1JFFB

Refined structure of alpha-beta tubulin from zinc-induced sheets stabilized with taxol
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
426
structure length
426
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tubulin alpha chain
publication title Refined structure of alpha beta-tubulin at 3.5 A resolution.
pubmed doi rcsb
molecule tags Structural protein
total genus 113
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2001-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1jffB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1jffB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1jffB01
3ZBPA 4ZI7A 4O4LB 5LA6B 4YJ2A 1TVKA 2RHOA 5CA1B 5M7EA 3WGMA 5BMVB 3JAKB 4I4TB 4IIJB 3E22B 1RLUA 3VOBA 5CA0A 3RB8A 3RYCA 5C8YA 4TUYA 3JATA 5LP6A 4TV9B 3HKCA 5J2UB 3RYFA 4TV8A 5KMGB 4I55B 3JASA 5MN5A 2XKAA 3C8LA 5EZYB 5JH7A 5JQGB 4DRXB 5CA1A 4B45A 2BTQB 1FFXB 5BMVA 1JFFB 3JAKA 4X1IB 4I4TA 4IIJA 4LNUB 3E22A 1W5EA 4KWEA 5J2TA 4TV9A 3ZIDA 3N2KB 5KMGA 4I55A 3WGLA 1TUBB 3WGNA 5EZYA 2VAPA 4XCQA 4O4HB 4DRXA 2BTOA 3CB2A 1Z5VA 3JALB 5LP6C 5IJ9B 5IYZB 2R751 4YJ3B 2BTQA 1FFXA 5EYPB 1JFFA 4X1IA 4EB6B 1RQ2A 4E6EA 5JCOC 4LNUA 3RYIA 4WBNB 3UT5B 4U3JB 4O4LA 5LA6A 3JARB 1W5BA 4ZOLB 5KX5B 3N2KA 2R6R1 4M8IA 4FFBB 4I50B 1TUBA 3HKEB 5ITZB 1SA0B 4DXDA 4O2AB 4U39A 4X20B 3JALA 5IYZA 5IJ9A 4IHJB 2GVIA 4O2BB 4YJ3A 5JCOA 3WGJA 5EIBC 5J2UA 5IJ0B 4EB6A 5LYJB 5GONB 5FNVB 4WBNA 1RQ7A 1OFUA 3UT5A 3VOAA 4EI8A 4YJ2B 5JQGA 3JAWB 1TVKB 4U3JA 4X1KB 3R4VA 3ZBQA 4ZOLA 5KX5A 1W5FA 3WGKA 4EI7A 4ZHQB 4FFBA 4I50A 4HNAB 2Q1YA 3HKEA 3HKBB 5ITZA 1SA0A 4O2AA 4X1YB 4F6RB 3V3TA 4IHJA 5CB4B 2XKBA 3RYHB 3HKDB 4TV8B 5LOVB 5MN4A 5IJ0A 2RHHA 5LYJA 5LXTB 5GONA 5FNVA 1FSZA 4O4IB 4O4JB 5JVDB 4O4HA 3JAWA 4X1KA 5EIBD 4ZHQA 4HNAA 3VO8A 4B46A 3HKBA 3N2GB 5EYPA 3M89A 3VPAA 4X1YA 4F6RA 5CB4A 5J2TB 3RYHA 4ZI7B 1W5AA 2RHJA 3HKDA 3JARA 5LOVA 5LXTA 3VO9A 1W581 3M8KA 4O4JA 4O4IA 5JVDA 5CA0B 2VAMA 4X20A 5C8YB 4TUYB 3JATB 5LP6B 3RYCB 2VAWA 4O2BA 3HKCB 3RYFB 1W59A 2RHLA 2VXYA 2Q1XA 3N2GA 4EI9A 3JASB 1Z5WA 5MN6A 3RYIB 5JH7B
chains in the Genus database with same CATH superfamily
1G3IA 4QEDA 1G5QA 2YRFA 4BV8A 2YIJA 2KM1A 1ESDA 2DULA 1X42A 3CSDA 4UU7A 1YR3A 4KUGA 2PKXA 3LJKA 4R5MA 1KMMA 1V5WA 1TQHA 4O8ZA 2OZVA 4LFCB 4B3SB 2Q99A 1JG7A 3BD7A 5DLDA 1R9MA 2MMCA 3TE6A 4FFSA 2MHCA 1YDFA 2HA0A 2ECPA 2HJWA 1N2ZA 5DNCA 3K3WA 5B7GA 5HYVA 2GM3A 3FD6A 4AC9A 5L9AA 1GPUA 1R6KA 3UATA 3NTRA 4Q3BA 1ZVMA 3JX9A 3MRSA 4MQBA 1XD2A 4B3CA 3D7KA 1YQDA 3MUEA 2QN8A 1Q7CA 2VNKA 1ZPDA 1AZLA 1MC1A 4I4CA 2VZLA 4ZI2A 1COMA 1IOVA 4JROA 3II6X 3JQAA 1ZA1A 3DMGA 3AF6A 3IDZA 4JLPA 2X9QA 2HSDA 5DB4A 2ZTSA 3ZXIA 5FWDA 3B7WA 4BFCA 1K7CA 1N8KA 1EI9A 2EJVA 2LD4A 3BF7A 4Y1GA 2BONA 4L02A 4J0IA 2LXNA 3T1CA 4BZXA 2DSTA 3PE4A 4G4SO 2IYLD 3ZWKA 1B04A 4FFLA 1TRHA 1EM1A 4F4IA 3PIIA 5BXZA 5B1AC 4PYRA 3MINA 4JBXA 4UMVA 5HCNA 2YXNA 2FXVA 4IZIA 3O1IC 2LIVA 2Q49A 5AVSA 1MOZA 1WZUA 2I7XA 2O52A 4JQYA 2Q0AA 4HMQA 1JH8A 1ML3A 4C82A 3PX7A 5CNKA 1IN8A 4KP4A 4KK4A 4MIEA 3LIPA 3G2IA 1V1MB 1DJOA 2EZ9A 1WN7A 3TYXA 1XPUA 2ZULA 3ZP4A 2Q6IA 5EB1B 1QAMA 1MO3A 3BL5A 4W4KA 1OBOA 3NBMA 2JJ8A 4QO8A 4PYMA 2GX6A 1MVOA 2P3SA 4BIIA 1HFEL 3BGSA 5BNFA 1K5DA 3SYAA 2FE1A 2WLNA 3AG1B 2CUGA 1T5DX 3B3AA 3NHWA 4JWKA 1V16A 1PFVA 2NO6A 4OBEA 5E9QA 3HKBB 3QX9A 2AFHA 5ICGA 3J7AC 2G1KA 2O8VA 2ATCA 4NARA 1XRRA 3I53A 4K6KA 1JMKC 5DYGA 3X43A 3BFJA 4KXLA 1GMGA 2ZJ3A 3FB4A 2C5SA 4ZEXA 2QI9C 4Z1VA 2OCHA 3RASA 3JVEA 3FYUC 1TGVA 1FFYA 3DTVB 3KELA 1SEVA 3CCMF 1J2UA 3VPDA 4AIIA 4QWWA 1SBCA 1MJ5A 3IGAC 5ICSA 3TTTA 3WLAA 2IEAA 2AEEA 1XXHA 2CV2A 4NFHA 1YO6A 3OM3B 2GJSA 2VDNB 2VTEA 5K8CA 2H3OA 1FP4B 2JS7A 5C37A 2EP5A 2BBOA 3FM9A 4YJ3B 1RJWA 1K2VN 2VCHA 1T4CA 1IJFA 1JDZA 3L7JA 4DV7O 3K4HA 4PQGA 2BEWB 4BNUA 2JHCA 5I9MA 4XGNA 2JF0A 4HQFA 5IJ0B 3GEDA 3SYTA 5JALA 1GN9A 3D7LA 3VJRA 1WETA 3UQ8A 3PQDA 4BVKA 1WPQA 3Q1LA 2IXFA 1RBQA 1M6EX 2J3EA 2GZDA 2GK6A 1CZKA 1XDCA 3FNGA 1K06A 4DLUA 4J10A 4RF3A 4BVTA 1GQOA 4EY7A 4M0LA 1QRUA 1C3EA 2QNBA 1NVKA 3QFFA 3Q0TA 3HDJA 1N6OA 4LEIA 3OZXA 3FOBA 2PK3A 5DCLA 1E77A 1J56A 3NEYA 1EP3B 2YQ5A 2VHEA 1E4YA 3AUTA 4LOAA 1U97A 2D5IA 5EUQB 4H1HA 3HJUA 4OXRA 4JYCA 3H2KA 2F3UA 4DA6A 1PR2A 4DR1O 2CJWA 1BGWA 3WKDA 1ZH2A 4B3RB 2HPZA 4BEVA 4XRRA 4U2FA 2XUDA 3EZ6A 4CG3A 4U7NA 5EIBC 3F9CA 4J0HA 1HSZA 1SOWA 3RT3C 4YCCA 3EQ7A 1QAOA 3FYIB 2E6UX 3E7DA 2RNBA 3K5NA 2JIZD 2YZGA 3UHPA 1WXGA 3TBHA 3CLTC 5DW3A 3T9AA 3UV7A 2RGAA 2OD7A 3QKIA 2A67A 1NVXQ 1EWYA 5LQNA 4EF5A 3SSNA 1V4NA 1EK6A 1SJ9A 4ZYYA 3O8DA 2VUUA 2NWQA 3HVIA 2O2HA 2Q3JA 4XR9A 3VPXA 3JQ6A 4EPRA 4L4YA 3TGWA 2P9QA 3EXIA 3RS5A 2JH9A 4D4LA 4BPRA 3HWX1 3HJHA 1UFKA 3W1WA 2HK6A 4WZAE 4WKOA 2GV9A 4KIJA 1R3KC 4GOJA 4XUEA 5C1IA 1HC7A 4BVRA 1WP8A 1WA8A 4ND7A 1T0KB 2CAZC 5HK9A 2XCSB 1J7JA 2BEUB 4MAFA 3KSBC 4TWKA 5E3IA 2H2GA 2VUHB 1ZMTA 4WNCA 1P4JA 4IUBS 4PZYA 1J2RA 4FFBA 2C03A 1WZCA 1I2BA 1H8ED 4EEZA 1VQOF 3R66A 5U4QA 2C97A 1JKJB 4F6EA 5ALLA 4U2BA 2HXGA 3LU1A 3D2BA 4Q3KA 3UB3A 5DYIA 3QPUA 1X1BA 1HR0B 1LB1B 4B44A 3E70C 3I92A 1HG0A 4XEHA 2VAWA 2JVKA 1Q3KA 2GM9A 4II2A 2GUZB 3CJHA 2MYUA 3WJ2A 1Y4UA 5BR7A 1H1DA 2JA2A 3B8EA 4TV9B 5JDCC 1ULBA 1JBEA 1ZNWA 4BLVA 3LQ2A 3T3HA 1XUOA 4IJ5A 3DZCA 3ORSA 2CEKA 4I6JA 2YJGA 4KHPO 3ZOZA 3K5PA 1HLGA 3D8BA 1L1RA 1P2FA 4ZRNA 1UP7A 2R62A 3OY2A 2PUCA 2AW3A 1FXUA 4PAQA 4C3ZA 1XBTA 3HY3A 3PCTA 1BYUA 1OILA 5IF3A 5DTMA 5C1DA 2C61A 3F98A 1WB8A 3NAZA 3U7FB 2H31A 3FR7A 3VR3D 3FOWA 4NJMB 3D36C 2NAPA 1TMKA 4HJRA 2MSKA 1M1NB 4PAMA 3VH2A 4C4YA 1R4NA 5K0LA 3QW2A 1Z3CA 1ZICA 2MW2B 3EHBB 4CGZA 3N6RA 1JKFA 4GMGA 4QD3A 5EPEA 3TXYA 2R0QC 4NBRA 4OV6B 2WAAA 1Z2AA 2ZW9A 3QW4B 4PPQA 3C3BA 3CJTA 4MWCA 4E2ZA 3FFAA 2JJQA 4ZP1A 1WE2A 5HF9A 5DM70 4C6TA 3IBYA 5KKAA 2BFFB 4DBVO 4M8LA 4H3VA 4L0QA 1C3XA 5ETJA 1YTLA 3GLFE 2H1IA 3PWTA 3HA2A 1EFCA 4NK4A 1HZZC 1FJ2A 3IAS1 3CCCA 2QK4A 3M1YA 5MFZA 3T5PA 1PEYA 1JLHA 2Y3IA 1YQWA 1R0BA 3LUDA 1FDRA 3LPNA 3G4SF 1IUNA 2HV8A 3HCRA 3AV3A 2JPDA 4PSVA 5JCJD 2C54A 1KYYA 2P35A 2RBKA 2VJQA 1AQIA 3QHDA 1JT9A 4NUTA 3QVMA 4KQGA 4IGEA 3WLNA 2WUGA 3HYCA 3D3IA 1CV2A 4QNMA 1OCRC 4X60A 5H80A 2AFHE 2VF7A 3TTUA 3ACCA 5KBYA 3R65A 4QNRA 5EWMB 2ZUBA 3EA4A 3K06A 4QUHA 4F71A 4LZPA 2R8BA 2BTEA 3L46A 2PT7A 5EA2A 5K3EA 3GJQA 2NU9A 4IDAA 1V8OA 1R6NA 3FCEA 3WL5A 5FH9A 5F33A 4X1OA 3DAHA 3KKMA 1B0ZA 5KSYA 1P0CA 5SY4A 5K8UA 4HFRA 2MTBA 1XXHE 2VVTA 3DEKA 3WGKA 3TTSA 1A5BB 1PLLA 1WDLA 2ENUA 3AFNA 4OD0A 5EHQA 4C43A 1X7ZA 4I0XA 2PPVA 1IY1A 4OAQA 5B2FA 3MHHC 1VKNA 4WL0A 3LYBA 3RVYA 4EBFA 1WUKS 2I33A 4YV7A 3DE1X 2Y1LA 1MTZA 4IG4A 3U56A 4JYAB 3TBKA 3I12A 3O4FA 5AJXA 5C5CA 3ZGVA 3M1XA 4XVUA 1YZHA 1GVHA 3DGEC 3AEYA 1QMGA 1OYOA 3OUUA 1RIFA 2AR0A 4GP9A 4UE6A 2I66A 4OHXA 2QTWB 1V48A 1Q74A 3LMEA 5IC4A 3HFSA 3UUWA 1N2XA 1UWKA 2C5AA 3PUJA 2G6TA 1XCLA 3DZFA 3RW9A 1HKUA 1NI4B 3UJ7A 2AN1A 1Z4LA 2FGJA 4MWGA 3EFEA 4EPWA 2D1YA 4KGVA 4V03A 3QXCA 2V6GA 1ZMOA 2JD0A 1KJNA 3OT1A 2B2XA 1ZEMA 4JI8O 3OMAB 5KYWB 1T0UA 2HP8A 4HZ3A 5FKJA 3QO5A 1U8XX 1GPNA 4U2CA 2CLHB 2V98A 3TLKA 2IP4A 4Z4IA 3VQYA 3T7RA 4URHA 3D1LA 1UZUA 3KCQA 2ZRLA 1ZGCA 5FWYA 2Q67A 4FXPA 1W4LA 5A5FA 3MRTA 3LUBA 3M34A 3RCBA 2J08A 4G4YA 4O5OA 4NYIQ 2B7LA 2NUAA 2GCPA 1AA6A 3GLQA 5FL7D 3BWDD 1XZQA 2DFDA 1Q2UA 3CYPB 3KCYA 2ZTVA 4A1OA 4K6CA 1JG6A 1Z39A 3KD2A 3L07A 2WIGA 4GI2A 4BE9A 4B81A 3JQRA 4FIZA 2QZJA 1G63A 1GTOA 1I10A 5L3VA 2YMQA 2AKEA 3KDAA 3M2TA 3AW9A 5KMGA 4QXMA 2LBWA 3MIZA 4NESA 2NSYA 4TYQA 3T5MA 4QQNA 1V5IA 3K0BA 4XIYA 2VJCA 5EWLA 4JJIA 3I5AA 4I5EA 2ZBDA 4IHJB 1QLNA 3VOAA 4YUVA 5BN4B 3QI7A 4UU8A 2VP4A 2RGUA 3SJUA 4F60A 2C82A 1ZH4A 5BOSB 1VI6A 4JP3A 3IR5A 4JU9A 1JMYA 3SDBA 3QUSA 3GCZA 4K05A 1XSEA 3D3JA 5EYPA 1U0JA 3UPUA 5IXYA 3KVRA 3QOWA 1L5GB 3K31A 3K9QO 4XGIA 1OHHA 2WJZB 3RH0A 3RG2A 1QX3A 5CDYA 2F6RA 2F59A 4MR7A 4W5JA 3O8OB 1O4WA 4MWOA 3I05A 4HGPA 1YJ9V 5K3BA 3P2OA 3E3OA 3C74A 2CB9A 2IQQA 4RADA 4CKBA 3S8YA 4ND8A 5LMNB 1HETA 1MDFA 2P4VA 4QGSA 4JP5A 3JARB 2PRYA 1L7BA 5MHTA 2BHLA 3CCLF 4Q01A 1ZUD1 2IIPA 5A62A 1QGUA 1MJNA 4PCLA 1SU6A 4C04A 4GX0A 1U2ZA 2BE7A 3RSSA 1FXVA 2BUBA 2AW5A 1U7ZA 1IBKB 3QWHA 1EN6A 3L72H 2VPTA 4TT3A 2GBOA 3X3HA 4A9AA 3DLIA 1U4NA 3MHSC 3FW1A 4MX8A 4TZKA 1L5HA 4GAEA 2NSHA 3AEQB 3U7QA 1QVZA 5KVSA 4AG5A 3NB0A 4CIVA 3U7EB 3K6SA 1RZ3A 2QEQA 3QVSA 2AZXA 1BXZA 2DQZA 1KEEA 5IYBO 2YIDA 1XTUA 1GUAA 3ELDA 3ZW7A 3FZYA 2NIPA 1H2GA 1QVFU 1N5RA 1JHRA 4N0EA 4YBZA 4I4TA 3JQFC 2EZUA 1Z6ZA 1DBFA 5JG7A 3PFFA 2JIPA 2MSDB 3KBOA 1RMQA 5HJ7A 1RHUA 1W8DA 3ABZA 2WSSA 3RSOA 4MUGA 2EATA 4I3GA 5CBKA 1MZVA 4EELA 5FB3A 4O3MA 3V8QA 5BSKA 1IXRC 3F5MA 3REFA 4C2AA 2A94A 1TQDA 4RHXA 1B23P 3VI6A 3EZNA 2TMKA 5DWQA 2G06A 2QPOA 3OPNA 1AKMA 3ZN2A 4NQ3A 1T10A 3CR3C 1DC7A 3AUYA 3HN2A 3CX6A 3UXYA 4S0XA 2IOFK 2QVGA 1GZ5A 2XZTA 1XEWX 5EXTA 4UU1A 4EQ6A 2Z57A 2YRWA 2NUPA 1RM0A 1KWGA 4NONA 2XI4A 3UXHA 1PWYE 4IGGA 1L0NH 3KZKA 4IUYA 2G76A 3E9RA 2FPGA 4JD5A 1EMDA 3FKJA 3EBPA 4JEIA 1S7CA 3BA9A 2P6RA 3P96A 4C7BA 1Y34E 4D8VA 3VRHA 3OC0A 4DPMA 1P4SA 2W58A 4BS9A 4NU0A 1WDTA 5LUAA 3QELA 4JI0O 1ODFA 4JI4B 4JZKA 1SULA 2VWGA 4CEHA 3LPDA 5KDLA 4BGEA 5FFNA 2B35A 4IJWA 3SKXA 1XIVA 2H2WA 5K01A 1PSWA 4Q00A 1BOOA 4D46A 4CW7A 5EZQA 5LBIA 4UBNA 4U9UA 1AURA 1EGVB 5AVOA 2B0CA 3E1GA 4UBKA 4ZRDA 4QBFA 3EAGA 4UHCA 5LP6C 3KZXA 5K0BA 1SCDA 2AVDA 2PX0A 3H17A 3IDQA 4MO2A 4KV9A 5IPFA 3K0TA 4MV4A 1F2UB 2CLOB 3S68A 5FL7A 4YRQA 2YXPX 3FHLA 1MT0A 3U62A 3WJQA 1NLUA 3EA5A 4QICA 1Q84A 2FFHA 4H3KB 4CIAA 3Q7IA 4BO5A 2CHQA 4GM1A 4YJ2F 3BQNB 2NQ2C 4JUDX 1KI6A 1U0FA 2P4KA 2HMTA 3RTDA 3B5IA 2YFKA 2CC2A 2DBZA 1YS9A 3GEPA 3NBXX 3ZK9A 4GL2A 2QKAA 3AZPA 4QQKA 1I14A 4LSZA 2XGOA 3KP1A 1XVVA 3ETCA 3QE9Y 1DZ3A 1FUEA 1Z63A 3WLEA 1UJ5A 5C8YB 4NEHB 4R7ZA 2XR1A 3B8MA 1T6BY 1TCCA 1X8XA 2ERYA 2IW3A 3GBPA 1AZSC 3ELUA 3O2SB 2C7RA 3BE6A 1FMCA 1R00A 1NQTA 2HCTA 3CLKA 3ON5A 1Q1NA 2ZWAA 2WC1A 5T7BA 3RSQA 5DASA 2Q8NA 4YJHB 1QO9A 1Y5NA 2QPAA 1S01A 1THTA 4K0RA 1TZMA 1Y8AA 2QSJA 3IVGA 3ISJA 2V1UA 2Q5QA 3DYVA 1HSOA 3NDIA 4PONA 1PNLA 2GLZA 3GFBA 3P8ZA 3GV0A 5IFKA 1KU6A 3QUCA 1WBBA 1NMYA 3TCUA 2NAFA 3OQIA 2K87A 1D4FA 2IUTA 2W0XA 1SHZA 4LMBA 2WIJA 4NDAA 5B53A 5COBA 3L0ZA 4MI9A 2FYUH 3NANA 1M6WA 4X71A 4XB2A 1N8RW 5FP0A 2QUJA 2VRNA 4FC7A 2OWEA 1E63A 4B4UA 3PNLA 4L16A 4MIKA 1IV3A 3YASA 4DVJA 4LPKA 4N49A 2IDZA 3DKVA 3X2SA 5FEUA 1JXQA 1GDDA 3D00A 4XA8A 4MVRA 3OMLA 4H6VA 2JJ1G 3BXPA 3RWBA 5IVDA 5BWOA 2IU3A 1VYVA 4PPYA 1RI4A 1NJ5A 3HO1A 3LZDA 4I14A 4DV2O 3GL9A 2IYYA 2QYOA 2PJUA 5FBLB 4MW5A 4JX8A 3HCNA 1ZGZA 2VQFO 1YOBA 4HATA 1EUZA 3QOYA 2G71A 1PW5A 2DJVA 3BD6A 1DT3A 2NYUA 3VNSA 2G07A 1NRWA 2LZ0A 1RM3A 5FUQA 3CJQA 4J1QA 2BHNA 1NF3A 5C31A 2Y2UA 1SVKA 1ZA2A 2O2EA 5FBRB 1UF9A 2XADA 3PXEA 3TRKA 3VPAA 2YASA 1U9YA 3IOMA 3HDVA 3H19A 3KDPA 1QHEA 3BWCA 1HE5A 1YFJA 1LX7A 1ZBDA 4CR8A 3ZJ5A 4ANFA 5BV7A 4M2LA 3HKCB 1N6RA 4DN6A 1JWAB 2Y1XA 5KSWB 4PO8A 3ZD8A 4JIGA 1FJHA 4TVSA 1N1MA 2BHSA 4C0SA 3CCJF 3JATA 2VP0A 2DM6A 4MEAA 3I58A 3KD3A 4I55B 5LDHA 1ISRA 4AMVA 2FR1A 2XNDG 1IEXA 4H1UA 4EB3A 2IPAB 4LHEA 3X1YA 1LI4A 3TKAA 1HUQA 3SLGA 3GDGA 3CCEF 2BDTA 1M0TA 1EEXB 3I5XA 1H48A 3N74A 2MYPA 1KUQA 3V00A 1ZM4A 1MQ8B 3ZRWA 2UVPA 1KGSA 3K0KA 5JLJA 2RC6A 3DO8A 4PIVA 2UYJA 5JNSA 2FX3A 3TI7A 1UMBB 1H6BA 3FUXA 5EB0A 4MRMB 5C32A 4LP8A 4UHHA 4L9SA 4LK2A 4ENUA 3LWNA 5IT0A 1DBQA 1L9XA 1I6KA 4RQOA 2ZJZA 3RF7A 1R5OA 2E6KA 4GKJB 4FDLA 3E2MA 3I1FA 4R51A 1KQPA 3N87A 3CVOA 2YV3A 3LWDA 2YTZA 3CZ9A 2UZ1B 5DPMA 3DLCA 1BVYF 4YASA 1E0AA 3A25A 4BL5A 3KR0A 2G88A 2H8KA 5EIFA 1NPDA 1ZAKA 5I8WA 4LF7B 3I9V1 2L82A 2QV7A 5T4HA 4H2DA 5LZ5A 1YDEA 5BWBA 3AGKA 3ESXA 4FHCA 4ZV9A 3GN2A 1OXVA 1HH4A 2YCLA 5AJHA 4DIMA 3WVNA 3BL8A 2BMDA 1K8ZB 1F2TB 3E27A 2VF5X 3UMGA 4EFLA 5CA0F 3CF0A 4G0OA 4FLTA 3CQ9A 4BQSA 4ZVSA 1QIMA 4OK3A 4B8ZA 3AILA 5DT9A 1DWUA 2CK3G 3LOQA 3ONVA 3HADA 3G0HA 4MROA 4FKMA 2D3TA 5IAGA 1EBUA 5DECA 1JMVA 3THXB 1H1TA 3ZXXA 2B5OA 1VJTA 1ZFNA 3VYTC 1E1CB 1J99A 4DDMA 1JEEA 2RBEA 5IE9A 3I2KA 4RK5A 2E48A 4F91B 1P2BA 4FK5C 5L7WA 4BLOA 4QPCA 5B55A 5KC8A 1WCIB 5HJ2A 4R9NA 4KRXA 1X52A 5BNZA 2V7EA 3QGMA 3LC2O 1HDXA 2ZGVA 2WDZA 1W1UA 5FBWB 2ZR7A 3ICCA 4Q9NA 2HS4A 1Q1AA 1JIUA 1Y89A 2JVIA 3ZR4B 2VUTA 2ZU6A 3CM0A 2QZSA 1A2QA 4Q3EA 4EYQA 1YAJA 5GY7A 3B70A 4AF6A 3QY0A 4R68A 2EHDA 4FZRA 2JNBA 3KWJA 3FJOA 1X94A 4FN5A 1XEQA 3QSYA 4FGJA 1KFCB 3O38A 4OGLA 3UJ9A 3TW8A 4PGFA 1ECFA 3CPSA 3PK0A 4ER3A 3L6CA 5I8PA 2QF7A 1DEKA 3OIVA 4FYJA 3D02A 4HQ6A 3JTEA 1JEAA 4UFZA 1FCJA 3AX6A 1JDTA 4K3VA 2QWNB 1Z68A 1OVMA 1SC3A 3GZTB 2LW1A 2QX9A 1KOFA 1AN9A 3TKLA 4BVLA 1RYEA 2BRUC 1GY8A 1RRVA 2WF8A 2D1RA 4YECA 3CUUA 1PD3A 3WICA 4K87A 3ABLC 1P7GA 4BT5A 2E87A 3BGWA 2Z3ZA 1KOJA 3OE7D 5IDYA 1QIJA 1SZDA 3PPVA 5JAZA 3PLAC 3TO5A 3LPAA 2VTVA 4CM6A 4U00A 4G88A 4TQ9A 2FC3A 3ENKA 3ACBA 2QNRA 2PAAA 2DBYA 1XNRO 2DTEA 1UAYA 1ID8A 3NT4A 2K6GA 5AI8A 2QG9A 1F4PA 1HNWO 3ETJA 2C77A 4IJKA 3CPWF 4IFEA 1OVGA 1Z2EA 4QYMA 3U09A 1EFTA 4HKTA 3W2TA 1QK4A 2R9AA 2MT9A 2CFCA 1G18A 2FRVA 4CU2A 2O0MA 3ON1A 3NW9A 2H07A 1CQJA 2TMDA 1AHHA 5C7IO 4XM2A 2EINB 4PTLA 4LISA 1SUBA 3KQOA 4BGIA 2EX4A 1DKMA 3EK2A 1C3JA 5ALDA 1KO1A 3VH3A 1EDDA 3FWNA 5KOIA 1OFVA 4B6JA 3K73O 1Y7HA 2GNOA 1D7OA 2AMVA 3WNCA 4ZYUA 5M3BA 2SECE 1I3CA 3H9VA 2WJ4A 4NFSA 2ZRAA 3GK3A 4E07A 3KZVA 5HGXA 4MW3A 1YD7A 1U04A 4FWTA 1XGKA 3QG5A 2LTAA 5FQNA 3BTSA 2XOXA 5K0NA 3ZVNA 5GJWC 4MGHA 1CQIB 5C7YA 1Y80A 1JBKA 3V8EA 4CMAA 5FAKA 3B6EA 3A14A 3C85A 3C5WP 3I3OA 3CVWA 1UXOA 1PGOA 3KL4A 1BJRE 2JDIG 5BVHA 3DZ8A 4PWZA 3MS4A 1NV8A 3RUDA 3FX7A 1UMCA 4IHKA 4L15A 1XRSB 3QTCA 1GN8A 1VG8A 3W5HA 3WNBA 2EX3A 4LFCO 2J85A 4B3SO 1J9GA 1R6VA 3BG5A 5EJ6A 3WISA 2ODQA 4MWSA 3MHTA 1W4RA 1Q0RA 4B48A 4QO7A 1VG9B 1IY0A 2FWRA 3STXA 4D9GA 4YRLA 1QGYA 2EULA 2PZJA 3B8NA 1F8GA 6YASA 1BD4A 2R86A 3LE8A 2EXXA 3WHKA 2WALA 3CU5A 1E8MA 2PEZA 4N3AA 1VHTA 4I19A 4TXNA 3IUSA 4DR2B 3KR9A 4WNYA 2JKYA 3GN1A 4KE9A 3NDBB 3BYQA 3GJXC 1RYZA 3O31A 4I9QA 1I1NA 3NR2A 1XLTA 3GOHA 3LQFA 4G07A 4ZOLA 1VE9A 3U81A 5DI9A 1DLJA 1VQ9F 3ZV4A 2CLEB 1RBZA 2OZKA 1BT8A 2NXJA 4G1CA 1NN5A 1VCHA 2I6GA 4QRIA 4HB4A 4PNEA 3PQFA 1BJKA 4RWUA 2CNLA 1HNXB 3SHOA 3R41A 2Z8XA 2QB5A 2JGKA 4CMCA 1OASA 4OKSA 2Z8YM 4EDHA 4Z3KA 1PEDA 1IURA 2C2KA 2IYRA 1E4EA 3DMRA 4GF5A 2DZDA 3K6KA 5JJEB 2QQEA 4H7FA 2ZPAA 3RVKA 3LVRE 1V41E 2ALJA 2AZ2A 4AY5A 1G64A 3VI3B 3AM4A 5HY2A 3VSCA 1J4AA 1EQ2A 4BYMA 3STTA 2BOBC 1N36O 3URKA 2JH8A 4RV5A 4EEQA 5FPKA 3ZG6A 1VRCA 1XWIA 2GHIA 4G36A 2BZ0A 3OZVA 2O7SA 1KVUA 2Q1YA 1CERA 1KAEA 3GTZA 3HWUA 1F51A 2MINA 2Q4BA 2MSNA 3O3OB 3V8NA 4DIUA 3WK6A 1JQKA 1AS2A 4B7UA 4QFDA 4WVFA 3RU9A 1U96A 3RNOA 5C1OA 1ISIA 3BH0A 5EXEA 3T4XA 3ZCXA 3S0HA 3HTXA 2Q3BA 3NHPA 4KH1A 1RM1C 2FN9A 1N0VC 2OD2A 1J1UA 1YZLA 3SYLA 3LXRA 1VJ1A 4IV0A 4M0CA 4J42A 3K9SA 4MICA 2DWEC 4B85A 3AG3B 4LJSA 2VHZA 5AM3A 1Z0JA 2J5XA 4HQNA 1U9ZA 1P39A 3OE7A 4X64B 4Y6PA 3R3SA 1QTIA 1VFNA 4OEHA 2G25A 3UT5B 2PWAA 2OCAA 3AEIA 4KE7A 2O05A 2UUCB 1IPFA 1T9GS 2GCOA 4FR2A 1YDWA 2UYGA 3IA2A 4OBWA 3IKTA 3TQTA 2C4VA 3QFSA 3HPQA 3OH8A 5HDQA 3ITDA 4KO3S 3ABTA 1DIAA 3C3TA 3DBHA 1UBGA 5TMBA 1KYZA 1EGAA 5D86A 3FJ1A 4OYRA 4BB9A 4D0SA 1C8KA 4K3AA 2BYTA 5K3DA 5CB4A 1TAHA 2EHJA 2I6RA 1IZ8A 4P34A 1T0HB 3LUJA 3QSGA 5AVZA 1R74A 3TPCA 2IHBA 4F93B 4LOJA 2ZRGA 3R7WA 3W6UA 4DK1A 2JRCA 3R20A 2XZLA 3OE5A 1HRKA 4KO2S 4DHWA 3GRFA 3VZCA 4NV0A 4MV3A 3OZIA 1PAUA 4N12A 1KIAA 3HLYA 2PUVA 1GM5A 1M74A 3OTHA 3DYIA 1HGXA 3LSUA 4YMIA 2VCEA 5ADUS 5BR8B 2FPOA 4TYYA 3QBJA 4EUNA 5A3QA 1R4MB 4DLSA 2UYNB 3W4KA 2AC2A 4CT5A 5HG0A 3TSOA 5AVVA 3LXXA 4PYOA 4CMEA 4FNMA 1A7JA 3ZKWB 3IDSA 1DJMA 3N3AC 4ZCLA 3HUDA 1Y4MA 2YXZA 2IH1C 2Y99A 4D9MA 3FSRA 1JGTA 1R64A 3T9EA 2YHBA 1X86B 1P0MA 1AB3A 2AHZA 2Y9MB 4B3RO 2YJ6A 3TLGB 2BKVA 5B1BC 1M93A 3KOYA 3MA0A 2FGKA 3H5OA 1W6RA 3PXBA 3HBFA 4XQEA 1B2RA 2E3CA 2UYHA 1EXDA 1CY6A 2GN1A 2Z1TA 2ES4A 3OOSA 3RHZA 5C4MA 5ALMA 1Y4ZA 2NU6B 5DMHA 2ETNA 3PUZA 5ARDA 4BVAA 3V8MA 4R0MA 2BVNA 3C3CA 2RGGA 3Q8LA 1K4KA 1YZFA 3TX6A 3N70A 5L3SA 4MS1A 3BDIA 4LZOA 1XTIA 3E89A 3EUAA 3HV2A 1A71A 6REQA 2XAHA 2AN3A 3CRRA 1QVGU 3H42B 3TLYA 4C01A 5B2EA 4P9NA 4WZAA 3VOTA 5I45A 3O8LA 1ZCFA 4ZAVA 5C81A 3GUHA 1AUXA 5LIPA 5IJAA 2D5AA 3VJMA 1P6XA 3L4EA 4EA8A 1L5QA 2BELA 4O6VA 4LF9O 4X9QA 2ZSBA 2VP2A 4EJ2A 5JJBA 3EMVA 2HV9A 4YJ2A 2E4ZA 5J9PC 3RTEA 3F7TA 3TRFA 3DSRA 3E8HA 2Y8EA 2I5PO 4HQOA 1QYDA 4W6QA 5D5PA 2N9UA 1FLNA 3F2IA 3E7PA 4M87A 1USUA 2ZKIA 4FGSA 3EYWA 1RYYA 4QOHA 2HQ1A 4DRXA 3GHHA 3K5LA 4FZVA 2ZS8A 3U3RA 3VVLA 1JZTA 3JWGA 3UJHA 1Q7BA 1U94A 1C0KA 4RX1A 3B9RA 1F0NA 3PJFA 4EO7A 4ZZIA 4XFDA 1P75A 4KQIA 1Y67A 1JPNA 2CDBA 1QRTA 4H18A 3U44A 2EAUA 4QLBA 4YV0A 4URUR 2ZNJA 2EGGA 3GXOA 4N1AA 4BU1A 3ZZNA 5CB0A 3AUXA 4BXOA 2B2NA 4JTCB 2F3TA 4DGQA 1BMDA 1QDEA 2DWQA 1GRQA 3LRPA 5LFAA 3OKFA 3M83A 5J43A 4I5IA 4JWTA 2QAIA 2J45A 1R15A 1U5BB 1UDCA 4LYAA 1GYRA 3L41A 1XE3A 3M2PA 3SOZA 1R6BX 3ZRVA 3CVXA 2W0SA 1L7QA 2AZTA 4N54A 3OE4A 2W2PA 3AKCA 5L45A 4C14A 2OORC 2ZSIA 1X1SA 3OAAG 4KVGA 2BGNA 1R0KA 5AQ1A 5JJCA 5G53C 2FCAA 4LC1A 3HABA 4Y6QA 1SD5A 2Y9PB 3IO3A 4NS1A 4RAOA 1V1RA 4GT1A 3FYSA 4FM1A 1MCZA 1KARA 2FMXA 5KCZA 1ZI6A 3KPWA 3QVGB 3QYAA 4D45A 4XQ9A 2CVLA 2ZPUA 3S7TA 3GLFA 3OJLA 1GAWA 4NABA 3LHSA 3QITA 1NBOA 5JS7A 3NKLA 2DFLA 5TJ9A 1X2BA 5AM5A 3NC4A 5FPTA 3CH4B 3W7VA 1ZI9A 4BC0A 3KAQA 4D9NA 4J41A 1ZS9A 4TN5A 3M6MD 4NNPA 4JC5A 5JH7B 3GCWA 5BXQC 2OO5C 5DN9A 5MF6A 1F51E 1GKIA 1YR2A 2AG0A 1NR7A 4LJ8A 4KIGA 1UINA 3V2GA 3W2EA 4EGCB 3KQLA 4X00A 3ADBA 1ZVVA 5HTOA 1E79D 3I28A 4UNNA 1CEQA 4BN5A 3KLOA 1CWUA 4RJ2A 4R1PA 4EK9A 4W9NC 2FLVA 3IDOA 4OVKA 4OHCA 4BUCA 2J87A 3HPLC 2XDQB 1U0GA 2QTHA 2N1MA 4FQ8A 1E5LA 2WSBA 4KOEC 4F2GA 3NHLA 4P4UA 4D56A 1RJFA 2FLKA 1T8UA 3GRYA 5AK4A 2A3QA 1VCMA 2QRPA 2D5BA 2VTBB 5DH9A 3C5HA 5C34B 2V3CC 2YXEA 1Y8QB 3LBNA 1M8FA 3Q3VA 3NGMA 1KJYA 1E7YA 3T06B 4OPMA 2B8JA 1WXXA 5EI5A 2P2NA 1LBEA 5K3OA 3S2GA 2HBQA 5IYCO 5B6PA 4EP1A 4UXNA 2IGBA 1YI8A 3WSTA 1GRJA 1M54A 3TZKA 1RPOA 4DJDC 3CLHA 4ZHQF 2V7TA 1KI2A 5H9VA 3P52A 4BJ6A 3U7HB 4NAUA 3ZJZA 5K0GA 4G97A 1MIOA 4EA7A 2WT9A 4LKOA 4U7TB 1G3UA 4I9GA 4PX2A 4H60A 2O59A 3QEAZ 3CNHA 4UW9A 3DNPA 3A4IA 1PTJA 3HR8A 1ADGA 3L0YA 2VUSA 2I4MA 1ECGA 2OILA 1IE3A 3K2IA 4JYAO 1USKA 5H68A 3A70A 1WR8A 2WG0A 2JD2A 4HPXB 3A6DA 2JAHA 1Y3AA 4IYRA 1TQ8A 2BHRA 5D6NA 5K3FB 2PH7A 3VH4A 2PH1A 5AJUA 1OX4A 2X2OA 5IYDO 3ABQB 3NMUF 4DVGA 1OLXB 3AWIA 5M29A 1E0JA 4EY5A 1SCKA 1NKSA 4UD2A 1SXJC 5ED0A 3K79A 1G8GA 3W2FA 2JFQA 3WHLA 5IZ4A 3PAFA 2EILC 5CA0A 2ZB7A 1K4YA 3KZOA 1H0SA 3DFFA 3EPJA 1M1XB 4EX7A 2HFEC 2VK2A 1HDGO 1TM2A 1FQOA 4PS0A 5DX0A 2G0TA 3DVAB 1W9HA 5A9TA 4KSBA 2BY4A 3GJ0A 2ZE6A 1XA3A 4FWBA 2JI6A 4MV6A 1FRQA 3RRZA 4H15A 2GESA 2ZG6A 2HPVA 2J32A 4LH7A 1FNDA 1LPPA 5CX1A 3OX2A 2PBFA 1KD1H 1WHSB 4CH4A 3DR5A 3C2QA 4BT4A 4GZMA 2DWDC 5A9SA 1JEJA 4CNQA 3VR6D 3TL2A 2XGGA 3KCXA 5JXWA 2FP4A 4B7CA 3ASOB 3WB9A 4JXZA 2QAJA 4CQNA 3ZEIA 1IUOA 3EEIA 3VU9B 1E1MA 4Z2AA 3U2QA 4RL6A 3A28A 4FS3A 3T99A 3L4BC 2ZUFA 3DNFA 5FBKA 1J0AA 4Q7LA 1MABA 3JAKB 1M2FA 1K7SN 2J3JA 5C80A 2ZYTX 1XRJA 3T12A 1M83A 3QO7A 4GP7A 1QH8A 3M6VA 2H54A 2C0CA 2NSDA 4RESA 3SC3A 3H1FA 4JKYA 2UYYA 3TVDA 3TTXA 4DANA 3O90A 4D3DA 5JD4A 3UJNA 3Q87B 2J3MA 3D3EA 1JEOA 1J9ZA 4DT1A 4PBRA 5KEIA 1FFCA 1SH7A 3DW1X 3O7WA 3TD5A 2FDCA 1QYXA 2JBWA 3ABRB 4BUZA 3QFHA 3QXGA 4QNHB 4A0FA 5LU9A 1PT9A 2EV9A 2PZAA 2CV1A 3USZA 2RI6A 2O5RA 4LOIA 1U8UA 1NP3A 4PGHA 3BVPA 4R8VA 3T9FA 4KFUA 4KVFA 4UUOA 5EK0A 5EHIA 3BXFA 3R2JA 1T2CA 1Q90D 1GKUB 1U31A 2V4UA 1ORRA 2WWTA 1ZG3A 3JQCA 5AO9A 2FQ1A 1SXGA 1VI2A 5FLXM 3SC2B 1Z7EA 4Y0NA 5KWJA 3CG6A 2ODBA 1VQLV 2WSIA 2YV2A 1PD0A 4D2IA 2HHAA 3RR2A 3MSCA 3K08A 4MH0R 4U5XA 4FOPA 1L4LA 2XVYA 4I1IA 4EY8A 3GAMA 5IDJA 1EHCA 1ZD2P 5J1TB 5CU7A 4P9OA 1M57C 3FY4A 1PJLA 1IBKO 2AF4C 1IMJA 5L6LB 3IQXA 3INGA 1GGKA 1H66A 4OHFA 1E79A 1NV9A 4GEGA 1FA9A 4TYNA 4JH0A 4IDNA 1GG5A 5EGNA 4BFZA 3P0RA 4ZT6A 4RK4A 3OZCA 2P40A 3FNFA 3QUWA 1ZOLA 2ACEA 4WFHA 5BSVA 4K1XA 3CKMA 4DCPA 4WZBB 5A3RA 3PYMA 1RAGA 1U7XA 3O8RA 1VQ4V 4YK7A 2P5SA 3P2JA 1H23A 3ZDXB 4IDCA 4YN3A 4KPFC 1ZISA 2Z3WA 5KWIA 2EX1A 5BPHA 5CYOA 1XZEA 3ESDA 4Q4DA 3LDUA 4M46A 2D5LA 5C2JB 2QHXA 4M0UA 2OESA 3RC3A 5EGSA 1RQNA 3HB5X 4JJ7A 2RGRA 2HX0A 3ABOB 3KB8A 5AP9A 1VF5B 1DHTA 5DSTA 4QSHA 3C6BA 4AECA 4F86A 2VNJA 1KNQA 4CLXA 1UT5A 2ZFUA 3DOHA 3DCIA 1SQ0A 3W06A 3ZNOA 4B6FA 1CJBA 4G27B 4I3FA 2R6ZA 1JA8A 3WPWA 3EWSA 4XWWA 3WNQA 1KOGA 5DTJA 4RDIA 4TQAA 2X6TA 2X5OA 1XP8A 3GB7C 1T4BA 2VKTA 4TV9F 1ZD3A 3IQZA 3JR7A 3Q3GE 2B69A 2ILTA 4C29A 1FUUA 4Q93A 4O2AF 4B8WA 1DAKA 2NNUA 1D9ZA 4AZTA 4ITVA 5EO3A 4JI4O 1DG3A 1YOVA 4DM3A 3EAQA 3FAVB 1NX6A 1AXRA 4CRWB 3L40A 4L73A 3KAJA 1B6SA 4ATNA 2XB6A 2P3QA 4JBNA 3A3KA 1EWRA 1QF6A 3U9LA 5DNVA 1BMFG 3H87A 2I4RA 2HRRA 2JIZA 4ECEA 1OE0A 2AOUA 2QN1A 3GDFA 2VTDA 1GKLA 1HT2E 3NTQA 3A4MA 2J3IA 2YV4A 5LGUA 1Z34A 3A26A 4NJOA 2YYEA 3DV0A 1LRLA 3IC9A 4WCFC 3UT0A 3VR6A 4TGLA 1T1SA 4BWGA 3O82A 1F6WA 4GSLA 1Z35A 2QR2A 2Q7OE 3OPXA 4MVJH 2IBMA 2PT9A 2D06A 9ATCA 2ZE7A 2IY9A 1SCNE 2LP4Y 2OV2A 1EHIA 4KQ9A 5LWQA 4RIFA 4HAWA 4RJIA 4KIUA 2GM4A 1WUTA 2WHRA 2W43A 4RNDB 4YRNA 4FEYA 1UOEA 4EG8A 2IL1A 5GW7A 2AJTA 3UGKA 4NXNB 3PE6A 2PRSA 4P7GA 1TK9A 2AIRA 3ONEA 3LFOA 1PYGA 2J0UA 4QU5A 4LNUA 2HNBA 4NH0A 3G6EF 4LKRA 4DJEC 2ZAGA 2YR0A 4J7JA 2ID8A 1H8EA 2RH9B 3VNUA 4ZPXA 3JD1A 4HSEA 3R23A 1S2OA 2J0VA 5B1IA 2O3QA 2A9JA 5IEJA 3L49A 3F47A 1T26A 2AZ4A 3SEFA 3UN1A 1TIKA 4DL9A 4UAGA 5A03A 2Y0CA 3MGBA 4G0MA 4K9KA 5HF6A 4JASB 1KTVA 1US6A 2XDYA 3HMQA 3QVXA 4RPJA 4QBKA 1PKEA 3E03A 1MO5A 3BXZA 1QHSA 2Q1XA 1SQGA 4FHEA 3RAPR 1GGVA 4G4ZA 4B2IA 2GBCA 4EG3A 3C6XA 5B12A 3OQVA 3U3JA 2WABA 4EPXA 3E9ZA 2DUJA 2EC5A 4NPCA 1O5TA 1UK6A 4L5JA 2OXEA 4RBNA 3L75H 3L7DA 3TZQA 3EVZA 2VATA 1QNFA 1A7AA 2V4DA 2RHBA 1T8TA 2B6NA 2HBZA 4UOZA 3HXPA 3P9KA 3QVWA 3H13A 4TM7A 3W3AD 1S8OA 3L9DA 1J2TA 3UC5A 3ZEDA 3WGUA 3VR3A 1H2YA 2SCUA 1QAQA 4UVEA 2PAFA 3HJGA 1G1AA 2OGSA 4M37A 3FOEC 1DGQA 1T8PA 5IXJA 1RYBA 2FWNA 3EX7C 3L5OA 5HRCA 5HW0A 1EM6A 3LT1A 1L5LA 1DAOA 2PLFA 1B1CA 4HVTA 1SKVA 1VGQA 1UBKS 3CKLA 2IHZA 2D8MA 3ETGA 1JHAA 1K3UB 1OU0A 2ID7A 2BJVA 1M73E 5IKXA 2JCSA 4R05A 1GSOA 4DABA 5DLEA 3E53A 3INTA 4FJ0A 3T0FA 2Z2JA 4BNDB 4LQLA 1PV4A 4FYMA 2O1XA 2Q62A 3IAEA 3CXCU 2IHNA 1O94D 3UAVA 3JQ7A 1E8DA 3WGVA 4K8ZA 5L3ZA 4QVKA 2BC9A 2ZATA 4A73A 1CJVC 3LNTA 1VPVA 4ZVPA 4Y3UA 2WFLA 4RPGA 2A14A 2FSSA 3GVIA 2O7VA 3ENZA 4OHVA 4N41A 1TVKB 4PR0A 4QTZA 1QV6A 4TRNA 9LDTA 4FLYA 2P1ZA 1BDMA 5JCJA 1FMJA 2QZ9A 3P9NA 2Q1SA 5IN5A 2XAQA 4F0JA 1OAKA 4HOYA 1OWNA 1S3SA 1NTRA 3SZOA 3H8JA 1P18A 3DMTA 3HVRA 3HKDA 4X3OA 3OHPA 3KSZO 1ZOIA 4DJTA 1YMUA 4NBKA 5CHYA 4I99A 3UFXA 4UB6Z 3HWWA 3WRVA 7ADHA 1FYXA 3ZU4A 4ZA2A 4OQXA 2LGQA 2JK0A 1X8LA 2D4HA 3FCSB 3IP5A 1GG9A 2PRIA 1ORWA 3UUGA 3EXAA 1VH8A 3OTQA 4BVFA 1XAIA 2Q9LA 3MCWA 4IHJF 3UOWA 3W5IA 4PXYA 1DELA 4HZUB 2V97A 1RT9A 3QUBA 1K8QA 2ONKA 2EJWA 3I45A 1NW8A 1CJKC 3ZZUA 1H47A 4MVSA 5GIOE 3CCRF 2WTXA 3OTOO 4XSVA 5DBOA 2AOVA 2XBLA 4A8HA 1NZDA 4JP1A 5H83A 4W5RA 4KUEA 1F2DA 4LMRA 2EL9A 1H4QA 5E4JA 2CSUA 3IP1A 4BP9A 1SCIA 4YEDA 1FS0G 1C14A 1W93A 4TXLA 1GYPA 3SQDA 4NIMA 4WESA 2KI5A 3C97A 4FFDA 4LZLA 5ESWA 3LYLA 4ZOQI 2I2CA 5L4NA 2YHIB 4PW0A 2NXNA 1ZCAA 2V9PA 4QLOA 4OFXA 1ZNZA 1LLFA 3U0ZA 3DC5A 1BW9B 4HPJB 3NEAA 3MNFA 3K0SA 1E9AA 3DTVD 4LF4B 4WN9B 1EXNA 1KL7A 2LPMA 1JQDA 2PYDA 3O8QB 2P06A 3TRIA 3FPSA 5B3SB 4HJXA 2V9ZA 2QAGA 1R2QA 2ST1A 1HMYA 3H05A 3I64A 5ED4A 1OFUA 5K1ZA 1QYRA 1DC3A 3VC3A 2ONYA 2KB0A 4TV8B 4DQKA 4D7AA 4WKPA 1QLWA 1Y9JA 1YT5A 3NFYA 1B06A 5CLLA 1RP1A 5AXCA 5E7MA 3HDTA 3PD7A 3P97A 1IRIA 5KA6A 4C06A 4JDUA 3M84A 4LGCA 4D80A 3RRMA 5B4UA 3ENVA 2BGLA 5KWEA 1NRXA 3GPDG 4M8NE 4PI0A 1LPSA 3F90A 2Q68A 5BQXA 3RU2A 1QE0A 1A96A 3GFTA 3LPMA 3WWDA 1JU9A 2FEWB 3RGBA 4JXXA 5JWPA 4UOQA 4J2HA 3ER6A 3CC4F 5EJ2A 4BX8A 3N76A 2QRMA 2AV6A 3K59A 3VDRA 1X7WB 4LC9A 2RCYA 1XRGA 2HMYB 1YQXA 1T91A 4I0WB 4PQFA 3VR2D 3INYA 2JB9A 3NOQA 1RQLA 1QGZA 1TQ4A 3GIDA 1FFBA 3BERA 3MJCA 3W3AA 1PJ2A 4KNYA 5G4VC 1X3SA 1SA0A 1OZHA 3PWKA 4KAAA 5CXUA 1E1LA 1M2VB 3QMPA 4HRYA 5KDOA 4NU6A 2V1DA 3ZU6A 1XEXA 2CW5A 4LZWA 1OH8A 5C8ZA 2CBXA 4UAVA 2YZMA 2C9YA 3TZCA 3GXBA 5MN6A 4ZZ3A 4W5HA 3RUPA 2IHKA 2E0IA 4M1KA 2ZBRA 5G40A 2RI0A 3E86A 1XN4A 2LRHA 4ZAYA 4NCNA 4G4GA 5ADWA 4KCGA 1F8FA 5FUYA 5FTLA 4MDYA 4WD3A 3P9IA 2Q3EA 4ZZ0A 3NXKA 1Z8FA 2O2GA 1KI4A 4AY3A 3ASNB 3MFQA 2D1TA 3MYRA 2BZ1A 3B1KA 3JSLA 4ZHVA 1WAMA 3T4DA 1O94A 3TXXA 3OBYA 1HE2A 2OSBA 5AI9A 2YI8A 1QIIA 1DQSA 3M1AA 1G8YA 5BSRA 3EW9A 3AGQA 4JY7A 2V74B 1TTHA 3A0RA 5L4SA 2ECQA 3TETA 5H4HA 2OCIA 1JY8A 2XGSA 2M6KA 3H5TA 3GJ5A 1K6XA 4ZHQA 4CIYA 5KVVA 3VQTA 2B98A 5H2FZ 3PEEA 3JR3A 1MA1A 4DPLA 2X2FA 4RHEA 3OFNG 3CX3A 3DULA 3R3YA 4B3TO 2C9ZA 2J3QA 3D7RA 5CW2A 1TDJA 3AZQA 2HG5C 4WOKA 1AKQA 3PF9A 2WV7A 2BEKA 1AHIA 1JTVA 5AHRA 4QGHA 4PZCA 3JVVA 3EPLA 4YACA 3HYRA 1CE8A 2CXHA 5JVDF 1E9DA 1GPDG 4BGDA 5KNCD 4B5LA 1FPMA 3A1NA 2DRIA 4IJUA 3SJBA 5FOTA 5TJHA 4W82A 5I9TA 2QM7A 4CETA 5ALSA 2JFGA 1VOTA 1RKBA 3MERA 3M3DA 1NTZH 1WDKA 2XUIA 2R85A 4H13B 2E21A 1I4OA 5KOHB 2C9CA 3FPGA 4B3DA 3CN7A 4RUFA 2PY5A 3JWPA 4D26A 4PANA 1PX0A 3HP4A 4FWIB 2PCLA 4TTAA 4DR4O 1BDBA 2EVWX 3DS8A 1MXFA 2XCTB 4BVJA 4DR2O 3RD5A 2XHBA 1K08A 1WXIA 1UC8A 3LG2A 1NVVQ 5KREA 2HHJA 3QNEA 5SV2A 4TQUS 1YB6A 4GW3A 1GNVA 4IT5A 3CVYA 4L5CA 2AS0A 2ACWA 4D79A 1P2GA 1DOHA 3G9XA 3WJ1A 1EFHA 5CT4A 1SUSA 3K16A 5ALIA 1Q81H 2VJAA 2IZ6A 3EBLA 2F4VB 5T4BA 4PLYA 5C46F 2YVAA 4FLUA 2IWRA 2XOKD 3A1TA 4MCHA 1QR2A 4L50A 2WUDA 3K1AA 3CEJA 3MHPA 4L9RA 4R0VA 4I1OA 2OHIA 2I65A 4EYGA 2AN9A 4HDRB 2YC4C 1W36B 4DB4A 3K6RA 2Q3HA 3DW3X 1HV8A 4EECA 1BH6A 4CL8A 2V9YA 1EUQA 3D7MA 5EJGA 3L4KA 3A32A 1TEHA 2XWQA 2WLSA 4P1ZA 2J5QA 1O6GA 1JR6A 3SQWA 3DEYX 1KP9A 5EZ5A 4HEQA 4CMBA 3F0TA 1ULZA 1GZ0A 3AEKB 4JI6O 4AKHA 4C3UA 5MGBA 1Y3HA 2JLAA 4WDQA 2XUKA 4L27A 1M6VB 3U4IA 3QWIA 1C8VB 5KTOA 4GNRA 3RSCA 2O6LA 1EG7A 1MC4A 4O2BB 3JAMA 2GNPA 3K03A 3K0DA 3VR2A 4FIDA 3O9OA 4HSGA 3TIGA 3ND6A 4MVJM 3IEKA 4GI1A 4BV3A 1E0KA 5DVZA 1FDVA 1K97A 1YS6A 1GNSA 5CVVA 4HN2A 2M1XA 4ENTA 2H1OA 1QYCA 1T2DA 5IVIA 3FHTA 1PK8A 3AYXB 4L4SA 3PKZA 2E9SA 4GBMA 2JGDB 2OGTA 3NHAA 1XFAA 2NMVA 3C7KA 1D5WA 1SKYB 1NLFA 4O4LB 3EAFA 3PFNA 5J40A 3E22B 2C8VA 2JJMA 2UUCO 2PGLA 2BZGA 3C8MA 3BF8A 2PBLA 1ZONA 3TM5A 3CCMV 2ZJ4A 4C0XA 4NX2A 1DJNA 1IHOA 2HLDD 3OJFA 2GFQA 1IBLO 1PPJH 3VM6A 3K0HA 4ALJA 3C9RA 3GEHA 4V3BA 3I6MA 3N53A 3DLHA 4BB0A 4XCQA 4MIOA 2CDYA 2ZCUA 3IURA 4HNRA 1PW7A 3JZIA 2PGXA 5DX8A 3FN4A 2DXIA 4BO9A 4OHBA 4GSKA 1KI8A 1SMKA 3I0MA 2QXUA 4JCOA 3QKRA 5CA1F 2W00A 3CONA 1JHVA 1BS3A 1G6Q1 3G2NA 1OYVA 1OA0A 1NBIA 5F2NA 2GAJA 3OCUA 1L4GA 2UDPA 5L3QB 4EHIA 1YACA 4RAQA 4KAJA 2NXEA 1QIKA 2Z5LA 1JXAA 1AHNA 4OJNA 3ZWWA 1DQPA 4L4UA 4DKJA 4GCZA 2I8LA 3P0HA 4HLNA 3BMOA 1HYEA 4C4OA 1GTL1 2GCEA 1RQGA 2R97A 1N3BA 1IH8A 3PXCX 3C5CA 1E69A 4WX2B 3P0ZA 1KJWA 2Y1EA 3Q1KA 1JIJA 1YULA 3HU2A 1G60A 3H84A 4UXIA 2Z5GA 5IDVA 1RC8A 1I5XA 2IDMA 2JG3A 4DA7A 1ZVKA 5L3EA 2WQ6A 4EQZA 3PPXA 4RXUA 2VHCA 4IXWA 4OUKX 2EL7A 1XZFA 1DIRA 5E1BA 4J2OA 3AK2A 1H69A 5A4KA 1TT5A 5EIAA 5ENVA 3T3GA 1LZKA 1E0DA 1FYEA 4DJJA 1DS6A 4RQFA 5CIWA 4KKXB 3BL6A 4G28B 2XE8A 4BJHB 5KNCA 4MPPA 2SKDA 1ZM3A 3G5LA 4A0RA 3L1UA 1WNSA 1MLDA 4A2QA 3KKEA 4O2AA 1KC3A 1SXIA 3EFOB 2WSLA 1HQKA 4N9QA 1DMRA 4Q4LA 3IUJA 3I55F 2PUGA 2CDCA 1OI3A 1VYUA 1FW8A 4EENA 4PHHA 2ZR9A 3ZHQA 4ZTZB 1TW2A 2OQVA 1ETHA 3PIDA 3N8IA 2EWCA 3FJYA 4NJMA 2PPLA 2GHYA 1FIUA 2R68A 4ODIA 5A5VA 1W94A 4FTWA 3ZIUA 1WDMA 1V7CA 3WIDA 4L28A 4UQOA 3L8CA 5HX7A 4Z9FA 1DKOA 4EUHA 1XK6A 4Q1VA 5BMOA 1I4DD 1PT6A 5CVTA 2R65A 1TK2A 3D8RA 1ZIXA 2V7VA 2JLVA 2HB6A 5FXMA 4XR4A 4BIMA 1AH2A 1E2MA 5AR1A 2XH8A 2WVGA 2IXGA 1E9FA 2A9OA 3EWAA 3HM9A 1WXHA 3WMEA 1UJWB 4HAYA 4GVXA 4C5BA 1M90H 1VQOV 3TD4A 3CMEF 3F1KA 2AC7A 3E3NA 3KTOA 3NWPA 1FNJA 1FDOA 1LKZA 2R60A 2HP0A 3N0XA 1YR8A 1F06A 2Q0HA 3H4VA 1BEZA 4IKOA 4P9PA 3VR5H 4TWIA 2LW7A 1D2GA 4DCOA 5TRTA 3F0DA 2P67A 2EKLA 2XTJA 1UI9A 4XKJA 5CLHA 4AB1A 2UUPA 5JJKA 2JAUA 1CRLA 5T6MA 5JAHA 4KHZA 1FTYA 1D8AA 4C21A 2GN8A 5HE8A 1W5BA 1ZM9A 2GN6A 5ITZB 3CLUC 3ESYA 2GAFA 1SKUA 4EOGA 4LJRA 3JAWB 1VSTA 1RWOA 4Y2XA 3ZH2A 3JVDA 4CEIA 2G63A 1AUPA 1BX0A 3LP8A 3HHEA 1UMKA 3KKYA 2QVCA 4M1OA 3QLVA 2NW6A 1YONA 1FPOA 4FUTA 4PINA 4J4HA 3CZPA 2B5UA 4C8EA 1F9EA 1YIDA 1YZKA 4HAVA 4NCXA 2FSVA 3VQVA 5G3ZA 3UO3A 4ERXA 1I7PA 4JBWA 1DCFA 1OH5A 1GL3A 4DDTA 5KYNA 5AW8A 5LYJF 3MEQA 3WYCA 4BBJA 3G5MA 5G3YA 1YVWA 1M1KH 2VHTA 2ZCJA 1MX1A 1EE2A 5JJJB 5B6IA 1HA3A 1V7PC 2YJZA 3BFKA 2Q1UA 3OZFA 3N2LA 1A2BA 4FNAA 3KC2A 3B40A 1VC2A 2CN1A 2ATXA 3I6YA 4W1SA 3VJLA 3QX3A 4AO6A 3RSHA 2EDAA 4FFWA 1V8FA 5CNJA 2V7QD 1P7CA 2PI5A 1YH3A 1GM8A 4HYQA 4QEZA 1RR6A 4L4XA 2QLTA 3OBBA 5EKTA 1IJBA 2WA4A 4HNAA 5BSMA 3T7EA 4FKBA 1FNSA 3LAWA 3G4SV 4MPTA 1Y6QA 1UK9A 4Q9IA 2BCGY 3QJYA 4J3FA 4RHCA 5BVGB 3OUTA 1UQRA 3FPFA 1IY2A 1COWD 3I9JA 1TE2A 2ILMA 2KB1A 2LO1A 3NUZA 1WZNA 3W8EA 4FDVA 1VGVA 3ROEA 3LKDA 3G6KA 4QM6A 1MQ9A 4QGBA 4HBZA 4WZZA 4ZCRA 5KAFZ 3O4JA 2PFSA 2JI9A 1JOYA 4OGWA 3R5XA 4PPNA 2XT9A 4O2RA 1Q7YH 1G66A 4D4MA 1YBFA 5JNTA 4WXPA 1X8JA 5BORA 4E08A 1O08A 4KYUA 1EFPA 2V0NA 1Y6GA 4CF6A 4TS3A 3WGOA 3VBBA 1N25A 5FTWA 4ZI7B 5K2OA 4IINA 4BEJA 3GH3A 1QWOA 3I04M 1N6LA 1JJIA 3N05A 2YW9A 3VNVA 3F8SA 1AKWA 1YVUA 5E95A 3SZMA 2I55A 5EWJA 2PN1A 5J23A 5BOSA 1LBTA 3Q3IA 4ZPJA 1DBWA 2DH6A 3IPYA 4O5AA 1L7NA 2KTVA 1VBFA 3H65A 4I5FA 1E8NA 2G72A 2J7PD 4K6HA 2DW4A 3HCWA 1XNGA 5REQA 3I37X 1GPBA 2WKSA 3QPWA 2QX8A 4EJ6A 2FUKA 1PNMA 5DHFA 4WERA 4DJ5X 2TRSB 5D3ZA 2C96A 2H92A 4LDRA 2YWRA 4IGIA 1G19A 3PGA1 4I81A 1PT5A 3DGFC 4CLHA 1K63A 4WY2A 4MHSA 1JYFA 5JBNA 2DBVO 2C07A 2O1WA 1FBTA 1CY8A 4W5OA 1J33A 1CTQA 4TKVA 1SEPA 3EWIA 4C7MA 5A2QA 2CL6X 1DG9A 1LVHA 4MTXA 1XAJA 5BUCA 3OFKA 4IQ8A 4JELA 1MG0A 4B80A 3JARA 2GDJA 1NH2B 3C15C 3VYVA 1EP1B 5CK4A 3SPGA 1XAHA 2O07A 4BFTA 3SIVA 3PNKA 1L9KA 4WA8A 1P8JA 5FHQA 3P9SA 4NVPA 3ABKC 2O57A 4RABA 1DEHA 3S1AB 1NRJB 1PZXA 1BN7A 8GPBA 1XAGA 3UANA 1THGA 1HMPA 1V7ZA 1BSMA 4CMJA 4Q7EA 4MVYA 5KOYA 2IS2A 4A6EA 1X13A 3FNIA 5I6DA 1JJ2F 3EORA 3W5BA 3M6LA 1OFHA 1T1EA 1UIMA 2OY0A 2QE7D 1KO4A 4ZMBA 5FPHA 3UEOA 4CBVA 3EOAI 5ALGA 3BHJA 5AG2A 1Z75A 5JXHA 3EXHA 3SQMA 4KAFA 1HI9A 2HCRA 3HO8A 3EGXA 4LDZA 1QC5A 1M4UA 5KUTA 1QVGF 5HM8A 1G3RA 1ODLA 1YVPA 1RCTE 1ZEJA 3D6VA 4LCJA 4GR4A 5EJAA 3CLRD 4L3WA 2NVUB 4YCDA 2HJ9A 4K86A 1DRWA 4P4TA 2HRQA 4NOLA 4OG2A 2IV3A 5LDGA 1PNOA 5GTIZ 1SC1A 5FWXA 3M6UA 2BL4A 1SK9A 2G80A 1GZ7A 4DF3A 3ZI4A 1HR0O 3IMPA 1VLMA 3T4EA 1PFYA 4WHMA 4BZPA 3ZRXA 5LJLA 3IXQA 2BDEA 2X41A 4HX2A 4UNSA 2N04A 4LXQA 2FZKA 5DCWA 3LCUA 5JISA 4P32A 1HW7A 3H2ZA 1K92A 4D7TA 1HYGA 1VGRA 4L2IB 5KQMA 3CCFA 3CSSA 3CCLV 2B94A 4URZR 2V7QA 4MS4A 4R5HA 3K4PA 1HF3A 4QRHA 3B3QA 5MDHA 5M04A 2G67A 3T7JA 3VHXB 2VDQB 1QOQB 3C4VA 4Q9JA 5JYDA 2OXIA 4YCSA 1CYDA 5CJPA 5FCDA 1ADCA 4EGFA 2YWEA 2Q07A 5ENDA 4DM7A 2W0FC 3A1VA 2JGJA 2LNDA 4EVIA 1PX2A 2JCVA 4ITUA 5DYWA 4QPJA 1GO2A 3UH1A 3I61A 2OTLF 1COWA 3KEQA 3WYBA 2OQIA 2VDWB 4JB2A 1K9MW 4HI0E 2P4HX 2ZP1A 1G1XB 1C29B 2BFPA 3WBJA 4E94A 2YXDA 3H3JA 4IGAA 3AIOA 5JUWA 4MGYR 2G0NA 1N34B 3PQ3A 4WY5A 2F8TA 5TPWB 2JFHA 3K5HA 5CYFA 1L5KA 5JSHA 3UO2A 1HLPA 2ASEA 2UXNA 3QLJA 2ZOVA 2AQHA 1ZJ6A 1P2UA 2ZQ5A 1M5UA 1D2RA 3ZHTA 1W49A 4ZT7A 1XO1A 3VGJA 5LBTA 1CUFA 1YHZA 1HL3A 1XZJA 2W4MA 3SYRA 3PDIB 4LCKA 3GFPA 3T15A 1WQ1R 2L42A 4PLTA 1S5HC 1VL2A 3FWHA 1HT1E 1YHNA 3UKJA 1J95A 5KHAA 5EWRA 5C5IA 4NV3A 1A4UA 2CY0A 1Q3TA 1YNSA 1X9HA 4BIUA 4ESEA 1LNZA 5JVDA 3THWB 4HDKA 1YR1A 2DAPA 3WC4A 1F3OA 4KQKA 4E5KA 1AQ6A 2WI8A 1H9AA 1GR0A 1YXMA 4FSHA 4LTDA 1DJLA 3OCCA 5KAIZ 1ZXLA 4NFYA 5EUBA 4N39A 2EIKC 4PYKA 4Q9DA 2PVSA 4G3XA 4XX0B 4D44A 3Q7RA 3NKFA 3MB5A 2PBZA 3AF3A 1R66A 4ZT3A 2VO1A 3UJ6A 4H0FA 2QRHA 5K6TA 5ERGB 1UANA 5SZIA 1J07A 2X5JO 5FBQB 4NZNA 3V7FA 2IIVA 3RUEA 2QRVB 1GGNA 4TKUB 3MCAB 5GVRA 1YQEA 2RK4A 4K35A 1ENOA 3L8YA 1N32B 2AL7A 2HIGA 4AJOA 4AJ1A 4O4IB 4JX9A 4X1KA 2H59A 3H5WA 5ALYA 1SBTA 1NBMD 2JRLA 4D57A 4HXYA 4ZHWA 4KQ2A 3LBFA 5CYPA 1P3DA 2Q0XA 1I4LD 3AK1A 5SICE 2IA5A 3DOUA 4TRRA 2Y48A 2ALEA 1KA9H 5AT1A 4F1KA 1NVEA 3BWYA 4IZHA 2PS3A 5E6UA 4P4LA 3TIVA 3H11B 2X0RA 2RG7A 1H2EA 2FFQA 2C3PA 4ESOA 4KXYA 1YZGA 2BFAA 5CVJA 5CEEA 4AF8A 4ZJYA 2VRZA 1E62A 1QK3A 1XWWA 1NYQA 3H01A 2IYSA 5IT9N 1U7WA 4LR3A 1RABA 4HLQB 4GYJA 3DC2A 4QJIA 3QU2A 1Z3IX 2WIAA 2EFDB 1BE6A 1BFDA 4G5GA 1QCDA 3EDQA 4NBLA 4REQB 4FUQA 2G9VA 1YCIA 3H2IA 1R88A 1ETUA 5AJVB 4R41A 4ZYWA 5JH7F 1NPTO 3AXTA 2GD2A 2Q9AA 2DEUA 2WD9A 3H8VA 3P5SA 4BVHA 5IH7A 2ONJA 1VF6A 3HCAA 2WMDA 1W87A 1KZ7B 4AICA 2FJ0A 4JJ8A 3KWLA 1OXKB 2JEXA 1WAZA 2JFNA 1A5TA 3ZHVA 4AYWA 1WBJB 5KYUB 3QTBA 4J7KA 4UC0A 1BTOA 2VJOA 3G1TA 2VPZA 3S70A 4N82A 1YBMA 1T0PA 3LL4A 2G6BA 4BRSA 2ZITA 3RTGA 4NP6A 3SYCA 1V54B 1I0IA 1OAAA 3C48A 3NJ4A 2C29D 1D5CA 3OEED 4M1TA 1P29A 1PVDA 2VRCD 1RWQA 2HQSA 3FVRA 3ODPA 3KEFA 221PA 2X86A 4HG2A 2ZVPX 2QRKA 4OPAA 4QQ8A 4EMUA 3TQOA 1OIVA 4JGSA 4AQDA 5KPJA 1S2DA 5CB8A 1JEQB 5M2QA 3QXXA 4QOJA 1EZJA 4YJ3F 1PZNA 3QWBA 2X76A 1AD2A 1VJGA 4ERNA 2I1WA 4S1TA 1GQRA 4LTNA 4D6PA 4MVWA 3VH1A 3K58A 4F04A 3AVVA 3UJBA 2FV8A 4BLQA 1PZFA 5CA1A 2GTPA 2NZUG 4Y7DA 3OQJA 1ACMA 2L35A 2WIKA 4I5DA 1PL8A 1WTCA 3G5UA 1LNSA 4XBFA 2HSEA 4MRVA 2GKSA 3F74A 4DR5B 4N7JA 1NFFA 5JI3E 3U4DA 4URFA 4F4FA 2HA5A 1UZMA 1XMIA 2W6JG 3M6XA 2IF2A 1P61B 1INLA 1B0PA 3NPAA 5FI5A 4XRGA 3V9AA 2H4FA 5LMNO 3CEAA 2AXNA 3OT7A 4H3SA 4IY1A 3LW7A 4TMWA 2OP0A 2AXPA 3SF8B 2DHCA 4NEGA 1Y5LA 1YGPA 1RPJA 4CG2A 4CM5A 4KFTA 3EXEA 2BOVA 3PRKE 1OXXK 1EWQA 3RLIA 2Z9BA 4TTIA 3OTWA 4A91A 3NHZA 4ACAA 2VT3A 2O48X 3EPKA 2PUTA 3SPJA 3BX1A 3Q9UA 2CLMB 2AZMA 3O92A 2O8EA 3DXRB 4G5FA 2HUPA 2HU2A 5JECA 5EXXA 4E5PA 3CCJV 2BTQB 1RE0A 1ZZEA 2HEGA 2Z2IA 2DPMA 2NUBA 3QXSA 2ZYIA 4Y6OA 3IPCA 1S72V 3DXZA 3H1LH 3C90A 1CUHA 3NCTA 3AEUA 1NZJA 2G08A 3CCEV 3A6GA 5CIQA 3TOZA 1W29A 4NMWA 3IPAA 1WQ3A 3H5NA 2FQXA 4Y1RB 3QF7A 3AR8A 4ZVQA 2F43G 3ROQA 1JG4A 3CC7F 1FL9A 4CDGA 2JAWA 4W8GA 3IV6A 4LY0A 5ALEA 2E75B 1C3OB 1AK2A 1RSZA 1O9HA 5E9WA 4XARA 1G4AE 5D87A 1FLAA 2FPPA 4W7HA 4OYHA 1B2LA 1SETA 3RYFA 2ZSAA 5ELMA 3JSXA 4EG4A 1KIMA 1JI3A 4D9BA 1JDNA 2P62A 4I8XA 3LD9A 5IVKA 1MA0A 1YQ9A 5AI6A 3WWOA 2Z56A 1Z6TA 2PFGA 4UNQA 4WEOA 2GVDC 2Z9DA 4M7PA 3PCRB 3C5VA 5DK4A 4IIHA 2E74B 4NSNA 3EQ2A 4RJTA 3KLPX 4GH5A 3MJRA 3EFFK 4GPIB 1RRKA 3JTMA 2ID9A 3SN6A 1PLKA 4ETIA 1H8HD 3NK6A 1QYVA 5DU2A 3BMQA 4EYKA 1KI7A 4AJIA 2GEVA 4Z3DA 4P35A 2O3JA 2VA8A 4HAOA 4Y7CA 3NDPA 4JENA 1LX6A 4JZYA 4W99A 1EFVA 3WK5A 2ZQYA 1WCV1 1XMJA 2C42A 3ECAA 3CZAA 4MUJA 4COOA 3G0IA 4OP2A 4QHYA 2GDZA 1CIJA 1Z4QA 2NPIA 2JZNA 1ORDA 3G49A 2YEVB 3KHTA 4B7ZA 1FX1A 4CIWA 3ABUA 1Y1TA 3NVMB 2A59A 2I2FA 1TU4A 3KQTA 1XLTC 4YRKA 1QF9A 2HSWA 4G0QA 4D0RA 1K4CC 4QASA 3ITNA 4DA9A 5JAQA 4EAAA 1ZK1A 3P20A 2EF1A 1PKXA 1XD9A 2E4YA 2VWJA 2CHGA 1CZHA 5LYJA 1WM1A 4JT4A 3ZX6A 3DXFA 4YAJA 3VC7A 5EHGA 4QLAA 2QTOA 1Q14A 3NT2A 1ILEA 3A2LA 2C9BA 3GLIB 3KETA 3CRNA 5JZVA 4NV1A 4R1OA 4IM7A 4MGEA 4DV5B 3ND9A 4BV2A 1XREA 3GBSA 4X84A 1Q0ZA 3KV3O 1S0UA 3PRJA 3UJCA 1CVIA 3DDSA 4AD8A 1VQ7F 2VJYA 1XJ5A 1QV7A 3OTFA 3GRVA 2X0IA 1H5QA 4U8GA 3DG9A 4XZ3A 1TTQB 3VYUC 3L73H 3F7NA 2Y69B 2HM7A 3AHIA 1JZQA 3IBSA 1AVMA 1JR9A 2P4UA 4LS3A 1T4MA 1Y5MA 1PS0A 3LF1A 4MA0A 3HYTA 3IAXA 1Z0KA 1VKZA 1YJQA 1QRSA 2RAUA 1WCXA 3VBEA 4A0QA 4LY6A 3R0ZA 1T9GR 5JATA 4IXDA 4KXNA 5J5VA 1MGOA 1ZJYA 5B66Z 3BRCA 2ATVA 1ZWLA 3W4JA 4D8WA 2NVWA 4AUMA 1XJ0A 2DT5A 4LWOA 3ER9A 3TECE 4JR1A 3ZS9A 3ZWNA 4B46A 4YXFA 4O02B 1PJSA 2QWRB 3BCSA 3QG1A 1W8IA 1TMYA 3NX4A 4YT2A 4P0QB 1OCZC 3JD3A 2ETXA 1OMOA 1MP0A 1CULC 4W1QA 4R7CA 1AR5A 4J07A 1YUNA 5HKAA 4QDOA 5CH3A 1WMBA 1NI5A 5L7TA 4PC6A 3X1ZA 3OZRA 3FKSG 1H7MA 3TG2A 5KTTA 4ERHA 4MYSA 1NVBA 1P5RA 1W9MA 4FT2A 4BO6A 2PLRA 5E2AA 2WLLA 2Y0DA 3TIIA 4C2BA 3O8NA 2H51A 3WIUA 3LMKA 2WYWA 1ZLYA 3PF8A 4DB2A 2W2QA 2WKQA 4Z4GA 1S4QA 4YRZA 1KHHA 3AETB 3B6IA 1UMDB 4F3YA 2UYQA 2NT4A 4X8AA 1NBEA 3FPCA 4BNMA 1A1VA 5SY6A 5K0FA 5ILOA 1ZM2A 3LVFO 2OMKA 4YRJA 2DOSA 2VEDA 4KQHA 3O8BA 5DHQA 4JN6B 2ITCC 4CDMA 3GRPA 1K8RA 3IRVA 4WCDA 5K6AA 1X38A 1ZUNB 3LWVC 1T43A 3EMBA 2OIEA 3VYSC 1MG1A 4CLOA 3CXCF 1QOPB 1V0JA 2WLIB 4QFCA 1YJBA 4RHFA 4YGXB 1WXWA 1IVYA 4P36A 5ALZA 4CMEC 1V25A 1H1LB 1NQOA 4KYIB 3RUCA 1GUDA 2HA7A 5F51A 5A9GA 5ALUA 3HUEA 1IN1A 2AUTA 2I4TA 4PLHA 4TKLA 1E1QD 2QQFA 4V0OA 2IHYA 1VQ9V 1UPUA 3WAGA 2D2EA 3K71B 4XGQA 2RH4A 1FYVA 2B7BA 2CVZA 3KZMA 1EVQA 3OGCC 5K0TA 4MTOA 4UCRA 2IS4A 3N8NA 1H8HA 3L1JA 4YAUA 1W85A 3INNA 1QVFF 1Y42X 1AJEA 4B9AA 2F4VO 3H9UA 1DQRA 4RDHA 4GKJO 1RSOA 4MB0A 1HOXA 2DQ4A 3BDVA 3FOFC 3W7BA 1JQ5A 4YPFA 4JGGA 4WEQA 4LE1A 1JIIA 4TPKA 3NASA 2RE8A 4AJPA 4IV5A 3FMGA 3KSDO 3NV7A 1NBME 4ZIRA 4AJHA 5JBQA 1BS2A 4EFDA 2IV2X 1NDUA 4LF7O 3OWHA 1SG9A 5E7JA 1CJCA 3BXHA 5DO9A 1NT2A 5L40A 4RVDA 2J59A 2PTMA 1AG9A 4Z6KA 2HBYA 3IOEA 5JTUA 1YRBA 3V4LA 1G5TA 2D4AA 1CC1S 5IP5A 4AXBA 4WKCA 2QTNA 3ZGOA 3MD0A 4L6IA 3ICWA 1A72A 2QMQA 4MTCA 1KR5A 1WSDA 3M8AA 1A97A 5TMPA 1H2RS 1P1FA 5IC5A 1UZAA 2PYLA 1FQJA 5BURA 1T5HX 3MJEA 4KJZA 4ZHSA 4FFOA 2WTNA 2A5FA 4K6OA 1MB0A 4YCNA 4UVAA 3ZOKA 3IJ4A 4FNOA 3NWJA 4GMFA 2Q1WA 4R54A 1CY0A 3E82A 3PQ7A 2FCRA 4RPCA 4MQEB 4CCYB 3G02A 4OQDA 2C4UA 1LNQA 1PG5A 5ADHA 5BY2A 1CUDA 4UTPA 4QULA 2CLIB 1LJUA 5ALXA 3S27A 1F23A 3TLGA 2REQA 4ZT5A 4F4CA 4Q1BA 1W5FA 4ZODA 1SVMA 1QP7A 1E2PA 5JSZA 4B62A 4P53A 5K4GA 1QVVA 1YRLA 1MMMA 2R7MA 2VT7A 2QRZA 2A5JA 3HVJA 3B1YA 4RGQA 2WICA 1SOAA 2LKCA 3A9VA 1UBCA 3KBBA 4H35A 1LGYA 4BNWA 1I8TA 3NDJA 2ZCVA 1SM4A 1GA4A 4QSMA 4QVIA 3VC2A 5G4UC 1SVNA 2ZUEA 5A6SB 2H7CA 1NONA 5EFOA 3EY9A 5HPYB 4KQMA 4BVQA 2H6EA 3GLHB 1N2SA 3G2KA 5F2EA 1NW4A 3RFXA 1H3FA 2J4FA 1SB8A 3CKKA 4L0CA 5LCXA 2HR3A 1L7PA 5M5BA 3HBAA 1QUEA 4CDNA 3DFZA 4FDUA 4GICA 1WP9A 2Z6QA 3C0KA 2V7PA 3K8OE 2CH7B 3U31A 1Z6QA 3EPPA 3ZHCA 2C31A 3D2AA 4X66B 1DK1A 1S7GA 3NUQA 1C50A 2YWBA 4PFKA 4MWBA 4C78A 2E37A 2GRJA 2H5EA 1YZQA 1BNCA 3HB9A 3SF0A 1ZGHA 1HXHA 1I01A 1M8PA 2HUNA 4CV3A 3ZNNA 4BN0A 4D8UA 3RVQA 4NNJA 1ZTEA 2PIAA 2QS9A 4K9LA 4Q3LA 2O4CA 3CCQF 2FUEA 2CNWD 4L3OA 2W5UA 2B8EA 2OFXA 1U7TA 2H5LA 4LXTA 3VPSA 4G4IA 1CT9A 3OEWA 1H65A 3DFIA 4EKYA 4KXWA 1UXIA 3SHWA 3SKVA 1P81A 3WSVA 4QHSA 2Y1OA 4UNRA 2A58A 3K9AA 1NJ8A 2ET6A 1VIBA 4G4SP 4FS8A 3LLUA 4QBTA 2JHFA 2XMRA 2CE2X 4TV8F 1PJ3A 3R6TA 2R25B 4GIBA 4E03A 4LRYA 1UBLS 1TUEB 1USVA 3PL5A 5I47A 1C9EA 4YDHB 3TLAA 1TYEB 1VQMF 1QX4A 1Q1ZA 3AU8A 4BDTA 3ESCA 3FR8A 3BCHA 3TQIA 2H00A 4YJGB 4Q02A 3M82A 4M0MA 3WL7A 3TB6A 2AWOA 4CC5A 3K4QA 3FPAA 3HCEA 5BV1A 1H0HA 4D6XA 1DEXA 3U3ZA 3K5MA 1QGDA 2H29A 1G17A 2C2GA 1YUMA 2R72A 1VMKA 4AP5A 1WXQA 1HM5A 1ISHA 3EMKA 3R9IA 1V1MA 3IBTA 3JZFA 1PTJC 2DPLA 2OTCA 1DL5A 3TVTA 3ZDAA 3I56F 2GEBA 2IITA 1XCOA 3G82C 3D4LA 5C8YF 4MVMA 3HY4A 3CVVA 1MX9A 4I7EA 1ZSNA 5DXFA 3UM9A 1B14A 4F2WA 3P30A 4XGRA 1D7AA 2N46A 1NZFA 2EJ7A 4QPKA 3DBIA 3A04A 2F9ZC 4X44A 2LCIA 3GWGA 3HKBA 4WLVA 5A5DA 2CDRA 2HMWA 1EZZA 3C3JA 1W57A 3KQPA 3LQRA 2C7OA 4XM0A 2CXNA 4FYKA 1Q0TA 1U3UA 2XDQA 4Z3OA 7REQB 4RQEA 1T35A 3B89A 4JNCA 1EKXA 1RAIA 3HJWC 4UAUA 3I2IA 1SRQA 4ALIA 2A9FA 3DTVA 4B4OA 4B6OA 4DV0B 3AZOA 2BE3A 1HNXO 3KTFA 2UU9B 4G6ZA 4X1IB 2HH9A 3PDJA 3ZZ0A 5I9LA 4OLJA 1T34A 3L0DA 4JYZA 5EIOA 1MC5A 4BYGA 1ZU4A 5KHHA 4ZVUA 5H1YA 2DFPA 3I9NA 5DW0A 1XVIA 3KLNA 3NHKA 4A3SA 4WADA 2KS6A 1FP4A 4G5OA 4YJ3A 4IO1A 2V54A 1FFAA 3C4QA 4AMBA 2BEWA 1IG0A 1NVWQ 4TS1A 3CSXA 2QL7A 1CNFA 5IJ0A 3IAUA 1GGMA 2QORA 3SYNA 1OJHA 2R8XA 3UK2A 3WE7A 1YE3A 2QYTA 2QR4A 4AJ4A 2C3YA 4ITRC 4HHEA 4NMHA 2I62A 2XVAA 1HYBA 2JAOA 3CF4G 2OECA 1T3GA 2X5XA 1GDTA 3AERB 1LC3A 2BGUA 4DLBA 2PLNA 3PEFA 3QFRA 2DJ5A 1BXGB 1CP2A 1GL7A 3W7TA 4GKBA 1OLXA 2D2VA 3PUHA 3GAFA 1RLJA 1X8KA 4PYNA 3BAAA 5K7SA 4AY6A 2DKOA 3F0FA 1TM5E 4DUZB 1A4IA 5KQPA 2HF2A 5DRTA 3A1EA 2GVIA 3PFBA 4J75A 1I80A 3RVOA 2AQ8A 3LS2A 1XI2A 3JQDA 1JXMA 4OF4A 3IA7A 1ZK0A 3TR0A 2OLJA 1WNFA 4P7JA 1FRVA 1MR3F 2H1VA 5F7ZA 4I55F 3UYLA 5LXTB 4X64O 4C0KA 2P9EA 4RTMA 3P45A 2VJDA 2WD7B 4HB2A 4RXMA 5AUOB 2GPTA 1IXKA 4KXUA 5A06A 3ZHRA 2X6RA 3IHLA 4ES6A 3WZLA 5AI5A 1AKNA 4LC0A 2PR7A 4NMLA 3LWQC 1UKAA 4LJ7A 1Z2OX 2Z09A 2XY4A 4CQLB 3TTVA 5LA6B 4QX6A 2D0IA 5HSGA 1WHSA 3MWKA 1L6IA 4QPZA 1RNLA 1U3WA 3KQHA 4C6SA 3GC6A 3RNLA 4INOA 1GQYA 4G4WA 1NP7A 5LUBA 5FORA 4O1HA 5IKOA 2XHEA 1UBTS 1GZ3A 4RTNA 4BB5A 3VUFA 4KV7A 2CFSA 2CMDA 3RARA 1Z26A 1M0EA 3DL4A 3WDMA 3C5EA 3R0IA 4YRSA 3IJRA 3UWOA 1N5IA 4J0KA 5EIWA 1CUAA 4U7WA 3S40A 2YIAA 2QM4A 3RVJA 2G5TA 2GXQA 2XUHA 2RBGA 3JYOA 1Y7LA 2BEUA 2GYVA 5BR8O 3N9IA 3UIEA 3HB4X 3EF1A 3MLEA 2W8ZA 4XDKA 1FU4A 3ZDFA 2TSYB 2B82A 3E8FA 3HU1A 3IVXA 5HHTA 1JKJA 1EJ6A 3MBIA 4UEWA 1E2BA 8AT1A 2Y4NA 2YMPA 5GIOC 3D81A 1FTWA 5L7YA 4BEWA 1Y33E 4WGGA 4YX9A 1KYXA 4U1RA 4YRBA 3E9EA 2H2AA 3DD5A 2GUZA 2RB9A 10MHA 1T3HA 3AYZB 3IC7A 3LDDA 4OGKA 2EG5A 1P1RA 3RBVA 4DMLA 4TV9A 1YTFB 2FMIA 2XBMA 3TNLA 4O2BF 4X8LA 1U7DA 3LZCA 4ZV4A 2I4LA 2ODPA 4PNHA 3OKPA 3K9BA 1UXGA 2PXAA 1ZX1A 3J81A 1B74A 1IQ0A 2IYEA 2FB9A 5F5LA 5NLLA 1L8LA 2B83A 4O4LF 1J70A 3H0KA 3AESB 2O5EA 3ZY4A 1M1NA 3H1GA