1JFFB

Refined structure of alpha-beta tubulin from zinc-induced sheets stabilized with taxol
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
426
structure length
426
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tubulin alpha chain
publication title Refined structure of alpha beta-tubulin at 3.5 A resolution.
pubmed doi rcsb
molecule tags Structural protein
total genus 113
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2001-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1jffB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1jffB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1jffB01
5LXTA 5MN6A 3HKCB 4ZHQB 5JH7B 1TVKA 2BTQA 4B45A 5CA1B 4EI7A 2XKAA 3CB2A 3JARA 4U39A 4U3JB 5M7EA 3N2GB 4EI9A 4O4JA 5CA0B 1W5AA 4I55B 5LP6C 4E6EA 4TV9B 3RYFA 4HNAA 4O2BB 4X1KB 4X1IB 3HKDA 5EIBC 3RYIA 5IJ9B 3ZBPA 3JAWB 4X1YA 5KMGB 2VXYA 5ITZA 3VOBA 3JASB 4FFBB 4X20A 3R4VA 5GONA 1SA0A 1OFUA 1FFXB 3HKBB 4XCQA 5LA6B 4ZI7A 4YJ3A 2RHJA 1Z5VA 1TUBA 3E22B 5CB4B 5JCOC 4TV8A 4O4LA 5LP6A 4WBNA 1TVKB 2BTQB 5IJ0A 5EZYA 3JALA 3N2KA 3RB8A 5IYZA 5LYJA 1W59A 3HKEA 5J2UA 5FNVA 1Z5WA 3VOAA 4O4HA 5EYPA 3RYFB 3RYIB 3UT5A 2VAMA 5JQGA 3WGMA 4O2AB 4O4IB 1RLUA 5JCOA 1RQ2A 3JAKA 4X1YB 5C8YA 5ITZB 3WGJA 3M89A 4X20B 3WGLA 5GONB 5J2TA 1SA0B 4I50B 4TUYA 2BTOA 3RYCB 4DRXA 3HKCA 2Q1XA 1JFFA 5MN4A 4IHJB 5CA1A 1FSZA 4LNUA 3VO8A 4EB6A 4TV8B 5LXTB 4O4LB 5KX5A 5LP6B 4WBNB 2R6R1 4YJ2A 5EZYB 4I4TA 3JARB 4X1KA 5LYJB 5FNVB 4O4JB 2VAWA 3JAWA 2XKBA 5JVDA 2R751 3C8LA 4M8IA 4IIJA 3V3TA 4O4HB 4ZOLA 5EYPB 4HNAB 3JASA 3UT5B 3JATA 3HKDB 5JQGB 5BMVA 3HKBA 1FFXA 3RYHA 1W5FA 5LOVA 3JAKB 5C8YB 4F6RA 1W581 4DXDA 5J2TB 4TUYB 4ZHQA 4DRXB 5JH7A 4ZI7B 1JFFB 1W5EA 4YJ3B 4LNUB 2Q1YA 1TUBB 4U3JA 3N2GA 4EB6B 5MN5A 5KX5B 3VO9A 2VAPA 5CA0A 4YJ2B 4I55A 5IJ0B 4EI8A 3JALB 1W5BA 3N2KB 4I4TB 4TV9A 4X1IA 4O2BA 5IJ9A 5IYZB 1RQ7A 4KWEA 3ZBQA 3ZIDA 3HKEB 2RHHA 5EIBD 5J2UB 4O2AA 4O4IA 5JVDB 3VPAA 5KMGA 4IIJB 2GVIA 4ZOLB 2RHOA 4FFBA 3WGNA 3JATB 2RHLA 3RYCA 4I50A 5BMVB 3RYHB 5LA6A 4IHJA 4B46A 5LOVB 3M8KA 3E22A 4F6RB 5CB4A 3WGKA
chains in the Genus database with same CATH superfamily
4HNHA 4E14A 3TZ6A 3BT7A 2RJZA 1IMOA 5CCDA 1N2CB 3UAOA 3K0CC 1U9IA 1SHLA 5HILA 2CEKA 4D81A 2ODWA 5AP9A 2FFQA 3HR7A 3AETB 3NALA 4UTOA 1BD4A 1T4MA 1CVRA 3FOCA 5B3KA 2Q4RA 4D56A 4ME6A 2B1JA 1U97A 1TZCA 1MC8A 3TZQA 3A26A 1PL6A 1T35A 2F8TA 5F77A 3G2IA 5KQPA 3R24A 3TVTA 3ND8A 3EAFA 2K9PA 2BM9A 4L0QA 4YA6A 2ISCA 1CUBA 3Q85A 4RK0A 5D1NA 2IXEA 1QLJA 1I5OA 1Y9EA 2OTCA 1EVKA 3CVWA 2GBLC 4JOCA 1WB7A 4EFEA 4BCCA 1YJNV 1Q77A 4S1WA 2XRFA 1IXBA 2IBTA 4TTPA 1IMJA 3NHLA 2QZZA 3HCCA 2OCBA 3T4ZA 4GLOA 4UXHA 3L1JA 3BD8A 4Z99A 5IKXA 1YXBA 1QS0B 1DLJA 4K81B 4IY1A 4MTGA 5KNBH 5KAFZ 4L1KA 2W71A 4UM9D 4Q6BA 3UHOA 2VHQA 3MRTA 1P6XA 2XEDA 4W5OA 2YBDA 5JSHA 2EG9A 3G5AA 4KIGA 4BNXA 1USUA 1XZIA 2HVKC 5HTOA 2ZULA 3OZFA 4YFYA 3LYAA 3V2HA 2OSVA 1Z9BA 2Q8VA 1YITF 1QZUA 4TT3A 1QGAA 3B85A 3I6YA 4Y9SA 1SURA 4LW8A 4MVXA 5IWAO 1N5DA 1XDSA 1WR8A 3K0DA 4NCIA 5ED0A 4MZXA 2CLFB 5JXHA 4RIGA 3I28A 1DIRA 3STHA 4HL6A 2CFOA 4BATA 4EBBA 3NGLA 3UTDA 1P9OA 3I9LA 2I2XB 3B82A 2HXSA 3GAMA 3MINB 3CNNA 5KU7A 2WOOA 1NI5A 4MDYA 3ANLA 2OHXA 1U1FA 2OPHA 1C3LA 5K0EA 3VPSA 4MW3A 2VDLB 3AY6A 3NPMA 1NLZA 3WKCA 3HGQA 3WJAA 3OIUA 5JWRA 2HC9A 5ALIA 3LV8A 1DTEA 1X7YA 4IGKA 2HV8A 1W2BF 4CQLA 2CXOA 3ZI7A 1I3CA 1T9GS 1KO4A 1P45A 4F21A 4RGBA 4RZHA 1G64A 1NVTA 4IIJA 4YRQA 1UMBA 4GKBA 1MQ9A 2X42A 5JAQA 2R5WA 3OCWA 5CH5A 4RL6A 4CQNA 4FGWA 5CJ2A 1NQAO 3K2QA 2B92A 2VJNA 2X0LA 3MWEB 4C3UA 2X7RB 4BFSA 4YRBA 1SVKA 1RADA 2P3SA 2OK7A 1WW8A 2O6LA 3EWSA 2GM4A 1XYVA 5J5VA 2ZZMA 1KKUA 2XMBA 1MIOB 1PSDA 4YAFA 3PLAE 1QZXA 3IP8A 1HR0O 1Z5OA 4OP3A 4OOFA 1DUVG 3T12A 3AR7A 1F38A 3EYWA 3TFQA 4X1YB 5KTRA 3LVQE 1XWFA 2C7OA 3GRVA 5HZHA 4D41A 4WA7A 4W5RA 4PCAA 5JJCA 2JFZA 4PZDA 4BNNA 4GECA 1QH8A 2ZRIA 5MN5A 1HO3A 1OR8A 1ZSPA 1R18A 3A10A 4BKQA 2PTGA 2E3CA 1P2BA 4ZOLB 2BWJA 1T5SA 2R8OA 2LP7A 2DQ4A 2VJAA 3JQ7A 4BZWA 3C7CB 2VGNA 1M0WA 1EU1A 1TQ4A 1U9ZA 1ECJA 4XM1A 4JD5A 1UOEA 4KGDA 1KFJB 1ZHHA 3QF7A 3PC6A 4R2XA 4OJNA 5A9GA 4JJIA 5K2OA 1RMYA 4P5DA 4PINA 3FZNA 4C4SA 2MOKA 1D9ZA 3F6RA 2HOQA 3O7WA 5INTA 3ST7A 4QJ5A 1ZD3A 1APBA 4KHPB 3EQ6A 4LJ4A 1Z6GA 1SBHA 3B5EA 5B5EZ 2EFGA 3GJ8A 4YMIA 2OY0A 2WPDA 1NI4B 3JQBC 1KD1W 10MHA 1BQZA 3U7FB 1RZVA 2DPYA 2ZWAA 2FW9A 2CN1A 4B1FA 1PUIA 1A9XB 4G4JA 4P7FA 3CVVA 3D9QX 3HK2A 4K1XA 1SEPA 3K8ZA 1R73A 5I9LA 4RZ2A 4WOBA 2ZQZA 2WLKA 3DAOA 3W6UA 1N2GA 2CB9A 1CYEA 1UP7A 3OGIB 3OU2A 2F4NA 1VARA 2ZIWB 5CBGA 3DXYA 3HDQA 3UENA 4LK2A 1PXWA 1XDCA 1WB5A 4RZUA 5CM2Z 1K5HA 3ZIAG 1BWSA 3JQAD 5KQLA 1CEZA 5BSVA 3BB1A 4RYLA 1KNQA 1HH4A 3KYIB 1F8GA 4GOKA 2OV8A 2OP0A 2GM9A 5CA0F 4V0QA 2XNCA 3PHLA 2JFVA 2CMHA 4RAOA 2FKXA 3ZTYA 2GV9A 1UFRA 1NNEA 1L5QA 4TMKA 3U62A 3WHPA 1OBCA 2QWNB 4PHTA 2Q7XA 4TRMA 4NZPA 4QIHA 4MULA 3PQ8A 1ADBA 4L9SA 1YB4A 2VZEA 3FD5A 2JIQA 2PH7A 4CU5A 4C0LA 1JB9A 4H16A 5ALJA 2PMDA 4MMYB 3APQA 1JLHA 1KF0A 3MWKA 4MV4A 1PV2A 1VXOA 4DRYA 3PJGA 2I6RA 1ELOA 3M6XA 5JD6A 1L1EA 1V2GA 5IXJA 1ZOOA 4N03A 3EZ6A 3G80A 4R01A 3DE1X 4XTCS 5KYYB 4HWSA 4KN9S 5IT9A 4LF8B 5BW8A 4AJLA 2ZM6O 3IA7A 3CMCO 1CUZA 4F93B 2W22A 4RKWA 2YXZA 4ARZA 1PG2A 1RIFA 4H60A 2R8YA 1EK2A 4LGCA 4P3OA 1E7QA 4XYBA 2J33A 4KODA 2I7CA 3HKEA 3OQ6A 3WWPA 1CD5A 2PGGA 1N33O 1HRDA 1XZJA 2WF7A 2C8KA 1VHLA 4MRVA 2ZBEA 1Y3AA 3JCMM 1AR5A 3JWHA 3LWBA 5HCUA 5DTJA 2PMWB 4QGPA 4RXMA 1PEAA 3KIPA 4A8TA 3KEQA 3C3DA 4TWJA 4Q3OA 2VAWA 2R751 3H11A 5TVGA 3DUFA 3E9CA 4UHBA 5C8ZA 4DIBA 2DETA 2GUZB 1JA9A 4CLRA 1V1RA 1I2CA 2J0UB 5HWSA 1ISSA 2EATA 1PYGA 4LH6A 2Q07A 4ALMA 1J5XA 4TRNA 2YIDA 4E09A 3C1AA 4PY2A 3SGIA 2W6PA 2PGIA 4X8HA 1C8VB 4IILA 4LPKA 5HKKA 3OWHA 4KPUA 3EXFA 3SR0A 3N3AC 4N1AA 5FFNA 3K6SB 1JL3A 3LQKA 4ZC8A 1FUIA 2PS1A 1W88B 1BMFA 2G83A 5KCZA 4DMGA 2VP2A 1JDJA 3F3MA 3KSRA 2ACVA 3R3HA 2WMYA 2RGWA 2VZLA 3DBRA 3MRXA 3HSYA 5IC5A 1GZ7A 2PBZA 4FFDA 1K89A 3KM0A 1Y9DA 2FPXA 3AEUA 1X9IA 2P68A 4ZT7A 1IOWA 4JKYA 2G08A 4DILA 1G2IA 3NDRA 3KIZA 5CVCA 3HVUA 5JATA 2PL9A 4R7CA 2DWUA 3OEEA 5CFZA 3QKWA 3QWBA 3DKVA 1B8PA 1CY1A 3S2YA 4ESOA 1SKQA 2P06A 1AC5A 4Z9YA 3IP3A 1ARZA 3E5NA 2I2CA 3RSOA 2XGOA 3AGQA 3NUZA 2DUNA 3C5VA 1K8YB 3L8CA 3R5XA 1PL8A 4N0DA 3CZPA 4E07A 5DLDA 3EPKA 2BE3A 1JIUA 2CFIA 1Q0RA 1Q16A 4ZI7A 4HWOA 4WEQA 1YJ9F 2RAVA 5K9ZA 2VQEB 3K9SA 3OOWA 2BI4A 1B3BA 3DOHA 4NPAA 2ZJ0A 1F2UB 1A69A 1AMOA 2QVZX 4QUIA 3R1IA 4UHEA 4NMLA 2R79A 1SQ6A 3SFVA 2DYYA 1JYFA 1AV6A 4G2NA 4IO1A 1HLGA 1ZR4A 4PX3A 4BIZA 3NC1C 3I8OA 3AR3A 4UPEA 3DBLB 2XCIA 2OUKA 1B26A 1GQSA 4ZOLF 1FK8A 1WXWA 3MBIA 4LGVA 2P6UA 3SBDA 5I3ZA 5TEVA 4K9LA 3DC6A 2YDEA 5TY0A 4R69A 2RHOA 4XDKA 3PUXA 3E7XA 5CX1B 4I50A 2AHOA 4K6CA 4A7PA 4LAFA 1FP1D 2FSUA 1Q0PA 1FXWF 3W8FA 4BWFB 3OWXA 5DPMA 2YJTD 4FDMA 2O7RA 1ZUQA 3HWRA 3H17A 3BFXA 4DCJA 4K87A 2JFBA 4LRQA 3DTVB 4LF6O 1A88A 3UG7A 1XOIA 3BK7A 4UEQA 1XAIA 1BS9A 5AVWA 2WJ3A 4YIOA 4DW0A 2ZRAA 4G56A 3C15C 3NT2A 3L8MA 3FROA 1E96A 3IDZA 4U63A 3F0TA 4MS3A 2VZ0A 2VHCA 2D54A 4MO2A 1QC5A 4EY3A 2VFAA 4I36A 3VRHA 5ICMA 1XA4A 3VR3A 5BXZA 1NVAA 3UWMA 4W4KA 3S1LA 1MUUA 3ZWNA 3B6EA 3HFJA 1H5UA 4OXRA 4I8IA 2X5JO 3A9UA 4XWAA 4NKGB 4EWLA 3HUTA 1W0JA 2UUPA 2FI1A 3Q6IA 3S2IA 1JEEA 4D9FA 1VSTA 3HCPA 1PJLA 1RZRD 3KPYA 1KETA 1Q2UA 2K2WA 5AW5A 3ZVRA 4N3CA 2ZJ3A 3NPAA 1YJ9V 5AOVA 4FX2A 2ZIEA 4CEJB 3JZAA 1OFTA 4URXR 1KQFA 1JZTA 5DLPA 3N86A 1VBFA 4UUOA 1P5JA 4MB0A 5A2QA 1TAHA 3GJ4A 5MN4A 4UASA 4GOND 3LIIA 4INAA 3KYBA 4NEHB 3UCEA 4LZAA 3EH2A 4BMPB 3UATA 2EX0A 5HKBA 4ER3A 1K3FA 1DC6A 2PR2A 3AF5A 4JDPA 1YASA 1NU1H 3MD0A 3LLSA 1DB3A 1SBQA 4GKJO 4IQ0A 1SG6A 1EVEA 3RTEA 1GH6A 2B21A 3INTA 2IW3A 1FYVA 1ISIA 1UZNA 3VNBA 5EZSA 2G0NA 3DGEC 4S24A 2BCEA 3BVPA 1G8MA 2XVAA 1FFDA 1BJTA 1HYQA 4WV3A 4GW3A 4O2BB 4KNVA 1L8AA 3LDTA 2BUBA 3FPLA 5FPQA 4WNAA 3M2TA 4LF5B 3UG6A 2ATVA 1R0XA 3IUMA 3LZDA 2PDAA 5B8FA 3NJRA 4DQKA 3U81A 2FJPA 4HEA6 3KZMA 1OYYA 1Q86H 2QZPA 5CEJA 3R7NA 3RT3C 5F7OA 3FSGA 4ND8A 1KNJA 4Y30A 3GLRA 1SCIA 3TGLA 2YWGA 5ITWA 3C3EA 1ZQ9A 4PA3A 2OOSA 1MPXA 1VRWA 4BZQA 2P9CA 3KETA 1L4UA 3KFVA 2M7WA 2H5LA 3AR4A 1T5DX 2O2JA 2DBVO 2E85A 4BWGA 1V8PA 1P7CA 4D57A 3MJSA 5B1HA 3LP8A 3HXPA 3G9QA 1SOAA 3GRFA 1D2EA 4PC3A 3LRTA 3GEHA 1I3KA 1LH0A 3WGNA 1M5RA 4OKSA 2TMYA 4OQEA 2AFIA 1VBNA 2EQ5A 2V96A 3E8SA 5BN5A 3HU1A 2PA0A 4E1VA 3E86A 2HXYA 2QUBA 1QRDA 5GONA 1BL8A 1R3IC 3I30X 3SS8A 4G5SA 4O29A 2V6IA 1KDYA 1AVMA 2EFEB 3WJPA 1JSRA 2YWDA 3X2QB 4J2TA 3W3AH 3A8TA 4HRXA 5SY6A 2CUKA 1BFKA 4XUEA 2DHRA 4FT2A 4C0QC 2WW8A 3I2IA 2R2GA 1J24A 5A62A 3HJHA 3CX3A 1F60A 2I4TA 2SKEA 1OSNA 1R6TA 4R3UC 1BXGB 1XB2A 4YCCA 3SSMA 1P0IA 3CLRD 4JQZA 4XVRA 1E1QD 4LBWA 1MDFA 1E6CA 2JH3A 5L3SB 3L07A 2FPUA 4K0RA 2OBMA 2ZJ8A 3JVDA 3FPBA 1QVGF 5F2NA 4EI8A 3TLBA 4HEA1 3N28A 3W9SA 4WN9A 1CB7A 2P65A 5A4FS 3CNOA 2OQIA 4OQPA 2FGJA 1D4ZA 3OIGA 5CDHA 3S1SA 1VF6C 1NTRA 2QZ9A 3M70A 1RYNA 1J56A 1LLDA 2BM1A 3FXAA 2R8EA 4WCFB 3FYEB 3ZTTA 3V8QA 2PMPA 4J11A 4OYYA 5NULA 3KWLA 3IAM6 2R47A 2CVZA 4QPJC 3FETA 3KZVA 1N1EA 2X5NA 4FOSA 4TLAA 1Q1BA 3OE7D 4RVNA 3ZCCA 3AIKA 4KXYA 2I76A 1LQUA 1XPJA 2Y93A 4C0WA 2VOEA 1FRQA 3ETEA 1BCRA 2BGLA 4KEAA 2OCYC 4G1MB 1QRUA 4RQFA 1K3TA 3PUZA 2WKQA 1MBZA 4UCRA 1XJ5A 4BYMA 1MJGM 2C4MA 1NBIA 2DQZA 2Y0EA 4WCFC 1JT2A 3FHLA 3JALB 3D4BA 3JSXA 2XUOA 3KJZA 2VBGA 2JFYA 5AK0A 5C46F 4G5FA 3ESJA 1VBKA 2LD4A 2V59A 1Q3HA 2BEWA 2OFXA 4P36A 3BB3A 1E60A 3QTCA 1U3DA 2OBLA 2IA5A 3HKBB 3SQOA 3OTIA 2OSBA 3KR0A 5B2EA 3F3KA 4Q93A 1G8SA 2X58A 1AKTA 3WFZA 3SR4A 1D2NA 5EJAA 1QPBA 1BMTA 2W90A 1Q81H 1QK5A 1L5LA 2NMVA 5KTMA 4E4EA 3OE4A 3S03A 1G41A 1ODSA 2Q2NA 4ZCMA 4LF9O 4CTMA 1YS9A 3K5MA 2H1LA 5I3CA 4J0KA 2CL0X 2C7GA 4GBGA 4ALNA 4I9UA 2FPRA 1WJGA 4WUTA 5AKXA 2QEQA 3CZ9A 2BFAA 4WXMA 3USCS 3IAM1 4TXHA 2ZSHA 2G5CA 2I87A 1M90W 4MS1A 3GUUA 4AO8A 1DBWA 1PNTA 5EKSA 3GVXA 5H1YA 4GDMA 3IIMA 4YO8A 4UBKA 1EWVA 4YY3B 4IJ5A 3T7TA 1X1AA 2ZGVA 5DRYA 3M7MX 2VEOA 4LRSB 3S40A 1RVDA 2FK7A 4EMBA 3ZGLA 2OGUA 3P20A 7MDHA 3NIDB 3ICEA 4Q1EA 1XCJA 2O3TA 1PTKA 5HBRA 1KFEB 3BWCA 3VOTA 3GLFB 1W55A 1T36B 1Y4DE 4ZMSA 3DTYA 4CMGA 1DKRA 4QARA 5FEMA 5I8WA 1G63A 1RFLA 4LKOA 3OPVA 1RRKA 1ATIA 4G26A 1TJPB 3CKMA 2X23A 3Q0EA 5EQJB 3I09A 4WY8A 3DM5A 4F71A 1AKRA 1XZBA 1GTOA 4BU1A 3LQ2A 3CG6A 1TCUA 4W9NA 3NRBA 4XVHA 5K8VA 3I12A 1A8QA 2P2CA 4KMMA 2H5IA 4O2BF 3DM9B 2AFHE 3AYXB 4HVLA 4JJGA 1HNZO 2XSZA 2HU7A 5CFNA 2BFEB 2BH9A 1ZBQA 4C6HA 2QWRB 1OAAA 4L85A 5EIBC 1M10A 5AJUA 4BPRA 1HFKA 4ZEMA 1G6KA 2PGAA 1CVLA 1TU3A 3OEWA 2HIMA 3TGPA 3D8UA 4A8JA 2WIFA 1PP9H 4DV6O 3ZDCA 2C88A 2ODQA 1E79G 1E6UA 1H66A 2R3SA 1DOAA 2X15A 2BSKB 1Y80A 4EB0A 3ON1A 2I6DA 3F0EA 3IOCA 3U44B 1R4MA 3NDBB 1F4PA 3BX1A 3E48A 3ZJZA 4YRJA 3S6JA 3TVDA 4AKHA 4AT1A 2DOKA 3PC7A 1UADA 3W2FA 1P9WA 4BNGA 1J97A 1LUVA 1KK0A 4FUTA 1ML3A 5K0CA 1JAIA 2HWXA 5BYJA 1SZQA 3BD7A 4MYUA 4D8XA 3CPQA 3QI2A 3WLQA 3AV3A 3S68A 1HX7A 1IUOA 1AUXA 3WMFA 5AKLA 4V03A 2Y1WA 1MLDA 4S04A 1GRCA 2QSJA 2COEA 5FBQB 2PYZA 2EBUA 2REXB 3WE7A 5AIBA 2FW0A 1PSZA 4YLGA 4J1SA 4WGGA 2ZI3A 2C95A 5FOTA 5BV2P 2GMWA 2R62A 2QSZA 3BKWA 5HDBB 2Z4TA 3TR0A 1VLMA 1PWYE 3ID6C 1I5YA 1X42A 5DWVA 3CR8A 1L7DA 2IHTA 3WAJA 2HJRA 3QF4B 3H83A 3T94A 4H1WA 3D0RA 2DT8A 1KMHB 3AL3A 4MYRA 4NV1A 1Q8IA 3OFKA 1AMNA 3PK0A 4DIDA 1Z0JA 4L07A 3ZK8A 3LBHA 4J4HA 3MTQA 3WLHA 1MEJA 1OY1A 3EIFA 2DFTA 4MWCA 2FPSA 4ALIA 2GBLA 3AETA 4AF7A 1ZCZA 1YB5A 3GK3A 4ETIA 4LFBB 1GKUB 3NAQA 1US8B 1KAHA 1OUMA 4OQFA 3C97A 1M1ZA 2PH3A 3VHQA 9GPBA 2O8CB 2WB2A 2WA2A 4HDRB 2SECE 3FHTA 2AW3A 2XCSB 1B41A 1USIA 1IV2A 3SR2C 4DBZA 4XWTA 1QGZA 4QM6A 3FUXA 2VYVA 1O4VA 2X5KO 3GT4A 3IUYA 3I2YX 1IY9A 1HLPA 2PUGA 3WL6A 3ZDEA 2GUGA 4J07A 2QTLA 5K6AC 1C3XA 2HB6A 1KI8A 5C31A 5IKEA 2DWQA 4QDZA 2GARA 3KKYA 2FDCA 2TS1A 3H9GA 3NFRA 2GLUA 2OZKA 4JC5A 4OUDA 4I9QA 2AH5A 1QS0A 1YZNA 4AYXA 3G5MA 2KLBA 1R6DA 1ZMOA 2YXPX 4K2HA 5CB8A 3NP7A 3B09A 1XYGA 2DHEA 2HS3A 1B04A 2ZWOA 4H7FA 4YCBA 1Y42X 1LZKA 2RHJA 2J08A 4QDKA 1ID8A 4Y6QA 5J43A 2AI3A 3GH3A 3R7SA 5D2CA 2O0LA 4D97A 2OZPA 4U5XA 1PHPA 3MHHC 4KC0A 4WLFA 5CMUA 2F1IA 4EZIA 4W5HA 5L3FA 1CE8B 1O54A 3O94A 4BNFA 3T99A 5FPHA 3F3YA 1B8UA 1PV4A 4YT5A 3DDSA 1W2HA 1FMJA 4OEHA 2PLAA 1KBHA 5ILOA 3T7CA 4NZOA 4K9QA 3UZUA 3CJHB 4JLPA 1O96A 3R66A 1SVSA 1O0SA 1XDGA 3JZIA 1XPUA 3A37A 5EPEA 2VRNA 1RWVA 3A0UA 3DR3A 1GZ3A 3ZJTA 1QCCA 4PX9A 3QFSA 4URWR 3R7BA 1P60A 3AG6A 3GNSA 4FSXA 4XIJA 1NVFA 2AQHA 4QSMA 1HL7A 4QGSA 2JI9A 1OIVA 4BFXA 1P39A 2X0NA 3UQ8A 1Q6YA 2ZRBA 4MWBA 3Q3GE 3I6BA 4K8RB 3PDCA 2ZUUA 3QLJA 2ZTLA 3USES 1F9AA 3A3PA 3LC0A 3U48A 3FPHA 5FUVA 3HJNA 2JCSA 4GOMD 1JRLA 3A70A 1ODLA 3MWEA 2WF5A 5CDUA 2WLMA 1ZNZA 5A5EA 1HETA 1SQXH 3AGKA 1A2QA 3ZLBA 5BURA 1WD7A 3I5DA 2WTXA 1E0KA 3VO9A 3VSDA 5AW3A 4E7PA 1HDOA 1BAPA 4OB7A 3KUUA 2RI0A 3NBKA 3CPJB 4H27A 4I66A 4CLEA 4OI1A 1MIOA 5JD3A 1BDIA 1LRJA 1XJWA 4JBNA 5TJHA 1VQVA 4U2BA 3RV4A 1SIWA 3PZBA 3DHWC 5CR9A 1E9SA 1BN7A 2R6JA 2C5EA 3WGIA 4X1YA 3VOBA 1E66A 3MHTA 2Z5UA 3TKYA 1GPAA 3FF1A 2XNHA 4OHMA 2F3SA 4AJHA 2X4GA 1TAEA 3ICXA 3V7QA 2A9KA 1QTQA 4XH9B 5A02A 3RUCA 5ALZA 4ES6A 4ZI2A 4V3CA 2IPOA 1G7SA 1G21E 2P3QA 2KMLA 3I9V6 1NZDA 4L4XA 4HS4A 2IXAA 3R3SA 4E2FA 1PQUA 3BL6A 4ZOLA 2PY5A 1WZ2A 3ISJA 3AHDA 4RHTA 2B30A 1UZLA 4GLLA 3STXA 4DC1A 4HVCA 1F5NA 2XMZA 3OQOA 3KQOA 3W7SA 5KYUB 4FGSA 1OV9A 2YYSA 1FXWA 3AR6A 5F3DA 4QYIB 1VHDA 3ABLB 3QFCA 2GCEA 2ANCA 1FMCA 2W6NA 2A0LA 1J0EA 4CMIB 1UZAA 1GNTA 3LT1A 1NI4A 3LWDA 2H9IA 1HQDA 4S1OA 2RHMA 3OJWA 1DXYA 4DMHA 1Y6GA 1ZZGA 4MRMB 4Q6WA 3FGOA 2EQBA 1A9XA 1G8HA 3WGJA 1M54A 4DDMA 3EVAA 521PA 3P5BA 3ABLC 2Q28A 3C48A 1RHJA 1HT0A 3WFJA 1G8PA 3D6JA 4BLQA 4DR1B 4RK6A 3PNLA 1YKFA 2X1LA 1YONA 3IODA 2OCPA 4P9PA 2EX3A 5EEHA 2CD7A 4J0IA 5LQSA 2K7FA 1FW8A 2AR0A 4KQHA 5B66Z 1QU9A 2FQYA 4O5AA 1OPXA 1DV1A 5EE1A 1W6RA 1OC4A 3I9V1 3JQ8B 4OHPA 2WJ6A 1O5TA 5FT9A 2IJIA 2EILB 2JDIG 3E8GA 3L04A 2VK4A 1ZXBA 2PVSA 1LRKA 2RGNC 4PPGA 1T8TA 4IQGA 4K2AA 1ZICA 3A06A 3V1YA 2QNIA 1NYLA 3KDAA 3UIEA 2P69A 5HGXA 3OCCA 1V7PC 3CRW1 4Y2TA 1NAIA 3IAEA 2AFHA 5C5DA 4QUHA 1Q20A 2N9UA 1KAGA 5F9HA 5C80A 1IK6A 3UFBA 3VOAA 5ECYA 4IIDA 2VS1A 4EG3A 4JI8B 5ITZB 2VJMB 1I4WA 2AJLI 4MYHA 3JQGB 2W93A 4L73A 4OGQB 3ZLVA 4I6GA 2EILC 2DWDC 4BRZA 1E8MA 2JLWA 3AJDA 1NXTA 1FFYA 2XT0A 5FTJA 4R2MA 3BZWA 2OXFA 1NXOA 2EYUA 2GX6A 4B2IA 4OG2A 5U4QA 2ALJA 4DSOA 2JCBA 1NNUA 3N3BC 1G3QA 2WFZA 4RMIA 3FG9A 2B5VA 5B7GA 4WZBB 4RO2A 1T91A 3CH4B 5J4LA 5KTNA 4W5JA 2WT4A 1XTIA 2FGYA 4DCSA 4JEHA 4NOJA 5JS8A 4KBYA 4E6EA 4ZK6A 3TKAA 3CXRA 2IG8A 4D8VA 4PYQA 1KMNA 1W2WB 2YOHA 2GHRA 1T9HA 2F1JA 2RHTA 1HDJA 1XX6A 1UI9A 2CUZA 4FC7A 4OKNA 4B2LA 4ERXA 1PR2A 3JWEA 2FCRA 4C5AA 4CLXA 4B3SB 1LGYA 2PKQO 1RTKA 4JLDA 1HFJA 3KS9A 3E8XA 2IUYA 4D8TA 5ALLA 3T9BA 3I83A 4LVCA 3LY7A 4RXTA 2GSDA 5BV1A 2J0UA 4QNRA 3G02A 3FLAA 3N76A 2W83A 1W0KA 3ZRVA 1EP9A 4Q4HB 1NW3A 4HQOA 1ZI8A 4UBIA 3H8SA 2I2WA 3N0RA 3H6HA 3K57A 4FCTA 4PBTA 3EXEB 4GYWA 4AY6A 3C9TA 3QXSA 1ABBA 3MJVA 3C6QA 3M4ZA 3LU1A 2HJ9A 4EVSA 2CXNA 5SYNA 1KJYA 1TEHA 3AOGA 4X85A 1UBTS 3ZS9A 3F8TA 1ZM2A 2AOWA 4NPCA 5K3OA 1KC8H 4OX9B 3I7TA 2DYKA 4PAQA 2J3JA 1SGWA 4A0HA 2IJKA 3QPDA 1QOZA 5TRTA 1HDEA 1CEXA 4INJA 2JFUA 3C3CA 4D3YA 4FGZA 2HFJA 2VJBA 3JZDA 2FJUA 2NZJA 2FSHA 1KJ8A 2I6UA 4B6OA 4BNKA 1V16B 4Q9KA 5FULA 5FLEX 2Z5VA 3DXFA 3MMSA 2C2AA 2J6HA 3RQSA 2AIRA 1MAHA 2JLRA 1CJCA 3VKWA 3SE0A 1VECA 3RWBA 1ZX1A 1RHKA 2XA1A 4HXGA 2UU9O 2VXYA 2AXTZ 3M5PA 1Q84A 4NCAA 1L5MA 2HHHO 1NU8A 3LDCA 5GMOA 1ZL0A 1RM0A 4IFEA 1EUDB 4F1JA 5L7WA 2YC4C 2IWRA 2QTRA 2CL6X 3DBLA 1E2MA 5FWDA 2DCMA 1GZSA 4V1CI 4P4TA 4FLMA 3S2ZA 3UMBA 4M8IA 1S2OA 1CFJA 2X0FA 3DNPA 1NR7A 1E3MA 2IUSA 2H2IA 1WHSB 1PS0A 2EGGA 1KY3A 1BA3A 3OMLA 1NP3A 4IWNA 4B76A 4EFDA 1OZGA 5E6SB 3FFTA 1VJ5A 3GT0A 3QEBZ 1UDAA 5D7NA 3RIGA 3CEPB 4I8DA 1JTVA 5M7EA 5LGTA 4N0MA 5CA0B 2QLJA 5CD1A 3DTVA 5J5AA 4DY4A 4QDJA 4HYOA 3Q7TA 4WY2A 4UOQA 1RBZA 3KR9A 5JYBA 5FUQA 3I04M 4G41A 1SXJE 2GFQA 1G98A 4NENB 5JASA 3HXQA 3WYGA 1ADFA 4PTYA 4Q7KA 3UO8B 3S28A 2XLCA 1XREA 4WJLA 1EFUA 5FPKA 3I9MA 3ICOA 4X95A 4QHYA 3FTPA 3QUCA 4N5MA 5EC8A 1XQVA 4ZTBA 4ADSG 3COWA 3L0YA 5EMMA 3F7TA 2I4IA 5C8VA 1NYTA 2FTKE 3TI9A 4TYYA 1K7FB 4UXJA 1RAHA 2Y1CA 3CF4A 1EVZA 4HGZA 1VK3A 2BLLA 4LY3A 1IFXA 1TVCA 2XTZA 2CMDA 5HW0A 1U2DA 1Y7PA 3KHNA 4CTKA 3LKVA 1H3EA 2D6FA 2ZS8A 2PFSA 1OW3B 5AVRA 1XU4A 3IQEA 1NF3A 5TQ2A 1ZH2A 3WI7A 3EMBA 4CEJA 5J3JA 3DGEA 1GPWB 1HE1C 3KQMA 4JI4B 1JIVA 1Z6QA 3GEPA 3PV0A 1ORIA 1HQKA 5EG5A 2GKGA 3U31A 5IJ0A 2OAQ1 1C4WA 1KVUA 4RHXA 2P6YA 1AZLA 4MIYA 5HIMA 2D2EA 4RV4A 1XXHB 4FLWA 1SUIA 3P27A 3GLKA 1GZ5A 3IDSA 4HYYA 1DUIA 1AGNA 3L02A 2JIZG 3CCRF 3SXUB 1X7GA 3R6GA 1KIFA 2CEAA 3MTIA 3GMDA 1AZSC 4D9EA 2ZDHA 4FYXA 4ASUG 3D8RA 4DFDA 1YZFA 3OLYA 4UVCA 4R0NA 3NYIA 3C8DA 1G21A 4PIPA 1W87A 3TCUA 4HATA 4O2BA 1D0IA 2ZS9A 2JCGA 3AF3A 3M82A 3SYNA 3VJLA 3RRMA 2D2FA 1JHRA 1EGMB 2O8NA 1YIDA 2X14A 4L5AA 5J40A 1GPYA 1WCIA 4HUJA 1XNRB 5FL3A 3QPVA 3OPQA 4D7TA 2FFJA 2XCQA 3TXXA 4G25A 4BLVA 3DL0A 1F0PA 1JW9B 4GI2A 1L1QA 1USGA 3AESB 3HJBA 5JQWA 4QDTA 3KX2A 1YVDA 4WNCA 1O97C 4DR5B 3G2NA 3ZHOA 2BI8A 1TIPA 4UVEA 3BJMA 2A84A 3L7NA 4IPTA 4G4ZA 1GHTA 3FUWA 1OLXA 1LDNA 1GN2A 4ZCIA 1Y98A 3EW7A 1PZMA 3G85A 4G0VA 2JI8A 4OCZA 2A1TS 5JAZA 1P31A 2DFNA 2F90A 3AFOA 2WYIA 1VMAA 3W6NA 1I51A 3EA4A 1NMQA 4J4BA 2X6QA 2FMLA 3CY6A 1K73H 1NURA 1YZLA 3UMGA 4J16A 4LHWA 2JKYA 3MBKA 1U3WA 3TJMA 2R11A 3ZH9B 1ZD2P 2VJQA 1N6RA 1VMGA 1WS6A 1HNWO 4RHEA 3SZOA 3PUKA 2W8BC 4I1PA 4DADA 5FPTA 4XIIA 3N75A 3K1JA 3R65A 2E4XA 4WXEA 3ZZMA 3WYCA 3N0TA 1X9HA 1ICEA 4WWHA 4ZVTA 2HA3A 4B8ZA 4D9NA 3LLMA 1VF6A 1I80A 2FUEA 4HBZA 4FILA 5HF8A 1BXGA 4HGRA 1IL0A 1IOZA 1XBLA 4DM7A 3NKVA 1UIMA 1ZMRA 1OCCC 3F6MA 1FSSA 4HDQB 1BC5A 2NIPA 3CCRV 3SQWA 4GL2A 4OHWA 3CTPA 1TJ3A 4DYVA 1OI3A 5DMHA 5CVTA 3M6AA 4RJKA 4R1TA 3VZRA 2QENA 1WPXA 3JPYA 2G1KA 2ASEA 4ZI5A 4X7RA 3ZIDA 1K8AH 2H8EA 1KGSA 4F4FA 4EENA 2AMTA 4UEKA 1EHIA 1ZJJA 3I34X 1M8GA 2C9DA 4UM5A 4CCAA 1KOFA 1OI2A 3QO7A 3TQIA 1PIWA 1Z13A 3SKYA 1BX3A 4G5GA 3DPUA 2HK8A 4J94A 4ZVOA 1Z0SA 3FFXA 4LC1A 1GX1A 3U09A 4CFZA 5CLIA 2LUOA 2VJLA 2AQ8A 4ZAWA 2AFIE 3AVQA 5ALPA 1NVPB 3GDWA 4ZCSA 1QRSA 3RC7A 1U40A 1Q6ZA 2HK6A 1O9HA 2O3QA 3TPFA 1V8ZA 3OQHA 1NRXA 3L8GA 5B3SB 1SC9A 4M8NE 1NN5A 4QQKA 3J80N 1TCBA 2BHTA 3QKRB 1EVLA 2IS6A 5HIAA 4MUIA 2Z01A 4JS0A 1H2MA 1PR3A 2FWNA 5K03A 5ARDA 4LSWA 2Z09A 2G72A 5FWNA 1GKKA 2NZVG 4H2DA 1DX9A 3CG0A 4C7MA 5AXAA 4H1TA 1FFAA 3Q5DA 4UZEA 3IS3A 5B3SC 1K0FA 1Q44A 1RQXA 1NW7A 2I6SA 3PNBA 4L95C 5FD8A 1K33A 4DOMA 1T6XA 2QLBA 2HADA 4WLVA 3FB8C 2AN5A 1J90A 2I3DA 4NHEA 4ZVRA 4LHZA 1Z7WA 2IP2A 1AU9A 2IEBA 1KU6A 3QMMA 2QE7D 3TG2A 2QTMA 4QE3A 3ZYCA 2IH4A 1QB7A 2OAGA 2W58A 1OFHA 3M9WA 1S1CA 5IZCA 1YOBA 4MTFA 3UOGA 1ESNA 4YASA 2P5YA 3SMVA 3UGQA 1TUBB 2CNDA 3EEYA 2XB2A 1YC5A 1GKLA 3GPIA 1I36A 3LGXA 4XM2A 3C14C 3UHFA 5HA5A 4NDAA 5DXAA 4G0YA 3D3IA 1D6JA 2GZDA 3RS5A 2JD2A 1SU4A 2C04A 1G55A 1S96A 3WKAA 4Z0TA 2G4VA 2IOQA 5BSKA 3KO8A 1T36A 5B4UA 3V1MA 1M34B 1Q1AA 3ZE6A 1O94D 4KQCA 1QFZA 3ZRSA 1JX6A 1FVOA 3CRVA 3RFRA 1GVNB 5JJKA 2DT5A 5ILQA 4OXXA 1YULA 4MKIA 2X0RA 3RW0A 3RR2A 4DUGD 4P32A 2I33A 3IFSA 3OTFA 4Z4HA 3UJ3X 3UKMA 1PJTA 5L4LA 1QIFA 2VVTA 1YDHA 2O59A 3HYCA 4F85A 1Z37A 4BKUA 4M49A 4LDJA 3OOYA 2GF2A 3W7XA 4FDLA 5AK4A 4DJ5X 1MXHA 4H3VA 3O8LA 3PIIA 3UT5B 4G0XA 2VNHA 3JCZA 3I5YA 4TTSA 9MHTA 2VDUE 2HQOA 3SIRA 3O84A 3FUUA 3KE1A 1JG3A 5AI6A 4QAQA 5L3DA 4E11A 3MOIA 1J9EA 2P27A 2LQTA 3A32A 1A77A 4CMEC 5HFAA 3L7IA 2KSQA 4RK4A 2IV7A 3LECA 4TLCA 3FBAA 1T4GA 3HS3A 3WMWA 5KDDA 1PG0A 3HHEA 1SBTA 4R9RA 2QPLA 3ABIA 4CKEB 3HTNA 1RYBA 3HN7A 2BSKA 3ESYA 4TQGA 1QCDA 2RHWA 3U44A 2X6CA 3S02A 1N2ZA 2J3EA 4ZT3A 1TKCA 4XFDA 4NZNA 4QJ4A 3ZMUA 4CC5A 3D8BA 1UK9A 3K0GA 4KN8A 4OBEA 4P38A 3PC4A 1GDHA 1FNNA 2VQFB 1Y8RB 3EGDA 5D7BA 1FTSA 3O1LA 1CDZA 3VR2A 2XE4A 2Z08A 1ISFA 8LDHA 5KHJA 4TMTA 3TD3A 1SXJA 4ND2A 3BYQA 3HXTA 5U4XA 1E99A 5IANA 1KDOA 3GEDA 1ADJA 1HE5A 1NC3A 3ZS8C 4UUMA 3O4RA 4BTVA 4Y67A 4CCWA 1FTYA 2RAPA 5KA5A 2GPAA 4PAOA 1B16A 5B7QA 3DVQX 1CUFA 4EZBA 4LOIA 3RIEA 5F73A 3TW8B 2W2LA 3L18A 3O31A 1E0AA 2ADPA 2JHPA 2FTKA 1XHXA 4QZVA 3KNZA 1ZISA 4XLTA 5CDFE 4OFZA 5EXTA 2OXRA 1J2TA 1QU2A 5B7PA 1M74A 1U94A 3LRPA 2HS4A 4WUVA 3D2CA 5DYIA 2ZPAA 3CKYA 1B8OA 3C8UA 1MW9X 2O57A 1JJ2U 1SCKA 5DW3A 3ZNQA 2X40A 4ZVLA 3ZLJA 1I0LA 5T8KC 3Q3EA 1PQ4A 5A71A 3E35A 3WRYC 1WNFA 3I01M 4PNEA 5DFAA 2QVYX 4IKEA 3LWZA 4JP3A 3U7EB 3U5ZB 2OIEA 3EFBA 2PU7A 4QXQA 5DX8A 2HH9A 1ZUD1 2G8NA 5CIQA 1NV8A 2AD5A 1S2DA 1GL9B 2V7BA 3TRHA 3P8ZA 3SJBC 4MW6A 3IPXA 1JQEA 2Q3CA 4AILC 2WU3A 2DBZA 2EZUA 1MHPA 3EJWA 2IYUA 4CHTA 2WYVA 1DELA 3U1TA 1KE1A 2O8CA 3AUYA 4HDRA 1M1KW 4GR5A 4IKPA 4LI3X 5A5GA 3RVDA 1KZHA 3SX0A 3U0OA 4ZFNA 1LLCA 1EQ2A 3QHPA 2Y0IA 3WYAA 1RRPA 3C0KA 3ACDA 5E6UB 5IVHA 2WABA 2X5OA 3FD8A 1E32A 1F51E 1N8SA 2PQMA 4LJ5A 4H3KB 2IYPA 4X62B 4E31A 3VKUA 4JDUA 3Q7EA 2YNMD 4BX0A 1POWA 4YRDA 4GR4A 2YXDA 3ELDA 3IP6A 4BX2A 4Q00A 2PUHA 1FJGO 1R12A 1DFHA 1QHEA 2GSWA 3PEEA 5FI1B 1PL0A 4L08A 4NWOB 4KL8S 3OIVA 4MVJM 4YR9A 3OZTA 4U9HS 3ILHA 3I61A 3QVXA 3KKOA 1M2VB 2R96A 5FI3A 2XOKD 3A25A 3M33A 1QCYA 3ONFA 4OGLA 2OTMA 4JQSA 1RFYA 1I10A 4ARAA 4LF7B 3MTDA 4AVYA 1ZK2A 3ZP7A 4MRNA 4YP1A 1NXQA 3JRWA 2D1TA 1Q1ZA 4RJLA 1P5HA 3G6BA 3VR0A 1W73A 3KXDA 3ZX5A 4F6CA 2Q5HA 3ITNA 1QHXA 3G9TA 4EPYA 3MG9A 1N2CE 4MP3A 1CE8A 1GDTA 2ZKIA 1SZTA 5LQNA 3K70D 4JYAO 3DZDA 3F74A 3ANYB 1Z26A 4BUCA 1N78A 1ISJA 2OBYA 5AJXA 1R8JA 4OYHA 5BQ3A 3AB3A 1N4DA 3DEJA 2CLEB 2W6JA 3CJHA 3EFOA 1IDOA 3EZ7A 3O26A 4BR6A 1F0YA 1N5JA 4DRXB 2Z95A 2OCXA 2MIIA 3BULA 3L7DA 2JIDA 2WIGA 1E61A 1YS6A 4L8WB 1J6UA 2WP0A 3CLHA 3C7KA 3H4VA 5K8UA 1Z12A 1TGOA 1U0NA 2OENG 3GHYA 4J9UE 3TBFA 3G0HA 1JDUA 3HA3A 5TARA 1GO0A 5GJCA 1M2HA 2VPQA 3CCBA 3T3IA 2YHBA 1GLNA 3OFJA 4D43A 2IH2A 3M1XA 1Z4OA 3Q40A 4P5EA 3PBKA 2MYUA 1QAMA 1Z56C 5EXPA 3LXMA 5LA6F 1WRBA 3IBFA 1KZGB 2PWZA 5D6NA 2PUSA 5GZ3A 5LLSA 2QPOA 3HYSA 3DE0X 1L4MA 4KRGA 4DM4A 1RJ9B 3CNEA 2M1XA 3W2TA 3HR8A 2CLHB 3S2GA 2E4UA 3BPSA 4LISA 2ZJ5A 2RGYA 5FOQA 2P4UA 2FWRA 5KBYA 1QORA 2C77A 4P93A 1RW4A 4JB8A 1OOEA 3RVLA 3S7TA 4S0XA 2WQZA 1XQXA 4RVUA 3D3QA 4UCUA 4UCQA 4B7CA 3K0AB 5CDTA 1TFUA 4QXAA 2RB5A 3H4IA 3DFIA 3O4IA 2J31A 1LNZA 3ZW8A 1G6OA 1NBMD 3E4DA 1GAEO 1E4YA 3RBXA 4HMQA 2BKVA 1K2WA 3TTSA 2D5LA 5ESWA 3DMTC 2J9YB 5DN6D 3UQYS 1UJWB 3FPAA 2ETNA 5FHQA 3PI7A 1I4LD 2FN4A 4IYHA 4ZAXA 3DC2A 2JFPA 3UUWA 3AW8A 1QO0A 1TKRA 3ZHSA 3QNUA 4KSCA 5EEGA 2HCTA 3GB9A 4HNAB 1V8OA 4RELA 1U8TA 1ZJYA 1KY5A 4P3NA 4O1IA 4IINA 3KZCA 3H7AA 3L3BA 1GZ6A 2Z04A 5UKDA 2YWJA 2FW6A 4CMIA 4EHHA 5KKAA 2CZCA 1LQ2A 4ZKIA 1LXCA 3ZU4A 2O54A 1LS1A 2CMFA 2VRCA 4HZIA 1Z29A 5J9PC 4P3XA 3PVSA 4M7PA 2FGKA 3KOXA 3L05A 3E1GA 3P96A 5EIOA 1JDNA 1XELA 4AMGA 4GBED 2OXIA 3ZWBA 4BMYA 5AUQA 1OB5A 4YRLA 4ER0A 4QRHA 1G2OA 4PO9A 4MDEA 1TJ5A 1V95A 4ZD6A 2WJWA 3UMYA 5EHZA 3GRCA 3BL5A 5HUQA 4RQBA 2OGZA 5D5QA 1E89A 4LSZA 1PG5A 2JJ2D 4UOEA 4II7A 4ETWA 2AGAA 5C7LO 3L82B 3ACBA 3KOUA 5DP1A 1K7YA 1H93A 2PMKA 2H29A 3H2JA 1KWGA 1VYHA 2IIPA 4EJ2A 4MW1A 4CQMA 2JLXA 2PSHA 5A0TA 2F4VB 3PQ7A 3OIYA 4HLCA 4DYDA 2PTMA 3DXRB 3JQ8A 1P62B 1F14A 1HA3A 2N48A 5BXYA 1JQBA 3RSFA 3GPLA 3ABTA 1RWXA 3BPZA 5KVAA 4EG6A 2RHHA 1X1RA 1XHFA 2WE8A 5GV8A 5I4BA 2VRZA 1PNMA 3Q11A 1QWSA 3LDDA 3PDHA 3MVEA 5FPPA 2C97A 4BB0A 1U63A 4FYMA 3ZU2A 4HH1A 3BHPA 4J0QA 4C22A 3PICA 4NV0A 4GZ5A 5M2QA 1KMIZ 5ITZA 2P9HA 3G4SV 1N4AA 4U7JA 4HVTA 4ZV7A 1AI5A 3R2JA 2V97A 1GRRA 2AK3A 1EFVA 2Q0OC 5AMXA 1V71A 4KGXA 4QPCA 3JQGA 2MW2B 4G0QA 1IEVA 1NU6A 3BCRA 5K4GA 4QE7A 3F7MA 3VUFA 2N05A 1INLA 2XADA 5D1HA 5LDHA 3WNBA 3E18A 3EGCA 4YACA 1EG7A 1H2BA 3J81A 2VS0A 2IEGA 3N8HA 4WZBA 3S3TA 1HT1E 2G76A 1LTHR 2HR1A 1Y0BA 4RZQA 4EW6A 1BW9B 4ALKA 1XUQA 4FD2A 2NQ8A 5G4KB 4K9NA 3GJZA 2R65A 3TYXA 2IEDA 3FYUB 1FU4A 3JD2A 4OXNA 3IUJA 1JKJA 1ZS9A 1FXSA 4JGBA 4TL7A 3DAFA 5TMBA 1QVRA 1DNPA 1V3UA 3P9XA 3HRKA 2BMJA 5E2BA 2WSYB 1Z68A 1JWBB 1GA1A 3KPWA 3KCXA 2Q6AA 4RAQA 3WTCA 2K1SA 4H4DA 5H9CA 1EDEA 4MR9B 4J49A 5HUHA 4ODIA 4TKMA 3NM6B 4YC7A 1JJ7A 2EW2A 4ZYYA 3GDHA 5AJTA 3SJAA 3QYPA 3UXHA 5CDFA 3HCBA 3EGIA 3FYUC 3VDXA 3HN2A 4ER7A 5EBLC 2PLFA 1J0DA 1TL7C 2BSXA 4F45A 2QBYA 3L2OB 3EXEA 5EXXA 3DFUA 1WULS 3KD3A 5IK2A 4JCCA 1N2SA 3HVIA 1RPTA 4FDUA 4MGHA 4QELA 2REOA 3QGMA 4YRAA 4KHPO 3TK1A 3MJRA 4WOPA 4EITA 2R48A 2FX2A 1OI4A 4U0KA 4NECA 1DEHA 2WHEA 2E48A 1D04A 2AK2A 3U3OA 4UM8B 2HCBA 3D6UA 1QH1B 4M76B 4B3TB 1MFPA 1TTQB 3RV3A 3SC3A 8OHMA 3H84A 3NGMA 4IP0A 1JZSA 2K5UA 4N3BA 3OH8A 3AUFA 4POAA 4N7JA 4YRKA 2RIRA 1PW5A 1THTA 1YCDA 2HSEA 3QRWA 1XFAA 1YCHA 2HFKA 1GPBA 4QWWA 5B55A 1ML4A 1AXRA 4GZ6A 4GOJA 1EXWA 4GPEA 1X74A 5HXZA 5DT2A 1U98A 3N07A 2LRHA 2ISSD 6REQB 5KDOA 5K0BA 4DMUB 2CXTA 4RIFA 1JFRA 3U4HA 3NATA 4NLLA 4KV7A 2ZSAA 4NG5A 4UUAA 1IXZA 3MDOA 2IF2A 2IK8A 1QFSA 1F51A 2FUNB 4H35A 5HJ2A 3PNMA 2EWWA 1XMXA 5G4LA 2PFKA 5IT5A 3PXUA 1NH2D 3PEWA 1NJ2A 1TQDA 3AG3B 3R5FA 2HYDA 1KZ7B 3MM4A 3PNYA 1D1SA 5JCJA 3UMJA 1EJBA 4MI3A 3RHSA 2YX1A 4L9WA 3ZN1A 4BQEA 4B3IA 3K0CA 3ZC3A 1USKA 3H9CA 4TQ9A 1WA5A 2C82A 4KI0A 2UZAA 4NYMQ 5IXYA 1H3NA 1T4DA 2A0KA 1W4LA 3VIUA 1MGOA 4HUQB 2UXBB 1F1BA 3C5EA 1EFRG 1XTQA 4QBGB 3CV3A 3SZUA 2ZTSA 4MMXB 1WHSA 3HCAA 3K1TA 3AG3C 2RGCA 2XZTA 2C4HA 4LF8O 4KHZA 5JADA 1N2CA 2OWEA 3WWYA 5F7ZA 2VWJA 4Q5IA 2ILTA 2QSAA 3GG2A 2XAJA 1VIVA 3EHDA 2DVMA 3PF9A 4BO9A 4WFEA 5CA0A 1Q22A 1ZVVA 3MGBA 2DQSA 3OZEA 3ROZA 4AF8A 3ZCVA 3LPAA 5JC8A 1WG8A 1Y33E 2ORVA 2AFVA 2AS0A 5LOVB 3LCUA 1N36B 4ENWA 4BASA 2CB0A 1V9PA 3NBQA 4D6YA 4MROA 2VWHA 2DWOA 4X1KB 1D2MA 3GOQA 1JU3A 2R5NA 3CZRA 2XCOA 2FFBA 1AA6A 2Y6UA 1FLVA 5TNXA 3LXRA 4GX0A 1Y6XA 4Q9LA 3DEHA 1P0FA 1DO0A 2JLAA 2NNWB 2BMWA 4E15A 4GXTA 2R8ZA 1PZGA 3KAKA 2H4WA 2C94A 3ZUPA 2C5GA 1VQ5F 2JLUA 3FMFA 5KNCA 4JK3A 2GAFA 3ELYA 3RSZA 2IQ5A 3ZCUA 5EJFA 3OTHA 4ZXFA 1TAGA 3GX1A 1XK7A 5BUZA 1EE1A 1CF4A 2VHUA 2IV3A 3CNHA 4RPGA 4B4UA 4NZZA 2YFQA 3C8ZA 1YBVA 3FJOA 4CM4B 3P2IA 3BA6A 3HKCB 4OV6B 3OICA 3PEUA 4UAUA 1IOLA 4HQ6A 3NH9A 5DECA 221PA 3GVCA 4W7HA 1XXHA 1RQPA 2REBA 3A7EA 5EJ4A 1ZRSA 4NKRA 2X41A 3AVPA 3OUTA 1WP8A 4HLNA 3FNRA 2Y1GA 2AX3A 1XCPA 1W4CA 4G9BA 3CMMA 1NMZA 1U1EA 1MRSA 1VL5A 3EIEA 3LOUA 1S0UA 1S77D 3P94A 2ZDQA 2Q7HA 1N2EA 1R9MA 3LC1O 4Z3OA 2IX9A 2H1SA 2PKXA 3ZHCA 1C1YA 3NTUA 4MV6A 4JSYA 2WK1A 4BNYA 1RLOA 3MINA 3SPCA 1P19A 3K79A 3P9QA 3KYJB 2WWRA 3GFFA 4Y2PA 1SY7A 4JSRA 1UKYA 3T7KA 5C32A 3Q12A 4B5CA 1BKYA 4YTEA 1FSPA 2GZ1A 2GVDC 3N2KB 5SZIA 2VQEO 1C41A 4GQBA 1QUFA 4ENUA 1DU4A 2Q21A 3IE0A 4J7JA 5AVOA 3Q8KA 1WX1A 1BGYH 1I6KA 3IVCA 4YV1A 3G2HA 1G8YA 4FYWA 1E8DA 3BE8A 5DX0A 1L1FA 1B06A 3HPLC 3ADPA 5ENVA 4GUAA 2XDWA 1J2UA 1KC3A 5LPNA 5CP8A 3VKFA 1TW2A 4FTWA 4MX8A 5JCOC 3VPCA 4IVNA 3NTRA 1NVWQ 3WAGA 4TTVA 1LBIA 5CB0A 4J1NA 2WLSA 2VTBB 4QTZA 1VQ5V 3LGSA 4X90A 1KVTA 3VJMA 3EIQA 3X1WA 1JG2A 3S0HA 2RB9A 3BD6A 1PZEA 2FYTA 2OGTA 2UKDA 3ZY2A 3SYCA 4B47A 2IU0A 1W5FA 3NIFB 4R8SA 2OAP1 1JNYA 3ROPA 3LXXA 3AVOA 4D9BA 4RVGA 4ZGWA 2CDYA 3PL5A 2FFAA 2X77A 1GSOA 4C0AC 1T3TA 3L4EA 3UJ6A 2NUAB 1TZBA 4BN4A 3ZHXA 2C2KA 5CJJA 3F6EX 1J4AA 5B37A 2O1EA 2BC9A 2CTWA 1JMYA 4O02B 1QF9A 1Q1GA 2HLPA 3T5TA 4U7FA 5M29A 2ZYWX 3WADA 5GGYA 1NBEA 2E75B 3MA0A 2EQAA 3EFEA 3DOFA 1B2RA 1YE5A 2Q6VA 3JQBA 2G70A 4CLHA 3KHUA 1UDCA 2PM8A 3K9GA 3BMXA 1KMMA 2G25A 3I45A 2Z8YA 2GRUA 4M22A 1H8EG 1Q6HA 1HBJA 2Y69C 3EEFA 1DKLA 2AVNA 3A3KA 5HFMA 1K9VF 4DHEA 3JD1A 4F4DA 1C8BA 1S4QA 2OKGA 2WYHA 2VWPA 1L3BA 3T1NA 2OGWA 2VSNA 3F6CA 2NLOA 1JHUA 4D3ZA 1G20B 3RSHA 4O3FA 4KYTA 4DCUA 1MX5A 3C43A 1CUIA 1KAEA 3LBNA 4QU0A 1Z2GA 2AGVA 2JW5A 3K09C 4KGZA 4E03A 2UZIR 1L7NA 2A6PA 2DULA 4OHZA 4KTTE 3IJRA 1TVEA 2IYRA 4YUZA 3PT5A 1UXGA 4ZYLA 3R23A 1J20A 4N01A 1E7RA 3K0FB 1PVOA 5HOEA 4HN4B 3WLIA 4RO0A 4M0KA 3QKRA 4EKIA 1CHDA 3WC4A 2RGGA 2I54A 2X8AA 1M7HA 1SS3A 2YHUA 3ZLTA 1KC8W 3QEOA 2BFMA 4BEVA 2VH5R 4LF5O 3QXXA 4CR7A 4E33A 2C96A 4V2UA 5LOVF 1K75A 3CUKA 4WVLA 1BKDR 1OCRC 3E5MA 1J00A 3K0SA 1GTJ1 4MRAA 4PCLA 2LCQA 1EWQA 3FJ1A 3N6XA 4UARA 2CXXA 1VSVA 1JG1A 4CN8A 4N6NA 5KNDD 3A2LA 2WLHA 4AK9A 2JGMA 4HNUA 3M9LA 1AGXA 3QEJA 4Q16A 1THMA 3PD1A 2K6GA 5SICE 4BT6A 4F91B 2ZDIC 1R5JA 4HMOA 5BN1A 3GFOA 3TD2A 2A7WA 5A9TA 3I55F 5JPDA 4S2EA 5KYYA 2Z2ZA 3QEKA 2LZ0A 2HY7A 3COSA 2Q1TA 4N49A 1E2DA 3CCEF 1IV4A 3GFGA 1T5OA 2W48A 1OAOC 3W8RA 4REQB 1I6WA 2XA2A 4BNJA 5KJCA 1RWNA 1E3SA 3ZIAD 3F90A 2FKAA 2JCXA 6LDHA 1OF1A 4EB6B 4ENQA 2GT1A 3P0IA 4P2ZA 4YP6A 1B00A 2HRCA 1YR3A 3K5OA 3WDSA 5LUBA 1AE1A 3KTAB 2MCFA 3NFYA 5GW7A 1L4BA 2RNBA 1L0BA 1IXSB 1A4IA 4F6RB 2IWHA 2VAVA 3P97A 4B4WA 3EWIA 2JS5A 1OLUB 4PSCA 4YV0A 4BDSA 1OKKA 3CXCF 2UV8A 5BWOA 4PYJA 1NJ1A 4EPVA 2GUZA 2W43A 3O90A 1CQWA 1V39A 1I7NA 3IPLA 4KFRA 2FB5A 5FTLA 3C3WA 3FPCA 4JLWA 1YB7A 1W2GA 2P6RA 5H3CA 1IUPA 3UT5A 3ZG6A 2QKSA 4FYIA 4YLYA 4OMUA 1E1CB 1D0SA 3OJFA 3G9XA 1N5IA 1C9EA 4Z7JA 2PVPA 3MEQA 2MR5A 4IDDA 2O06A 3DHYA 1ECBA 4KI7A 5F23A 4AYWA 2ZTUA 3P9IA 3QJGA 1KDZA 1TB4A 4M0PA 3U3JA 4FFPA 4DR6B 2B82A 2OAEA 2RG7A 5A6VA 3TM5A 3ZE9A 3SZGA 3K6SA 5IKOA 5B1YA 1W88A 3C74A 1QGDA 1C4KA 3SQMA 4OLHA 2PH5A 2Q4EA 4UQLA 5JWOA 2WPDG 5JAPA 4KDRA 4JKIA 4IH9A 4XX0B 4EDFA 4RPIA 4I3HA 2ID4A 3C2QA 2ATIA 1CQJB 2ZSIA 4B84A 2ECOA 2RHCA 3NVDA 4MZDA 3PUYA 4DGQA 4N5LA 3KB2A 1XTVA 3JVUA 4L5BA 3VSCA 3OMNB 4D6PA 4KJZA 4PNHA 1L7RA 4CL8A 5AI9A 1DS6A 5LZ9A 2RGAA 4FHFA 4NYMR 1Y8RA 4PXYA 4WDQA 3DEKA 1Y7TA 1RCTE 2MYTA 3CPEA 3B3GA 4LDQA 3CRMA 2C00A 1KARA 3RVMA 5EKDA 1D8AA 2VNIA 3I55V 1SESA 1JAZA 3GLFE 2NT3A 5K3FB 5KEIA 1ZGZA 4V2IA 5JBNA 1RHQA 4BNLA 1DFGA 3CCEV 4G0UA 4Q6GA 4Y9TA 4RTSA 2XE6A 4I7EA 5KWIA 3WRYA 3ZOPA 4QQRA 1P1HA 4HFNA 2QMQA 2EVWX 2OHVA 1F2UA 1GYPA 1UMKA 4JI7B 2G9VA 3DMGA 2IVFA 1K7CA 1P3Y1 5BW5A 2PUFA 4DS3A 3SM9A 2DN9A 4YHHB 2LBXA 4ICGA 4ZZ3A 1DOZA 3NH6A 2GAOA 3A6ZA 2NO6A 1B1AA 4BNDB 4TTRA 2VXBA 2BYTA 4UATA 5K0SA 5DXJA 2PMEA 2ZJ6A 4R8CA 1L4FA 3WP0A 3ZEIA 3ZK7A 5DHRA 1IC6A 5F51A 3UH1A 5CX1A 2ZSKA 5EI5A 2G71A 2Z3ZA 1E2LA 4P3YA 1XDDA 1FSZA 4A0QA 2W0FC 3N9IA 4P9OA 1CY7A 2G82A 1DQRA 4YY3O 2OM2A 4IUYA 1CT9A 4N18A 1JBQA 2XXBA 2EBOA 4RKEA 2XTMA 4DXDA 3PXAA 3SLGA 5H83A 2ZZKA 2W9XA 4JMPA 2NU8B 1RAEA 3UUFA 4BMDA 4PS1A 3QVNA 3WLNA 3ZQ6A 4QPKA 1V11B 4GNRA 3M4JA 3T1VA 3OFNA 1GKIA 2IGBA 1SPBS 3U80A 1WOYA 2Q41A 2VG8A 5JZOA 1GPDG 4KX3A 4BX3A 3IE1A 2IPAB 1T5HX 3K9BA 3CPWU 1IHPA 1M6YA 1XA3A 1ND5A 2CL5A 2I2BA 2OYCA 3GFSA 3ASUA 5FLYA 2GPSA 2QX6A 5CT6A 2WINI 4EHFA 1EPUA 1J1ZA 2IDMA 3NYRA 3R9KA 3ML1A 2QUIA 2VLIA 2RBEA 3WGVA 2BTOA 1W0CA 1WA8B 4QUKA 4XQ0A 1J1IA 3GFPA 1DWOA 3L8DA 1YE3A 4LHEA 1SG0A 1KC1A 1M2VA 3TL6A 2LCFA 3FNQA 3IVGA 2W42A 5EQFA 1WDLA 4YJ3B 3BH7A 2ZRQA 5F2KA 5B64A 4I5SA 3VVLA 4NBLA 1N2JA 4LHVA 2V03A 1OMOA 1E1DA 4F9GA 2E37A 5TF4A 1EDOA 2X8JB 5FLXM 3Q7RA 4LOAA 3VR4D 5I7RA 3AO0B 3OEEG 1B6QA 3BCSA 2F43B 1E2EA 4D3XA 3VCZA 1E1RA 5ERGB 3JQ6A 4DQUA 1CNEA 1K8AW 2CBGA 4O33A 4TYMA 3IDAA 3OPNA 4CKZA 3QPUA 4Z9XA 3LTNC 2P2YA 3UUGA 4FE4A 1JHAA 4PRZA 1QK4A 1Z88A 4KWHA 3AZPA 3BTSA 4QREA 4FZ3A 4DRXA 1R66A 1TPYA 5C4GB 2A9HA 1WXIA 3FWNA 4HAZA 5KNBD 4OHRA 2O3SA 1SQSA 1LUAA 3ZZ1A 2BDUA 2OT3B 5TQVA 2FF5A 3C1OA 4Y2YA 3TNJA 2ODEA 3DDZX 1VE5A 3C8HA 5ESXA 2H94A 4MP8A 4E2XA 1H8HG 4KK3A 1SRQA 1WEHA 3UCFA 2J3KA 4JELA 1OXUA 2GJAA 5FBZA 3N58A 3R4CA 2DWEC 3NJ8A 5KI6A 3PQDA 1NJIH 1NN3A 3DCIA 2W8BB 1HK7A 4PVDA 3DOCA 4QPNA 3WNDA 5HSGA 1XNQB 1RJ9A 2OV1A 4OX9Y 5HJEA 1AQIA 3ISVA 5EXDA 1Z5NA 2JA1A 1RI1A 2O2SA 5BRJA 4K6KA 4DJEC 4Y2HA 2C3OA 1U8AA 3GUVA 3V6LA 2P67A 4ESVA 2ONYA 3WK7A 3NOVA 4O4IB 3BGWA 2QN3A 3CW2A 1Z6TA 2PE5A 4X1OA 3KVRA 1ST2A 4EFNA 4OQNA 1T9AA 4G36A 3WGZA 1WBJB 1TU0A 4BBJA 4UTXA 4LBZA 1CP9A 3FGZA 4R0VA 2DR3A 1YR6A 3BN3A 1MTOA 3DZKA 1T43A 1OCCB 2BKEA 1ENZA 3DV0B 1FBTA 1X1EA 3FTNA 4LFBO 4PCVA 4ZJUA 3TCXB 4BY9E 1JLMA 4L8VA 3WXMB 4CKYA 1JJOA 1I4TD 5BZBA 1YIJF 4KQGA 4ERNA 2ZSEA 2GYYA 3GVIA 1IXRC 1GFZA 4WFHA 4WIAA 5IVPA 2NSLA 3FX7A 3A6KA 3EW9A 1NBAA 4JSTA 3JAMM 5FB3A 3A05A 1W42A 5E1MA 4IR7A 3VYRB 4Y1GA 5DI9A 4BQIA 3T9DA 1JKIA 5FADA 4I1IA 4K3AA 5L3SA 1QP4A 3RUEA 2C2WA 1BD3A 3DMYA 4PFSA 4QPJA 4TVSA 3K9HA 1C2YA 4MUGA 4ZV9A 2VOJA 2IUUA 2W8ZA 4J7AA 1ZJ4A 3I2JA 4WA8A 3HJRA 2XNJA 3GCWA 4LDRA 1N9ZA 1GPLA 1MCZA 1YB1A 4C0BA 4FFNA 4JI2B 3FB1A 2CJFA 5EZYB 2DF8A 4JYMA 2WOJA 1O4WA 3WHIA 1IJBA 4WCFA 1KQ3A 4BEJA 3SPXA 2C5HA 4C8EA 1QGOA 1Q1NA 3CC7F 1TIKA 3EC1A 3TDMA 2LGJA 1O5IA 1HPLA 4BIMA 4CR6A 2AYYA 4MUBA 2CFSA 2AZ4A 4L8FA 1Z62A 4KU4A 4Z1MA 2BCJQ 3U11A 1PEKE 3V7NA 1TMOA 3ZP4A 3QXJA 1DTWB 3BFPA 2IYVA 4BO2A 3JALA 3PHBE 1FVHA 1USVA 3TLYA 1URFA 2OMKA 3D54A 3VC1A 3NASA 4ZQHA 4RM3A 3DXRA 5A3VA 4UHJA 2C98A 2AMLA 1ZIXA 2VRBA 2WAOA 3U6BA 3JARB 4UD2A 5EMLA 2ORYA 2XB8A 1A9SA 1WAZA 2J3QA 4BO0A 4G0WA 5CLLA 3HKBA 1LVGA 2I1LA 4L5YA 4KLNA 4GKAA 1YL5A 3G5TA 4DCVA 3OUFA 4AP6A 4B3JA 4WFBV 2YXHA 3G0CA 1YIJV 3VPBA 1SXPA 2QLTA 4DR7B 2GLTA 4ECEA 4MGYR 4G8DA 2HA2A 3KC2A 2VYNA 4FBMA 4AG3A 3GJ3A 2UXCB 1G6UA 3EMDA 2JGEA 4WOCA 5JH7F 2FQQA 1UT8A 1NY5A 1RPOA 2P5OA 3H1EA 3E0XA 3LRXA 4H4CA 3CX7A 1LLFA 4KXLA 4A2CA 5T7BA 1M5IA 3ZK9A 3B1VA 4WZZA 2AJ8A 4U5QA 1I24A 4DLYA 3NLLA 1NVGA 3MYRA 1RQGA 1LFDB 1JZQA 4JROA 2W6IA 3Q8XB 2X22A 3V7EA 1RC8A 3OIWA 2I1QA 4IYIA 1LDYA 2ZE7A 2PN1A 3GRKA 3M4SA 3R0ZA 3A1DA 4YJ3F 5CG2A 4LG1A 4P2GA 2GZAA 1YHNA 3PHIA 4L4UA 1V96A 2P4HX 3FYUA 5DBOA 4DIMA 2EFYA 3QHQA 3CJQA 5EWLB 3UK2A 4JH0A 3GLFA 3CC7V 4ZGGA 3EORA 3KQNA 4BL5A 2NPIA 2LBTA 3BHJA 2WC1A 4RJIA 3OETA 1XCBA 1DT5A 3GN2A 4LZPA 4IDAA 3TSWA 3IIEA 3MJHA 4EI9A 2N1BA 1IM8A 1GM8A 2F1OA 2HQRA 1DHTA 1A8IA 3UWDA 1GADO 3BRWD 3IAUA 2IOHA 1WNSA 5LA6B 1CZLA 4QXOA 1LUWA 1CUVA 3X43A 3U3XA 2JGDB 2YYAA 2XTAA 5JMWA 3NV7A 4UZFA 4FJ1A 1MEEA 5L3RA 2YINC 1EXVA 3LA6A 5AVQA 1LSUA 3A3NA 2P9GA 2BFEA 1JPNA 2ZW9A 3GJSA 4OK5A 1QX3A 5IAOA 4CKXA 2AYXA 4UQPA 5ERXA 5JFGA 1Z2EA 4DG5A 3QUBA 2ZRCA 4CV0A 1KAMA 1VKHA 4IDEA 4EJMA 4F6LA 1ZH6A 2GESA 4PG8A 1GUYA 1CR2A 3X2FA 3A2NA 3BRQA 2W2TA 5FH9A 1FPOA 2I1VB 2CK3G 4GM0A 4E2WA 4EKEA 1QH1A 4CT4B 4R2IA 4ROTA 1L3IA 4CH5A 3BKXA 1RSZA 3QPAA 1SC3A 1ZK3A 1IY1A 3ILVA 2A0WA 5ALOA 4WZBE 2BEUB 3IB6A 3JXEA 3I1YA 1OXSC 3STLC 4MIOA 1PR6A 3U19A 1KXZA 1E6KA 2XEXA 4O4IF 1Z5VA 2IXTA 5JSZB 4DR1O 2JIBA 6REQA 4YCJA 3AI7A 2CLKB 3KALA 2VCHA 4OQZA 3FSEA 2IXBA 4Q4JB 3DA8A 4MEBA 1K98A 4UFZA 2J3LA 4G24A 1UWKA 1C7FA 4MI6A 1VSQA 4WH0A 1JPXA 4Z0NA 1E3QA 3WLTA 5JXGA 2BSQA 2VDWB 4P58A 3WV4A 3L0DA 1G3RA 1ECLA 2QXTA 1JQ0A 2ZUDA 4DV0B 2NZUG 4JI8O 4L9AA 3BG5A 4RGYA 3U1BA 5TMEA 2JFWA 4QDXA 3GLUA 3K1AB 4BKRA 2ITDC 2V4UA 3ORFA 1BGWA 2OD2A 3SC4A 2FSGA 2OGSA 2P79A 4EKDA 1KBZA 4X66B 1VIBA 1E79D 1ZNXA 3K6KA 1AR1B 1QE5A 3KHKA 2HQSC 3U17A 3QF4A 3PQ2A 1YR1A 5IDYA 4DLTA 4JKOA 1YEWA 1SQBH 3OUSA 3BWYA 1F8YA 2GCGA 1KMHA 1A8UA 4U2DA 1SUAA 4LQ4A 4FNOA 4Q9IA 5C2JB 1XRSB 3THYB 2Z1NA 5EZYF 2QTCA 4CNBA 4F84A 5JZSA 2JVIA 1Q86W 1NHWA 2AXEA 2HQBA 3Q10A 3QOXA 1KI1A 1F20A 1L8DA 1J5PA 4UNQA 4HF7A 4WX2B 4P33A 4LH7A 5K6AA 5T4FA 1HTBA 3QK7A 5LOVA 1US8A 3O9ZA 2AN4A 4J0JA 1SKYB 1OT5A 1DXOA 1FUYB 1K9SA 3IKJA 2K2QB 3RYTC 2O1SA 4CH4A 2KQXA 1C1XB 4B3SO 3AJAA 3OAAG 1NUAA 1JEQB 3WLJA 4MKZA 4XB1A 2PXAA 1M2WA 1CRZA 4Z1VA 2PS3A 4OQQA 5JRDS 3UKDA 1T13A 1ZQ1A 5KMGB 3NRCA 4FFBB 1FS0G 4BO7A 2DKOA 4Q05A 1TMKA 1GM9A 1SVMA 1GUZA 4RV5A 4QFDA 3IR7A 1TIBA 3ZXYA 1A95A 5LJIA 3E15A 4WK2B 4OQDA 2PGJA 9ATCA 5K3CA 4DHWA 3A4VA 3PJRA 2IP1A 2VF8A 4GHWA 4U6NA 3W05A 2J9RA 3L0BA 4RNCA 3C41J 4KLCA 2E4VA 3ECSA 1LR1A 2ZB7A 4CM4A 4QOFA 1EWYA 4DBLC 1GPUA 1U28C 1K0UA 2GYWA 4KFMA 1JFFB 1YZKA 3TKLA 2JG3A 1AN0A 2AKEA 1XGKA 3CZCA 2HP8A 1UWCA 4BXOB 4H31A 2PA3A 1OZHA 2ZAOA 4OX9O 4JQYA 2CUTA 1E2FA 3IR6A 5F5LA 5C37A 1VQ8V 3B6MA 4ND5A 1W52X 3QX9A 1ORRA 2FSPA 3A4YA 4NCJA 3VI4B 1ZN2A 2QV0A 1CUAA 5JC1A 4OUKX 5DTIA 2B1QA 1A5SB 4HGOA 2X3FA 3FCXA 4CIXA 4ZQIA 4DVJA 5AUNB 2HDOA 5B5SA 3NANA 3RTDA 3V8NA 5GJVC 1IZ0A 5LU8A 4KKXB 4JN6B 3EX7C 2NT4A 1U65A 2Y2VA 3HCNA 5JCOA 4EGAA 4PAGA 2JEUA 3SD7A 3UQZA 5BQXA 2Y1LA 2BFOA 1YGPA 2BKLA 2XIJA 2ACEA 3SBEA 3NTOA 2RB4A 1AF7A 1PJ3A 1ZINA 4UDOA 4C7BA 3PC2A 5IX8A 2X0KA 3AG5A 1GTSA 3R6TA 3L5KA 4NF2A 3EPJA 4PLPA 4FUQA 1O0BA 3BSYA 4BT7A 4XWOA 3LDEA 2YYYA 5EKTA 2JH9A 2X9NA 4ND1A 1GL3A 4FC6A 4WKCA 1F4LA 2QQFA 1PUJA 5J63A 4V1CB 2IYQA 1E3EA 2VPZA 3KYDB 3AMVA 2VTBA 2CCJA 5FIUA 4PR0A 5CCXA 4UB8Z 1WIWA 1YA4A 2JFXA 5ALEA 4DQDA 1Y5IA 3IA2A 3GJQA 3J81k 1J9GA 2J5RA 2IYEA 3HGMA 3FPSA 2C7VA 1NULA 4EY5A 1Q81W 3SYKA 3S55A 2CWWA 2V9CA 3SJUA 1XXHE 5JHGB 3WLKX 3RK4A 4YJDA 5BR1A 4OLBA 4ISBA 2ZUEA 1BDBA 3EBLA 4NR1A 1T8PA 2RHRA 3EZFA 4ZJYA 3H1GA 2ON6A 3OQIB 5HF6A 2D1FA 3O38A 3LPDA 3I2GA 1KAQA 3LCMA 1RXCA 1AILA 3G4SF 2J4FA 4I14A 4IZ6A 3CUTA 3MAAC 4M4SA 3LBFA 2G38A 3MDSA 2DQYA 1AB3A 4IH1A 2ORIA 3DBOB 1EIWA 4JGIA 4URFA 4DN6A 3B8MA 4BZPA 5K0JA 1V2HE 1MQAA 3DYIA 3UPDA 2A33A 3BGDA 3VU3A 1A9QA 1U6IA 4PX2A 1EXNA 3DF9A 2ZIGA 5E4YA 4MVJI 2PG3A 5TPZD 5KYUA 4Q0MA 3TM4A 3OZRA 1RXSA 2CLIB 4BVKA 2Z4RA 5G4UC 4QYIA 3V8RA 1GZHB 3TMKA 5H0IA 1YRLA 4P34A 4KDEA 2WT8A 2B5UA 2ZEJA 3U9TA 3W3AD 3HEBA 4JI4O 1JIXA 2Q68A 1G20A 2XWPA 3DNMA 1KVRA 3WTBA 1XMIA 4D4MA 4MRMA 4U8GA 1KORA 4Q66C 5KYWB 3LP5A 2OLEA 1J8DA 3TDKA 4TSKA 2IX3A 1CR0A 4OXYA 5H7XA 4H18A 3PQ4A 2C5AA 1CX9B 2WD9A 4BBPA 3PCTA 4GZLA 1LI4A 1HFWA 2RGNA 2EKDA 2Q1WA 3B9PA 3ORRA 2GBFA 5EMHA 1PM9A 4ZOAA 2C9OA 1II0A 2LIPA 1H0KA 2BZGA 3U4QB 3BE6A 3W3ZB 3L0PA 5B58C 4WNIA 4A9AA 1QUEA 5JU6A 3UJ8A 1COWA 3JWPA 4DV1B 4TWIA 5FA5A 4CUJA 1I0ZA 3JYOA 2L69A 3KVNA 3HFSA 3CLTC 1P9LA 1XNRO 1P44A 1I1QB 1GFWA 3M3PA 1C2TA 4ETNA 2R7AA 1OAOA 4O1HA 4ZO7A 3AIOA 1MJ5A 3HDHA 3FOZA 2A79B 5EWJB 1NS1A 3FB4A 2JJ8A 5L40A 4DR5O 2VJMA 1ZZEA 3MT7A 2IQQA 2IYLD 3BEOA 1PT6A 4ZTZB 2PUBA 2ZITA 1J1UA 1P1BA 4BT4A 1SVIA 3FFWA 3OKCA 3CRRA 3RWRD 1AK2A 3W6OA 4F04A 3IDQA 3D6AA 2YXBA 1U81A 3NJ4A 5DBFA 4A6PA 1NKSA 5G02A 3TZEA 3GVMA 2ZYRA 3IEUA 4REQA 4AQ7A 2GZHA 3WGLA 1PF7E 4RNDB 4EF6A 4EB6A 3D2BA 3IBCA 3DC7A 3VDNB 3CU5A 4DQ0A 3F2VA 3FOWA 1VP3A 4F6RA 2LW1A 4HJXA 3LL4A 3UK1A 4F2DA 2JDID 2ERXA 3A2FA 1OLUA 1V7ZA 2NADA 2UXDB 3PS9A 3KZ1E 3DWFA 3EEQA 2M2IA 3K04A 3WXBA 1QLEC 2JLYA 5BSEA 3T4UA 5IUKC 2WI8A 3FLBA 3KLPX 2YHIB 3ZBPA 2MINB 1E1CA 1SIUA 4Q4HA 4PYOA 1VLZA 2HWUA 3FIUA 1ECPA 4CZ2A 4F92B 5JARA 5CAEB 1WKVA 2DPGA 5DGTA 4BX8A 2JA2A 2GN1A 2QV7A 3BRSA 5TB5A 3NAMA 2WT9A 2P0AA 5EC2C 4LYDA 1IXMA 3KB6A 4PSAA 4TLEA 1Q50A 1HYEA 4CIDA 2FSIA 5F4ZA 3I39X 1C3EA 4XUDA 3ETQA 4XX0A 4G63A 1CQJA 1FX0B 2PXCA 3RGGA 1U7UA 3ZQ4A 3TIVA 4C7XA 5ALXA 3CCUF 4F2WA 2IYNA 3G23A 3DS8A 3C5WP 2VUTA 4XJSA 3BTOA 5I9BA 3N05A 2UZ0A 3VPDA 1TPZA 3EGVA 2JLSA 1R9GA 4TYNA 5SY4A 3C3TA 1E4OA 1F6WA 2XE7A 4EL5A 2BFWA 1AKNA 3S81A 4YVFA 3RSQA 2Y1FA 3DQQA 1W3EX 1M34E 1SMKA 4KP7A 1V16A 1XTKA 2XDQB 3UHPA 2BR3A 2O1WA 3NAGA 3KJJA 3F97A 2WSIA 5KVCA 1QP8A 2H4FA 1OWNA 4EA9A 3GT3A 3IHTA 3VZBA 1QBGA 2VHTA 1YBHA 3VO8A 2HJSA 3O47A 4B3FX 2J7PA 1Z4JA 3RROA 2Z30A 4YN3A 3E7PA 2YS8A 2C9MA 2ENWA 1P7WA 1S5PA 2BFCB 4C4YA 3PYMA 1NG1A 3NK6A 4Q18A 3C90A 1R10A 4IDHA 1TK9A 2X76A 4MUYA 1EUDA 2J45A 2P22C 4CXMA 1T2FA 2VTDA 4JXXA 3FYIB 1BU5A 1ZOPA 2YJZA 1XPRA 2ASVA 3U6KA 2VBIA 2BBOA 3NB0A 1COMA 5EZQA 3OX4A 3AEQB 3DE4X 2FWBA 3EBOA 4FLUA 2UYGA 2DWPA 3PGXA 2PX0A 3LD9A 4ACAA 4YRCA 2ZSJA 3BY6A 1VHJA 4TTQA 1DQPA 4JJZA 3WWOA 2IJGX 2L2QA 2VA8A 5JXJA 5E6SA 3AVVA 3LQ1A 2GEKA 4UTNA 3JQPA 4DMMA 4NNJA 1G9SA 3D36C 2UVQA 5IJWA 3QJYA 2NU8A 3ZWAA 4JWTA 2OTJF 2PUWA 3IQZA 3ILXA 4L8YA 2VSQA 1V11A 4N12A 2ST1A 3MSXA 1SD1A 1CY6A 5EGNA 2WU0A 2CLMB 4HVAA 1FTGA 2WTBA 3ET4A 4RVDA 1JP7A 3ZZTA 4NR0A 2H2HA 4NENA 4IO0A 2JLQA 1WZEA 1CF9A 2W6CX 3CCUV 5FNZA 3PEFA 1PP4A 4IJVA 3ZCRA 4BP3A 4CM9D 4J1QA 1M8JA 3AL2A 1V5EA 2QJOA 2BRUC 3F6BX 4J0FA 4MUHA 3PENA 1CLEA 3B53X 1RRGA 4GC5A 2GZ2A 2RKWA 4HNSA 3E9YA 3O3MB 4NI5A 4BV2A 4GPTA 5AKEA 5GVSA 1XEWX 5CH3A 2CDCA 1MMFB 2J09A 3PNPA 2FL4A 3QLVC 1WA8A 2QVLA 3AW9A 1TT5B 3AX6A 4TYWA 1SH7A 4P6VF 1P4SA 1SOMA 3INNA 5HKOA 4WN3A 1UC9A 2ZYDA 3BHNA 5A7HA 2AZ2A 4IG4A 2QVXX 2AE1A 1X4TA 4IYRA 4A36A 3RRBA 2OESA 3EPHA 5HZGA 4LTNA 4D2IA 1ZH4A 1P2TA 4CM8B 1JAHA 1JIJA 1YDGA 3SMQA 1LPMA 2IW1A 3QM1A 1E3WB 1NLUA 1I08A 5FTMA 3UCSC 4MA4A 1L9KA 2F55A 2AN1A 4PZUA 4TSFA 1K3EA 2AYZA 1M8KA 1XQYA 5KWJA 3ZV5A 2J46A 1S5HC 1CB0A 3GFQA 1K3UB 4RPHA 1H85A 1DCKA 4MV1A 3OW2U 5FPRA 1PX0A 3V7YA 1Y1TA 4Y6OA 3SYOA 3RSGA 3A2MA 2VQFO 1EVJA 2A5YB 3SXUA 3KWJA 5DHSA 2W4QA 1MKYA 2IU6A 1YRBA 1E2QA 3TZKA 2I4MA 4MDFA 1S2NA 1L3CA 2ZBGA 1YCFA 1QV7A 3NQ41 1Q6UA 1IBKB 1LA2A 5IYBO 5CW1A 3CCSF 2OCIA 4B0OA 4B82A 2WSBA 4FLYA 2GNAA 4BRUA 3O4GA 5FO0A 2VP5A 1MAAA 5K3DA 2R0QC 1W36D 2O2HA 4G4VA 1NQOA 2OTJV 3TBHA 1R0RE 1EM6A 3HL0A 2OQ2A 4B4OA 4US0R 2IDZA 2RCVA 3U0VA 1X7OA 3KCYA 1J0AA 3WBJA 2C5LA 3KJEA 5FOWA 3TXQA 2WNHA 4B3RB 2QK4A 1EK5A 4A91A 3AESA 3SXPA 4CG2A 5ALTA 1OBOA 4I3FA 4AI8A 1U04A 1B8NA 4IJUA 3EXIB 4BVAA 2W8BA 1UOQA 1ODJA 3TZBA 4MV5A 1E9DA 5IT4A 3HCDA 1EFHA 2FMKA 3KRTA 4EQZA 4I9GA 3I5UA 4B6SA 5CVEA 1YVUA 1AO3A 5JZVA 4JCOA 4L3WA 3T9EA 4S1NA 3KKEA 2VJCA 4G9EA 1AUOA 1P6QA 3DAHA 2B4TO 2JIZD 2EF0A 2V9ZA 1Z28A 3LZ6A 1BFDA 3BK2A 1Z7YA 3VNVA 2OHFA 1EFKA 1JI0A 1HEUA 4B75A 3E9DA 3OU7A 4ASUD 3FNEA 1FOEB 5BYBA 3DV0A