1M6HA 2DOKA 5HE9A 4CV0A 2RB5A 1J2EA 1SCJA 3PD1A 4AQ7A 2DFVA 5DEDA 3EXHC 3WDSA 2H1VA 1OWOA 2O8DA 1N2JA 4GVLA 4FFSA 1RQXA 5EP3A 3UB4A 5ISMA 3E2PA 1LWNA 3M5CA 4YJHB 2UVQA 1YQNA 4A8TA 3TRDA 4O4JF 4HH1A 2X1LA 4AZ0B 1RSZA 1V7QA 5LM3A 4BTEA 4KUHA 3RCBA 2FWJA 2H4FA 1RRVA 4RD1A 4UCFA 4B3TO 4NP6A 3I9JA 2AOTB 3T7TA 2N48A 3ETQA 1T8UA 3CRNA 2WTMA 1VL0A 1KD1W 3W7TA 1AGPA 2BGKA 3A25A 3E6AA 3K9NA 5L3RA 1HF3A 1A50B 4GIBA 2F1HA 1DHTA 2ZATA 3BE4A 5TEVA 1E5TA 3OZGA 3ZXUB 1EGHA 3U17A 3EQ7A 4PFJA 3V1YA 4HB3A 1KRXA 3L7YA 3N05A 3CCVF 4MSUA 1I0HA 4HYOA 2OTCA 1OAPA 3CZ5A 5CN0A 3EGWA 5LBTA 4V02A 4BKPA 4EECA 3CPSA 2R62A 2YV2A 3OETA 1E2PA 1N2OA 1W36D 1H23A 3K71B 3D6TB 3G5LA 1CIVA 1HY3A 3AXSA 5G3YA 2PZBA 1ZIYA 1DQRA 3EAFA 4H1TA 4TKVA 3MLBA 3OPQA 1G4YB 3ZV6A 1UH5A 3F5SA 3I04A 2I2XB 4GKJO 1JJIA 1V6AA 2C9CA 1O8CA 5GV7A 1OTXA 1GXSA 1ZXLA 5ITZB 2OYSA 1FNMA 4O1HA 4X93A 4CN8A 4LY0A 4E5PA 2H0AA 4QU9A 3B78A 5DYYA 3HBFA 1Q14A 2WJAA 3ICOA 4OJTA 3S2YA 3WKBA 3AH8A 1IMOA 1DWOA 3BA9A 3Q5GA 4NCHA 4LSZA 5KJ6A 1UKVY 1EVZA 1JG6A 1E2JA 2ZUSA 3LPNA 4V0ME 4E5MA 3KSRA 1Q0TA 2GZHA 2FYTA 3IUNA 4OHCA 3VJLA 1G4UR 4CH3A 2REQB 3AG6A 3R4VA 2Z95A 1JGTA 3FHOA 3KDSE 1GN6A 1JPVA 1YRYE 4IJ6A 5FI1B 2YXYA 1XRNA 3DXRA 1WS6A 4FIDA 4FFWA 4EK9A 2XCSB 2IXEA 4A2PA 4NMHA 2Y05A 4MTLA 2NX2A 3AO0B 1LUWA 4GOXA 5E7IA 4CG0A 2OCIA 1MRSA 2PAFA 3LUAA 4DR3B 3WYDA 2IHUA 4NENB 3JAMN 3CEHA 3GT4A 2JIDA 3QI2A 3CG6A 4K28A 3NM4A 5F3RA 5C51B 2ZULA 2ORVA 1BVUA 4N5MA 1T26A 4X8OA 2JHCA 4IKEA 3S3XA 4WLVA 2ISCA 4RSGA 4JI7O 4JLSA 1M57B 3HWRA 3WP0A 2FSPA 4C7UA 5IN4A 1GPNA 3NALA 1KY5A 3FPFA 3KKYA 4GR4A 2Z98A 3O4IA 2A7WA 4S0XA 4DC9A 3P3PA 1VSQA 1WF3A 5A7FA 4KFTA 3WGMA 2EATA 3D6FA 4RK1A 3A6FA 5K8IA 4RTKA 4ZHQF 1G5PA 2VPXA 2J85A 3WLSA 2NT3A 3I3OA 2XNDG 4NG5A 2VOJA 1GZ6A 2Z2XA 3SS9X 1XZFA 5ALJA 3LYUA 1FVHA 4UTNA 3VZPA 1V96A 2OTJF 1JQKA 3MTAA 4B74A 3CJRA 1XUQA 4J0HA 1WZUA 4HDNA 4I5FA 2QKYA 4KR2A 1XLVA 1XZHA 4PYMA 4RV5A 2AZ0A 4WMLA 4YJFA 1JA0A 2X6CA 2NSYA 1BWSA 1BQ3A 4HS4A 2XODA 1Z3IX 3W78A 4DWOA 4OXSA 1S72F 5KTPA 4LCUC 4IGAA 1X7YB 1BHAA 4KDFA 4Z51A 1SXJD 3COPA 5DPMA 3LPCA 3KDPA 4OJMX 1LI7A 1Z16A 3EXHB 4BDTA 5I7VA 4HQKA 3WB9A 5JQGA 1WRBA 4FLXA 2P1ZA 1BDBA 2WBLC 1Q95A 1M56C 2BT4A 2HSEA 1EZZA 5HCNA 1Z63A 1C3EA 3GMIA 4PEVA 2LCFA 3U0OA 3BGWA 3JU3A 3PPVA 1QHIA 3MINB 4MUMA 4WADA 1FXVA 3UOGA 4PR3A 2VJMA 4F3TA 2F48A 4KIWA 3AESA 2N46A 4QDKA 1JAIA 1GITA 4F7WA 2CDBA 1L5MA 4FN4A 2P9BA 3QBEA 4MTCA 4NYIR 4P4TA 3BRQA 5KOIA 2NADA 3DZ8A 3GUVA 4QJ4A 5KJCA 4YLGA 4LJAA 1SIWA 4Q4JA 1UUFA 1TVKB 4CL3A 4RAQA 5REQA 4H1VA 1Z2EA 2F6RA 4TYWA 4KXLA 4G4JA 2ZJ2A 1JU3A 1GRNA 1NHWA 1KIFA 1WXDA 3EVTA 1VMEA 3G2NA 5BN5B 4JUCA 4CL0A 5K8LA 1UFRA 5L6LB 2BSXA 1TUEB 4BQOA 2I2FA 1KFEB 3QKWA 4TTAA 5SYMA 4CQMB 4E1AA 1AKRA 1T8PA 1JXMA 4GL4A 1Y33E 3V5NA 4MVQA 2W8BC 3EIUA 3EOZA 4MROA 3TXQA 1U0RA 1YDFA 3HB3B 2QW0X 2P9QA 5FD8A 5K0NA 1GPUA 4D96A 1LD3A 1UC4B 1Z0DA 4HQLA 4LYAA 4YI3A 4E6EA 1NQXA 2ZTHA 5HP4A 2VPQA 4JX8A 4CL8A 1DG9A 4J0KA 1J0DA 4EVRA 2DPYA 3QIAA 3RE3A 4DDVA 4PG7A 4LRYA 2HIHA 3MDSA 2FZ5A 2Y9PB 3M70A 3EISA 3M6WA 4U2CA 4X45A 2X0DA 3T5TA 3OEHA 4JJ8A 3O2NA 3P9ZA 3UMRA 4CMBA 1NXVA 4RTRA 1FQOA 2GZ3A 3DFZA 5LA6F 1S1CA 2ID7A 3GWZA 4WFIA 4OHOA 4B62A 1CR6A 5F1OA 1XMOB 1AJEA 5HY1A 1GYQA 1E5DA 4ETMA 1RRMA 1BYIA 1Q3HA 4QU5A 3CU5A 4KRYA 1L8LA 2BOBC 3IEWA 3QF4B 4NBVA 1HTWA 1HT2E 3JTMA 3KJEA 2CFSA 3GBPA 5E4YA 3W2TA 2AFVA 3OE5A 4EHAA 5I4KA 1F5SA 1ORTA 4QNHB 3LF2A 1HNZO 1B0UA 1I13A 4WCDA 3BD7A 2G0TA 3N7TA 1R8SA 3P9QA 5PGMA 1KECA 4CDRA 1DAOA 2VK8A 3UKMA 4DR7B 3K9FC 3NTUA 3E53A 3VVBA 4YHBA 3G7UA 3PVSA 4Z2AA 4M98A 1IBSA 2VLBA 3PRJA 4EG8A 4J49A 1L7OA 4W9RA 1EJ0A 2RI1A 1EUDB 3OC0A 3PWKA 1FUKA 4JUDX 1J5EB 4QE3A 4XFDA 4G8DA 3UG6A 4JYBA 1TZ2A 2C9ZA 5DW3A 5ER9A 2V0NA 3CKKA 4U7JA 4XSGA 1Z39A 2CKMA 5AKHA 2IDKA 3OA2A 2OHOA 3QUSA 2FUCA 4TUYB 4ZOBA 3EPHA 2VYFA 5JG7A 3LUBA 1H85A 2IW1A 3EHDA 4L2IA 3ABLB 1X80B 4EMSA 1ZSYA 2YV5A 4UDNA 3GELA 2JGUA 3T80A 1PFKA 2NTYC 2OCBA 4V0OA 2IYVA 2NU7B 4LF9O 3GEEA 3JSXA 3HCDA 4CNQA 4F4FA 5M7EA 2W6ID 5IFKA 3AM1A 5B8FA 2UZ1B 3I1IA 4FDMA 4P32A 3O7MA 1MLDA 1DCTA 3KXLA 2DEUA 2HBQA 1F4PA 2JJ2D 2AN3A 3LSTA 2KE5A 5F35A 1HMPA 4X1IA 2BWJA 5AJUA 4YRDA 2QEXF 3QY0A 2FEXA 1HYGA 3RUDA 5L3QB 4QHYA 3VO8A 1R8XA 3LLVA 4RLHA 4UVDA 4XQEA 4F84A 1GDDA 1ZJ5A 4QPKA 2UYKA 2D0IA 1BDIA 3BMCA 4PSVA 4CLRA 1OXSC 4UBIA 1KMHB 1ZOOA 3VKGA 3TZKA 4X9XA 3KLNA 4JH0A 4TXHA 2PGDA 3G88A 2IZ1A 3BRSA 1YR2A 3FPJA 3O91A 4LE0A 4J1TA 4LR3A 4LG1A 4DR4O 1KUQA 1XDBA 2H9YA 4AJ9A 1G5TA 2E6KA 4YR9A 4Z4IA 4NMWA 2OO5A 1TCBA 2ZJYA 2AFHA 1C2TA 3RRYA 3ILHA 5I3ZA 2X0EA 3E5MA 1XPJA 3L4EA 2Z5UA 1VQVA 1YVEI 3L3BA 2C84A 4YAFA 4K3VA 5DEIA 5JU6A 2JIMA 1X7GA 1QVGF 4Q3DA 1WTAA 1XL1A 2I65A 1NH2B 5BXZA 1BX1A 1GARA 1O6ZA 4K86A 2IV7A 2ZIWB 1UWCA 4MS1B 5EZYA 2XVXA 1ZL8B 3IB3A 1SVKA 3RSFA 1YIJV 1W7AA 3KBBA 1BG6A 4YRGA 2AH5A 5D1NA 3OJWA 1MP0A 3JQBC 4BCBA 1IIRA 1EUQA 3AYXB 2QDKA 1OZ0A 3GJTA 1AHIA 4LXXA 2X1VA 4R2JA 1QTIA 1JPXA 1NV9A 1RMYA 3GHZA 3DKRA 3JZFA 1FJGO 2G8NA 5ECYA 1IG3A 3ICVA 2B4YA 4L02A 3G0HA 5DWVA 1G3UA 2IEYA 2ZETA 4R7TA 3CONA 1KKLA 3Q8LA 4P5EA 4Z9BA 1XVIA 3V4DA 1NR1A 1HDJA 1WXHA 5JSZA 3JQDA 3NHMA 1OJHA 1DCFA 1T0UA 2ONZA 4CMKA 5HFMA 2YWRA 1G7TA 1TMKA 1GV1A 4IG4A 3IX7A 5K1ZA 3GRCA 4LX8A 1E7MA 3GNQA 3BIXA 1WP9A 4B0OA 5KYGA 5JJKA 4JV5B 1ZYUA 5IH3A 4OLHA 4RTJA 2NTVA 2Q68A 4LNUB 1DUVG 4LMRA 4B3FX 4DZRA 3UCFA 5JIBA 1VQ5F 3EDMA 3ZOPA 1SQ5A 3BSWA 3FPKA 1J07A 5TQ2B 1T9KA 2W2XA 1N0UA 2Q6TA 1ZJJA 3H3JA 4FLMA 4RVCA 3D81A 3BWYA 3N3AC 1T3HA 3Q3EA 3ZKAA 4ZFNA 3EFHA 3LNTA 4DUGD 3P0FA 4BU1A 1QHHB 1L1QA 3CYPB 1R0XA 3CVOA 1K4KA 1VQ8V 2YNMA 3JS5A 1CK2A 1X74A 1QIGA 2FETA 4LZWA 3NUQA 1A7AA 1FXSA 3BREA 3K0EA 4LGMA 1KH2A 5AUQA 4L4SA 4JC4A 4G9EA 4UNSA 4BNHA 5LD2C 4GPTA 4O33A 1WV1A 2I7TA 3TS1A 3K70C 3G9XA 3EA4A 3DBLB 1XILA 2OCGA 3PG5A 1IXZA 1RYBA 2JLSA 1N2GA 3MRTA 1ZICA 2QRZA 5TF4A 4H35A 2YH2A 5HUQA 4AKTA 1XCPA 3W8EA 4EJ6A 5EC2C 1NY5A 4WN9A 3DW3X 4ZBMA 1V3TA 4I99A 4JVOA 3E5RA 1Q44A 3Q72A 3IVCA 4KP7A 4N82A 2F1OA 4JASA 3AIMA 3GYGA 4V3CA 3A0UA 3RC3A 3VYWA 3QMMA 3ZLBA 2BMWA 4IF6A 2PSHA 3OICA 3P20A 4BIZA 2D0PB 1FC0A 3ABLC 1V8OA 2AYZA 2WVHA 1KFKB 2IXDA 1JIIA 2HY7A 3GF4A 1G19A 1BMFD 2OO3A 3I9V1 3P4UA 4NARA 5JCOA 4CODB 1OH8A 1SWWA 4BHTA 5D86A 4BXOA 4J0EA 1QUEA 4A6XA 5F9FA 1B6RA 1RWOA 3IIEA 1PR5A 4M1KA 4JKOA 1IV2A 4KXWA 1AN0A 2FSSA 2FW9A 5LZ7A 3GP8A 2PBLA 2WF9A 2GSDA 3EZNA 1FSFA 3O4VA 3DMNA 2VN8A 3OFSA 3OZFA 3PWSA 4QAQA 4BO0A 4F8EA 1B8PA 2EG5A 4PDVA 1HYBA 1QO7A 1V9SA 4RQOA 1ULHA 4PS1A 2WE8A 3VPHA 1EU1A 3A4LA 3JSAA 1NFQA 3P9RA 2XLCA 2ZIGA 1EFVB 1G20E 2QTAA 3Q8XB 3PD7A 1QKIA 3Q85A 4Q3EA 5ICFA 3UOAB 4B3DA 5KNDA 1R9NA 5KYYA 3O8OA 4FR0A 4MJLA 1JQ5A 2D5LA 3LY9A 4GRDA 1TEZA 4KZPA 4J1NA 4L1KA 1FZQA 4GMXA 4H31A 4MR7B 1QYDA 3UUFA 3IXLA 2G9RA 4ZCMA 5LDDC 1A97A 4MDEA 2GFQA 2ZE7A 1ULTA 3TSCA 4BIIA 5CDSA 4CMIA 3RIEA 4GOND 4E7PA 2YS8A 4PM4A 2ZUVA 5EUQB 5KTNA 1Q0LA 2YEVA 3OFKA 2E0IA 5I7EA 4P0TA 5K99A 3RVSA 3K3WA 1TECE 5A6SB 1A77A 2EAUA 3DE2X 3OLWA 3PQ6A 5BW8A 10MHA 4NTXA 1F2TB 1T4CA 4EI9A 3W2IA 3C8UA 2ZRJA 4UHDA 1RKBA 4X20B 2Q5CA 3UHOA 2PQ2A 1AI4A 4B73A 4O4LA 4QG7A 1XQ8A 1UPUA 2PWAA 4XDYA 2HHHO 4GUDA 3OTOO 3LWNA 1F8FA 5G0SA 5IULC 3IRUA 1XZQA 2Q5FA 4WRRA 4RTNA 4L51A 2A8YA 1QRTA 1S3IA 2WZCA 3C6KA 3E1YA 1JHXA 1FNDA 5ALDA 2Y1KA 1SCDA 4ENUA 1I3KA 3PR2B 4B3RB 2Q62A 4N0EA 2PS0A 1ZAKA 2BKUA 3U11A 1T0BA 3KZMA 1YTFB 5I9TA 2FPRA 3E9EA 5T64A 2WTBA 2VBIA 1R9GA 3MFQA 1BS9A 2BTUA 3E9YA 3QOFA 3MYYA 4PBRA 5AJTA 2CNNA 2QS9A 5AHOA 3TQSA 3S2SA 2NMUA 2H3HA 2P65A 3OAAD 4MP8A 4RD2A 4WOPA 1U0GA 2P2YA 1GUDA 1W0KD 1UEXC 3LVBA 3L0OA 1BHSA 2Q2VA 2FHPA 4S24A 1QYRA 1QVWA 3PAFA 5B3SC 1CF2O 1H5UA 3C85A 4WIAA 3UMFA 3ZBUA 1P4AA 3B8MA 5DBOA 2BSQA 5DZSA 2ZUFA 2H8GA 2EIXA 5A02A 4XRGA 4QGAA 4Q21A 4OYLA 3WB0A 2FKNA 5EO3A 1A9QA 1JEQB 2HU7A 2ZUDA 1L3IA 1TEVA 5KQSA 4D41A 1VOTA 1DAFA 2F8MA 4GPIB 4FE7A 4FB4A 3COJA 4F4IA 3SICE 1SCBA 1GPKA 3EFFK 1XNGA 4EG7A 1SVIA 3I1YA 5DULA 3MOSA 1T8RA 2NMVA 3CH6A 1ORVA 1SHUX 1DXQA 2QTBA 5T3UA 2CHVA 5ICEA 5H9CA 4DJAA 2Q29A 3X1MA 2KWIA 1LF0A 3RHTA 1XNJA 4S2UA 1MOSA 4EF4A 2J6BA 1KI8A 2FPKA 4MQ6A 3EDYA 3E23A 2IYRA 3SF0A 4AX8A 1YZNA 2NUTB 3H84A 1T2AA 3NIBA 3TTUA 1GKKA 3CX6A 2WUEA 3ZK8A 3H6KA 1CP2A 3GP3A 1Y5MA 2YMPA 3DT6A 3E70C 3QE4A 3O1LA 1O97D 4FNOA 4EMBA 3L9DA 3BK1A 5IT0A 3DOJA 1GGNA 2XYHA 3CUUA 4P0QB 1V55B 5BPFA 2JA2A 4CF7A 4RZXA 4MVJG 3FTPA 5C37A 2FMHA 5L3SA 5IVIA 2H1LA 4DV5O 2VQ3A 2AG0A 3I37X 1COMA 1A1SA 1L3BA 1WUIS 3OM0A 4PG6A 3ZWKA 4ZVUA 1BEUB 5C4MA 5E6RB 1OXTA 4UD2A 1NNEA 3U62A 1M2GA 3LQYA 3ZWDA 4ZAWA 4IJVA 2OCCC 2XLBA 2CDRA 1KDZA 2CNWD 1KP2A 2W37A 4WNAA 1IB6A 2PU5A 4NQZA 2NG1A 5ALGA 1PJSA 3BYQA 5JS8A 2QWRB 1KEWA 4RJTA 4ER7A 3DOIA 1WSAA 2QTVA 3PFGA 4IWNA 4XX1A 1NC1A 2ARHA 4PONA 3HXMA 4Z9YA 1RHUA 2O8VA 1E8NA 3HN7A 4HNUA 5IPFA 3C1TA 2IBSA 5FPHA 1O08A 2FLVA 3A1WA 4QTTB 1AKQA 2JEYA 3ZCRA 4OI1A 1IUNA 5DSZA 3SS7X 4B83A 3D54D 4KN6A 2QTFA 1WZCA 2ILTA 2VG8A 4OQLA 1EM6A 4RVGA 2Y77A 2IHNA 3EYAA 1POWA 3RYFB 3DCYA 3ZDXB 4RY0A 1MNAA 4RFLA 4D25A 2D2CB 2G04A 2XGGA 2PLFA 3B6MA 3EOAI 3GEIA 5FHQA 1T2EA 3KS9A 4J03A 5K3AA 2CVLA 1BW9B 1E9RA 3ANSA 4OQMA 5HP7A 1DT5A 2PMBA 1R6TA 1XU7A 5I9BA 4DPLA 3E3LA 5C1IA 4V1CB 2W2LA 5BSVA 1KIAA 2MK3A 1VHQA 3R09A 5BSWA 3LTNC 1DJPA 3FZQA 3S55A 4G0UA 3VR5H 1EJ6A 1SFRA 2QEQA 2DXIA 5KTSA 4C06A 3CX4A 1R74A 2E2WA 1CUDA 3BMOA 4R1NA 1K0UA 4KBGA 3TMKA 4JJFA 2ODTX 2NU9A 3ORQA 3NASA 1RD4A 5E7QA 4EYOA 3FMOB 2LUOA 2PY5A 4TT3D 3RU7A 4GG1A 1CRQA 1LCIA 1RPOA 1KMQA 2Y1WA 3S3WA 3KHTA 2QJ1A 1L5OA 4FR5A 1X7ZB 1IY2A 2AF3C 4FGSA 4E2WA 1JFRA 1L5VA 2RDCA 2AXNA 2CJYA 4ASUD 5IM4A 3FB6C 2X58A 4IRUB 4I1YA 1X52A 1KOFA 4TZZA 1J22A 2V5UA 3C3XA 3QVKA 4II2A 1I1QB 1FVXA 3KUDA 1VYUA 5AOVA 1Z0JA 4B47A 1QO9A 2YWHA 1SXQA 1M93A 1RCFA 4DK0A 4RW0A 2EINC 4JI4O 1AJQA 1J5PA 1Y6ZA 1EN4A 3EIQA 4ZEOA 3DTVA 3V6MA 1DBPA 3OZBA 4BVEA 5C2JB 3WGHA 2PUBA 5I4IA 1LS1A 1MW8X 4LDJA 2YHUA 1BE3H 1VMKA 2JFNA 4U63A 1N2CB 1NI8A 4PPQA 1E7YA 3KE9A 2ZE5A 1G6UA 4FYPA 3AG5A 5CVVA 4N3BA 1Y6QA 4KK4A 5G41A 3BJEA 2FQQA 1R0SA 2OESA 2VH1A 4IUBS 4B3RO 3B6EA 4MNTA 4NEGA 4OYYA 4P7BA 3CRAA 3OVMA 3OTHA 4A6EA 4OI0A 4LWSB 1TKCA 1GAXA 2G5GX 1TF5A 3OKCA 4N0MA 3LSUA 1IVNA 2PMFA 2O57A 3WISA 2JLYA 1FZTA 3HXTA 1JWAB 2QUIA 3KZVA 3QI7A 4P9OA 3I9FA 2XVYA 1BKSB 1WLSA 2CFIA 4RPCA 3H0CA 4JCCA 2SBTA 2XKAA 4Z2WA 3TIXB 3QX7A 4AQDA 4MYTA 1I7LA 1OVGA 3A4VA 3LO5A 1LK5A 3I5YA 1T25A 3Q3IA 3LQ1A 2XKBA 3CB2A 2C3PA 5K3SA 3IQFA 5LZ8A 4I4NA 2NQ8A 3C3KA 5K4GA 3EDOA 3FNFA 1YZKA 4CQMA 5A06A 4DCVA 4RS3A 3QUBA 4XUEA 1ODSA 3JVIA 1V43A 1T6ZA 1QF6A 2OMKA 1FX0B 5EZ5A 4WCFB 2XKKA 2W2TA 3B2EA 1TIKA 3F6YA 4KN8A 5BQ5A 1N5LA 2QD5A 3BMXA 2ODMA 1XZMA 3U1VA 3NX4A 5AW0A 2IL1A 3EWSA 3N4YA 1CRLA 2Z3ZA 3OPVA 5EEHA 4EZBA 4WLNA 5FF9A 4YCLA 1FFBA 2PZSA 2JH3A 4DPKA 1X1AA 1T43A 2BLNA 2FU5C 3QENA 4OO3A 4K6MA 3SFVA 2J5QA 4LW8A 2WE7A 1QVVA 2LVBA 5ABPA 3SHVA 5IF3A 1TJ3A 5H6RA 2GZDA 5BSMA 1DKUA 2IPMA 3CBQA 3D2LA 2RARA 4MULA 2E4AA 4XB1A 4H3HB 1Y7TA 4WK6A 4YT5A 1D5NA 3FB4A 3BD9A 1X70A 4DYVA 3HL4A 3OJLA 1N8NA 3GRZA 1UC8A 2WFZA 4PVCA 3RS7A 1N1DA 6REQA 2ON6A 2ONKA 3C3EA 1MG0A 1UINA 4CRWB 1OQAA 1Z0ZA 3DDNA 1D1TA 1EJBA 2WVJA 2QWOB 3DVRX 3E8SA 1SUAA 3KQYA 3KR2A 3L7QA 3QF4A 1ISPA 5JXHA 5K20A 3AF3A 1KYXA 4ND8A 3KV3O 1REQA 2JK1A 4CDNA 3ZRWB 4KLAA 2AFIA 2IH3C 3QTLA 2PX4A 2WSBA 4PXSA 5BORA 5BV1A 2YWXA 4D2IA 1JLKA 3TAXA 2IH4A 3CNBA 2H7CA 2I76A 2AKYA 2P2GA 3A1UA 3FSJX 1BGYH 3VC1A 4Q4HB 2NAPA 4DFDA 1DKPA 3NNDA 1NY6A 1WMEA 4JSRA 5CRIA 1K4YA 5ES4B 1CX9B 1TUIA 4BNXA 1OFUA 3QUQA 4J11A 4FQ8A 1WY5A 1XMPA 3LDEA 4N0DA 3DAHA 3CRQA 4C8GA 5ALQA 1SGWA 1IU9A 3EBLA 4NOLA 2FQWA 3AM4A 1GM9A 2AVNA 1RZRA 1GM7A 3HBMA 2OGTA 3JALA 5ESXA 4UFNA 4PQEA 3S7TA 3MD9A 4F91B 3EUEA 5IM4F 1Y82A 1CS0B 3ADKA 3J80N 1CJKC 4HAWA 4ZO9A 4I1RA 1IAQA 2YHSA 4HDRA 2YWBA 4H3SA 1QQ6A 3PEWA 2GN0A 2MW2B 5HCIA 1Y3CE 2ZOSA 4GWGA 3MCAB 4OUDA 3LUDA 4YQZA 3EZ9A 5TVGA 5JWOA 4OIFA 1Z35A 2LKCA 3HEMA 2BGMA 3QVVA 2NLOA 3RIYA 4Z5XA 3UBTA 3DCJA 4EVSA 3E7FA 3EXHA 4QYWA 4XFKA 1MMFB 1PEAA 3OTIA 1PXWA 1EWKA 4KQ2A 5JAHA 2J09A 2O7NA 4JHXA 4MRNA 2O8EB 2QRUA 2FEMA 2NNUA 1T0AA 3B1JA 3CG0A 3CRCA 4L72A 5EA2A 4RTSA 4M8LA 4EKWA 1YHYA 5BNWA 3HCFA 3ZGYA 3QTTA 4NNPA 4K35A 1C4XA 5KOYA 2Y1OA 3M6VA 4MGZR 2CL0X 4BQRA 2VQFB 4PNZA 3AEUB 3WLHA 2CV1A 1AUVA 4D97A 4LWZA 4EFNA 1RYZA 2IPLA 3H9CA 3IL2A 3DAFA 5TR9A 1VE9A 3LW8A 4HAZA 3H11A 4S1OA 4Q9IA 4A8JB 4N48A 3R3JA 1QLEB 1MHPA 4BUJA 1W0JG 3EHBB 1GZDA 2IS4A 3KPVA 1V9LA 5KO2A 1HW7A 4Y9TA 3FMFA 3Q7QA 1PPJH 3RYCB 4DA9A 6NULA 2ZYGA 3VR5D 2EFGA 1HNWO 3ZU5A 1F1JA 1I80A 4DWVA 1BGWA 2OIEA 3SZRA 5KLVH 3EWAA 1ENOA 1MJ5A 4URFA 1EVKA 1H5NA 2PMCA 4IMPA 1QMPA 3LBYA 4OJQA 4BFWA 1IEQA 4QGGA 1RI3A 2HS0A 1W49A 1XROA 3C7TA 3CIFA 4ZQEA 4F2GA 2GF2A 3BMNA 5K0SA 3IJPA 3ZIAG 3HYTA 1N9KA 2QPOA 4JODA 3FUTA 4V38A 3VRHA 4YV0A 3ICPA 2EINB 4YRNA 2F8TA 2IJKA 1U8CB 2GV9A 4EG3A 2KGWA 1YAJA 3EVFA 1BJTA 1U6KA 1XC7A 3GARA 2ZIMA 3GQBB 3M4XA 4XCVA 1UAAA 3VNUA 4DLVA 4PD4F 2J7KA 4L8JA 1TU3A 3OBIA 2VDLB 1LPOA 4BMVA 1UPTA 3LX4A 1ZGBA 3R2JA 4INPA 3F4LA 1H3FA 4CQLA 3FKSD 1PV2A 4I6EA 2YNMC 4QUAA 5G4LA 1J39A 2P6PA 4O25A 4UB6Z 5DHPA 2PUGA 2JJ1D 3QWAA 4D82A 4OXQA 1VG9B 1D2NA 3PCXA 1Z33A 2IPOA 3CLRD 1XXLA 4HJXA 4DRXA 3CMEF 3OWHA 1ZW6A 1BOFA 5BVHA 1U7UA 1U3WA 1U0FA 3ZCTA 4YONB 4QFDA 2EKDA 2YCLA 3H9UA 2WWHA 3ZBHA 4Y2HA 3SR3A 2Y4NA 2Y4TA 1XZJA 4PHTA 5FI5A 4ZK6A 1FTGA 1DRUA 2AUMA 3EASA 1I08A 5HTKA 2I33A 3S40A 1UZAA 4PCAA 2W48A 4AAYA 2ZB2A 3AJDA 3IS3A 3K6SB 1WM1A 1PK7A 2ZAIA 2M6KA 3H6GA 2GX6A 1K33A 1IXYA 3BC1A 1FMCA 1F0YA 2GK4A 1L9XA 1LK7A 1NJ6A 4W99A 3ROZA 2H85A 3U40A 1M2OA 3G79A 1MX9A 4WOJA 2GEBA 1USIA 3I04M 4RVHA 2P11A 4P7JA 3LX6A 4MVJF 2JBHA 3A8TA 3VQWA 4ILKA 1BXGB 3QKSB 5BYBA 3O8RA 5HIIA 4BMZA 2X3FA 4DIFA 5K0FA 2H65A 4RACA 3R8XA 2RMKB 3VZQA 2BGNA 1A9RA 3KT3A 1KXJA 2ESRA 3LJKA 3UAZA 4XB6B 1M76A 2GEUA 3UUGA 4MOWA 4JP1A 1KJ9A 3WKCA 4EB0A 2FZEA 4JL8A 1G17A 4GKAA 3LBAA 1Y76B 1DAIA 1CY8A 1B3RA 1UBLS 3O65A 2IXTA 1CQZA 1JIJA 4TV8F 3CVYA 2ZCJA 5CJJA 4PU0A 1M6YA 3N5KA 3ASVA 4Q7EA 1NIJA 1QHEA 3KVVA 3ZHQA 4QO8A 1SESA 4WFAV 2O05A 2KG4A 4I3GA 2B9ZA 2Q3JA 3IHLA 4RMIA 4RVFA 4UUPA 5LP1A 5K6RA 5JRZA 2A79B 3ZY3A 1LSSA 1KSFX 4UW9A 1R73A 2BR3A 4KKXB 1ICEA 4PPGA 3QWBA 4M9UA 2FTKE 5FAKA 2RGBA 4ER6A 2ZVJA 4DF3A 3FPSA 4FDLA 2B8EA 2XMZA 4IHQA 4HN4B 1PR6A 2IDJA 3RAGA 3RG8A 3VMFB 2LFSA 1FMTA 4HFRA 1JB9A 1DBQA 5K4AA 3ZOZA 1ZRMA 4PAMA 3GFBA 4JUBA 1ADGA 3NH6A 5AVSA 3FTFA 4FFDA 1M5IA 2HHJA 3DQZA 3ZU4A 3GLQA 4RKEA 1UPCA 1Q91A 3KCNA 1XZLA 4IJQA 4I1VA 2Q0SA 2AI3A 3OJ0A 4RHCA 4FM9A 1MTOA 4RE5A 1NXWA 3WGIA 5A6VA 3AZQA 1GRQA 2C92A 4WJZA 1K4DC 4LC1A 1RHJA 1T9ZA 1V2GA 2QIOA 2O1EA 1S9DA 3NBUA 4W4TA 5KKAA 3ZGXA 1KKCA 3QSGA 5KREA 3HCEA 5BMVA 1MC1A 1P2SA 2AKAB 4FMPA 4YRJA 1GPYA 1ZI6A 3PUWA 4QL3A 5DLEA 5HJ2A 4PLZA 4RA9A 4B44A 3A26A 5DHFA 1O96A 2RBEA 1JLLB 1KPGA 3RPEA 2MSNA 3K12A 2OZLB 2Z2ZA 3PQ2A 5BYJA 2H94A 3BILA 2AEJA 3G0GA 3V7EA 4UHJA 3PC7A 5JFTA 4BY9E 4AY2A 4MR8A 1N2HA 3DBHA 1M5TA 2SKEA 5FWYA 1PL4A 1XL4A 2PLRA 2ZE8A 1UXIA 3PGJA 5TQ2A 2OK8A 3MPUA 4JLDA 5KOHB 2Q5OA 4UU7A 1RWQA 1ZL2A 2EW1A 3JASA 3ZO8A 1L5ZA 2XAAA 3DF7A 1PAUA 2HJDA 1PT7A 2CDAA 2FUEA 4HEQA 2H16A 3OZIA 3GLFA 1XBLA 1OT5A 2AJBA 3A2LA 2LJ2A 1JTEA 2IQIA 2ZT8A 4MQEB 1FTWA 5CW2A 3RFVA 4YPFA 3TLYA 3ADCA 1F60A 3QLVC 2P27A 1SZCA 2F3TA 4UQOA 3VAYA 4WGGA 5EMMA 3E1SA 3IP1A 3K0FA 1T6NA 3LKBA 3ZEDA 4O4JA 1UJ6A 2D3TA 2DUJA 1C0PA 2DF8A 3P2JA 3S1AB 2FLWA 1ONSA 4U9UA 3WNBA 3TXAA 3WYBA 4E46A 5TIIA 1NYLA 2E7ZA