1JFFB

Refined structure of alpha-beta tubulin from zinc-induced sheets stabilized with taxol
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
426
structure length
426
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords tubulin alpha chain
publication title Refined structure of alpha beta-tubulin at 3.5 A resolution.
pubmed doi rcsb
total genus 113
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2001-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1jffB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1jffB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1jffB01
5IJ9B 5JVDA 5CB4B 3ZBPA 4O2AA 3UT5A 3HKCB 3WGLA 5IJ0B 1JFFB 1OFUA 3WGNA 3M89A 5IYZA 3N2KA 4XCQA 5GONA 5EIBC 5LOVA 4I4TA 2Q1YA 5JH7A 4IHJB 1SA0B 4WBNA 4YJ2A 5CA1A 1FFXA 4YJ3A 5JVDB 4X1KA 4X20A 3CB2A 4O2AB 3UT5B 2RHLA 3VO8A 5LP6A 4I50A 1RQ2A 5IYZB 3N2KB 4TV9A 3JARA 3VOAA 5JCOC 5GONB 5LYJA 5LOVB 4O2BA 1W581 5LA6A 4I4TB 1W5BA 3N2GA 4ZI7A 5JH7B 1Z5WA 4O4IA 4WBNB 4YJ2B 4U3JA 4EB6A 4B45A 1FFXB 4EI9A 3HKBA 4YJ3B 3E22A 4X1KB 4O4JA 2Q1XA 4X20B 3VOBA 5MN4A 4LNUA 1W59A 5LP6B 4I50B 3HKDA 3JASA 5LYJB 3VO9A 4O2BB 1W5AA 5LA6B 2VAWA 4DXDA 4EI8A 3RYIA 3HKEA 5EYPA 4DRXA 5BMVA 3C8LA 4U39A 3N2GB 4ZI7B 5M7EA 4O4IB 5C8YA 3V3TA 4EB6B 4TUYA 3HKBB 3E22B 3RYFA 4LNUB 4O4LA 4X1YA 4ZOLA 1TVKA 4X1IA 3HKDB 3JASB 1TUBA 4EI7A 2RHOA 1W5EA 3RYIB 3HKEB 5EYPB 4DRXB 4FFBA 5BMVB 5CA1B 2GVIA 3JATA 5C8YB 3M8KA 4TUYB 4M8IA 3JAKA 4TV8A 3RYFB 5KX5A 4TV9B 4I55A 3JARB 5CA0A 2RHJA 4O4LB 4X1YB 4ZOLB 1W5FA 4B46A 1TVKB 4X1IB 3JAWA 3RYCA 1TUBB 4HNAA 4O4HA 5KMGA 5LP6C 4F6RA 4U3JB 4FFBB 2BTQA 5ITZA 4O4JB 5FNVA 3JATB 5JCOA 3JALA 2RHHA 5MN5A 5JQGA 2BTOA 3JAKB 3RYHA 3WGJA 3RB8A 4TV8B 5KX5B 4I55B 4IIJA 5CA0B 5J2UA 4ZHQA 1RQ7A 5J2TA 3JAWB 3RYCB 5EZYA 5LXTA 4HNAB 4O4HB 2R6R1 5KMGB 4F6RB 5IJ9A 2BTQB 5CB4A 5ITZB 1FSZA 5FNVB 3JALB 3HKCA 5IJ0A 5JQGB 3VPAA 3RYHB 2XKBA 1JFFA 1RLUA 5EIBD 2VAMA 4E6EA 4IIJB 5J2UB 1Z5VA 3WGMA 5MN6A 2XKAA 3ZBQA 4ZHQB 2VAPA 3ZIDA 5J2TB 4KWEA 2R751 3R4VA 3WGKA 5EZYB 5LXTB 4IHJA 2VXYA 1SA0A
chains in the Genus database with same CATH superfamily
4F4CA 3ZWOA 4QQRA 2FI1A 2HDNB 4YCJA 3IT2A 2WAMA 4AQYO 1QHHB 1AMUA 1H48A 1RM5A 4WZAB 3MCWA 4LZAA 2JJ2D 4PW0A 4F2WA 1P6UA 1U7DA 3UQ8A 1WZUA 1A97A 1VCNA 5IKEA 1PXWA 4J7JA 2OENG 2Z58A 1E7SA 4PNPA 1OBVA 1EZJA 3LPDA 2RDCA 1VG9B 3W2FA 2VWGA 5ARDA 1EM1A 5JBQA 2YHUA 3BFVA 4MX8A 1Q7CA 4P3OA 2R4UA 3TZEA 4J0FA 1E3MA 2CXNA 3CCRV 3DV9A 4QOHA 3T1QA 3F5FA 4LF8B 3BVOA 3L4JA 2GO7A 4Y1RB 4F1JA 3QUBA 4X44A 4H7DA 4GBED 2I6FA 5B66Z 3F6MA 5B2FA 2NXEA 2X8AA 2QD5A 1KP2A 5K5EA 1O8BA 5DI3B 1CUGA 3QWBA 1E3LA 1RXVA 2X6RA 2ZR0A 3UCEA 5B1BC 4PTLA 2P3LA 3FB6C 4LA4A 1YCFA 1ZX1A 3OM1A 2QD3A 3H9QA 4QXMA 3O95A 1GKYA 4YAKA 2XXAB 1G4UR 3QVVA 3GLQA 5BV7A 3W3AD 2ZXWC 3CXHF 2A3QA 3PVCA 1GO1A 1QLJA 3CA8A 3R7BA 2EDAA 1ZI8A 4MVQA 2C7RA 1R8XA 3SF8B 2QORA 4QULA 2IQIA 2XMZA 3WLEA 3N2IA 4F1WA 3II6X 1COWA 4WZAE 2JCXA 3PQ3A 1NH2B 3KTAB 3K9FC 2O8CB 2EFYA 2CNWD 3PT9A 5CX1B 5EJ4A 3TOVA 2ZT6A 4HXGA 2EL7A 2QM7A 4H0FA 5JS2A 3TYXA 2IIBA 2Z3ZA 1P0FA 2Q7HA 5FOUA 5T5QA 2P2SA 1PEYA 3OZRA 4HB2A 1PNMA 1GAQA 2K2QB 3GHHA 1QU2A 3LT4A 2Z3YA 4P9OA 4ETMA 3RR2A 2RDMA 2FVYA 2Y1LA 4XB6B 3WXMA 5I5GA 5CBFA 2OM2A 5IFLA 3AG3C 3N39C 3N9IA 5B6JA 1OIVA 2GERA 4BKUA 3H19A 2PI5A 3F6CA 3F4KA 3W9BA 4R6WA 1L2TA 1MQAA 2LPMA 3LLVA 3HEBA 2BP7B 1ULAA 4OKSA 4BLPA 1ML4A 1CZRA 1A2QA 3SP1A 3TSYA 2UUCB 2G70A 3FPCA 4HDSB 4QSMA 1JSLA 3IQWA 1N0JA 2WM3A 4M2LA 4PV7A 1DZ3A 2ZT9B 1YQXA 5KQSA 3MHPA 2LR0A 2Z1EA 4G8BA 4GPEA 1MX1A 1L8OA 2CTQA 4TYMA 3E20B 3HXMA 1X7DA 1CR6A 4IDHA 1PDOA 2D3WA 2WJ3A 1CUJA 2HSEA 4D3YA 3ZDCA 4KACA 4LFAB 3R6WA 4HKTA 3AJAA 3QBJA 1XHEA 3CURA 3SS7X 4WBNF 5JS7A 5JYCA 4WERA 3JASA 4RDCA 3D36C 4DAOA 1RWXA 5KYYB 1UJWB 1RRMA 3SXPA 3OTFA 2XGOA 1YB7A 1MV5A 2GPYA 2RHOA 1HDOA 1Y4DE 3VR5D 4ND8B 3E9EA 2PK3A 4R81A 3S5UA 4D46A 3OF2A 5LKRA 3QYPA 1U8TA 1XROA 1XZKA 1N77A 2XADA 5K3EA 1DKQA 2R2GA 4LYJA 4XXHA 2QRGA 4JHLA 4KXXA 1LFAA 3HO1A 2OCKA 2CNLA 1UC9A 2DR3A 4IQ0A 1NVXQ 5J2TB 2FMKA 4CU2A 3AH8A 1NHWA 2KS6A 1BWQA 1C1DA 3M5WA 3NP7A 3CONA 2QRLA 5HRCA 4PR0A 1JQ0A 2PA3A 1GXSA 3TJRA 3TBHA 2ZS9A 1BA3A 4PVCA 4RAIA 4B08A 4UAUA 5DGCA 1YA6A 4ZTUB 5JSFA 4MVUA 5IDVA 1NVPD 4MK4A 4AF6A 1UOQA 2PCJA 3RW0A 4L73A 2HVKC 5JAHA 1E3SA 4AKIA 1EFCA 3OBYA 4RZSA 1MG1A 1YOVA 3PFWO 1YRLA 1JEQA 4RPGA 3FLMA 1PFUA 1AB3A 3FPGA 3UWDA 5I7AA 3UG7A 1SK8A 3AONB 3DJYA 4UEOA 1OJHA 4LF7B 3L8GA 1OMOA 1D2HA 4K8ZA 2QOEA 3NG1A 1S1CA 1HKUA 2OPHA 3URMA 2HHCA 5DULA 5K3FB 2G3YA 3PFFA 1GAWA 1IV3A 4P33A 3F0DA 5KJFA 4PGFA 3ESQA 2JANA 3OCYA 2GK7A 4RD2A 2Q3FA 4YJ3A 3LHDA 3ME5A 4DC9A 3NHLA 4WUTA 2BJVA 1CUEA 3KR0A 3TIIA 4PIMA 2CHGA 1IZ3A 4XUDA 4NS4A 3ZO8A 1KMMA 4KXLA 4RELA 2GFIA 3LWOC 4Q4AA 5HS4A 1I2MA 3H0KA 4KLZA 4I4LA 1KR2A 5E7QA 4RFLA 5B4TA 4OMDA 3ZGNA 1JQ5A 3EMVA 1HE2A 3GRKA 4MUXA 1Y8QB 2GEUA 3OONA 3IAFA 4TMXA 3SX2A 1VE9A 3SFZA 2PWZA 3JAMN 4Q1CA 1KECA 3BXGA 2JRCA 3OLWA 4EHIA 1GYPA 2ZIWB 1KA9H 1EESA 2BUCA 4HF7A 1MT3A 1WN7A 2OG1A 2B5VA 1M6EX 1T15A 3OQVA 3L7YA 3JYLA 4BNGA 1OFVA 5HOEA 2PGXA 3QVKA 2PZMA 2N48A 4PN7A 4NOMA 4R8RA 2QL7A 4OUDB 5ALHA 3SFVA 1E4VA 3ZEIA 2OQ2A 3D0KA 4FM2A 1U3CA 3CMAV 5LMZA 4U7FA 2ZJ2A 2ZREA 3AP2A 3NK6A 2XKJE 2WVAA 1JWBB 2F43G 4JBHA 2IS6A 3SYLA 5TQ2A 4EHDA 3C14C 2REQA 1DQRA 5LZ8A 1QP4A 2ZUUA 3EVFA 4Q0MA 1QO0D 1J1IA 4IUYA 3SLKA 5JJBA 3IEIA 3KFLA 2BUAA 1Z74A 4FHZA 5KVCA 4XWTA 5FTWA 2DY0A 2H52A 1DF5A 1UFRA 4BMOB 1J5EB 3E18A 4LS3A 3DF9A 4HQ0A 1MN6A 4CE6A 4B62A 3RUIA 1H3FA 4RE6A 1JPUA 1IQPA 4I5SA 3JWGA 2A5LA 1MEOA 1Q3HA 4DB4A 5SYAA 2XUAA 4S2EA 1JG6A 1POWA 1K4YA 2UZIR 3E89A 5ELLA 1Y5NA 4DCMA 4URXR 5JIBA 1CZOA 1K8RA 1SOAA 3K3PA 5LQJA 2ZJOA 3ONNA 1BCCH 4IVQA 2JS3A 1J70A 3VDXA 1H0KA 3SIUA 2H7CA 4UFNA 4EGJA 4AY3A 3B51X 4DPLA 4L0QA 4W4TA 1MIOB 5JJNB 2R1TA 3RG2A 2NU8A 2EIJC 1S8AA 3CPJB 5F9MA 2WMNB 4P2GA 5FTKA 3CR3C 1EU1A 3IDFA 3U44A 5EE9A 4GS5A 3B2EA 1W36D 2ACVA 2O3JA 1MABB 2YXEA 2MSEB 1JVNA 3RABA 5ERXA 3GI1A 1EK2A 1D2NA 2FMIA 4LNHA 1GLGA 4BIMA 4P86A 5HR5A 3VOAA 1W0JG 4MB0A 9ABPA 5EVJA 1FFHA 2OM6A 1W59A 2YZ2A 1V16B 1SIBE 2IZ6A 3Q41A 4NNJA 4TMFA 5A5DA 5IT4A 2E4VA 2ERYA 3ASOB 5D3QA 3RVZA 1AKWA 2L69A 1E66A 2JH9A 4Q4CA 5GANK 4DIFA 2HWUA 1BWSA 4MV8A 4MPPA 3V4RA 3U37A 2AGVA 2QRJA 5HEKA 1A82A 2BZ0A 5H5JA 5A0FA 5EE5B 5K2MA 4IIJF 4X62B 3PGJA 2CJXA 4EABA 2QTRA 3C3XA 3ZBPA 4Q4JA 1FXWF 3UAYA 4X89A 1NVGA 3D8CA 4LWOA 3BK7A 3L7OA 4Z4EA 1L3BA 2ZATA 1PZHA 1AM4D 1XMSA 4Z7QB 3C3TA 2G72A 2X8JA 3OFKA 4W5QA 4DLUA 2VG8A 4WBNB 4J0CA 2JJQA 4J0QA 1B6TA 4BNXA 4DXAA 3I3FA 3DEJA 3MJCA 4BP8A 3I9MA 4Q7LA 1P49A 1COWD 5E3JA 3N3BC 4EB8A 3NXKA 1RBZA 1AV6A 3MGKA 3M8KA 3MLEA 4ALKA 4K0KB 1NNSA 4JT8A 5B3LA 4MWEA 1P62B 5J9FA 1OXXK 2ZQZA 2X0JA 2VUUA 4BB0A 4PLFA 3GGGA 1ESZA 1YI2V 3IC5A 1R4NA 3Q8HA 1DV1A 1AKTA 2WSSG 4C6HA 1KORA 1QLHA 4FYMA 4RV4A 3HCFA 3SI7A 4KQEA 4E5KA 3GFOA 4R1LA 4G2KA 1MC8A 2G80A 1JIUA 5G4KA 4B7UA 1HY3A 1LR1A 5DTIA 3AQ4A 4RV9A 3RT1A 4UZSA 3TSOA 4LJRA 4TMWA 3CTMA 4ARAA 3CX5F 1RLOA 3SE0A 4CDNA 4RLQA 5K1XA 3Q3GE 3W2HA 1KXZA 2PFSA 4TZZA 1IQ0A 3RRXA 1VHDA 4X7RA 4X8AA 1SIWA 3MGBA 1U2RA 2CCJA 2F17A 1U63A 3VOUA 5ITZA 4GVPA 2QU7A 5AOVA 2UV8A 4ZVPA 5LQNA 1RHJA 3EUFA 4NJEA 4ZAWA 3R0ZA 2GAOA 4X6YA 4FFKA 4EY6A 1DCTA 3SBDA 4RTSA 3UWMA 1U28C 1ZK2A 4U02A 2IEGA 1Y76B 3DXYA 1PR1A 1CDEA 2VLBA 2D1RA 2VJQA 2H4XA 3SNHA 2HYIC 3CUKA 4YCNA 4B7ZA 4C0WA 1GD1O 4QGFA 1QBKC 2COUA 1C7ZA 3T7JA 4F21A 2VFAA 3OLYA 2CVPA 4NONA 2R70A 4E2LA 1VJGA 4NV0A 1O87A 4LE2A 2QP4A 4Y2JA 2PS0A 4X3PA 1XRGA 4CKBA 1OLSB 4J1QA 4M8KA 4MYSA 2GB4A 5I8ZA 1E2LA 1CTQA 2RC6A 1E63A 4BRWA 3SJ7A 3LDAA 5KAIZ 3GRRA 4V1CI 1AUQA 3W7BA 3FD9A 1FRZA 4KKVA 3DEFA 4ZDWA 2W8BC 3CLUD 4KOEC 3LIIA 1A7JA 1U3GA 3UWSA 1CIVA 2R8BA 4UC0A 4KQKA 1LS1A 2E4ZA 1SKVA 5F2OA 4C0SA 5FWYB 2GFHA 2DT4A 3R5SA 2QD2A 4F3TA 1FYWA 2P06A 1NY6A 4U5XA 1OCCB 1C3OA 3TR5A 3KU4A 3TTXA 4DDUA 2ZQMA 1CJUC 3LX5A 1K7DA 2ILTA 2VXOA 4BC1A 4UVHA 4NCBA 1GM9A 3C1AA 3ZCQA 1P2GA 4PHHA 2V6BA 3ZUGA 1PQ4A 1TUEA 2X1MA 2ZTUA 1Q82H 2CTRA 2RGCA 1G3UA 1UFYA 3E9NA 5TLSA 3L04A 5JTUA 5HMMA 1G41A 4ND4A 2VQEB 4FZ0A 1HBJA 3DAYA 4JD5A 3C3PA 3PGA1 5GY7A 4D3ZA 1ZMOA 2WFMA 2XA2A 3ETNA 4JI0O 1QVAA 3I72A 1C9DB 5BRAA 3GLFB 3ENVA 3UFXB 4J76A 1NJ5A 3D0QA 2IGBA 1GFIA 2JIDA 2OP1A 4YP7A 3MA0A 3I73A 2AC7A 5K8VA 2OCAA 3ZDAA 1K92A 1KYWA 1KJQA 4QYTA 1RHQA 1TZCA 1IDSA 3F7NA 5FAKA 5C1BA 4GL4A 4G28B 5EZSA 2G1JA 1OUMA 3EVBA 3LUKA 2BMWA 2CXRA 2J45A 1ZXLA 2YUIA 2JAQA 1Y3HA 4G9EA 3ZZ1A 5IN5A 3SZGA 3OQOA 3TAHA 1W75A 5EXDA 2D8MA 4JFRA 4ENPA 1OXVA 4B31A 3WLLA 3K8QA 1QOPB 2HF7A 1CQXA 4YH1A 3ZYCA 4P3YA 4C3VA 3M9LA 2Z8YA 2Z5LA 4DRXB 5JSHA 3RYTC 4RORA 1XL6A 4XWYA 1M2OA 5FWDA 1E1CA 4EUKA 3O4HA 2Z1TA 4YV1A 3GFBA 4EZIA 3C90A 3ZQ6A 4H6WA 3JAMA 3SC2B 1E32A 3TNFA 3D6TB 4KDEA 5LD2B 3LSQA 3C43A 3KEQA 1TU3A 2HHAA 2P5OA 2SKEA 3QU5A 3BE6A 4AUEA 3ZHUA 2VCHA 1Z2NX 2BRUC 4BGIA 4F8JA 4FZRA 3EFOB 2QMHA 4QYXA 3ZMVA 1TK3A 5EP1A 5GPBA 3LO8A 4NY1A 2IOFA 1X86B 1JDNA 1VI5A 3WADA 1XD9A 2NU7B 5EE1A 1GNVA 2O5RA 2BWJA 5DB4A 1YE5A 1VM6A 2WIBA 4J0IA 2TSYB 3PWTA 3JSLA 3GLFE 4ZOCA 4OI1A 4MVOA 3MOGA 2ZRPA 3EJ6A 2P8JA 2ETVA 5KHKA 3NMUF 2H63A 4L8GA 2B1GA 4URFA 3TLMA 1OB2A 3NX4A 1SXQA 1WHSA 3D8UA 1VQOV 1KJNA 4RD4A 1YMQA 2RHMA 5JLAA 1N2XA 4Y2YA 5J4VA 1RM1C 1V2GA 3GT4A 4DNPA 1XTUA 5FLXN 5EIBD 1E64A 4IIJB 1XZEA 4PNZA 2R25B 4YRAA 3ZXSA 2IXAA 1SKBA 3I37X 1E9CA 4RNCA 1UDBA 3VMFB 4OQPA 3LMKA 4LYEA 4ZAVA 4Z9FA 4RVHA 2VS1A 1TMYA 2VHTA 1OROA 4TMZA 5EXXA 4GC9A 2AFHB 2C9MA 2BELA 2ZUEA 5CPFA 1ZIPA 4YIOA 1NQVA 3LWNA 1DJLA 4HPXB 4S35A 2HYDA 3LU1A 3A05A 1EFVA 4GFDA 4MO9A 3IKFA 1RZVA 2ZJZA 4RHYA 4BUZA 3Q12A 5JSUA 2WLLA 1CK4A 5IUNC 2FK7A 2PKEA 4UE6A 5AW8A 1QKIA 4JI7B 1Z28A 1KH3A 2PMFA 1VZ2A 1X7WB 6LDHA 3CMCO 4KPGA 5E1DA 4LDZA 3KQUA 3IEPA 2AD5A 1W2WB 3E8FA 3C9RA 1YQGA 4HY3A 3ZJYA 1V25A 4PIVA 3MB5A 3CG0A 3UMCA 2DYYA 5JS8A 4BB5A 1SHUX 5JXGA 1U97A 4B75A 4MQ6A 2PH5A 4AS2A 3K5OA 2PLNA 4Z4HA 2OV2A 3OTWA 3OE7A 4C0AC 5FI3A 1NURA 1X39A 4KI7A 8GPBA 2VJPA 4NTZA 2HUNA 3VQVA 2WQ7A 2ZBGA 3TQRA 3AVTA 1LBHA 4JL8A 3ASUA 5C8YA 3ZNPA 1JQLB 2HBZA 4F3CA 1GU7A 5AKYA 4RESA 5L6MB 3SXUA 1SQPH 1I94O 3C41J 1ZXXA 4AP6A 4PSDA 3ABRB 4BQQA 4RA6B 3JAKA 1Z15A 4RTJA 1L4FA 2VQ6A 3M4XA 3OA0A 3BGWA 1TTPB 1XXLA 2CW5A 4GKJB 5BN4A 4HVCA 5AVVA 4DYVA 2LO1A 4XYMA 5DHSA 5KHIA 4XDZA 2AFHE 3GARA 4I8DA 2WTXA 2Z9DA 1X7OA 3K30A 4PLYA 2HRQA 4G1CA 2ECQA 2RGYA 2YWBA 2K6GA 3ICCA 3E8MA 3TXYA 2QSJA 3O4FA 2GAFA 3VTZA 3SIRA 3LYLA 2UUBB 1XEXB 2Q5HA 3DWFA 5JNLA 1ZBQA 5IZCA 4LYYA 3KJHA 4TLBA 1DXYA 1S9DA 2GA8A 3BE8A 2G77B 2XXBA 3W5HA 5BV0A 3OZDA 3OEHA 2A9OA 5AKZA 3EMKA 2C2MA 2XRYA 4XH9B 1TLLA 5K03A 3A1TA 3KKKA 2WTEA 2WBLC 3SE7A 1N36B 1PT7A 3CX8A 5FYQA 3OJ0A 3TD6A 1CVLA 1UJ6A 2MR5A 3HJGA 3RRBA 3TS1A 3KJXA 2HRRA 1M1XB 2K7ZA 2W00A 3OFNG 2ID7A 1Y33E 4UB8Z 5JROA 5EUCA 4B87A 2FEWB 3B40A 2W6OA 2J5RA 5GAPK 3JALA 4H6XA 3FUWA 3MJRA 3BSSA 4YRNA 2HCRA 3HCRA 3CIFA 1KVRA 2GN2A 3EF3A 4MW4A 3QV2A 4CTKA 3LHIA 2KTVA 3HYTA 1YRBA 2I4MA 1IMJA 1YJ8A 2R62A 1ZX3A 3I30X 5K1ZA 3ZWCA 1WY5A 4RK4A 1NF3A 4Z8YA 4HN9A 2WF7A 4FEGA 5GQSA 4LWSB 2EBFX 3IRVA 2JFGA 4A6XA 3E3MA 3AIKA 5TSDA 3D8SA 1JKMA 3QVJA 3K57A 1RP1A 3VVCA 1Y9JA 3CLHA 1YTFB 3PLRA 1E69A 3NVAA 3R0JA 4A0HA 3C15C 3OZCA 1HSOA 4LBZA 5TGZA 4D26A 3H83A 1H22A 4K9QA 4JV5B 1U02A 5CH5A 2V1UA 3KELA 1EXNA 3FRIA 4K88A 4RTRA 3L8HA 5GM1A 3IAAA 1NRXA 5EIXA 2YIBD 2H6LA 1H8HA 3DH0A 4C3ZA 4BFCA 1GZ0A 1XTBA 3AF3A 4RXUA 4KI0A 4KTTE 1WXHA 3I3SR 4JSRA 3AY0A 4BNVA 2CUNA 2UYCA 1OA1A 4ZN6A 2BBOA 1SQSA 2ZB3A 3D8TA 3FYIB 4H3HB 4DQKA 2DTEA 2EP8A 1AJPA 2OCIA 3E81A 4P4LA 3IERA 1X7GA 3OT1B 4R8SA 4W5JA 2BFFA 3D2BA 2ZE7A 3MQFA 3S2YA 5FO0A 3GEPA 1K73H 3NPMA 3FOZA 2QR4A 5HF8A 2JK1A 1GGNA 1V7PC 4G1MB 4FFPA 4WT7A 4OK3A 2NUTB 2DHCA 5CIWA 5GIOE 5KMGB 1SK9A 3P8ZA 1GT91 1UKVY 3HLTA 3OM3B 1QYWA 2FZCA 2E4AA 1JEAA 3Q8XB 1G3IA 1AK1A 5CTJA 3LA8A 3Q4HB 4YASA 1RA4A 2QN3A 2B25A 1EFLA 5ADHA 2F3PA 2IFTA 1TMGE 3C7DB 4TZ0A 5I7WA 2BL4A 3TPCA 1JX9A 4TVBA 1XDBA 2IHYA 2YVLA 3CLTD 2XTZA 1R18A 5BVHA 3CPWU 3CCFA 4IJKA 4JCOA 3FPHA 1MO3A 2QRVA 3KM0A 3SQMA 4CF4A 5HK8A 2EFGA 3N0VA 4HQNA 1IIRA 3J81N 3SR4A 3AFHA 4FIPC 3ZZNA 1U3FA 2FB9A 1VCHA 2DH6A 4RZQA 4AWBA 3M9XA 2H5LA 5KDLA 1FF9A 5FLYA 1SXPA 4OHPA 4M8IA 1XQ1A 3B5EA 1ZH8A 4J16A 4ZCLA 2PD3A 2NUAA 5A4FS 2HP0A 1Y7HA 2ZRJA 5DP1A 3CUYA 1B8OA 4IL5A 5KYTA 4N12A 2XNCA 3MJSA 4YYZA 4OI4A 5ITWA 1K5QA 4B48A 5AUNB 4MWCA 1YXBA 1WW2A 3NRCA 1TM2A 2YJ3A 4G1VA 3D3WB 2D2IA 3BT7A 1YU6A 3BL5A 4HK4A 5GM2A 1WP9A 3ACDA 3I6ZA 1YONA 3J80M 2X15A 4MS1A 3MQ4A 2HB6A 3PHHA 3EXIA 1KMIY 1XZPA 2YASA 7YASA 4YC7A 2J0UB 1Z5WA 5JOQA 1F38A 2RAUA 1NUPA 4WI1A 4IP0A 1VF6C 2BGKA 2R8XA 1SOWA 2V0CA 1JT9A 3U62A 3VQTA 4MITA 5KQPA 3WA6A 2VZ0A 1RBQA 4AMUA 1JHDA 3M34A 2G9UA 2JVDA 3A3NA 1MB9A 3EXHA 3OW2U 1MSDA 1WD7A 4J3FA 2BI4A 3ELDA 3KBOA 1F8YA 3IILA 4JOBA 3IA7A 4DF3A 4I9HA 4PCAA 4TS9A 3PTZA 4JLNA 3HN2A 5H02A 4KP7A 2UZ1A 4YRMA 4L6AA 1SPBS 3CC7V 3SYAA 3ITDA 2FEMA 5F1YA 3O65A 1XNJA 2RB4A 1I7DA 4RZUA 3H9JA 2GF0A 3VNSA 2IHUA 1VQ9V 1U1DA 1O89A 3LFUA 1ZA2A 3L1KA 3MTJA 1U0TA 1C0EA 1PVOA 1HT3A 4XX0B 2WW8A 2JRLA 4MVYA 3U3RA 5EJ2A 3GFPA 4FLEA 5C5CA 3FWKA 4GRAA 4KBGA 5JALA 2WUWE 3V8MA 1G8GA 2FP4A 1J42A 3D2AA 1P8AA 3HO8A 4DREA 4F4UA 2PZEA 4QDTA 4AROA 4OBBA 2VOJA 3KJKA 3QMMA 1S5HC 2H54A 4HRXA 2RGBA 4ENWA 5IABA 3M4ZA 3RVRA 1L5FA 4U7OA 5EXPA 1VSBA 2VF5X 2KGWA 1ONSA 1PFVA 1DINA 3VR2A 2FP3A 4H1TA 2Q4DA 1WX1A 1GMGA 1PJRA 5FLXA 2C3PA 4MI1A 2GHRA 3N87A 4NVRA 3IGAC 2JD1A 2NR5A 3DLCA 2I7XA 4KBYA 3T5CA 4WLUA 1YKFA 4XGQA 2HT1A 5CT4A 1CUCA 1ZW6A 4UDXX 4OJQA 4S12A 5K8TA 1UJ4A 1QHGA 3O2SB 3KPYA 1XR3A 3HJCA 4MTLA 2D4HA 3C74A 1C1XB 3CX4A 3ONFA 1Q91A 4X9XA 1SUCA 1KQNA 2Z0MA 4ZV7A 1Z5NA 1TTQB 1G55A 1Z6TA 2DTDA 1AGXA 2IUTA 1L4EA 4N8DA 4ZKEA 3DHWC 3RBZA 1CXZB 1YDGA 3GQBA 1U9YA 1AR5A 1YS1X 2ZR2A 2TS1A 2WA4A 1P7PA 3MGGA 4ZV4A 3AB8A 4K6OA 2AK2A 1T6YA 2ZFUA 3DTNA 3QFRA 2HA3A 1Z2EA 2PN1A 4JP8A 1M2GA 3R6GA 1N78A 5KNBA 1G2QA 5L40A 3VO1A 3EDYA 2Z2KA 2DBQA 5FCDA 2DXIA 4DABA 4UNRA 1NPYA 2L2QA 2XNKA 1XZIA 2J33A 4HWSA 2QT1A 1EXDA 2FNAA 3TGPA 2G1AA 3RI3A 4EQ6A 1YITV 5LB2A 5DX0A 3REQB 4MRPA 3FA2A 3EOZA 4KFUA 4DUZB 1XZFA 1IOZA 3TDMA 4GLXA 1VQMV 3A1VA 4TT3G 1YZGA 2UXDO 1HZZC 2FVXA 3THYA 1E8NA 1VLHA 3KUCA 2JFPA 4TT8A 4ZTZB 1KDPA 1MQ9A 2Z01A 3S0YA 5DHUA 1SKYB 3FWYA 2ZRCA 3KP1A 2ABWA 4ZI7F 4KUMA 5TDHA 3R0QA 1RVDA 3AZOA 4LF4O 1PD3A 1L7MA 2CLSA 4MMZB 1YS4A 1Q7GA 3LS2A 3JATA 1W49A 4H2DA 3L8YA 2OHIA 3G6WA 4G85A 1P2FA 3H4VA 3IVRA 4JJIA 4NTXA 4N9WA 5KTRA 2X19A 3FZGA 3I6BA 3KRTA 3UJ8A 5L7TA 3OEHD 3OZEA 2JGIA 1O9BA 3LTEA 3NTLA 2C1XA 1R3IC 3UKOA 3W3AH 4B3GA 2R0QC 1X7XB 2WWXA 3G71F 4GKKO 1JYEA 2X1VA 3L0CA 3NIBA 4ABTA 4QIWF 3R3HA 3SBEA 4QJ3A 4IG4A 1GN6A 1JAIA 1O7JA 1GYRA 2H2IA 3LLMA 4LH7A 2ZK7A 3P0HA 4RHUA 2F8SA 4IS2A 2EARA 5JD4A 2B34A 4AJNA 4PRYA 2QSAA 3CZMA 1L7BA 1WPBA 5HFAA 3Q5DA 3R7AA 3HUFA 3NAZA 1OIXA 2PPLA 2PUTA 1EZ4A 4MRVA 4K9KA 2DN9A 2EAUA 3QNMA 5JRZA 3VI6A 4CC6A 3THWA 3UMGA 4CUJA 1KEEB 4ZJYA 2GBOA 4Z1MG 5L95A 1NX9A 2R8OA 3WX0A 4EMSA 2ARHA 1XN1A 3M2TA 2X42A 1J9EA 4OMUA 5ALZA 5DT2A 3ERNA 2OTLV 4KQXA 3REOA 3DLPX 1G7SA 3AFNA 3DXRB 1RJ9A 2GCOA 1SKYE 3WGKA 1XMQB 2CMFA 4C2AA 4X00A 3IQGX 3PQFA 4MVJD 1M76A 3IEKA 5C1DA 5EJEA 2X7XA 3V32A 2V4ZA 3EF0A 2X4IA 4U7HA 3N8NA 1LX7A 4JLVA 2OBLA 2I55A 1ZD1A 5B3JC 1DDGA 4GSLA 4ZAFA 3GEIA 3PG5A 2XAFA 1CY0A 2CVOA 2QMZA 3A06A 2XB6A 2FPXA 2HW8A 1PBTA 3AUUA 1DJPA 2A7WA 3A2LA 1IBLO 4JLWA 5DCUA 2PO5A 1YJQA 4AZ3B 4UMEA 1WNSA 1T0KB 3A9WA 2D7CA 1V96A 1XKQA 1HXHA 1GPWB 1H8HD 3S2IA 4JSYA 3DE5X 3EHEA 3FMGA 3KXDA 3X1ZA 1YD7A 1CUBA 3OC0A 3C6YA 3KSBC 1E5XA 1Y67A 3HXQA 3Q11A 1K9SA 5H6QA 4JAAA 1YZBA 3VTIC 2VQFB 3EAQA 1MTOA 1OXKB 4NZ9A 5EERA 5ETJA 2OO5A 3MZ0A 2UDPA 4M1OA 3TQQA 3AEKA 5JZOA 5G0UA 1ZL8B 5EY5B 2ZXWB 1ZUNA 5ALOA 3QTCA 1YH3A 4UCVA 4RC9A 5KJ1A 2HBRA 1OT3A 1VQPF 1QOZA 1T3LA 1IWOA 1CEZA 2BEVB 4B3XA 3GB9A 4HAXA 2V7EA 1GKUB 5JH7F 3KJZA 4IOLA 4OMCA 2UXXA 1V8DA 3CPEA 3W7UA 3AJRA 3R4CA 5M7EA 4J1TC 4TSFG 1T4CA 3DYIA 1KB9F 4PDVA 3NKFA 5L45A 2WAXA 3DVAA 2Q6IA 1MSWD 2CWWA 4B3HA 2KBFA 1DG9A 1K75A 3SVLA 4OH1A 3GEHA 5AM2A 3E4CA 3I39X 1YGYA 2ILMA 4MDFA 2LCAA 3C3MA 2ADMA 1YBMA 4ARSA 4C30A 2J0QA 3WLFA 4GM4A 2XQGA 4NZMA 4DHEA 1VLVA 5TV2A 4ITRC 3MD0A 3FN4A 3RJZA 1Y4AE 2Q4OA 4TXHA 2QT9A 4ESOA 4KWCA 1ZN8A 2C9CA 1QU3A 4P7FA 3LHFA 5ITVA 3SN6A 3AG3B 3GT0A 3KQLA 4YO7A 1C4KA 4BO1A 4BRSA 3GNTA 4N39A 4GOMD 2HXGA 4RABA 2I66A 3J81A 3H42B 3H5VA 1CRPA 3D4LA 2Z6AA 4CQLB 3HRIA 4ZJZA 2V97A 2XASA 1U1FA 1RYHA 2HLDA 2WINI 4UZEA 3L6UA 5K99A 4CQNA 3GHYA 4Q00A 2RHBA 2OKCA 3L02A 2QZPA 4PC1A 3REGA 3SPHA 2XDQB 1O96B 2KYRA 4LI0A 5B6IA 4FX5A 3ZZUA 1J1UA 2QTZA 3OIGA 2LGQA 4E2YA 2QLJA 1VHTA 4WFJA 4UCTA 2JS5A 1FRFS 2WA3A 1YIAA 1EE2A 2Y68A 3U0ZA 2W71A 1L9XA 1F8GA 3W05A 1YWGO 3OPYI 2XBMA 2FE1A 3WMGA 2AYXA 1TZMA 5EIHA 2IEIA 3V8VA 5JI2E 2RCVA 5CLHA 1GZ3A 5FPOA 4CEIA 2PTMA 2QW1A 4RW0A 3CUSA 3CMEF 3N5KA 1FPOA 4WNIA 4WK0B 3HB7A 4AW9A 3LP5A 3QF4B 1IURA 4OHVA 2QSUA 1CQWA 3K8ZA 2G7ZA 5DE3A 2C98A 5KVSA 4OXKA 4O6VA 3UUGA 5JCZA 3L6EA 3G2KA 3L7CA 5A9SA 2VPQA 1FRVA 3P20A 3U4HA 1NF9A 4R3NA 1VKOA 3WNVA 4N6NA 2HXYA 4FWTA 1GNTA 2Z5GA 1EEXB 5C9ZA 2IYAA 1U99A 2VKQA 4LDQA 3C2QA 1JHQA 1YQNA 1N2CB 1DTSA 4Q7JB 4ZVLA 3V2IA 4DV4B 4OJMX 2YBDA 4ZYYA 3V7EA 3VX3A 1WCWA 1U7TA 2WD7B 4HDMB 3FKSG 1F17A 1TX4B 4CBVA 3GRZA 2IF0A 4DEYA 6Q21A 1I3OA 4LJ4A 3AHIA 3ZEAA 4Q48A 5ULLA 4JUCA 1HWYA 4QATA 5L7YA 3K5MA 3VR2D 2CLFB 2P4SA 4DMUB 5JFOA 2VHCA 3IJPA 4YMGA 4C6RA 4ZI7B 5MF6A 1L5RA 4LCUC 3JQ8B 3N0XA 4C4SA 2XT9A 2XMPA 4LUCA 4WFIA 5AKKA 1Q7YW 1JBQA 1FX1A 4CEHB 2PLFA 3OKCA 3T1OA 2VXBA 2WJWA 3PJFA 5G40A 4FJ0A 4Z0NA 3QFCA 1NSFA 3DSRA 4QNHB 4I2NA 1MOPA 3L2OB 4GPAA 1NUQA 3FH0A 2UUCO 5E6SB 2ZRDA 4FJ1A 4U6QA 2G07A 1RI1A 1HQCA 3OE4A 3K0AB 1F0KA 4FTWA 3TCNA 4UVBA 1NNLA 4WLNA 3C45A 1A9PA 3IOBA 1OFUA 1RQXA 1H5QA 4BWVA 4RX1A 1NUUA 2VYNA 3N6VA 1L9KA 1W25A 1T2NA 1Q5PA 4BWYA 2FWBA 3IELA 1W0CA 3O90A 1E3JA 4LFAO 1U43A 5JE8A 1F1JA 4HGOA 2VXCA 2GKOA 3R0VA 5ICMA 1GAJA 3ABTA 2Z1NA 4M49A 1N2CE 3PDIB 1N0WA 4FBGA 3VBBA 3OIUA 4HS9A 3RVPA 4JJAA 2XNDG 3ZC3A 4XEUA 1USVA 5HY2A 2A7XA 3H18A 4NPAA 4NB5A 3HWRA 2VP5A 3U16A 1H2AS 3AEQB 1CQIB 3E5MA 3EQ2A 5LQSA 1CS0A 3OD1A 3O4GA 4UVDA 1KY4A 3D5QA 1L8DA 2IT1A 3C6ZA 4D8YA 4WCFA 3S27A 2I6GA 5D86A 2IYLD 2EYQA 1PD1A 1U6JA 5H81A 3DLAA 2IYOA 5CNMA 2VF7A 3ABUA 5DN6G 8ABPA 3CS3A 2X1LA 3LC2O 1WXQA 4LEIA 1YJAA 1SOMA 5GV7A 1SBHA 5KINB 1DTEA 1D6SA 3BD8A 4AXXA 4REOA 4QD3A 1AC5A 4PYLA 2YYYA 2JS7A 3T1VA 2QLMA 3HR7A 3W4IA 4TTSA 2GK4A 1II9A 2WSIA 4JB3A 4X24A 1G1XB 4Y1EA 3LUCA 1VK3A 4QDZA 1JKJB 4HGRA 4LF5B 3DLHA 3L5OA 1JD1A 1EGQA 2ZDHA 4LF7O 3GLIA 3DZJA 4F8EA 3WLHA 1QRUA 3NVKI 4C06A 1SQ5A 2X6TA 2RONA 1BHQ1 1XCBA 4XD7A 1K7FB 1DGSA 1CP3A 2A5DA 2V5VA 4P38A 4J80A 5ES4B 4Q34A 2ZSFA 4D81A 1ZJ6A 2GM3A 2XYPA 4YPVA 3BYZA 4OHXA 1ZCBA 4N7BA 1SQ0A 3OF3A 2H1WA 1MNAA 2N04A 1SWVA 3ZBHA 5LP6A 1GZHB 3UW1A 4YUVA 4HZ3A 2VHYA 4M37A 3C3CA 5JH7B 2BONA 4G01B 2HX1A 3KB2A 2GLZA 1X1EA 3C24A 3TR0A 1VQ6F 5EXTA 2AFIA 2WHYA 4CG2A 4L8WB 4EYSA 1KKLA 2HN9A 5KTNA 1IUPA 2J59A 4DOMA 4EENA 3DAFA 2MSLA 1YQUA 1YDXA 2LBXA 1IE3A 2EIJB 3ZWAA 3F74A 3O2NA 3EIOA 1EP1B 3QXGA 1WTCA 3ZD8A 3Q8LA 1B8UA 4NCJA 1S2LA 1Q11A 2OGWA 1VCMA 1I7LA 3H6HA 4YUZA 5AG2A 5E9WA 4X1YB 3D3QA 5F52A 1T1JA 3MBIA 3D4IA 9MHTA 3A1FA 2I4IA 3LWPC 1BQEA 5HF5A 1YJ9F 3KHKA 4YACA 1IOWA 4OHRA 5AI8A 1PCXA 3W8NA 4GNKA 4PC3A 5I9BA 3RT7A 1TGYA 3G2JA 4RK0A 1IV4A 5C1OA 5CXUA 1B74A 2ATIA 3OKAA 1NUSA 1DQNA 4ETWA 4EYOA 1MAWA 1FS5A 2XE7A 5IBPA 2CXSA 1UOEA 2QUAA 3TSCA 3EUWA 2BGIA 4ZU3A 3NYWA 3MCAA 2YV1A 4D3XA 1QHYA 3BABA 1EN4A 1T25A 3GLRA 3DD5A 1E1YA 2UXBO 3VV2A 5IAEA 1KI9A 1VG8A 1KYYA 2BPOA 2V7XA 1I51A 5AIBA 4DCOA 1Z0DA 3KUXA 3DXXA 4PE5B 3EQ9A 3GEEA 8ATCA 2OD2A 4KKXB 3LQRA 5ALKA 3PPYA 3VISA 5C51B 1RFLA 4NS1A 4C6SA 5T4EA 1VECA 1A5ZA 3VVBA 4RTQA 1ZSPA 1MAVA 2GJKA 4WBXC 3TJMA 2R97A 1O6GA 2OXIA 4PA3A 2OHJA 2QYTA 3QNWA 3IHKA 3AY3A 4UHFA 3TB6A 3L6DA 4FK5C 4NAUA 3UKDA 4KR6A 1AQYA 2OLEA 2V0GA 4LI3X 4BX8A 5JYDA 2NTEA 4A5OA 1EDEA 4O2AA 4ZOBA 3DBLB 2ATVA 2IUSA 4WZ6A 4PPQA 4Y6LA 3BHJA 4OXXA 4J3JA 1FFBA 2QIOA 4Z99A 2V03A 5K3CA 1UBMS 2H11A 4HS4A 2FSGA 1V54C 1DT9A 2QGNA 2ZR3A 2KSQA 4YX9A 4FJ2A 4DVJA 5IJAA 2EYUA 2ZB4A 3AUSA 1IWBB 2SECE 2VJLA 4UUBA 4GRIA 1N5OX 3MK31 1FS6A 2PL5A 1PJTA 1DSSG 2V6IA 4MYCA 1LV7A 4ZO6A 4NFHA 3ZCTA 4MLPA 1IULA 4GZ5A 2G7MC 2GDSA 3TK1A 3SSAA 1OILA 4DYDA 2QJFA 2IYEA 4U1RA 1TOAA 4RMHA 5LL6Y 1BE6A 4WKOA 5SZHB 5BQXA 4Q18A 2VDMB 3L8EA 2ZBFA 4YI5A 2O8BB 3V2HA 1U8CB 1U9IA 5EKUA 2FSVA 5KQGA 3IQDB 1CX9B 2PRSA 5IMBA 4KU4A 2IJKA 5FIUA 4Y2GA 4Z5XA 4CNQA 3U61B 3IUYA 4CM4B 3FD6A 2ZI7A 2AW3A 3K9SA 3D3KA 3GNLA 4RYLA 3FHCB 2XMCA 4PPYA 4QOSA 2HJGA 1F3LA 3VJRA 2IX9A 5EVCA 1OCEA 3S03A 1TFUA 4UCOA 1UC4B 4DDTA 3QEBZ 4GG1A 4CLRB 1F4NA 4NHOA 3PE4A 4A27A 3HYRA 3NIGB 4WCEV 3OWXA 2VOEA 3ABMC 3MBMA 3O03A 4MR9A 5CFLA 4UVCA 2XF8A 3MC1A 4J07A 2HQOA 3O8NA 2OC4A 1DNPA 3CX7A 2HJRA 3JQCA 1RKUA 3S0WA 4OXIA 5CYGA 1T9DA 1I4OA 2OOKA 4UDYX 1O94C 1XVVA 2QY6A 1A7KA 1QYVA 3WISA 3KPWA 4PXSA 1U3DA 2B36A 4X62O 3FI0A 2B4YA 1QTQA 2H4YA 1QP7A 1U04A 1S8OA 5A5EA 6AT1A 4B33A 3VSAA 1XVTA 4X85A 1C0KA 3RRYA 1R37A 4AJPA 4AWXA 2R00C 1G0NA 2W0XA 1XB2A 4QQ8A 2WHPB 3HKDA 1U3WA 2C3YA 5FLKA 2B8WA 4NBVA 3V3TA 1KKDA 1B4DA 3EZ2A 4S0ZA 3RM3A 3VDQA 3JYNA 1PK9A 1H47A 5A4DA 1DC6A 2VQSA 1GZUA 3JQEA 2W8BB 1U7HA 2YV4A 4KQ2A 5CA0A 1NI4A 1GGJA 4BO7A 4PICA 2Q1UA 5HNKA 2BKLA 5AT1A 4K0KO 3H11B 3T3DA 5DPMA 2QMYA 1NFFA 2XUIA 3TSZA 3B89A 1AR1B 2EQBA 2WSYB 3CNLA 3I7TA 2GZDA 3RA5A 3IP9A 2QYHA 1VA4A 2Z83A 1VE7A 2OEPA 1NOJA 4OQEA 4ISBA 1ZISA 1PZFA 1GRQA 1E5VA 2CC2A 1E5DA 5DNVA 1VF7A 2YY7A 5JSQA 3R3VA 3JVVA 2ZU6A 3B85A 2X8LA 5IBQA 3RK1A 1KI8A 3O8BA 5C8ZA 2ZVYA 3WK4A 1VFPA 2IYPA 5AW3A 4IAOA 1X7PA 3HZRA 2HPHA 3GWKC 3OCZA 3WSVA 4KNVA 3TQHA 4BAGA 1OV6A 5B3KA 1U0NA 4MEAA 3GA5A 3EA4A 1V6CA 4FFNA 3IIJA 4Q6WA 3DMPA 1Y6QA 1C7RA 1KKMA 4R2MA 5J43A 4L9SA 5IAJA 3WGZA 1A8SA 5EQTA 1OCOC 2BHTA 2XUDA 2RBGA 4ZICA 4HB3A 2OFXA 1GOTA 2AXTZ 4EW2A 2HADA 5EJAA 5ECDA 4OHUA 4AQ7A 3B5JA 3L77A 1F4MA 5LMNB 5CDFE 3CLSC 3QQ5A 4DLLA 1XT6A 1BJTA 4QDUA 4ER7A 1Z4KA 3LOUA 5REQA 2ZBEA 3D31A 4RJ2A 4F86A 4WFAV 3VO9A 4CIXA 4C22A 3FVVA 2WPDA 2XUOA 1H85A 5EHZA 2Q50A 1JDUA 1YA4A 4KH0A 3WMWA 3A9TA 5FHQA 2NQ2C 4FCVA 2QVGA 2A1IA 4ZU1X 4KDFA 5EMNA 3L4BA 2JFQA 3I8XA 3T1CA 3T3GA 4IDPA 1W1IA 4Y2TA 3TD4A 4MWZA 2PBRA 1W9HA 3CT4A 3VPCA 3K35A 4H9GA 4PV1B 1PVVA 4ARVA 2X9LA 3CCEF 2ZSHA 4FM0A 5C80A 4YN3A 1ZCJA 2C94A 4DR7B 1EGHA 1RBMA 1D9XA 3C39A 2O4CA 3G6EV 3PYXA 3BGSA 2UYNB 1OAPA 2ZUCA 3NEJA 4WFEA 1B8NA 1X15A 5TX7A 4E94A 1N0VC 4N48A 2FQ1A 1VLZA 3BY6A 4PSVA 4GLJA 1II8B 2PZLA 1CV2A 5HIKA 1XUQA 3UXEA 4PFKA 2JFFA 1FNDA 5K8CA 4AB1A 5E38A 4I36A 5DMHA 1OCZC 3E3NA 2WRZA 3PUXA 1RM1B 1VQLV 2F59A 3I5AA 1IN1A 3FYUA 4QXAA 3ABQB 3IFXA 1XZAA 3OJFA 3RFFA 3CWZA 5DLPA 2V7QA 1GKKA 3BDIA 2EINC 5DHAA 4G5HA 2DSTA 1OXMA 3IYLW 4X6UA 2RBEA 1ESCA 3W7WA 1UBTS 5BYJA 2DT8A 3CH5A 3WNZA 1QGDA 1NU6A 2F00A 1S72F 3PK0A 2BEWA 1ECCA 1Z33A 3IPAA 2OGUA 4RF5A 4NBLA 1XBLA 3HKCB 1V43A 3IOYA 2NZYA 1V4BA 3C8DA 2JFZA 3N8HA 4YDRA 4Y0VA 4Q1EA 1M2NA 4PDRA 3BWXA 1VPVA 4O29A 2P9EA 4X3CA 3WLOA 3U60B 3W04A 4U2CA 1XWIA 2NU6B 5FPRA 1Q0SA 1VE1A 2Y1WA 4PSCA 5HILA 5DHRA 2WJJA 4G0PA 1JHOA 3AUXA 4R0NA 1HLFA 4NWIA 4QFBA 3KEFA 4RXTA 4KUHA 3HLYA 1SCNE 3E5RA 2CZCA 1L7NA 4TUYF 2XZTA 5F76A 4DA8A 1JJIA 2YEVB 3F1KA 4MZDA 1WXDA 3PGVA 2B5OA 1RQ7A 2Q49A 3WLAA 1SS3A 3H1HH 2FOLA 4M0MA 4ER6A 2R6R1 2C88A 2KLHA 1MUUA 4L6IA 2W37A 1G8SA 4XYBA 4TYNA 3CCVF 4LCEA 1IV1A 4XGRA 1DT3A 2I65A 1T5IA 4A0RA 3UMMA 1HYQA 4KFSA 2Q3CA 3QRWA 5H3HA 1JN1A 1BCRB 4KHZA 1MAAA 4DANA 2GHQA 1BVRA 1Y8RA 4IDGA 1LU9A 2I3AA 2Q2OA 1H4TA 4CKCB 1XPOA 3IOCA 1U1EA 1X52A 3KB6A 4IV0A 3IVMA 2HO4A 4HWOA 1CJMA 1RWBA 1BGWA 2QN2A 2WQ6A 3DWGA 3RU7A 2XZOA 2JLZA 4YP0A 3HWUA 3ADPA 1V45E 4E21A 1YK1A 3H4IA 3QEKA 4D0RA 2B1JA 3V8EA 3IUQA 5F77A 4M1ZA 3CIOA 2VK8A 3TD9A 3N2ZB 2AKEA 3LCCA 4I14A 3AT1A 3QNEA 4D0NA 1EFAA 1RFGE 4DK0A 1IVSA 2ZIAA 1FDUA 2IITA 2Z0AA 1LPMA 2ZQYA 5FH9A 3ZHTA 1MFZA 1YR1A 2P6NA 1MU0A 5CDTA 2FFBA 3OEEG 2O19A 4KXYA 2GEBA 4FFWA 5JAUA 4Y2XA 1T26A 1SCUA 5IT9M 3IPXA 3U3ZA 3UICA 4IWXA 1FYVA 4UOQA 1DDIA 4S1OA 2QVYX 4KXWA 2UVPB 2VUHB 3EVEA 2HV9A 2J5BA 3LV8A 1CERA 3FRJA 4A8PA 3F6RA 3CJHB 3FAVA 1T3TA 1JA8A 1YVWA 2RGEA 2TYSB 2X0EA 2OCXA 3MWKA 4K87A 1LVUA 3GJ6A 4EBFA 5E1AC 3J7TA 4JI7O 3SLRA 2BZ1A 1ULZA 1PWYE 2YS7A 4Q1BA 3OZVA 4EJSC 1XMOB 4TXJA 4X8MA 2P6UA 2OHFA 4ZHQF 5IKOA 4RCZA 2P91A 5L3SA 4BNYA 3NT2A 3JYHA 3BF7A 3LWDA 3BH0A 3FKJA 1J95A 4XVUA 4JKIA 2MINA 3C8HA 3LBNA 5L4LA 5FQNA 4CKWA 4OI0A 5HTKA 4QGGA 5D00A 3F0GA 4JUIA 1GU0A 1NJSA 4FX2A 1G8MA 3NWOA 3A4MA 1N9GB 5IXJA 4YHBA 3OCVA 5EUQB 3EVTA 2Z04A 3KBBA 2ZE8A 3TTWA 5BVGB 3OR7C 2NSYA 4TLLB 4Q05A 1UXIA 3JQ7A 3ZMSA 3VHQA 2VPIA 3C3KA 3D6AA 2B7BA 1NP3A 1Q6ZA 2BFEB 4D8VA 1V5WA 3IS3A 3QP9A 3W7VA 4OM7A 4DWJA 1HFJA 1GH6A 2CLLB 5H9VA 1ZIOA 3HDHA 3LVQE 1EFDN 1XU9A 4XRRA 3VHRA 1ITZA 1PTKA 3PHLA 3NIFB 2A9FA 3OJEA 2M6LA 4L5IA 1P39A 2GBFA 3WVNA 1GO3F 3H2KA 5I7SA 1D1PA 3N0TA 2C59A 3HDTA 5DRYA 3ND8A 1VQNV 3VHLB 2XMGA 4TPKA 4D45A 2RH9B 1GL3A 3G8CA 1W2BF 5FUWA 5HDBB 2WNHA 4EA7A 4ROTA 5LFAA 4BVFA 5A3QA 2QMUA 3H3JA 4FPXA 4F92B 3TAUA 1SU4A 2CUKA 2QWXA 2LDBA 1PG0A 3HU2A 5LIRA 1N4DA 5KTTA 1HTBA 1U0HC 2FYUH 3DGFC 4KG7A 1XGKA 5HJ7A 2AB0A 3OI7A 4JYMA 2BKAA 4LDJA 3KNZA 2N1BA 4X9QA 4IYRA 4CFYA 1IPEA 3H5OA 3PKJA 2XMRA 3INNA 1OGJA 2GPNA 4FDVA 3T4EA 1NKDA 4DE5A 1Z2AA 1F7UA 2CUGA 5CB8A 4BBJA 4ZJUA 5LLSA 4UHBA 5EIFA 2A9VA 1UWLA 3E9QA 1DIOB 2YXHA 4HEA1 2IU6A 3TUZC 5AXCA 1SZTA 1EQ2A 4C0QC 1XCLA 1CZKA 5A4IS 3IQHX 1E1DA 2J87A 3P9PA 4HX2A 5TRTA 3K5WA 1OJ7A 1Y5LA 2AGAA 3QX3A 3TRFA 2DPYA 4L72A 1AUXA 1EVZA 1SU6A 4D41A 4C76A 2MSKA 1W88A 3QVMA 4GR9A 1ES9A 1K4MA 4NYJQ 3L9XA 1DI0A 1WLEA 1CUHA 3MWJA 4DL9A 2D1YA 4HNRA 4RF4A 3HVIA 4ZCTA 3E2MA 5KNDA 1G5QA 3VDMA 3ILYA 3NOXA 2Q0SA 1YFLA 4PI2A 1ODKA 2Z9BA 1Q1BA 2IUUA 3LUDA 4E11A 2TECE 2HEPA 3GGSA 3IC9A 2HA6A 3I9V6 3HJRA 3RAFC 3RODA 4FDLA 4F1KA 5AJVB 1UC8A 2BI7A 1B16A 2VHEA 3T99A 3PQ7A 1NIPA 3FMVA 4YAJA 4YP6A 1AS3A 3TH5A 1KAEA 5HIIA 5CB0A 5JJEB 2PSSA 5J2UF 2BSAA 1Q0PA 3SC4A 5AH0A 4UTZA 1KH1A 1EA7A 1MMFB 4F11A 4PPFA 3F7MA 2Y3IA 1PL8A 3R5TA 3TTSA 4EITA 3Q9UA 4Q12A 1KO8A 4M99A 3EX7C 4BO0A 1SVMA 3SKXA 4G1EB 5AUPB 2PZJA 1UMDA 1V3UA 4BBZA 3NANA 4JLOA 3WDLA 5L4SA 3CCQF 3MJEA 4I99A 3RQIA 4QNRA 3QKSA 3EXAA 1ZLZA 3FFBA 3FYDA 2C7GA 4E2XA 4CG3A 3ABOB 1W57A 2QJOA 4B5CA 1G4YB 4WKGA 1RC1A 5LQMA 3ABKC 4TUYB 2DFVA 1LSJA 1Q57A 4JYZA 4ZDKA 4IZHA 4ZYVA 1M75A 1GTJ1 1KYXA 3DZKA 1MZVA 1ZOIA 2JLUA 3FCSB 2JFUA 3ZLBA 1YMVA 3WG9A 2GD2A 4ZEVA 4YRGA 2GUZA 1KFBB 5KREA 5HZKA 4K2HA 2IHJA 5D3MA 5KAPA 1E2PA 3EBPA 4AKTA 2XKAA 4DIMA 1EG7A 1TEZA 3B3GA 5I9IA 1QG4A 5F7ZA 3Q4GA 7REQB 1DFIA 4A2PA 4W5TA 1GG8A 4P5PA 3ON1A 4HYQA 1C8BA 4L16A 4KIGA 1VYUA 1QCYA 3F5WC 2AOVA 2XRFA 4Z49A 4M46A 3SDBA 1WQ3A 4HWKA 2PNJA 3AJ9A 2V7QD 2I29A 1YZYA 1XVUA 3A1SA 4AMVA 3HBLA 1AKVA 2LBPA 4LTMA 2NZJA 1CYDA 3O94A 1R4MA 4RETA 3GLSA 4Q37A 3TLEA 1UBGA 1F2UA 1Z5GA 1PL4A 4CM3A 4H7PA 3IUPA 4UCXA 2WG2A 3ADKA 4MS4A 5I4KA 4G5GA 4OLJA 2MMCA 3RROA 1NRWA 3I9FA 5JMPA 3H5WA 1A2KC 1ZUHA 3TEFA 4E4TA 2IHVA 2IDMA 1NY5A 1YZ3A 1WRBA 2OCHA 2F1RA 1YCDA 5JDIA 2XCIA 3QW2A 3DMFA 4BMNA 2Q1YA 3ZD7A 1RYEA 4GWLA 1JHAA 1T4BA 3FJOA 4NFYA 3QOXA 5FPTA 3ILXA 5A4JA 2YXLA 1QGED 5JU6A 3JARA 1CR1A 1R6AA 1DLIA 1KZ4A 1VH8A 1XLUA 1AGYA 4ZK2A 1N3BA 3U13A 1IRXA 5IAOA 3TZKA 4W4KA 4AYWA 4C01A 2IZ0A 2G8LA 3ZRXA 2FMFA 4OREX 4HZGA 4K6CA 4LC0A 3HGMA 1JIXA 1H2GA 2I78A 1E7YA 4ZGBA 4MVJH 2ILVA 2XYVA 4ZK7A 2XCQA 1KEWA 3NYIA 4HLNA 2EC5A 4K40A 3T3HA 2JB9A 2GYWA 1DADA 5FBRB 4S24A 2QMEA 1IDOA 3HAXD 2PQMA 3SICE 4K35A 2HK6A 5CGQB 4C0HA 4P54A 2P7HA 1A8PA 2C9ZA 2REXB 4RVFA 4ZHQB 2PD6A 5DECA 1DRUA 1XIVA 4KR7A 2C2WA 4WCDA 2ZR9A 4ZC8A 3G7UA 1V47A 5E6RA 1UK9A 2D2CB 1FVXA 3AR9A 3HA3A 3M5CA 1QIKA 2QN6A 3TTVA 1XDGA 4EFNA 3QLTA 2O2JA 3L8MA 1E0AA 1VHJA 4GL2A 1QH9A 5JS6A 2G0NA 1F51A 3DZ8A 3ER6A 3R41A 4R8CA 5JUWA 2IH5A 3K3WA 1PSZA 3KPUA 2NYAA 1XU7A 2FG6C 5AW7A 1T24A 1Q6YA 3R9WA 5G0WA 1X8LA 1E6KA 2IELA 1PE0A 4PSUA 1VKNA 2OLJA 4AJ1A 2AOUB 1N92A 3OE7D 4UVGA 821PA 5C7OO 1GN8A 1T8RA 2WLIB 4D9KA 4H13B 4C43A 3V4SA 1US6A 4M9ZA 1UI9A 4AJ9A 1I2DA 1WMSA 1XXHA 2NUPB 3KVOA 1K3EA 2JBHA 3IT3A 2QN1A 4B6EA 1PHRA 3QKIA 3ENZA 2A5YB 4EEKA 4V24A 2W0FC 2VDJA 1U8EA 2F3RA 1INLA 4R9UC 2IVZA 5IY5C 4BZZA 2C4VA 1ECLA 1PYDA 4PC7A 5AVWA 3RC7A 1CC1S 2AE1A 1E79G 5EIWA 1UBSB 4JQOA 1XBIA 3BKXA 4QWMA 2Q9BA 5K0TA 5LYJA 3OOHA 5CW2A 2XR1A 4LJAA 2AEFA 2BEJA 4RE5A 4EHAA 4WQMA 2E18A 4II7A 1FXSA 3BXEA 4PDMA 3M83A 3IUMA 2QJTA 1SD1A 1RI4A 2IYTA 4EI7A 2DQSA 3A4YA 3EEIA 2VYCA 1K5SA 4JNKA 4ZT6A 3NBYC 5E4FA 3KYIB 1VQ7V 2GAIA 2XNSA 2QZJA 3PL1A 4MDEA 2YS6A 4G25A 5CN0A 5HP8A 3TLXA 4MGZR 3MWYW 1UPUA 3RT9A 4K6MA 4KK4A 2VF8A 3BEOA 4C7JA 3RN4A 2LQTA 2VTDA 1UMBB 4P1ZA 2SICE 4XIJA 3V7UA 1N2GA 5CB4F 3T4ZA 4RD0A 5FOVA 4YAUA 3WWCA 3DNFA 1JZQA 5EE3A 1DQYA 3CM0A 1K34A 5L9AA 4I0XA 1O5OA 4D0GA 3HKBA 3LT5A 5DNDA 1KC8W 1Z29A 3ZTYA 2QN7A 2XMQA 4IFBA 4BPBA 2QRUA 1F0PA 4TLAA 6ABPA 4OQZA 2OUIA 1S2IA 2SCUA 1XZMA 1OREA 2XWBF 1QVGU 3UJ6A 4G0WA 1SHTX 2E49A 3LCUA 4MI6A 2B82A 4MGIR 4K6GA 1N25A 2IEYA 2OSVA 4AK9A 3JR7A 3W6PA 4JBIA 3F0TA 1T3SA 3DAOA 1J2TA 2CXQA 2ZB7A 1KK1A 2VLIA 2H16A 3C4JA 2AYYA 1K5DA 1C80A 2Q1TA 4DJFC 3SIXA 2QZSA 5J2UB 5KTMA 3B48A 1M7GA 1YL7A 3C3YA 3DWEX 1XRMA 4GD3Q 3NAGA 4FC7A 1GG2A 4UHHA 1LUVA 5JY6A 1EHCA 4F4IA 2XYRA 3I6QA 3GJ8A 4FR5A 4BJ6A 3I5DA 2L17A 3K73O 1F20A 2OZLB 1YDHA 4REQB 1KU9A 5AXDA 5TB5A 4NRDA 2CJYA 1A5SB 3JSNA 1GCGA 4MSUA 2VDNB 4R7GA 1D4OA 2IEAA 2I6XA 3D5EA 3WDSA 4NCKA 2FW1A 4RL6A 5B1BB 1B00A 5D85A 4BJ3A 2WKPA 4KXFB 2YDYA 1VBNA 3PNLA 2E82A 3TW8B 2IV3A 2XUGA 4JH0A 2YIMA 4X60A 5TMBA 4G2NA 5TEVA 4BVGA 4ZQGA 3FCYA 1KZYC 4HJRA 2XT0A 3LE8A 1H9CA 4F4JA 3RREA 3H9UA 4OSEA 1PNKA 3VR5H 3WBFA 4BJ1A 2X5NA 5BNWA 1FRQA 5FOTA 1V9CA 2SBTA 4ZZIA 3S2FA 2YV3A 5BUSA 3FWHA 5KDDA 2HREA 3PU6A 1XMQO 2QN8A 4Y6GB 4FW9A 3M33A 5KQMA 1O97D 2BFBA 3E83A 2VSFA 2Y69C 4HZUA 2QI2A 4WXRA 2W2MA 4B6JA 3BCSA 2Q5CA 3CB4A 4MQEA 4M0LA 2OZKA 2QR5A 3DOUA 4N41A 3HNPA 1E2JA 4HNSA 1Q7YH 3KYCB 3GT3A 2YKGA 2QA4F 3E0QA 4P2ZA 3NHYA 1M2EA 1C50A 3PE3A 5A4AA 1I5XA 1O6BA 1J09A 4QPJC 1PGNA 2QVXX 2FB5A 3KYJB 3KE8A 1KMIZ 1YE8A 2N3ZA 3E9MA 1HDRA 2Q1SA 1TKBA 1YCIA 1NP7A 1NYQA 1Y1KE 3GL9A 3GPDG 4LJ7A 1WMDA 4C8GA 3NASA 2VQFO 2I87A 1RP3B 1CIJA 3KJIA 1M2VA 3WLSA 4YAGA 1DFHA 4EGCB 4GKAA 2BF7A 2QTVB 3F49S 1GQFA 3ABIA 4QQFA 4CTJA 1G2PA 1ZRSA 2LP4Y 1AF7A 2WB4A 2CVQA 2NZ8A 1WUIS 2DJ5A 3DMDA 1M10A 1B6GA 1M3SA 2J31A 1PL7A 2CNBA 3QEJA 3ORRA 3O9ZA 2QX8A 4IQ8A 3Q3EA 1YHZA 3MQWA 2C7QA 4M9QA 4MYRA 4K8OA 2BGLA 1HV8A 3I2YX 4ZVSA 1VJ1A 3F9IA 1ZPDA 1QO7A 4I6EA 3QVGB 4LF8O 1W55A 1T5EA 1BH2A 2YJZA 1SOVA 4MS3B 2V0NA 2EF0A 3CZQA 1NC1A 1TM3E 4RDXA 2XOXA 1YC5A 4J03A 2YYEA 3QUWA 3D2LA 1GRVA 3DO5A 5IDWA 4BNTA 4FINA 2O7SA 4JK3A 4ENVA 5C32A 3AIOA 3U5TA 3BBPA 4TKVA 3KYDB 4EHHA 3WB1A 4TZKA 1AO0A 2JA2A 3TNYA 4K9OA 1VOTA 3JWEA 4HLQB 5CA1A 3I32A 2IRWA 1LQUA 2AC4A 3JTMA 2RE8A 3Q9LA 3D8NA 4LOAA 1RIFA 5B5EZ 1HDEA 2DYSC 3HDQA 2TRSB 4LY3A 1H2WA 2AG8A 4OXYA 4Q93A 3VZSA 5HP7A 4BVKA 2NZVG 2W22A 2X5XA 2FWPA 1RXWA 4ECEA 3DEYX 4NE2A 2GWHA 4CI9A 4M9XA 4BATA 3WB9A 4KLNA 1WUYA 2XLCA 3DW3X 1ESNA 5YASA 3F8TA 1UM9A 1B0ZA 1KZHA 5J3JA 2F43B 4JGSA 1WDKA 5L3RA 3GGOA 2Q7DA 1ESMA 1S3IA 4Q3KA 5MN6A 1ISPA 4JYYA 1ZMTA 3L0SA 1O03A 1TUIA 2R44A 5JQWA 2FPIA 2WNIA 4IXMA 1YR8A 3PC8A 2ZJ8A 4UHEA 3PUKA 2ERXA 4JGBA 2A0XA 4II2A 3A9SA 4ZOAA 4NSNA 2VNHA 1W5BA 1SZCA 2UKDA 2I3DA 4NULA 5EG5A 3HABA 2IU4A 2AW5A 2CXPA 4QRHA 3TIVA 4O2BF 1REQA 3VNQA 3THXB 1GDTA 2R9AA 1QANA 2V6GA 2X77A 1SG0A 3O8LA 3CLKA 5LCXA 4KAXA 1KQFA 2C5LA 1GWNA 4L4UA 5ALFA 3ONWA 1B3BA 1M5UA 1KXJA 5P21A 1IMOA 3ZHSA 4UUMA 2XA1A 2PH3A 2J5XA 1G8PA 2NOAA 4DLAA 2HQSA 2FF5A 3HPQA 1AY0A 2NV6A 3FHTA 1PR2A 3NHSA 3HFRA 1YB1A 5AW9A 4Q7MB 2XOKA 1RR6A 1G5IA 2OAQ1 4GEGA 3BXHA 2M9MA 2I4NA 3WICA 2WF8A 2VBIA 5KNBD 2AR9A 5CB4B 1JBEA 3DDOA 4ML3A 3IBGA 1I7QB 2WSBA 4L57A 2FKAA 1L8XA 3KZNA 5UKDA 2ZTMA 3ZCUA 3MCTA 4EPRA 1N6IA 1RWOA 3MEQA 3QWFA 3S70A 1FS0G 2HI0A 5BNZA 3QVTA 1DQPA 2H9IA 3EVDA 1U3TA 1TKRA 5GZ6A 4ZK6A 1EJ6A 4JBLA 2L82A 4F3YA 2VYVA 4HDKB 1QB7A 4YCBA 1KHHA 4OAQA 3AB3A 3KUKA 1IZZA 3K70D 2FPUA 3TLAA 121PA 4PLCA 2X4LA 4M0CA 2CHFA 3ESCA 1JL3A 3PUIA 5ICSA 8AT1A 1BZKA 1CJKC 3E2PA 2F64A 5B58T 3FW1A 4WOJA 1CN7A 3D4BA 1W1WA 5FLEX 1RLUA 2JZNA 1NT4A 4B32A 2BSKB 2P3SA 2NXWA 1XTQA 2XHZA 4FD3A 3JU3A 1C8LA 2WJHA 1QV7A 1IN7A 4HI0E 4B3RB 1X7YA 5KTPA 2J0VA 4GPZA 4IHJF 1UQTA 3PWZA 1A32A 2ASEA 4BNKA 4LX0A 3T9AA 1UFOA 4WOKA 2Z2YA 3BFPA 2JD0A 1ZWKA 2QLFA 3ICQB 1HH4A 4I4NA 1D2CA 1EK0A 2WIJA 4D6XA 3H1TA 2HJVA 4V0SA 4B7KA 1QC5B 1ZDMA 2JAWA 2UYYA 4G56A 3L6RA 2X0LA 4J3NA 1V3QE 1GLNA 4NIMA 1XG5A 1NZDA 3W8DA 1ABEA 2A0YA 2H31A 5ICEA 3GP5A 2QZZA 3O0DA 2FZ5A 2NYRA 5CCXA 1YHQV 4DLNA 3U7QA 2XEDA 4D8UA 2BFCB 1Z18A 4HVAA 3I5YA 3L05A 1NW3A 3FE2A 3OGCC 5EUMA 2GEVA 2KWIA 1QRDA 4BO2A 3EGCA 1GPKA 3IDSA 2X6BA 1X1RA 3TL3A 3FB4A 4OLAA 5B57C 3I2IA 1QHHA 4RUKA 4TLCA 5FWAA 4AYTA 3VYUC 5AW0A 2V55B 1RC0A 3PPXA 4WZAA 1IN5A 4BE9A 1E5LA 3NOVA 3AVUA 4KOAA 2LW1A 4QIHA 4RZ3A 4O1IA 1V35A 1M8FA 4RK1A 3L18A 4YJGB 3SQXA 1ADJA 2BI8A 3LZDA 3AWDA 2GH1A 1Q1EA 1NHGA 2QUHA 4CI0B 3TVDA 4RPLA 3ZZMA 3AHJA 4RACA 1MH9A 4L5JA 1E3IA 4G97A 1LNSA 1PJQA 1XRSB 3NBMA 3T4XA 5JXIA 3DC5A 3D02A 3RBVA 2G8NA 1TQHA 1H23A 2VTEA 4ZZ2A 3SIVA 2EW8A 5CT6A 4I4CA 2DFTA 2IH3C 1KMNA 4L85A 5EQDA 1VKHA 4Y1RA 1SQFA 1WUJS 4KXVA 1L5GB 5KYWB 3LXUX 3W5UA 1N8RW 1SU8A 3R7LA 2IIPA 5DI3A 2P77A 4N49A 1SPXA 3JCMM 5I4CA 3WQRA 1CP9A 1V54B 3KIPA 1Y8CA 1K2WA 3OT4A 3O1HB 2D5CA 1ECJA 2O8VA 4W99A 2ZTHA 1WCIB 1Z6YA 2XXAA 4PTZA 4QDKA 3D7RA 3RSSA 3ZGYA 3P30A 3LD9A 3V97A 4I4TF 2BFNA 4R2LA 3K03A 1YL6A 5AVQA 5CDYA 4NVPA 1JHPA 3DNPA 2RI6A 4EI8A 5A1JA 3DKPA 3HJAA 5AICA 2O2SA 1M9NA 1MR3F 4N3CA 3T2MA 3SF8A 3R65A 1CHDA 2B1RA 4ZVRA 4E5PA 3OQIB 3R24A 4IOMA 3BMCB 4MLCA 1AQNA 3R5FA 2PX6A 3KTAA 3P97A 2O8CA 1WABA 5CX1A 2FWNA 3U7GA 1Q14A 3V55A 2IX3A 3DCJA 1M5IA 5A06A 4KB5A 3SEAA 4GC5A 1J5EO 5KZMB 1MB0A 4PDLA 4PYRA 4C2TA 5I7FA 4JF3A 5F3DA 1UEXC 1O1YA 2V6JA 3NHJA 4HBZA 2WHRA 2W2XA 5AHKA 1NS1A 3G2PA 3K0FB 4C0LA 4AS1A 2XDYA 2ZANA 3ABMB 4LJ9A 4ED9A 3WWPA 1YRYE 1ND6A 4N40A 1B26A 1SHKA 4R9VA 1X8XA 3RU3A 4L27A 1KJZA 2BP7A 2Y92A 1K8XB 3P0IA 4NTYA 3EIHA 2YUAA 1FTGA 2ZULA 4HDSA 1RYZA 1KZGB 4CMEA 2PYDA 3GMTA 4ICIA 4E5DA 1KIAA 1UQRA 1WXGA 2OOSA 1Y8AA 3KZOA 1PR9A 5CM9C 1Q17A 2E2WA 2QRHA 2VR1A 3B6ZA 1MEEA 2FW6A 2HLDD 3K0DA 4P35A 2FZVA 3UM7A 3K4QA 4N5HX 4EG7A 3V8RA 4UM9B 4G65A 4MWBA 2NQ8A 1GA4A 4OFWA 3DCIA 1G63A 4L15A 2DVMA 5LPNA 1EHYA 4TN1A 2ZDIC 4LWPA 3LC7O 1PWHA 1DEAA 2E5LB 3RAPR 5D3KA 4L08A 5KHOC 2GBLA 1NYLA 5KYYA 2RH4A 1FB5A 2WWGA 1OC2A 4O2BB 5EZQA 1RC8A 5FDFA 4ND8A 2XQFA 1UK6A 1HDCA 4BB6A 3KAJA 2R47A 3UVEA 4DM7A 2J5KA 1WBBA 2YIJA 5EUBA 1HL3A 1SU7A 5KC9A 3GJYA 1Z39A 4CW7A 4F2DA 3RE1A 4OGQB 1RRCA 4C6TB 2XQVA 5JJIA 4NBSA 5CLIA 1BWPA 5DOVA 4D3DA 2G71A 4KBFA 4WEOA 2FRDC 2Y9PB 1Z9BA 1GUYA 4BL5A 2OECA 1X6VA 5J2TA 5E95A 1E4OA 3HM2A 1IHDA 2BAGA 1SO8A 4ZQBA 4TYPA 3L8DA 4I1PA 3Q2KA 5HMLA 1SC3A 3GO4A 5ESRA 5LXTF 1UCFA 2C84A 1O95A 3PXBA 1XZLA 5CFPA 4L0DA 4G4ZA 3EG5A 1AG9A 1ZD2P 1Z07A 1H2KA 1NXOA 1CS4C 5KPDA 1OZGA 1H2NA 5DM1A 3QJYA 4U3JA 2DEUA 3O2QB 2ZS8A 2HQ1A 1ZFNA 2Z98A 4NBUA 1XMJA 2JHFA 2IP1A 1ZGCA 1O58A 3SHOA 1T8PA 4XRGA 4BVAA 4ALNA 4QPZA 3VDRA 3D7MA 3IAM1 4P31A 3T7CA 1K7SN 1CD5A 4KNYA 1OCOB 3QKRB 4DQLA 4QLBA 3B1YA 2W6CX 4EKYA 3AK3A 2P6OA 5D3ZA 4KIUA 1VKJA 1LI5A 1TJ4A 4DLKA 5K3FA 1IV2A 3FGOA 2A8YA 3B7WA 1RRKA 1H1TA 3STUA 2RAVA 3O8QB 4A0FA 2NNLD 4QARA 2OVBA 1TLFA 1V8ZA 2Q6KA 1RJGA 4CZZA 2HHHB 3FY4A 5K01A 1EFRG 1G2IA 4WVFA 5EC8A 2NO7A 4KN6A 4HRVA 2HMAA 5KA5A 3AVPA 4RD1A 4Z2WA 2YN4A 5FBQB 4QTTB 4BQEA 4FD2A 3KVNA 2OWOA 4JZGA 4OBEA 4IHJB 1E9FA 5A2QM 3L6BA 4B2LA 4Q15A 3HH8A 1T91A 4KHPB 3A6DA 2QVBA 3J80N 3ANYB 4DMFA 2C4HA 2W93A 2C1ZA 3TX6A 4F5YA 3AESB 5AVKA 2BDEA 2VYND 2QSZA 3HGTA 4WECA 4BLRA 2XOKD 3L7IA 3KO8A 5C7YA 5J4KA 2WHXA 3KJNA 3CCMF 3G9ZA 1DAKA 3H65A 3RWBA 5JZ9A 4HLDA 1Y8QA 2JLXA 2G40A 1Y1TA 2OZVA 4Y1GA 1KBQA 1FBNA 2ARKA 3ESYA 3LK7A 2YZ7A 2QM3A 3VZPA 4B74A 4QWWA 2PVCA 4YQFA 3VMMA 3ZQKA 2OZPA 4ODIA 2Y2VA 3QSYA 4FSDA 4MGHA 5B7NA 3VC2A 1TAQA 3IR5A 3WPXA 5I01A 5ESWA 1BMTA 1R6NA 3FXAA 1ZQ1A 3OZTA 4OK5A 2XDWA 3WLIA 3DXZA 4LF9B 1RS0A 2P27A 4YT5A 1DO0A 1N6PA 1OCZB 2UYGA 5E1MA 2ZR7A 4NG5A 4OUDA 1A72A 5C7IO 1ABBA 2O2XA 5EEGA 3VR3A 3N59A 4LFBB 1YL5A 2P90A 2VHWA 4D9HA 2L42A 4C2UA 1KBHA 3OP4A 1GV0A 1HEUA 1D7AA 2VJDA 2EINB 1I0ZA 4I4IA 4IX1A 4Y2QA 3N2GB 4GPIB 2DWUA 1U40A 1AR4A 1N9KA 1PG2A 5BMVF 1V71A 3E8HA 3AR7A 3JQFA 1ORVA 3FFXA 5MGNA 2QTGA 4OHCA 3L5KA 3T06B 3EDRA 3ZS8A 4HDCA 3B78A 1OQAA 5DH9A 13PKA 3BIFA 3D6VA 3FNIA 1XRLA 2HC9A 3H2YA 4JAUA 4R41A 1COMA 1PR0A 3M4SA 5FRDA 1PJZA 2C1EA 5K51A 1DRKA 1J0AA 2JVIA 2NO4A 3D43A 4LJ5A 3TOZA 3A27A 1RTTA 5KOHB 2P9HA 4ZCQA 3TZLA 4I4TB 2WP0A 4X8HA 1PLKA 3WL8A 5LMNO 1M66A 4XD7D 3CC2V 2QGZA 1GO2A 3EJWA 3CYQA 4YRKA 3A6ZA 1T6XA 2VWJA 4DKXA 1Z0FA 1SZJG 2XUZA 2VQEO 3RFXA 2JL1A 5T64A 2HS0A 3QMVA 3W7TA 3N75A 3CX3A 3WXBA 4N76A 1Y3FE 3CLRC 2OC9A 1Z6QA 5GGYA 5HP4A 4B0OA 1MIOA 4TTQA 3S55A 3RNOA 2A9KA 4HBGA 4PQYA 2V9ZA 1QG2A 5HDQA 4IYJA 5J4HA 4ZGGA 2FW8A 5BQ5A 2FAXA 2Q8NA 3OO1A 2FTKE 4U0JA 1Q3KA 1U2GA 4L22A 1HFEL 4CM7A 4DG8A 4YCAA 5DYNA 3IJRA 3SZMA 4QRIA 3LOQA 1Q21A 2O7QA 4DR7O 3TNDA 3SJCA 5HA5A 2H8EA 1N2ZA 3BE4A 1AKMA 1V16A 1P19A 3TZHA 3B9RA 3EGOA 2X4GA 5THQA 4PSAA 1E2IA 3DBOB 3K0HA 4NECA 3MB8A 5AHXA 1R4ZA 3NALA 3MUEA 2OHHA 2IP2A 4U9IS 4CKEB 1I4WA 5E9QA 4P36A 3ZLVA 3C1OA 1K4KA 3M3HA 2IHKA 4PX2A 5EZ6B 3AOEC 3EMBA 2HU5A 3RJ5A 2R8EA 4B9EA 4BFTA 3MAGA 3WJ2A 2C9YA 4F5EA 1U31A 1T0BA 1DG3A 3L7MA 2LBWA 1L4BA 4TWKA 2PBLA 1M74A 3A7EA 4JASB 2JFVA 1RKVA 3B2NA 1XRNA 2D00A 3AFIA 4WWHA 3DKIA 1PJ2A 1LV8A 4NU6A 3LXRA 2NZXA 5DW0A 8OHMA 2ZT5A 1U80A 3LDEA 3PXXA 4FT2A 4WBNA 1E1MA 2O14A 4F9GA 3K4HA 2WKWA 2J9YB 5CGZA 1OX6A 2HF9A 3OLCX 2AHYA 4R2JA 3N2NA 1B15A 4FR0A 3KKLA 2GZ3A 2WF5A 4YT8A 2ANBA 3LXMA 3SXJA 4R8VA 3FFTA 2JGUA 2C2ZA 1KARA 3IP5A 1EVIA 3MUFA 4JOQA 2P69A 5JNVA 1BMFA 5IMSA 4IZOA 4EJSB 5ALPA 1SCDA 3A0BZ 4JVSB 5K0EA 3B3AA 1GNLA 3E8SA 1IDN1 5F23A 2E4WA 2PMPA 2SHKA 2R7MA 5A62A 4YAFA 1MW8X 1GV1A 1XQ8A 3LRXA 3NBFA 1WJZA 2PRZA 2CDNA 4WGGA 3JWJA 1I13A 2YUTA 3ESRA 5K6RA 2DU8A 1XRQA 5C1IA 1L5OA 5GIPC 5LXTB 3X1WA 4KMSA 1Q0LA 5CVJA 3ZHCA 3DM5A 4YECA 2W2VA 4YJHB 4ASUA 1EMDA 5ABPA 2YIAA 1K63A 2AMLA 1RXSA 2FJUA 4EA6A 4YTEA 3QFHA 1USGA 3N70A 1TECE 2B5UA 1NUTA 5ALLA 3V00A 3EXFB 3BTOA 1KF0A 4MYDA 2Q4BA 5E3HA 4EHBA 2VGNA 1D5NA 5L3GA 3WGOA 3PJSK 3T61A 4TN5A 3NDBB 2OZEA 1XCPA 4H31A 2FFRA 1FLVA 4ARZB 4F5DA 1IBMB 2Y2UA 2FN3A 4E5NA 1Z35A 2E75B 2O8NA 1YBAA 4I3HA 3V4DA 4MW7A 3F0FA 2ENUA 1N3LA 4DMKA 2F62A 5JSYA 3GJ0A 1QQAA 5ALMA 5DNAA 2VPXA 4MJXA 5J1SB 2IJGX 1T2DA 4QBFA 2VP0A 3PX7A 3BHIA 3KQYA 5DLYA 4A92A 4C0XA 4EF4A 3KR1A 4ZAGA 1Y76A 1UDAA 3SF0A 1DLBA 1OZ0A 4B7CA 3DO6A 2WY2D 1K6JA 3RAEC 3KJEA 1LUWA 4EUSA 5FBLB 2FWMX 2VWKA 3R3ZA 3C5WP 2BW0A 3D7LA 1I80A 3KL2A 2HIMA 3UYKA 5DT9A 4DLPA 3MCQA 2FUCA 3PJGA 1ZIDA 1TIBA 1MZFA 4DR2B 3EZ7A 4HQRA 1D04A 2JAXA 3HM9A 1OLSA 4XYEA 3HSKA 3W2EA 5DISB 3T0IA 4LXXA 2DPGA 4FYXA 1MD9A 3G80A 4U9UA 4ME6A 1DWOA 4D0LB 4MYHA 4GKJO 1AZWA 5BSKA 4DIBA 1J90A 1NT2B 1P9LA 1AX9A 4HX5A 2J4FA 4Y0NA 3PQ4A 3CHYA 2HT6A 3PRJA 3WLMA 1UC5B 4QLAA 1Y1SA 2DUJA 4FZ3A 3IOEA 1ORTA 2VQDA 4FZ1A 4XIIA 1UFVA 2JIZG 3UK0A 4YMVA 3NGLA 1QGUB 2ZJ4A 3DZCA 1W76A 4B3BA 4WL0A 5FF9A 5FWYA 1AGNA 2PQ0A 3EZFA 2EZ8A 1JUDA 1IY2A 4WVLA 1O5IA 3OX3A 3P52A 4HNUA 2UUBO 3DUFA 2O52A 3PNBA 3KKQA 1F7VA 2P9BA 4G5YA 4WZBB 1TB4A 2H7YA 3HUEA 2F55A 3AR3A 2I71A 1TAUA 1N36O 2EWWA 1ZWLA 4IIGA 4XDLA 2G06A 2TMDA 4KZKA 1YF3A 3L75H 5DYYA 5C93A 3L43A 4ALLA 2XMBA 3ZH9B 3TZ6A 2OHWA 2BBSA 4BE4A 1M1ZA 4G1UC 3EUAA 3FDFA 2J09A 5BMVB 3R40A 1Z73A 1Q1AA 1U6IA 4D97A 2QK4A 5IH7A 4GH5A 1UEIA 4G1FA 4AZTA 4UATA 4M1YA 3GLFA 3FD8A 3AUYA 3UFXA 3P96A 1GAXA 1VEWA 3UCSC 1NF8A 2K87A 1Y9AA 1LH0A 4H1WA 4OMFG 4EOGA 4NOKA 4NC9A 5AW1A 3A1DA 4D99A 3ZUPA 4YWJA 2O8FB 5JDCC 1BMDA 4OPHA 3HCEA 2BD0A 2Z6UA 1SZDA 2AT1A 3N2LA 3ZHXA 3HMKA 1MC4A 2VK2A 1KI2A 3WRYC 5EWMB 1WETA 3ZI0A 5M2QA 4AKEA 2X9VA 2VPPA 3RS5A 3ABKB 5CMUA 1P9WA 1JFVA 2F7SA 3J80A 5C5DA 2IVFA 4DMHA 1J2UA 1T2CA 2P67A 1U9CA 3CJQA 4NYMQ 3DKKA 3JY6A 2HRUA 2G0AA 4DRXA 1GGVA 1QTIA 3NFYA 2JKZA 4LK2A 1UPGA 3UM9A 4WY5A 3GEGA 2R87A 3U49A 4YMHA 4HGPA 4JV5O 1TM7E 2I6SA 1E9RA 2PWBA 3V8QA 3MUNA 1ESDA 2OP0A 4E33A 3GGDA 4TTVA 2POQX 4F4FA 2NPIA 3MJHA 3EZ9A 3RWRD 4YLEA 2PGDA 3W4JA 1GPNA 1SBQA 3WO1A 3SC2A 4WZBE 3SK0A 4P9NA 3O3CA 3NTQA 4A26A 2FXIA 3ANNA 1OZFA 3SX0A 3PTLA 2WPDD 4L0MA 1EVLA 1RP7A 3L72H 4IM7A 1VCOA 4NDAA 4NYIR 1BU5A 3R0IA 3GUYA 3Q2OA 2MK3A 2BKUA 5D6NA 3EFOA 1EE1A 2RC5A 1N9ZA 2DULA 4GAEA 1JXOA 3DULA 4WOCA 4LYFA 4EG4A 2R5WA 1TCAA 4F93B 4WEQA 3IUEA 4GF5A 1IEWA 1U2DA 2NU7A 4LY9A