1JFFB

Refined structure of alpha-beta tubulin from zinc-induced sheets stabilized with taxol
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
426
structure length
426
Chain Sequence
b'REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tubulin alpha chain
publication title Refined structure of alpha beta-tubulin at 3.5 A resolution.
pubmed doi rcsb
molecule tags Structural protein
total genus 113
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2001-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1jffB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1jffB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1jffB01
1SA0A 3JAWA 4O4LA 4KWEA 3JATA 4X20A 4ZOLB 4WBNA 5IJ0A 5JCOC 5CA0B 5CA0A 5LOVB 5BMVB 5J2TA 1W5AA 2Q1XA 4O2BA 4O4IA 1W5FA 3VOBA 5KMGB 4HNAA 5JH7B 2VXYA 4B45A 5LP6C 1RLUA 4B46A 2XKBA 4O4HA 5IJ9B 4I4TB 2RHLA 3M89A 4X1IA 5KX5B 5CA1A 5JVDB 3UT5B 4O2AB 3HKEB 3WGJA 4O2AA 3N2KA 3VPAA 4EB6B 4ZI7A 1TUBA 4EB6A 4TV9B 5LA6B 2VAMA 5LA6A 3RYHB 2GVIA 2BTQA 3JALA 1RQ7A 3HKDB 3RYFB 1W581 2Q1YA 1JFFA 4YJ3A 3R4VA 1SA0B 3JAKB 3JAWB 3JAKA 4O4LB 5MN4A 2BTOA 3RB8A 1RQ2A 3JATB 4LNUA 4U3JA 1Z5VA 4X20B 4WBNB 5IJ0B 5J2TB 3WGKA 4O2BB 4O4IB 4EI8A 5JCOA 4HNAB 4X1KA 3WGNA 4IIJA 3E22A 4O4HB 4TV8A 2VAWA 5LP6A 4X1IB 4I55A 3JASA 5CA1B 1TVKA 5MN5A 2RHOA 3N2KB 3ZIDA 4ZI7B 1TUBB 4O4JA 3JALB 2BTQB 2XKAA 4FFBA 5EYPA 2R6R1 3VO8A 4XCQA 1JFFB 4YJ3B 3JARA 2RHJA 5ITZA 1FSZA 4DXDA 1FFXA 4U3JB 4LNUB 3VO9A 4U39A 5LXTA 2VAPA 5LYJA 3RYIA 5IYZA 1W5BA 4IHJA 3C8LA 5CB4A 4X1KB 5EZYA 4DRXA 3N2GA 3HKBB 5FNVB 3HKBA 5JQGA 5FNVA 4IIJB 4EI9A 3E22B 4X1YA 4TV8B 3ZBPA 5MN6A 5LP6B 4I55B 3M8KA 3JASB 4F6RA 1TVKB 5J2UA 1Z5WA 4EI7A 2RHHA 4O4JB 4YJ2A 5GONB 4FFBB 5EYPB 5GONA 3JARB 3CB2A 3V3TA 4ZOLA 4I50B 4E6EA 4I50A 5ITZB 5LOVA 1FFXB 5BMVA 3HKCB 4ZHQB 3HKCA 4ZHQA 3WGMA 5KMGA 5LXTB 1OFUA 4M8IA 3VOAA 3RYIB 5LYJB 5IYZB 5JH7A 4IHJB 5EIBD 3ZBQA 5C8YB 5CB4B 5C8YA 5EZYB 4DRXB 3N2GB 4I4TA 5IJ9A 3RYCB 5JQGB 3RYCA 5KX5A 3UT5A 4X1YB 5JVDA 3HKEA 4F6RB 4TV9A 5J2UB 5M7EA 4YJ2B 5EIBC 3RYHA 1W5EA 1W59A 3HKDA 3RYFA 3WGLA 2R751 4TUYB 4TUYA
chains in the Genus database with same CATH superfamily
3GEGA 3O94A 4CCAA 4OATA 2HHLA 4P3XA 4IZOA 1VI2A 3ONNA 4Q1EA 1OI4A 1C3LA 3EHDA 1C9EA 5AVZA 4FI3C 3P9RA 4ZREA 5KTNA 4YXWA 3FAVA 4HR7A 8OHMA 3IAS6 3OQ1A 2XDYA 1EX7A 3PL5A 2W2LD 1VL5A 4M54A 4OI0A 5C81A 3SKXA 4TSFG 2VOJA 2VDMB 3KSMA 1AH2A 4G8JA 3U9LA 3SBDA 4RIEA 3F5WC 2OO7A 1Q0SA 2AZTA 3AVTA 3PGKA 2PZBA 2GXAA 3B6MA 1D2EA 3QYAA 4HAWA 2YWRA 3M8KA 2B9EA 4C0XA 1UC4B 4QXPA 4AL4A 4J9VA 4CQLB 4KBGA 3ABMB 4UOEA 4JGIA 5KPDA 3C43A 1OCRC 4NHOA 4P22A 3FPLA 1ZL0A 2WHYA 1YGPA 3I2FA 1H2EA 3FGNA 3I6BA 1M1KH 4TTQA 5FR1A 4NZPA 4OCZA 1YJNF 5CM2Z 4YB8A 4HQKA 3K14A 4AMGA 1L1QA 3JQGA 4OB7A 3EGDA 1EZ1A 2ZITA 1NKTA 4ESEA 1LI4A 1FJXA 3QBVA 2XNSA 2VYVD 3E03A 3QQ5A 4N5MA 4W5NA 2XF2A 4RF3A 4ZMRA 3CCQF 3R6GA 4GSLA 3OI7A 4L95C 1N0HA 1FU7A 4FLVA 3C87A 1EXVA 4CKEA 4YHBA 1HE2A 4KNVA 1QAOA 3IKEA 3V1LA 4R7TA 2YWGA 5C3MA 4PC6A 4HZUA 3WGUA 2WIFA 4X6YA 4QDXA 2HC9A 2WAAA 2AB0A 5EE1A 2JAPA 2H16A 2GAFA 1X7DA 2B9VA 4CMCA 1QNFA 2LCIA 3OW2U 3TETA 1KWKA 1W2HA 3AJRA 4EPRA 4JZGA 2QN6A 4EYGA 1B4DA 5J1TB 4ZHQB 1GVHA 1KYVA 5AMXA 3R75A 2E37A 2EFCB 4G2NA 1FLVA 1UWLA 4LJ6A 4Q1CA 4A8HA 5CVCA 1CUDA 1SY7A 3FOZA 1VQMV 3M70A 4IIVA 4UZFA 2PTGA 3GRZA 1V8ZA 1WHSB 3A0BZ 1JXOA 3TM4A 2D1SA 3E48A 1C1DB 4JITA 2I2XB 5G3YA 1ULUA 1GGEA 4DEXA 2OXTA 4YRLA 1OGJA 1SUBA 3L6CA 3BERA 4CUKA 3U4MA 3K4PA 4LE2A 1T5SA 5HKKA 3JX9A 2D3WA 2G04A 3HFRA 1VI6A 2BFEA 3BILA 2WZQA 2GYWA 2C7QA 3UJCA 1IG3A 2HCBA 1M2NA 5CHEA 3BT7A 2WT9A 2NXEA 3T9CA 3ZDQA 2LKDA 1WY5A 1O95C 3CMEF 3C8ZA 3GXOA 4PINA 4LPKA 4FFOA 5PNTA 1XK7A 4ZOLA 4L51A 4DLRA 5F9HA 4W9MC 3PNLA 3IKTA 3OLVA 2P41A 4JWKA 3H5LA 3FOWA 4K0KB 1X15A 4AY3A 2CAZC 2VP5A 3DFIA 3QE2A 1XTVA 3UKMA 2Z5FA 4N7MA 1JWBB 4NK5A 1AJPA 3V80A 1I32A 3ZD9A 3UHFA 2B3DA 1SIWA 1IBRA 4A23A 1KD1H 1O96B 4WBXC 2EEZA 4HEQA 1HDRA 1YZTA 3NLLA 1FNBA 3LQYA 3LDCA 3T5CA 1WUTA 2FF7A 1GPWB 4E4TA 2WQZA 2VDWB 5IVHA 1G16A 1FAFA 4L22A 3AG7A 4P0TA 4YRKA 1AMNA 2QS9A 2XGMA 3CH7A 1DG3A 3ANYB 2E5LB 1FUUA 4LH7A 1VE7A 4JYAO 4LHEA 3A0RA 1QKJA 3GX1A 3VKVA 4NXNB 5G0VA 4LF9B 2IIVA 1GU1A 1MDFA 2C7BA 3ONWA 3GMDA 5K7SA 2ZPAA 4HC4A 3ZTWA 4OXYA 2CC2A 1QQTA 1NVBA 3CYQA 2HPAA 4X64B 2VJDA 1AQNA 3MMNA 4LJRA 4ZYTA 4KGXA 1IXRC 1FS6A 3A6JA 3E9RA 3RBAA 3WS7A 1VSTA 3EDQA 3BGOS 4DCJA 1VQNF 3FFMA 4D45A 4EJSC 1AGNA 1SKVA 3QKTA 1GXSA 1YFJA 1EA7A 2VQFO 5ADUS 1X7YA 1BA2A 4I99A 1JEYB 3VMMA 2ZLBA 3B6KA 4PE5B 3PDWA 3S6JA 2ZI6A 3Q2OA 5AKIA 2GF2A 2HWUA 4INAA 2V4UA 4N41A 1B15A 4HNSA 4HYOA 1UPBA 2FHSA 3SJBA 1I4DD 3B4SA 1NBMA 2MINB 4E07A 3WNZA 1IVSA 4BPBA 1O8BA 1CUFA 3JYNA 3AM5A 3N05A 1DC4A 1WNSA 3UT6A 2G9ZA 4WOPA 1DJLA 3TCKA 2EX0A 2CV0A 4CU2A 4RVCA 1O7JA 2EQ5A 3IUBA 5FA8A 3TIXB 2BR3A 1YL7A 2C8KA 1XD2A 4WINA 5JVDA 3JQEA 3OURA 3ADPA 5LQRA 3BJRA 1J9GA 2ZATA 1TM3E 4JPRA 1UK7A 3MF4A 3C2QA 4MEJA 1SVMA 3BFRA 2G38A 1ZUNA 5BT9A 2JAXA 1LRKA 3UGTA 1AIPA 2MDTA 2MWMA 1QORA 3VHLB 4E6PA 2XA1A 1Z2EA 4L2IA 2PWZA 1N2CA 4V2UA 2PSJA 1EQAA 2V3VA 4JJFA 3OM8A 1VSQA 4PBRA 3IP3A 1NJIW 3DDHA 2Z3ZA 5REQB 1UP4A 3HADA 4JI1B 3W0LB 3V1TC 4LFCB 3NZEA 3AG3C 1AM4D 3RUHA 1ZKMA 4DR5B 4BAYA 4DMUB 2CNWD 4L15A 2BFOA 2AJBA 5JJEB 4RCZA 3H5RA 4ZQCB 5EQDA 1RFLA 3EBLA 4H4EA 3Q11A 5BWCA 4OM7A 1AB6A 3ZZTA 3T4XA 1E3TA 2P91A 4WBNF 4FHDA 5L3QA 3DD5A 1KEEB 1Q82W 3VDNB 4JELA 5LB4A 3ZX5A 3RUDA 2DAPA 4XKJA 2H0RA 4PLCA 3L7JA 3LNTA 3RS8A 2DLNA 4L1KA 5K99A 1ZM9A 3NBYC 3DDNA 3CGGA 1T5OA 3ESZA 4CL8A 1G98A 4IJMA 3CZAA 4P6VF 1JJ7A 3SLRA 3INTA 3EIQA 4ID9A 2EIMC 2I7TA 3RYHB 4JNKA 3UJBA 2FX5A 4OI1A 1AILA 3P9PA 3FB7C 3T3OA 2PYJA 3MWKA 2GCPA 5T3UA 3STTA 1NQXA 3O4JA 1EUCB 4NZMA 3JD2A 2GJAA 1VM6A 4HB0A 4BQEA 2O8EA 4LSZA 5ILQA 4KG7A 2DT5A 2XAFA 5JZMA 2WFZA 3PXBA 4R2LA 3W9SA 1QVZA 3CV3A 2AV6A 2D4AA 2F67A 4QDZA 1UMDB 5EUBA 1YA4A 3EYWA 2WD8A 4J41A 2QX9A 3AEKB 4B4KA 3OQ6A 2PSDA 2Q3EA 4LK2A 1DINA 4C08A 2EKLA 3BMOA 5DCLA 3TIFA 1RYNA 4Y1FA 4WOBA 2IYEA 2PMWB 1Y8QA 1ZR4A 5EXPA 1GGFA 3OO0A 3OEWA 3R7BA 2WLTA 2PKEA 5EHXA 5K3OA 2R25B 3VO1A 4KPUA 3KZCA 3OHSX 1X7XB 2J4DA 2GCOB 1ZK0A 2R4UA 4L8FA 5B4TA 3VSEA 3CJQA 4YRRA 3D8NA 5KJCA 2AG8A 1DKOA 4HMOA 3CNLA 4BKMA 1OJHA 3A3YA 1A9ZA 2IXAA 3HLTA 1N5DA 4TL7A 1Z5OA 3GJQA 2C9OA 1S8OA 2IIPA 3I9KA 4QOSA 1P5ZB 1C2TA 2EKPA 3NM5A 2A5JA 4I50F 1RRPA 1RYHA 4NSNA 1SUSA 3OY7A 4BN5A 1B76A 4TPKA 2YIMA 1TEXA 3VSBA 1M0SA 1U9YA 2C04A 2XUKA 3KUCA 4X3LA 4ZCIA 1RACA 1IAVA 4JLKA 5A05A 1TJNA 4ZT4A 3Q3IA 3RWMB 5EMMA 5BQXA 3OZIA 4OUKX 3UNXA 1M66A 4UREA 1N7IA 4TGLA 2BE9A 5M29A 1C29B 5H6QA 4EH1A 4PDMA 3CPSA 1IM5A 4Z53A 3MCVA 2QD3A 3ROMA 2YEVA 3K0DA 4YCDA 1G5HA 3S2UA 3VTKA 4URFA 1XKXA 1QP8A 4EQZA 3MELA 3OEEG 3A6EA 4DLYA 3BRCA 1QDEA 4LY6A 1IY8A 4DGQA 3EAGA 1DP4A 2ZRKA 4AKTA 3AV3A 4Z1MD 4ZCSA 1G2PA 4KVZA 1GUAA 3ZXIA 5I9MA 2WQ6A 1YACA 1TYZA 3TI9A 1GKLA 4F9TA 4QOHA 3ESYA 1FK8A 1DRJA 1Z17A 3STHA 4AF8A 1YDWA 3BAFA 5E6UB 3L7IA 5A3QA 4MPTA 2HCTA 3ZBPA 5JMTA 3LRXA 4LV5B 4YHHO 3ADDA 2W58A 1NVXQ 1VP9A 3M4SA 2IODA 2AR0A 5K8CA 4HN4B 2DTEA 5B7QA 2NZ2A 2FDXA 2HNKA 3SQWA 4Q6GA 5H0IA 2HIGA 4OHRA 1GPMA 1USIA 2JARA 3WMGA 2TECE 2R87A 2ODQA 2ZE8A 1U7OA 4YP9A 1DGQA 3ASYA 3IJEB 4XM2A 4BCBA 4WEOA 1PXWA 3BJMA 3U3JA 2PNFA 1IEVA 2IG8A 4PZEA 3OQVA 4XQ9A 4EW2A 1N2GA 3KQHA 3ZWQA 2UYQA 5KQPA 5JY6A 4WF9V 1AVMA 5EPOA 3REOA 3IR5A 3D9QX 4WLUA 5CX1B 2WYIA 1N7HA 2A67A 5FOUA 5AVXA 3GRCA 5KUMA 4XEHA 4QM6A 1H4TA 1QUEA 1M7HA 3UAOA 1MAHA 4BYMA 3SM3A 4E2FA 4TZ6A 2WA1A 4XYGA 1EI9A 1SBHA 4C7OB 5AHRA 2BT4A 5EWLB 3NYWA 2E6KA 3GDFA 4KXWA 3EY9A 1MQSA 3A32A 1JHZA 2P8JA 3ENNA 2J59A 3C0KA 1R0XA 2PI5A 3VOSA 2ID8A 3QW2A 1U2EA 2X9VA 4LF5B 2R47A 1JWAB 2JGDA 4MTCA 1FX1A 2GO7A 1UMKA 1MN6A 3GUCA 1BJTA 1EFPA 1Y5LA 1F23A 5DSTA 1SCKA 3IDFA 2I6SA 1VLQA 2B2CA 2ZTLA 3QVWA 2MSNA 4PYJA 4IFTA 1F60A 2XKBA 4DV2O 1II8B 2R1TB 1L0LH 1GARA 2B8EA 1ZXLA 3E7FA 2H8KA 1ILWA 1KQPA 3PHIA 3DP7A 4V0KA 1S5PA 3B8EA 3U1BA 2AJCA 3PQ4A 4JBIA 3E53A 3MIZA 5T57A 5GTIZ 2Z1DA 3KSAC 3ZDRA 3L6BA 3AF5A 4ZYVA 3CPQA 4J6FA 2WHPA 2BJWA 3TTUA 1V3UA 5CK5A 5CTJA 4D6PA 2QUIA 2OGWA 1XA4A 3RVNA 2IEBA 2ZOSA 1J0CA 2VHQA 4LHZA 3LSSA 1DDOA 1V11A 1R3JC 5AUPB 3N2YA 4L9WA 4QPPA 1K9MH 3Q88A 1XB2A 1YE3A 3Q4HB 3WKDA 3E8HA 2WD7B 1W19A 3M84A 1QB8A 1JE0A 2YWHA 2B4KA 1ZRMA 1W5AA 2FSUA 2I71A 5I9LA 1FPOA 2CXTA 3AB3A 3NBKA 4HDRB 5HCIA 1L7OA 2QQGA 4UCXA 2ZRPA 5FPPA 2A5LA 2NXJA 5HE9A 1JIXA 2PZEA 3AEUA 1AY0A 1NW6A 4Q3KA 1XVIA 4DC1A 5BV8A 2JIZD 1P1JA 1BQ0A 3L7DA 4N01A 4KHZA 3DMPA 4RAIA 1GUDA 5T6MA 4P82A 1UZAA 2QG6A 2J0UA 1HG0A 2PIDA 4EW6A 2VJYA 3GCXA 2GT1A 1SWVA 4O6VA 4M0UA 1FSFA 2VJCA 3E35A 3LL7A 2R3SA 1XHXA 3LY7A 3C7AA 5SY9A 2O1EA 3A1NA 1Z5WA 1NE2A 5T64A 2IK8A 3ECAA 4EGJA 1LRJA 4BZWA 1BMTA 1ORTA 1XTPA 2EIHA 2JCVA 7REQA 1P80A 3RABA 3JU3A 4HUQB 1JR9A 3RVRA 2C94A 4LBYA 4ZARA 3BL6A 3VV3A 3Q6IA 4UD6A 1MW9X 1C8LA 3UQYS 1LSOA 3H5IA 3HU2A 2ZIEA 2WTEA 1KDVA 1ISMA 3HU3A 3S8YA 1ODIA 2IQIA 2VPIA 3OCWA 1QKKA 3D81A 2WUDA 4ZZ2A 3MFYA 5BOSA 3W77A 5C4MA 1KY2A 3BXZA 4LYJA 3WKCA 4R31A 1ZSYA 4KK4A 5AQEA 1DC6A 2GK6A 3RVYA 1C8VB 4LVUA 1B6TA 4QD3A 4HZGA 3VQWA 4RTNA 3NTXA 4OB6A 5E6SB 3CUVA 1HLDA 1QV7A 1APBA 3JSLA 1A9QA 2VSQA 2BBWA 1EBUA 1QLEB 1ECPA 4EF6A 3O9ZA 4TXHA 5AVVA 5J9PC 4CEJB 1ZW6A 4WFEA 5FTMA 3ASUA 3VNRA 2QW1A 3FM9A 4MVWA 4RH0A 3NHUA 4H7IA 4RU1A 2IPMA 4C2AA 4IX1A 3WSVA 4FCCA 3QF7A 3ZS9A 3DZBA 3HCOA 3RSLA 3HPLC 3PWZA 2XVZA 3A1TA 1JTVA 3TQRA 1HRKA 1I2BA 1C1XB 4KQKA 2D59A 2ZAIA 1X8JA 2Z1UA 2AOVA 5DTMA 3IAAA 4O4JA 1W8DA 2FSIA 3MAGA 2HT1A 3O2JA 5FNVA 2FPGB 5JJNB 1V1MB 1GM8A 1GQ2A 2R9IA 4YJGA 4QOGA 1G3RA 4IOKA 3AESB 3EH2A 1F7VA 1YNOA 2HB6A 1MQ9A 4X8OA 4GZLA 3SSNA 1R9GA 1E3IA 4RAOA 2C7PA 3ZHVA 1D0IA 5DP2A 4CF3A 5HBGA 4IR7A 4EPTA 2JATA 3ZDBA 2UZHA 2R5NA 2ATEA 4KQJA 1YBHA 4G0VA 2GXUA 1V3TA 1DXYA 3LY9A 1H85A 1J20A 5K0LA 5TT0A 5JU6A 4DQVA 4FLYA 1NXQA 4U3JA 3QY9A 4Z9BA 2HZ7A 1N9ZA 1RJWA 3DOEA 2PDAA 4I1RA 2HDWA 3DNMA 2YWXA 3IQHX 2GFIA 4B47A 4IFIA 4KACA 4DILA 4YAOA 4BIIA 4F1KA 1MTZA 2HI0A 3MTDA 4COKA 1L5RA 3DLTA 4UU7A 1UFVA 5LZ2A 3RGWS 3PS9A 3QY0A 4JBHA 5MGBA 4KL1A 2IYOA 4ZI5A 4X65O 3UOAB 3GLIE 3E0QA 1TE2A 2IELA 3A04A 1H2YA 1K27A 3JQPA 2Z3YA 3F7YC 3THXA 4ROTA 1VQVA 2HVYD 3CKLA 2O4CA 2ODWA 1PL7A 2PG3A 4YCNA 3PXGA 4TXJA 3BCUA 1TC2A 3ERCA 3S2SA 2C8VA 1SURA 3EA0A 2WLLA 2C9CA 4C2UA 1PUXA 2PUJA 1OWLA 2AD5A 4GR4A 3U48A 1EN6A 4AX4A 1N25A 2IYUA 2WJGA 3D02A 4QWWA 4UC0A 4BZQA 5IVPA 2A9RA 6PFKA 5GAPK 1NXOA 1OT3A 1GCOA 1YL5A 2KE5A 4FR2A 2Q2OA 5TQ2B 2QYOA 5FEUA 2XH8A 1KDRA 1IN6A 3ZZNA 3Q3EA 3BWCA 2B7LA 3HUTA 3PI7A 2PRIA 1FNSA 4KKVA 2XCQA 1IOZA 5LKRA 1FRVA 3K0AB 2FEMA 1E94E 4EI7A 1HG1A 4KN8A 1EGHA 1X7PA 3MTAA 4E03A 2WPNA 3FOCA 4TVSA 2IE0A 3OO1A 1E18A 1FX0A 4AJLA 4TT8A 2CXQA 5EXEA 3PHJA 3HWX1 2JLZA 3W1EA 5CRIA 5HEKA 1U0RA 1ZTEA 4UMEA 3MTGA 4NVRA 5CA0A 1L0NH 3PPWA 2BFCB 2FQ1A 4UTVA 1JIKA 3BJEA 4TKMA 1PR9A 1HNWB 1IBLB 3CJRA 6CHYA 3MTIA 2FRXA 3I6ZA 1XTSA 1YJ8A 4MUHA 1NP3A 1P8AA 3MQ2A 1XAJA 2AFVA 1NBWB 5K6AC 2CDRA 2JJ1A 2BKXA 3WMWA 3OAAA 5DWDA 2JFFA 3FHCB 5TEVA 1L8DA 4KO2S 4G23A 1ZGGA 1I7NA 1V26A 5GZ3A 2VFAA 2EX1A 3MZ0A 3ZCRA 4D3XA 3O84A 3EARA 3GLFA 2P2GA 2EFEB 4JJ4A 3HBFA 1MMMA 3UPUA 3RTCA 4DLSA 1LBQA 5A0FA 2QD4A 5TQ0A 4CJXA 3D6MA 4OIFA 3L05A 4AWBA 4XYMA 4RK0A 2F43B 2B1RA 5BQPA 3TCNA 1RZUA 3U3RA 3HC7A 3FBTA 3A1SA 1WW3A 3F6BX 1FCJA 4L0CA 4MKXA 1XQYA 2XT9A 2XMGA 1REQB 5DASA 4V0ME 5HBRA 3UMFA 3R9KA 4DW1A 4GPD1 4FCVA 2VRCD 5BNWA 1SC4A 3BMXA 1NNI1 1G6OA 4PYOA 5C51B 2JFGA 2XXAB 1AGYA 2OBMA 3LLCA 4QYIA 1UFYA 4QM7A 1RZRA 3D6VA 5H02A 3ROGA 4U00A 4E2WA 1T4CA 1PJTA 4ZZ0A 5IXYA 5EPUA 4AJHA 3VQVA 2NMVA 2ZE6A 2BDUA 1P0FA 2BP7A 3ICXA 5JCXA 2BKLA 3OT5A 5C31A 3K0CA 3BKXA 2BY4A 3TNLA 1T10A 3YASA 3UB4A 1H8HD 1FFHA 5CA1F 2PZSA 2Z1MA 3IOYA 1KE2A 4N18A 3UKDA 3PU6A 4ND3A 3RJZA 1AQJA 1E4VA 1JHUA 2PBFA 5GANK 1GFIA 4RULA 3WI7A 2PA0A 4DR1B 1TEZA 3CCEF 2SHKA 3DGFC 2VP9A 2EBHX 4XVUA 2NTNA 4FZ3A 4WZBE 1KVRA 3EDRA 3PJRA 1Y48E 3PUWA 3VJKA 1XZNA 4QZVA 5BSKA 2RN9A 3QU4A 5FOTA 4HVTA 1QSGA 1A4RA 5BUCA 5F77A 1YRYE 2IHTA 4CKBA 2V7EA 2J5BA 5CM8B 3ENVA 1O5OA 5K0FA 3H3XA 3FCOA 2O2SA 3H9JA 1PNOA 5A3JA 4FBMA 3DTTA 1YC2A 3ZLVA 1XZIA 1LPSA 4RTRA 2LIVA 2Z9BA 3GLGB 4B6EA 1UOOA 4IXMA 4PSUA 2GUZA 3WRWA 2JB9A 9MHTA 1J0DA 1AKVA 1NT2A 4CCSA 2XNDA 2GBLA 1R9NA 4HBZA 2QRZA 5AVMA 3RKUA 4F45A 4X88A 4K9PA 4DA7A 1TL7C 1B04A 3LFTA 3L7AA 3MSXA 1P39A 3NBQA 1JEQA 2EJCA 3I01A 3CR8A 1R5NA 4LCJA 2QENA 1YIAA 1IY9A 1QLHA 3EF3A 4IQ4A 3OZDA 3EVFA 2I4MA 2JRCA 1KC8H 3BMCA 1GZVA 4D0NA 2YASA 3OCYA 2Z1TA 1JLSA 3O8QB 3FRJA 2C0CA 1EM8B 5FF9A 3ZG6A 4US0R 3SIPA 4Q1DA 3ZRWA 2WYHA 2V6GA 2AXNA 1U2QA 1AS2A 3KHSA 1KYWA 3NNNA 2W8BA 3CCMF 4NENA 1L4MA 5SZJA 1T3ZA 3SBEA 5CLIA 1JHVA 3DE3X 3WBKA 2PM8A 1H0KA 2P4KA 1OXVA 3W2EA 1I6KA 4OHCA 3WAJA 1TM4E 4ALNA 2ACVA 4F21A 1GA6A 3OE1A 3WHPA 4UNIA 4EF4A 2RBEA 3O47A 1VJ1A 1KYOF 2NYRA 3TLBA 1P75A 2A5DA 4PZZA 1E5QA 2CUKA 2CCGA 1BRTA 2CNLA 3TL6A 4NONA 2IYRA 1X42A 3OH8A 4ZKEA 2QQEA 3F5QA 1EDOA 1I4LD 3V7WA 3K5WA 4WVLA 1HBJA 1N4DA 2BFNA 2BR4A 3KPYA 2J85A 4ZV9A 3F47A 2YUAA 2BL4A 2LFSA 2HWYA 4Y7DA 1NKVA 5GMOA 1OAPA 1LC3A 3T9DA 2JI9A 1KDOA 4P4NA 4RIIA 2FN4A 4F11A 2JEYA 3PXAA 5CGZA 4L85A 4TN5A 2XTZA 2FJPA 1KI6A 2Q3MA 4MV0A 3KOMA 4LFBB 3HKDA 3TMYA 4IJUA 1RAIA 1VQ6V 5B37A 5HUHA 1ST3A 4PZPA 4KJZA 1I94O 1Q0LA 4H37A 1H2HA 1X80B 3SM9A 1U99A 4H2DA 4DA4A 2RB5A 1ZM4A 3CRNA 2HA4A 1EEHA 3L1VA 3R2JA 5GV8A 3DMRA 3URKA 4QNHB 4X7RA 1P1HA 2NVBA 2Y2UA 2BVNA 1CEXA 3NS7A 4OXNA 2W83A 4OHFA 1ENYA 5L3CA 2IYWA 2Q2WA 1ISHA 5JCZA 1DXHA 2I4LA 4JVOA 3BK1A 4A0SA 1HXHA 2FWIA 2H2GA 1GG9A 3HSKA 1NE7A 3AVPA 4KDCA 1F8XA 1TZMA 5KOHA 4LFAO 4P86A 3WGMA 4ZYYA 1Q7TA 5JH7A 5B1AB 1FXUA 1VI5A 5FV4A 3CZPA 1XUOA 2FMLA 5I9NA 4M0EA 1U3DA 1X7ZB 4N6OA 2L0XA 4ZIRA 4O4HA 4F5DA 4TOIA 3F5DA 4QQRA 3ESBA 2L6LA 4JLWA 3NWPA 2R6JA 3TLKA 2H92A 3IAHA 4PYNA 3PWTA 4BO4A 1ZM2A 4C06A 2ZI5A 3CLTC 4JLBA 1I4EB 3S2YA 3HMKA 2A9OA 2YYEA 4RQTA 1KFKB 3C1AA 3IL2A 3G88A 5B1BB 3ACBA 4TMKA 4ZCPA 1GKYA 1ULSA 1BOOA 3M2TA 4W5RA 4IT5A 1M3SA 1KDYA 3CB4A 4QPZA 3AF6A 2AFRA 1NJ8A 3QMPA 1GGKA 4MW4A 1N7GA 3D4LA 3RF6A 4BRSA 3TK1A 1JR2A 3TOZA 1QYVA 4LS3A 3CR3C 4C2TA 3OUUA 2ZWAA 4EATA 2VHJA 3FKJA 1Z82A 1SKUA 2MSEB 4DKJA 3CPJB 4JT8A 3GFSA 3EQ6A 3L72H 3HGTA 4XSHA 5DNVA 3LQQA 3AGPA 4H27A 3S28A 5AM0A 4DO2A 4B35A 3W5JA 4F5ZA 2X9QA 4GBED 3L9XA 1LPOA 1WDLA 2DF8A 1GZDA 3WK4A 1CUHA 3TQQA 1HLPA 3H2JA 3CT6A 5KNBA 6GPBA 2BFAA 1G8SA 3N53A 2JEOA 4PRLA 4J9YB 4R41A 5DI9A 3QFTA 5GZ1A 4YH1A 4KODA 5G4UC 1JG3A 1SQVH 1JJ2F 1KRWA 1NPYA 2VHZA 1OX6A 2A86A 5F1PA 3P0FA 3IBCA 4ODIA 2KTVA 3P2IA 4QE3A 1E3DA 1T4BA 2UYPA 5CNMA 4FSDA 2QD2A 1JG2A 4K2AA 2OA0A 1JPVA 3CB2A 2YICA 4R8LA 3IOMA 4QT4A 4NXMB 2O2EA 1PUJA 3ZU2A 1GCUA 2BAGA 4E5MA 3OLQA 5KWJA 5FA6A 3FYIB 4PSAA 2Q1XA 4IRUB 4K6HA 4LOAA 1D5NA 4OQDA 1BMFD 2C57A 3E9MA 3S0JA 3RVQA 1J0BA 3D3QA 1X52A 4OBWA 3RYFB 2O2ZA 2ADMA 2KB0A 5KHHA 5DIFA 4FNAA 2HA6A 5FTJA 3MJ4A 1VE6A 4TZ0A 1GTG1 3EODA 1E6CA 2QV0A 4FHCA 4D8WA 4TV8A 5A7HA 2R85A 2XTNA 3RFVA 3DT6A 1SXJA 4D92A 2C31A 2GLXA 1OV4A 4RFSB 4K46A 3P0RA 4G5GA 3W4IA 2J7PD 4NYJQ 2MK3A 3APQA 2CZGA 2RGWA 2G7ZA 5J2UA 3WFZA 4V0RA 2X0FA 2JIZG 3CZQA 1C2YA 3H5TA 3ESDA 2NXWA 2CYCA 1FTGA 4H0FA 1XA0A 1O6GA 2ZSJA 4PZ9A 5LZ9A 4EWLA 2PYZA 2VXBA 3D0KA 4B7CA 4KAJA 1NI5A 5BRNA 3IIIA 5EMLA 3MTQA 3VNSA 4FYKA 5HFLA 4REQA 3PHBE 4UASA 5IZCC 1VBKA 2WSBA 3FLEA 3ZY4A 1KPHA 3WWDA 5IJ0A 2ROQA 1EKXA 1PS9A 3SXUA 5DKFA 4IL5A 3LP5A 4KFCA 3N6XA 2C2HA 3KJIA 2BCCH 5HQ3A 4KXVA 4CQJA 3B8HA 1GK9A 3V32A 3KPJA 4TV9B 2BHTA 3WLKX 3IKLA 1T1RA 3GAAA 1JG1A 5A3RA 2P9JA 4MB0A 1STOA 4PAGA 3DL4A 3OIVA 1NU1H 4Z49A 4UXNA 4YAWA 1VPDA 3FPJA 3P0IA 2DQ0A 4RTMA 1QPBA 1A4UA 1KYXA 2XUAA 3RT9A 2LBTA 3FMOB 2FTKA 4AZ3A 3L4KA 3CF6R 3MGGA 3GJ8A 4R40B 1UFQA 2YIBA 2C00A 4K5QA 4I81A 4FLWA 1KYZA 3NVKE 3VU1A 4JI4B 3WJRA 2GVDC 3QLUC 4JKYA 1CQWA 1S8AA 1YZQA 4JA0A 4JI2B 1OKKD 4DSOA 3DR5A 3CYFA 1V7QA 5DN6G 4WFBV 1ELOA 2WYWA 1R0BA 3AK2A 1S76D 1NX6A 4LMBA 4BW0B 3ZN1A 2JHGA 4Y6SA 2DKFA 3MRTA 4DR6O 5KPJA 2TMYA 3RA6A 4J94A 4FB5A 2QTBA 1R6TA 7MHTA 4GKKO 1N2OA 3O8DA 4R7GA 1RR6A 2ZT6A 1R6KA 5TT1A 4XGKA 2OHWA 3F4BA 1M2VB 4ZT6A 1C7RA 3TIGA 4O2RA 4BV9A 3VVCA 3QFHA 1J07A 1KOLA 3GJ4A 3DLHA 3STUA 3FSJX 5AJHA 5ALSA 1PZEA 3IQZA 1QVRA 5K0GA 3H9EO 4L72A 1JHAA 4ZTBA 2HX1A 1Z74A 2IEZA 1BXKA 4GX0A 2AQHA 3F4KA 3I0MA 1YZLA 4IQGA 4PQFA 5LU9A 1UXOA 4MVJI 2V7PA 3TH5A 4XR9A 1A1SA 2DFVA 4EHDA 2HY7A 1BH2A 4LCEA 5AW7A 3EEOA 2QW8A 3T7EA 2OZEA 2FOXA 4QGPA 5HZMA 1OAOA 4IIFA 3SQLA 1XXHB 1JZSA 2ZTHA 1YR1A 4J1NA 2NVUA 3IAEA 3FMGA 3UMYA 2HMSA 4EG7A 1AHHA 2FW7A 1V8OA 1Q7RA 3I56F 1E64A 2WAXA 3C5VA 2HP0B 1W5SA 2BGKA 2CXRA 2DQSA 3IDQA 2OXEA 3ZMZA 3NKFA 2NU6B 4BO7A 3BS4A 3EIEA 3BSWA 3TX2A 2I8LA 1W0CA 1WB8A 1E2EA 2QTZA 4M8KA 1NN0A 1J2UA 1SQXH 1QXSA 3ONDA 2QY9A 4LGVA 4PDLA 1EFRD 2AEFA 1DO8A 2NAFA 1DCKA 3BWMA 2Q5FA 3AKEA 3QWAA 3WSTA 1SUIA 3FUTA 4ZQFA 1NR7A 1DHRA 2R7LA 1HX7A 3GZ4A 1JG4A 1VQPV 4GL2A 2D0PB 4FONA 3V2HA 2C96A 4FC7A 1ZN2A 2GV9A 2DHEA 2ZCUA 4G0YA 1NN3A 3GEEA 4K6MA 1NTMH 4HRAA 3I6YA 2YUTA 1U1FA 3CCJF 4MZXA 1D5WA 4OSPA 4L4RA 2GD6A 4RABA 5E8RA 1E3WA 3W2GA 1OLUB 2R6GA 1MX9A 5DM1A 3TSAA 3IVRA 4P2BA 3DE7X 3FYUC 3ITEA 1H65A 2B7BA 1DL5A 1PG0A 1R6DA 1DQZA 1QK4A 4WLVA 1X4TA 4JI0O 2D1YA 4KVFA 4FOSA 1XXLA 2R70A 4GYYA 3D4NA 3IT1A 3KVVA 3FNRA 2X7XA 2WB2A 3MDSA 3CF4A 1X1EA 2H52A 3VGPA 1Y63A 4BN4A 3RBXA 1H66A 4BWFB 3SJCC 3GA0A 5COBA 4TTIA 3RO7A 2WPDA 3TLYA 5LMNO 5FDFA 9GPBA 2ZJZA 3RWBA 4L6CA 2PN1A 3E5HA 4LE1A 3FCYA 3U7QA 2HRCA 2DPMA 2JNBA 4KAAA 4L8GA 1R0ZA 4IGIA 4DRYA 2NO6A 3ZI4A 2WG1A 2WHQA 1W4BA 4BP9A 1Q95A 3TW6A 1HZZA 2OAEA 1XZGA 3T7IA 4QDTA 1SOMA 1FJHA 2QRVA 1QE5A 3V9PA 3VXKA 2GS9A 1EG2A 1HE5A 1WW8A 4B4OA 4PLFA 1S2DA 3UJ3X 2J45A 3ZPXA 4AZ0A 1L5SA 3EEQA 3DBOB 2OGSA 1H2AS 1FRFS 2ZCJA 2DERA 5KAIZ 3N9IA 3OCXA 1FMFA 2X6AA 3RVMA 4BAZA 3KBOA 4DXAA 1TADA 4FMTA 4MKFA 1RWWA 2PKYX 3ELWA 4UHKA 4JLAA 4JBLA 4URXR 4AIIA 5L3FA 1YC5A 3V3KA 4B3SO 1JY8A 3IQGX 1G64A 2CVQA 1IJFA 1J2JA 3WIVA 5LUBA 3AFNA 4ARVA 1QPGA 3LSTA 3RG2A 3UO2A 2PXHA 4RKFA 2FGYA 3UC9A 5HF5A 4D4JA 4M46A 5LHGA 3HEAA 2P9ZA 5L3SA 1MVLA 3M34A 4W7SA 1KKLA 4HLCA 2FA9A 4MVYA 3VPGA 3E83A 3GEHA 1ZH6A 2HIAA 2A6PA 5J1SB 2I1WA 3X1DA 1T1GA 4BLWA 3MEQA 4BXOA 2F1IA 3O8OB 4WV3A 4UMFA 5KYKA 1ZI8A 6YASA 4P4UA 1O6CA 4MTGA 1FDUA 2OWEA 4H15A 4W7HA 1MABG 5DULA 4Z3KA 5K3BA 4NR1A 1XNQO 4GYJA 1F6DA 4EY7A 2IUTA 1PJRA 5EC2C 4OAQA 1HQCA 3HHPA 1T0HB 3U3MA 4W4KA 3IMFA 4BC0A 3DKVA 4QFMA 2IVFA 4DJTA 1NVWQ 3VGJA 5HY2A 1P2GA 4EUSA 3I32A 1X0XA 3KVNA 5FBLB 3SFZA 2WWTA 2GHQA 2WVJA 3RFTA 2OKGA 3CXCU 1S02A 4GPEA 1IBKB 2QTWB 2F1JA 2VBFA 3AFMA 3R5SA 3BVOA 4FLMA 1IBMO 3EF0A 4UU1A 4BIZA 3H0KA 4B6JA 3G6KA 3KXDA 2OXIA 1VMKA 2E87A 5F2OA 4XTCS 3WRVA 1KYTA 4GRIA 2AEJA 2ZBEA 1B1AA 4TWAA 4YONB 4EIWA 2IPOA 1FYEA 2ZXWC 3Q12A 5B1YA 4G8CA 1OFTA 1ACLA 2AOUB 1A8PA 3WQSB 4RYLA 4BGIA 3TZQA 4LZAA 5C52B 2X8JB 3TLCA 1L5QA 3TZCA 2J5QA 4GMGA 1HDGO 4Q9HA 2JBAA 2HGZA 3PSHA 4X1YA 2ISCA 4PNEA 1FFSA 3FIJA 1C9KA 3K8ZA 1V8DA 3QUBA 4TKVB 3B3GA 1VXRA 4CLXA 3PR3A 3N8HA 3R5XA 2Y4OA 1XIVA 4J2HA 3WRXA 4LY0A 1XVVA 3FOAA 4LV6A 2L42A 4XJXA 1QIEA 4HOYA 3IEKA 4Q7EA 5K9ZA 3E8BA 3HI6A 2ZVZA 3MAAC 4MYRA 2ANBA 1JPUA 2AI2A 3HKEB 4Z4GA 4YQEA 4KWIA 3SSMA 3NXKA 4QATA 1E1RA 5TGTA 2A1IA 1DOAA 3GZNB 1K3TA 1SA0B 2Y76A 1W0JA 1VF6A 2QZ4A 3JCZA 2QLBA 3BX1A 1N2BA 3SP1A 3N3AC 3SMVA 5KUTA 2Q46A 4R8VA 3L06A 3ZWDA 2UUBO 1UJ2A 2BI4A 4KLCA 1BS2A 1RU3A 3H05A 4JKOA 4D97A 3VX3A 2HVJC 1V3QE 3E22B 4KXUA 1GZ5A 3DE5X 2A9QA 2Q28A 3KZ1E 4BVSA 1CE8B 1P7GA 1I13A 1X94A 2VJMB 4MS3A 2XCOA 1AUXA 4J0KA 1NBHA 1PEKE 3JQ6A 1A95A 2WFMA 1OIXA 3VH1A 4EY8A 3FVVA 2FK7A 5I4KA 4OMDA 5JMOA 2R7AA 5EQTA 1GGVA 1DEAA 2GEBA 2QL5A 2I6QA 1PNVA 4KLNA 2WKSA 1O03A 2CBZA 2GX6A 2JKYA 2KSQA 3N70A 2QL9A 4EMUA 5KVCA 2A7QA 2IYSA 3VDXA 4MKGA 1MFZA 2HPZA 3V8RA 2CZCA 1RC1A 4IDEA 1QVAA 2G9VA 4C0SA 5B58T 5HF6A 3PF8A 1XTUA 3LWNA 1NDHA 2OSVA 5IXJA 2J9ZB 5LQAA 1OXSC 4G5HA 2VHYA 3ZGVA 3GCWA 2O0JA 1KR5A 3DZGA 2WHRA 3R7AA 4WMLA 1X7GA 3UFXB 2QRQA 5EZYA 1V7ZA 2LRHA 3EW7A 2V9ZA 2LR0A 5LP6B 2N3ZA 2FVXA 1O9GA 4IZHA 3VM6A 4H0CA 3FLAA 2C2WA 1ZIXA 4I6GA 2XCRB 2CBXA 5AVOA 1TDJA 3D3KA 4G65A 4E5DA 4N6NA 3CEAA 4BLQA 1TQ6A 1GKFA 3DPIA 1RNLA 4NESA 2ZXEA 3IGAC 5G1OA 3Q2IA 1NVPB 3IULA 4BLOA 2JI7A 1J7JA 1DFGA 4V38A 2I33A 4A8JB 5JS6A 5IKPA 3M3HA 3L70H 1QYCA 1XDZA 4P3NA 4S1VA 1KMCA 1WUJS 2J6HA 2HLDA 4KI0A 5EEHA 1QLNA 1QH8B 1Z5UA 3IEMA 5FYQA 2P5OA 5F3WB 2BWJA 4CEIB 2YHSA 5J63A 5HK9A 1E3JA 5ITZA 1UPFA 3F90A 1OXXK 4JVMA 3HDVA 3C9RA 4Y1GA 2IV2X 4P8RA 5GM2A 2Z1NA 4F4HA 5HY0A 1JQJC 5DNCA 5BWLA 3RSFA 3SEAA 4K8ZA 2BFFB 3ABTA 1GAXA 1I3NA 4PHGA 2FEWB 4MW8A 2HXGA 3SDSA 2R96A 3OX1A 3CNQS 3WGYA 1ODCA 1Z5NA 1HT1E 3W3ZB 1KAHA 1QHNA 4GZ3A 1ZD2P 3EMKA 1E3EA 3S99A 1EDDA 2ZTVA 3SICE 4Z7NB 2ZSBA 2WMYA 3PPYA 5F1YA 3N2KA 4S24A 3E1KA 3TJTA 1JDSA 4IDPA 3FMPB 3H2IA 3NDPA 4M4SA 1SS3A 3TEMA 1OAAA 4GS5A 2GZRA 3UW1A 2P69A 3WL3A 2H29A 1XRNA 4B2LA 1RAFA 4Q4JB 4FWIB 4AJJA 1XDSA 4EYKA 3RT7A 3TTWA 3BAZA 3RRXA 4CNBA 3RW9A 4DPKA 6AT1A 2OY0A 3UQZA 2AFIB 4LTNA 3AWDA 4JOSA 4QXAA 1GTZA 4R2MA 3INRA 1Y8CA 3F8TA 1GN2A 2HJWA 3NOVA 1V47A 4LXXA 2PFSA 2O48X 1MRNA 2O06A 4PQYA 1WU8A 4WOJA 5GQSA 3QW4B 3OTHA 3Q7QA 1NJ2A 5FEMA 3MRVA 1Q21A 3JZFA 1QH1B 3WP0A 2WJ6A 4U7JA 5D85A 3WMEA 2FPXA 3QSYA 1M1YB 3Q9SA 1D2NA 1OH6A 3IMPA 4PC3A 5EPEA 3GN1A 3W1WA 4EB6B 2ZT7A 2X8AA 5DWVA 3PEWA 5CXSA 4FYJA 3PNSA 4BECA 4DV3O 2DYRC 5CDGA 1SOWA 2YV3A 1W1WA 4NMHA 3EW9A 3TLJA 1UM8A 1V2HE 3VR2D 3B9PA 4LAFA 1J8QA 4DPLA 4UM9D 3CX3A 3ZGZA 4OVKA 1FXVA 4AKIA 3RQIA 1UBOS 3NHJA 4CIAA 2BFBA 2X0EA 5BN5B 3AI3A 2HMWA 3LO8A 3JS5A 4TVKA 4AFNA 3B6EA 5KVVA 3QSGA 3IT0A 2GNPA 5DI3B 3TB4A 1B3QA 1GN9A 3K9SA 4AW9A 3DGEA 2C77A 1U7TA 1XEWY 5D87A 4QASA 1WB6A 2CFIA 4GOLD 1AN0A 1ORHA 4PCAA 3UPDA 2BH2A 5IKEA 4PSVA 2VXCA 1G8YA 4D9GA 4Y8VA 2YXYA 3C1UA 3U4AA 5CJ2A 2P9YA 4PNPA 1CUGA 1UBMS 4TS4A 1P77A 4GZRB 1V54B 4PHFA 3DHWC 4UEKA 1XJQA 4L4UA 3MUFA 2VLIA 4X91A 3ASOC 5KQSA 1R74A 3QFSA 5F1KA 2E4WA 3S0YA 3K3WA 4C5AA 4BT5A 4B73A 3RSOA 2E75B 2QTAA 2I87A 1Z75A 5AW4A 3QX9A 4Z0NA 3OY2A 5BORA 5BMVF 4R9UC 3QVLA 3LTEA 4YGYA 2ZBVA 4MB2A 1TAUA 1LA2A 3ZV6A 1RQRA 2V6JA 3I12A 1RJGA 2OFXA 4FN5A 3JAMN 3RYIB 3KQWA 1IDOA 1CSEE 3EFEA 1VQOF 3AVXA 2IS2A 3WL4A 3HCNA 2ZRNA 1H2WA 4NYKA 4IIUA 3ADKA 4J1TA 4DUYB 1JMKC 3MCWA 2X4DA 1XZQA 4IXTA 2X15A 3JTMA 5IDWA 1XELA 3TLAA 5FLXN 1G5QA 4ID3A 1FYVA 1Y67A 3FIUA 2UUCB 3N3BC 3Q87B 1HL7A 3M4XA 2LKCA 2BLLA 2VJOA 1P9LA 5EE9A 1M8PA 5FPKA 1BA3A 5FTNA 1QS0B 2H4HA 2VJPA 4DA6A 1MO4A 4HNVA 5GJCA 3HA3A 3IUMA 3B78A 3C5EA 4AIRA 4BMVA 1NV9A 1DTWA 1N0NA 4S12A 1EHIA 1H2NA 4OGLA 5K45A 1PR4A 1NR1A 3HXMA 4LPSA 1FTQA 3VKUA 1LZKA 5GONB 2HEIA 3EZFA 4YRDA 1MXFA 5KQLA 3V00A 4TX1A 1AKQA 2HTEA 1RMQA 1G21E 1UP6A 4LWZA 3GL9A 1DMRA 1ANKA 2WU8A 3AFIA 4ZCMA 5IAEA 4FBGA 4FFMA 3ZVNA 3OFVA 5EZQA 1E0AA 1U40A 5KA5A 4DADA 3JQFA 4EGFA 3OCVA 2QPTA 1ZL8B 4MW9A 2CDYA 1OXKB 5H83A 1ODTC 1I7SB 2PJUA 3KT0A 2F90A 3PSAA 1H4QA 5DGIA 1FEZA 1JPXA 4QSHA 1Z26A 2BTOA 1KH1A 1KJJA 3GNTA 4HYEA 1Y6FA 4M8LA 4C8GA 5FFMA 2CL7X 2NAPA 2I6FA 2BFDA 621PA 1FUIA 5ESXA 2Q6OA 4CHGA 1C1HA 4YGXB 3P45A 4C01A 3AC0A 2M6LA 5AKKA 1PZFA 2IBSA 4WESB 5KYYB 3RLFA 1RE1A 4XI9A 5HJ2A 2C2BA 3G2OA 1SRQA 3AEIA 4ILKA 4IIJB 2CVFA 1GDTA 1QU2A 3HB9A 4JJ6A 3V8BA 2PUBA 4NMMA 4P4LA 1U7DA 1DK1A 4HD8A 4KDEA 4MJLA 3GVCA 1RXIA 1XALA 1AG9A 4HH3C 1L7DA 4ZYLA 4JR1A 2BDTA 4FJ0A 3L18A 1YF3A 3AG2C 4AUNA 4DYVA 2Q73A 3VZCA 1G3MA 1P9RA 4QTZA 2YI9A 5EIEA 1NVVQ 3QUQA 3GOHA 1CRPA 3MJFA 3U6BA 3PCXA 1F2UB 2ZJ7A 1IATA 2W2KA 1OCCC 3OBIA 1ODFA 1MTOA 4DR2O 2XSZA 4H0LB 2RMKA 3M4ZA 5IAJA 4C87A 4DQXA 1LX6A 4A10A 4RKRA 1C3JA 3N2NA 2XY4A 3EG9B 3X2QC 5ADWA 4IGGA 3F0FA 3WFJA 3SU8A 2NUBA 3NJ4A 1CJMA 1ONSA 1NMZA 3BJIC 2HJ9A 3I6MA 1Y4UA 4IHJF 3STZC 2PH5A 1O6BA 1QJCA 3S7ZA 5BO5A 1DPGA 3EXHC 3O1LA 2R11A 2FYTA 3V6LA 3KQKA 4K6FA 4ZVNA 5F2VO 3DEKA 4R98A 2PKQP 4EFBA 4NYMQ 4KPEC 2OORC 3OICA 3JQBA 2A0YA 3TLGB 2V3CC 5LMUO 1V6SA 5KQMA 3BMNA 4UNNA 2MIIA 1E3QA 3PNVA 4CF6A 1N8RW 2ENWA 1G8AA 3EXIA 4NTZA 5AHOA 4FZ5A 3AO0B 1LH0A 1YQTA 2VTVA 3DC2A 4BNVA 2GZMA 3M1AA 3UK7A 3KQNA 2AW5A 3TMAA 4G1FA 1RDFA 4RTLA 4RTOA 3M6XA 3L8HA 1RLJA 2HQ1A 1SHTX 1L5WA 4DLLA 2BH9A 1O94D 3PHHA 4YJ3B 3T99A 1NH2D 3W2TA 4ZT2A 4I1OA 4KBFA 4KGDA 5AIBA 5JZSA 2VL7A 1PQPA 2QRPA 4EHHA 2WWIA 5JTTA 1V7PC 1Z9BA 2NADA 2WFAA 3V7YA 4M83A 4ZGGA 4QBHA 5HFJA 5HQTA 2B8TA 3QE4A 4LYHA 4PONA 2O2XA 5ALNA 4Z1OA 1SR8A 1IURA 3DKKA 4GKVA 4IHKA 5C5CA 4K9SA 3EVTA 2R1ZA 4F2DA 3DMGA 1VQ7F 1T36B 4O2BA 5EWMA 2IWRA 3A6PC 4CW7A 4WJLA 4DV1B 2CLIB 3ZMVA 4CUJA 5A5VA 4MV6A 1SPBS 3FFXA 3H11B 1NRXA 5EBMC 1SZJG 2IHBA 4BRUA 3UMCA 1PJZA 1PJLA 5TARA 3RIXA 4E12A 1HETA 1OFVA 5DCYA 3CRZA 1XC7A 1IMJA 4XGRA 3NWEA 4WFAV 2OFPA 4W5HA 4MVJP 4MTFA 4V1CB 3CMAV 4MDYA 1JUDA 2JGUA 2X0NA 4H7DA 2F8SA 2ZIAA 4UHCA 4BFVA 4IV8A 1VL2A 3ZDAA 2AIFA 4FM2A 4NY1A 3HBMA 3BFVA 4XVQA 3R4CA 2FPIA 3QPDA 4JP5A 1J1ZA 3JSNA 4NJEB 3CVJA 1JE1A 3R7SA 3AJ8A 3K94A 2ZZKA 5I8PA 3CLVA 4BVRA 3SOPA 4UUMA 5FJJA 3DBHA 1KI2A 4C0AC 4R16A 1DEHA 2ADQB 4I0WB 5ED4A 3D6HA 2F48A 2YHBA 5A5DA 3T7AA 5ALOA 3DA8A 2Q62A 4OHYA 1EX6A 2XT0A 3WYFA 4EHFA 4LJ7A 3M99B 4GW3A 4JMLA 3ZQJA 8ABPA 3HH8A 1K1EA 5HS6A 3K12A 2HFJA 4YRJA 4MUNA 5TLSA 1YH3A 4WY2A 3AMVA 4ZK6A 1LU9A 2CE2X 4UEOA 3JASB 5EJ4A 1WXHA 4RV9A 2XMBA 1HFJA 3BE5A 3HJCA 4FGZA 2C5BA 1O5IA 3PJFA 4TSKA 3UWOA 1RC0A 3FD5A 4MYDA 3CCBA 2PRKA 4NZOA 3RFRA 2LBPA 3MWEA 1UBLS 3ROEA 4D5GA 3AG6A 4R1LA 3QH4A 4J0IA 5HMMA 1JQ0A 2VWPA 2DWUA 3RUCA 1U2GC 3TG8A 3ZP7A 4U3FH 1EDBA 1YDMA 3NCTA 1Z6TA 2JGNA 3IT3A 3OZEA 3NW9A 3KTAA 4B8WA 2FFQA 4BP8A 3RA5A 2YBDA 1JFFA 2B0CA 4C3UA 4M6WB 2OAGA 5FCDA 5C9ZA 5DNYB 4JVNA 1FP2A 1EBOA 3OJFA 4MT8A 4IJ5A 3SHFA 1ZUIA 4FHGA 1FFTB 1PV4A 4J4TA 4CQNA 1N9GA 2AHOA 2HU7A 3CCRF 4M99A 3QLJA 3OECA 2I1QA 5CEEA 3FYSA 1VKJA 1KQGA 1Q1BA 3Q3CA 3KRTA 5H82A 3GH3A 3Q9LA 3Q8XB 5IT4A 3W5IA 5IEJA 4RACA 4ARZB 3BSFA 1R64A 4IINA 4D8TA 4EO9A 3E9CA 1QGZA 3PE6A 1YOVB 4TLBA 1QP7A 2AQIA 2WMNB 3QO5A 4RLQA 1RWNA 3AHEA 1T35A 1OAKA 4B4WA 2RGBA 1PW7A 2CLOB 3A3NA 5LA6B 4EG4A 2NV0A 4J29A 3WGZA 3G8YA 1H22A 3ITKA 3L5KA 2JFYA 3FKSD 1D7OA 2VHUA 3QVGB 4KMOA 4PZLA 4XYEA 4QG7A 3QU7A 2ZETA 5HCNA 1JHXA 4NWOB 2WAYA 4MR7B 1P7PA 3D8UA 2W93A 3EMVA 1D04A 3EGXA 2DH5A 3HBJA 4XFDA 2CXPA 1QOZA 2FMXA 4KMRA 3HYNA 2XIQA 2C20A 3H86A 3HCFA 4DN6A 5LN1A 4EQ6A 4OGQB 3T1OA 3FG9A 1QO7A 4ZAWA 3P19A 4ND5A 2F3QA 3NEAA 5BR8B 1AQIA 5JAZA 4L78A 4X20A 3RS9A 4WA7A 2IY9A 3S40A 3LZDA 3PFIA 4XGIA 5TQVA 2NQTA 2XA9A 1FMLA 4JJ8A 3HJWC 1XCOA 2BMDA 4EZEA 4IX9A 2HO5A 1DQRA 3RS0A 1IV1A 3EQ2A 4PPFA 1IOLA 2CD7A 4ZVKA 4G0MA 1KNKA 1GM9A 1FPQA 1M2EA 3IUQA 2HPVA 4NCJA 1YA6A 2J7KA 2B21A 1GZ6A 3WPXA 1U2PA 2DSTA 3ILVA 2Y69B 1P91A 4B7XA 4X71A 2WLMA 4FZ0A 3IX7A 1Z28A 4FMCF 1JX9A 2NSJA 1M33A 3FSGA 4LMPA 4M1YA 1E9FA 4C1NA 1NVUQ 5EMNA 2XLBA 4PLHA 1PFGA 1X70A 1R4MA 3UICA 4EY5A 2I62A 1BX3A 1N1EA 4EM6A 4FK5C 2V7TA 3QRWA 4NOLA 3W1VA 3R0VA 2HP3A 4B43A 2REXB 2GZ3A 2Q50A 1BKYA 2Q0HA 2CB9A 4LJAA 4Z8XA 1AZTA 2QKCA 2P5UA 3MTJA 3O31A 3EGVA 5GINE 1P9NA 1ZD8A 3BBPA 3LW8A 3CH4B 4MO2A 1OT5A 1DG1G 4M53A 1T2NA 4ZI3A 2QN1A 3RU7A 1U2RA 2JVKA 1A7JA 3PICA 1ZUHA 4BV8A 1PR0A 4E09A 3FDFA 2Q0OC 4FDMA 4H6WA 1PP9H 3UK1A 4ZOCA 3BDIA 4K88A 1RM1C 4QT0A 2QL7A 2ZSHA 1GQRA 4HDNA 1VJ5A 5AUOB 3ZVMA 1PEAA 3QKSA 2Z1EA 1WA8A 1UOPA 1YZBA 3RTEA 1T8TA 4UDOA 3KSRA 3HN2A 4KTVE 1YB2A 1CUEA 1L7RA 3UAVA 1UADA 1DKUA 1QZZA 2CKMA 4MOWA 5FUQA 3HCAA 2CJYA 5G4KA 2EC5A 1DOZA 1ENOA 4JP2A 4R8SA 4QDUA 3U0BA 4B5KA 3RGBA 2IZ1A 3TO5A 1CJUC 3BE6A 3S03A 3CCLV 1PTJC 1WE2A 2G1JA 4B3JA 3P2KA 2H1RA 5E2BA 3IXLA 5B1NA 1Z0SA 5TPZA 2DFNA 1PHRA 3WO1A 5IK2A 4L8VA 3BHNA 2GEVA 5G1PA 1BW9A 1TCCA 2Q6IA 2OC9A 2RBKA 3CC4F 1DWPA 4BP1A 1J0AA 1P73A 3L92A 3TECE 5GIPC 4U1RA 1Y5MA 2NO7A 3IMKA 1CKEA 1I0IA 5ED0A 5HS4A 2VBCA 3JXEA 3FR8A 4IXNA 1FB5A 3IBTA 4ESOA 2RK4A 4NEQA 4L02A 3RJ5A 4Z1MG 2DQZA 4BTLA 2IXGA 4OJNA 5I9TA 3K0BA 2IYNA 3L9DA 4FVMA 1OE0A 3PEVA 3VHXB 4ZU1X 3HYLA 2NNUA 1EPUA 4V3BA 3P3NA 3T4ZA 4RDIA 1DTSA 2M6RA 2C3OA 4BX9A 3V4LA 4RDCA 5TMDA 4A82A 1P1FA 3N07A 3T7TA 1VBFA 1SBZA 1IOWA 1N6RA 2XB6A 3JQAA 1MIOA 2PX4A 1O95A 2GFHA 3KSDO 2ZJ2A 3UAWA 1UBSB 2X0DA 4DA0A 1KH3A 1GPYA 3Q8WA 2JW5A 1K8AH 2Q5QA 2F9FA 4DJFC 2QA4F 1BQEA 3VI6A 3PR2B 3RB8A 4LZNA 3R20A 1T26A 2QTHA 3AKCA 1MZVA 4GYWA 1YBVA 1E3MA 1EVYA 4LV8B 3VKGA 1V35A 5A6SB 2HK9A 3H6GA 4BMPB 3K70D 2JGMA 3V5NA 2F66C 5CD1A 3HV2A 1DRUA 1JEDA 3KDSE 4CM3A 1YDHA 2O7VA 4WKOA 1LLQA 4LE0A 4BV3A 2D7CA 5DNUA 3Q7TA 1BEEA 5CW2A 1M2FA 2EX3A 3S1AB 5E2AA 3Q7IA 3DQZA 2VQSA 5A7GA 4F96A 3U44A 3NMUF 5A0TA 2AEMA 2X77A 1GG5A 1PFKA 1BN7A 1B14A 2D3OW 4I5IA 3KD3A 4LRQA 5HRAA 4MPRA 3ELBA 3VU3A 4NCAA 2YFHA 3ZY6A 1GA4A 4RESA 3ZGNA 2H7XA 4QQ8A 3RROA 3FCSB 4EA7A 1H1LB 3LUGA 2RB9A 4UE6A 3CWQA 3DCNA 2C2YA 2DWCA 4JV5B 1V16B 3C70A 3PLAC 3SJUA 3VR6A 2IEAA 4I1PA 3T5PA 4KYTA 3L43A 5IY5B 1W47A 2IXBA 3QXGA 3HLKA 2OHOA 4JLVA 4B6QA 4ZVUA 4MYSA 4EJSA 1EVEA 4D80A 3P94A 4HLQB 1E89A 1LPNA 1FD9A 1ONPA 3KSBC 3K31A 1B1CA 2AOXA 4JHLA 5AJZA 4YQYA 2PYDA 3MHTA 1D1SA 4FJCC 3H87A 4JJEA 4FLFA 3RH0A 3BORA 3RU2A 3A58B 1F1JA 1JI3A 2EBFX 3CH6A 1XDGA 3KJGA 4ER3A 5KYUA 2BEUA 3VRHA 2WUVA 1RQNA 4RSMA 4UHJA 3TGWA 2EW2A 1CERA 3O3CA 4H3KB 3RC1A 2OWOA 2PL1A 3EQ8A 4X3OA 5DECA 4GPTA 1AHIA 1E5LA 4URWR 5ALQA 2WJHA 5DV9A 3TAHA 1PWEA 4OPMA 3WGNA 3L7LA 4J49A 5FUYA 1U0HC 3ABOB 1CUIA 1TIPA 4MQUA 4DBLE 3D5TA 1RPZA 2JS3A 4EKNB 2H9AA 1Q14A 2YXLA 3FAVB 5HUQA 1C8BA 1JFRA 1J39A 2E2WA 4UXHA 3BF7A 2QLLA 3UIEA 5LDGA 4Y2PA 1TVCA 3NWBA 2QDOA 1PD0A 1W36C 4XDJA 4MW1A 4G1MB 1HDCA 2RKBA 1LGYA 2P9FA 5J2TF 3PAFA 3FH0A 2G67A 1UJWB 1UXJA 1YMVA 5C8YA 3OIFA 3VSAA 1HR0B 1AXRA 1TT5A 3W2FA 4ZA2A 3WNDA 1QP0A 3KV3O 3QM1A 3FN4A 3G8BA 1NVMB 3EZ9A 3L8EA 5IASA 3Q7PA 2RI0A 1L5KA 4HVAA 2QRKA 2RHLA 1RKXA 5TISZ 1ORIA 4IXWA 2R8EA 1DE0A 1E9VA 5CYFA 2PBRA 4AJ9A 4EHLA 1MJNA 1NBOA 5IKMA 3T7RA 1E92A 1T29A 1FVHA 3R3ZA 2HEGA 4YRFA 3UC5A 4G26A 3JQGB 3T3DA 4I4LA 3ZIDA 3EGDB 2RIPA 3R66A 1A5BB 2QTOA 1GNVA 4KI7A 2OCKA 2QJRA 4G4GA 1RZVA 5IE9A 1PAUA 5TR9A 4WCVA 1FP4A 3B2NA 3EIUA 1XTKA 1I01A 4X41A 4YLYA 2P6MA 4X3MA 1W6RA 3AM4A 2V59A 3THWA 4CKEB 2O8CA 3JWIA 1KMMA 5LD2B 2EFYA 2ZZMA 2NQ8A 4AWAA 3VPBA 3ADBA 3FROA 2R8OA 1XFDA 3WNCA 4B3RO 2OCBA 3B1JA 1H8EA 1CETA 1JFSA 3B40A 2QTCA 3QVJA 4KITB 5A1TA 1VGRA 1OASA 4MPPA 2NGRA 2D1FA 1GNQA 1R8SA 4Q93A 3ZW7A 3L0DA 2GCIA 2ZIWB 1X19A 2P2YA 3VQYA 4KMMA 2NACA 4JCCA 4NPAA 3BMQA 1PK8A 2X8LA 5KYWB 3KIZA 1X1AA 1LTHR 1HH4A 3ZN0A 1E0KA 4B6OA 1Y98A 3I01M 2RCYA 4ZPJA 4QLOA 2YXEA 1XMOO 4J7CA 2UYNB 4G9GA 1SCIA 4Q18A 5DFAA 4UATA 4XVHA 3TCUA 1UJ5A 1W5BA 1VPLA 4BUCA 1OFUX 4P35A 4F86A 4Q9DA 4EJ0A 2QX7A 5FH9A 4OXRA 2BFEB 4E6EA 1NBEA 3SPHA 2N04A 2GAIA 2JKVA 2I91A 3HZHA 5DLDA 4BRWA 2X40A 2PX2A 1JQ5A 1CQJA 3C3TA 1NC3A 4EDFA 3HXPA 5K3CA 1BSMA 3NORA 1NOKA 2P9QA 4PSCA 4ZOLB 2A0FA 4BO6A 4D81A 4HFMA 4Q1FA 2DWQA 2NSDA 1BEUB 5SZHB 5KU1A 4C7BA 4DKXA 5JJCA 2AI3A 1W73A 2VP4A 3IHKA 1TTTA 1RYDA 2RGDA 3FFAA 4TMVA 1QQCA 1KVSA 4Q0MA 1NZJA 2FPLA 2A3RA 4L3WA 1ENPA 1C9JA 2OV3A 1QF7A 3DEIA 1GRNA 4FQ5A 4EY6A 1VLJA 2QWNB 2ZIGA 5CBFA 1AA9A 3UJ9A 3OIDA 1NBIA 2Q5HA 4CBCA 3X1WA 3A06A 2BI8A 4OI2A 4BWVA 2QVXX 4RUEA 5T8KC 4RA6B 3IKVA 3WJ1A 5I45A 3QMVA 3MMSA 4C05A 4G24A 4WK0B 1RYYA 4F7WA 1T9GR 3GRUA 2HAEA 1GN6A 1NW9B 2L19A 3ZRXA 2PV7A 5IYCO 1I3KA 3A0RB 5BVGA 2X4GA 2GKOA 5HP4A 3RK0A 5JQWA 2JI8A 5LUAA 3ONVA 2A5FA 4P7BA 3NASA 5C1OA 1QC5A 3KPUA 2I6GA 4FD3A 2QT9A 3SF0A 3WA6A 3JYCA 2Z4SA 4N3AA 1YOBA 1XDUA 3COPA 4P7KA 2NP7A 1PT7A 2C1EA 5C8XA 3TPFA 1SEVA 1QDLB 5LYYA 3OPYA 3E8SA 5WRFA 2WVHA 4MLPA 2IU6A 5E6RA 1YHNA 2ZUWA 1FLAA 4AZTA 4D4HA 2DUUA 4L28A 1DV2A 1Q15A 5CR9A 3QWFA 2BOBC 4YP5A 4NV1A 4YRBA 4JSRA 3GLQA 4MQFB 5FI1B 3OM3B 3FNIA 3NPAA 4IJVA 2YXHA 2Z4RA 4RL6A 1X7OA 2C9ZA 2W2OA 4I1SA 2IP4A 2XB4A 4ADSG 1OV6A 1NDQA 1XKQA 1A9TA 1OX4A 1QP4A 2QW0X 3O75A 3A9CA 3H5NA 2ARKA 3IBSA 4J11A 1XK6A 4F4LA 1RVDA 2OENG 5TS2A 4ETMA 4W1RA 2X6TA 2QIPA 1XD2B 5JVDB 2A4MA 3HLYA 3QUSA 3NDBB 5F3RA 2G80A 1FOEB 2NMUA 4Q19A 2HM7A 1KHTA 2XDAA 4JTDB 3TQIA 1HT3A 4CIVA 1P5HA 3F4LA 3UB3A 1ZUNB 4DK1A 1E5XA 3EULA 1WXFA 2JZNA 1W4ZA 4ZJUA 4OPHA 1RTTA 3ZMTA 2FZVA 1AGRA 5BUSA 2QRGA 4L2IB 1N2CB 1TLTA 4N1AA 3QKIA 3C9SA 2H57A 3CLUD 4A4DA 1G42A 4Z2AA 4L9RA 2QU7A 2X8BA 4UNPA 4CYMA 4J3JA 2NR5A 1P3DA 3BIWA 1CZRA 4WH0A 4HVLA 1EJ0A 2OT5A 1MPTA 2YQ4A 3P32A 3CTPA 5K0ZA 2CB0A 2GTAA 1T0UA 2IW3A 1TD9A 2Z98A 4GG1A 2AK3A 1OWPA 1N2EA 1D2GA 1KDPA 4O2AF 1M2HA 1D2CA 4D4IA 2H1LA 2YUIA 2CFRA 5AKJA 1CRZA 1ZP6A 1W9HA 1DPFA 5L3QB 4JGGA 4OQEA 3O4IA 2YWEA 1WBDA 3KUKA 3CW9A 2C78A 1BU5A 3G80A 1AUOA 3ZI0A 3GPBA 5KWVA 3JZAA 2WJJA 2FE4A 2G0TA 1I2MA 3W5UA 1UFKA 3IHTA 3OMNB 3OKPA 4NWIA 2UYCA 2OG2A 1F5SA 1XILA 1RXSA 1J7HA 2OUKA 4D4MA 3U4DA 1C3VA 1VG8A 3P9IA 3L6OO 3MWFA 5JQGA 4MUBA 3QHDA 1CCWA 3T3EA 2O8EB 3GLUA 3F5MA 5CYOA 4AJEA 2FU5C 2QPOA 1GZ0A 3LPNA 5EHZA 3NAZA 4UVIA 1T5IA 1I2DA 1ZH0A 1RJEA 3RNOA 3H5WA 3FYDA 2KBFA 1E6MA 1HORA 1ZY2A 5K6TA 1U90A 1U3FA 2JFWA 1H8HG 1JYSA 3BMOB 4PO1A 1UWCA 5TIIA 3FXAA 1KNJA 3EJWA 3ZGLA 3K0FA 1GGJA 3PVSA 1JNYA 2X13A 3K5IA 3CW2A 1Y8QB 3B6JA 4CIWA 1Y42X 1N3YA 1PX0A 5EGSA 2DYSB 4EK9A 2XTAA 5HDBB 4MVJD 1AKTA 1PKEA 4F3YA 3SLKA 1R27A 4KPUB 3ETJA 2EZUA 3VSCA 2Y48A 2OBLA 1CQPA 1VPTA 2RH9B 3WV4A 1P7ZA 3GVMA 2GM5A 3NNSA 2HZBA 1UQTA 3BQ9A 1I5RA 2GDZA 1DTEA 4Q03A 1DT5A 2Q6LA 4GI7A 4OBBA 4GE3A 1YB7A 5LBIA 3LLVA 3TN7A 1XVTA 3RVPA 1FDWA 5KS2A 1C4XA 3FPHA 3FYHA 1VLLA 3LHSA 4IDAA 4W9NC 3BCCH 3AFGA 1J90A 2FMFA 4BLTA 4RSHA 4OI4A 4RPHA 3RARA 3L04A 3O5AA 3ELDA 1RM4A 2YHAA 2VF8A 1V2GA 3ZQUA 2WJ3A 4CQMD 3NCHA 2H85A 1LBIA 1W2BU 1FW6A 2QLMA 1GGNA 2QSUA 1Z68A 1FTNA 3INGA 5B6IA 4QBKA 4ZI7A 3B7WA 1FFCA 3BRWD 4AULA 1U0EA 1RYEA 1JRLA 2CHTA 5GM1A 1THZA 1JDVA 3LPLA 4H77A 2A9PA 2GLUA 2FN9A 1WL8A 3RS3A 4CIXA 5KNCD 1S72V 2VNIA 3PX3A 2VA8A 2MYPA 5FHQA 1JALA 3I23A 5JS8A 4XUGB 2W90A 3A3OA 1ENVA 1NTKH 3O82A 2CWJA 4AMBA 1N7JA 4NJMA 2YHIA 3GYGA 1CRLA 2ZUCA 3OFND 2OKCA 4KRGA 4QGBA 1SU6A 2DBZA 1LQ2A 3OTFA 1T9CA 2HOQA 2VYND 1GTJ1 1CVLA 2OV4A 3F96A 5FJIA 5DOVA 4UUPA 1MUUA 1A9RA 3C6XA 1WIWA 3VAYA 3FNBA 2MSLA 2AKYA 1S3JA 4DYDA 2YVAA 4B3DA 1VYVA 2GN6A 4XLZA 3DZCA 1KQFA 3ABLB 2DHCA 3LT2A 3AOEC 1A50B 1MEOA 1MD9A 4MTXA 1ZD1A 3G85A 4ZQGA 1XPOA 5DVZA 4KO4S 5M04A 1EG7A 4AI8A 3F6CA 3VHQA 1EP3B 4PR3A 3E7DA 3UTCA 4F04A 2VF2A 3TGUH 4TRNA 1OYVA 2YFKA 2EP5A 2YC0A 3HBNA 3FWPA 1KZ1A 3ZCXA 821PA 1XZMA 4RVDA 2L26A 2QMUA 3SPJA 5EJGA 4A16A 2IHKA 4N4AA 2ZB7A 4K6OA 2NW6A 4AQYB 1KEZA 3ZUPA 3S2EA 5E4FA 1Y3FE 3H7AA 4TLMB 3ZV5A 2FOLA 4C3VA 3GFQA 5EHNA 3A6DA 5FBWB 2OK8A 2X2OA 1OLSA 1N6LA 3V2UA 1MH9A 2V7XA 4D9CA 1AK2A 3BREA 2D0DA 2YNMD 3GIWA 2NZWA 2FN3A 1QCEA 5AI8A 4G5RA 5TV2A 1EFPB 2QOEA 2R5FA 1H6CA 2FZEA 2ZWVA 4FS8A 3GD5A 1UK6A 5IAAA 4Q16A 4ZYZA 5CVJA 2PS3A 2B1QA 1V41E 2VYCA 1SERA 2EYUA 4BMOB 1G41A 1J97A 2HFKA 1HTTA 4YUVA 3WTCA 3ID6C 3PUIA 2ZR8A 4JASA 5IYDO 1N5LA 4ZZIA 1EBFA 4L5YA 1WPGA 4KUMA 4QQKA 1WMSA 5E9WA 2X1LA 5F7OA 2WHPB 3ZGXA 4OSEA 5DM60 2PMDA 3WGHA 3CXHF 1TJ4A 3UFBA 4NZZA 1M34E 3D2LA 5I7HA 3V2GA 5JD5A 3KJZA 3SWWA 2IOYA 2IH3C 4MPDA 1V11B 1VYHA 3C15C 5EAIA 2P4SA 1TZJA 3VC3A 4F4IA 2ZBRA 1S2LA 3GEIA 4DR7O 1PJ2A 4L76A 2QVZX 4ENVA 4IL6Z 5B3SB 3AI2A 1E77A 3ZLUA 3AR9A 3R3HA 2Z5GA 3JAKB 5LL6Y 4UV8A 2H59A 2QWQB 2JRLA 1VLVA 2CXNA 2BMFA 3IB3A 3IPYA 4OIMA 1QYDA 1ZNXA 2QP4A 4JU8A 3AEUB 5FL7D 3F67A 3ED1A 1KERA 2P30A 5K6AA 4ER0A 3OSUA 3DCJA 3UH1A 1KH2A 3LKZA 4MKRA 1I3CA 3KOXA 3P9ZA 2J0UB 1OPRA 3RR2A 4NYJR 2BLNA 3GAZA 5EESA 3RNLA 3GHZA 3G0CA 1FDRA 2PWPA 4YY3O 2IFTA 2XVXA 3TSWA 4N6GA 2VHEA 1UIMA 1ZEJA 1ZONA 3LWRC 3MJHA 1GADO 4Y2SA 3TVDA 1FDIA 7REQB 4B62A 4XWTA 2B5WA 2VP3A 3QPWA 4S35A 5F73A 5CEFA 1E59A 5C2JB 1VQMF 4A0RA 2VWKA 4LECA 1Z8FA 3STYA 4EW3A 4RSGA 4NU6A 3O26A 4HDMA 5KDDA 4PQGA 4M38A 1V7CA 1YV9A 3CURA 2J4CA 1NSTA 2EKDA 4YA6A 1UFIA 5LLTA 2XHBA 3PC4A 2IV7A 2A2ZA 2IW1A 4JUCA 1LDMA 3DPSA 4MVUA 4R0NA 1J06A 5BOSB 2G0AA 4ZODA 1RCFA 2QMQA 1NQWA 5SYNA 3D8HA 3WLNA 4G8BA 4BVAA 3NBXX 4OOFA 4DT1B 4XB6B 2WNHA 1K75A 3VYSC 3UAZA 1TGVA 3E3LA 3OZVA 3R0XA 2QNIA 3OLXA 4DR4B 3FD6A 3MBOA 1RYZA 5JSZA 2O5EA 2RJOA 2ZULA 1NYLA 3H2ZA 3OHPA 1NUUA 3B12A 5DXJA 3DP9A 7MDHA 3SIRA 2XRZA 5F7JA 3G59A 3NH9A 4EBBA 3URMA 1U0OC 4DXHA 4TZKA 1U0NA 2DM6A 1M5IA 4BQIA 5HZGA 4Z9AA 1VMIA 3TQOA 1XRPA 1BMFG 4JS0A 2BHLA 5BXQC 4MRVA 3W5BA 4DSTA 2Z3WA 4Q15A 5ICCA 3M1YA 4P32A 2PUGA 5CDFA 2XXBA 3II6X 2FDRA 2EKZA 1EP1B 4C22A 1GRQA 2ZYAA 3IKFA 2DR2A 4QICA 1R8XA 1KBHA 2ZJ6A 5F51A 3QXJA 1PSZA 2J0QA 3PTAA 5DN9A 2P6YA 5JADA 2VK8A 4O4JB 3D2AA 2HTFA 3M5CA 1SUFA 4IMIB 2ORYA 4MQEA 3UMSA 2WIDA 1QRTA 3S70A 1G9TA 1RCUA 1YHQV 4YJGB 4U9UA 2BZGA 3NX4A 5EOVA 4AN4A 2AFHA 1NW7A 1EDZA 5DYIA 1QE3A 1L6IA 4CFYA 3LL4A 4TWZA 1XTRA 1O2DA 4HDAA 2Y0DA 1UKZA 4IYJA 2QT0A 3A37A 1FLNA 2F1MA 4PRZA 1T9HA 1TFUA 2QVBA 3PNPA 4ENUA 3EIXA 3X2EA 4JI8B 4Z86A 5ALGA 3B6ZA 3C7KA 2ZM6B 3AM1A 3SS9X 3F9CA 4KQEA 1VQLV 1RJDA 4DIEA 1YDGA 1FMCA 4I9WA 1EE2A 1T43A 4U3JB 4KRFA 5B3KA 1KJ9A 1S7GA 3X44A 3WU2Z 4WNYA 2WDZA 4R3UC 4ZAXA 1EFDN 2LDXA 1UKCA 1XRGA 2RHGB 4TTJA 1DFIA 2EERA 3VI4B 4M9UA 1Y1RA 2WP0A 3SYKA 1P2VA 2HQSC 4G1EB 4UZSA 1A9SA 1HEIA 3W34A 4US1R 2ZJ0A 1YZFA 1H2XA 4PCVA 4YRPA 1A4IA 1EGMB 1IX9A 1T8SA 3GMIA 1JDBC 4BNDA 3ON1A 1GL7A 1ETUA 1J95A 1W25A 4OLJA 3THXB 1ST2A 3VYWA 5D7NA 1QG2A 3U4HA 2Y0BA 1K98A 1P4SA 4CI0B 3I83A 1RSZA 3BIOA 3QFCA 5K8JB 3HA5A 4F6CA 4KIUA 5M34A 3FETA 1F3LA 1FU8A 3TX6A 4J3FA 2WLLB 1H38A 2XAHA 1VGQA 5MN5A 4QXQA 5KA6A 4DZTA 1ZNYA 2X5NA 1SCAA 5HJ7A 2O8BB 2JEUA 1U8UA 4CH3A 1P4HA 2VRBA 1W85A 4MVJH 1CEYA 2YJNA 5SZIA 3JRXA 1C0PA 4RX1A 3V8EA 3I9LA 3M7IA 1QO0D 2UV8A 1TF2A 4ZHWA 3P4XA 3DTVD 3HKCA 4HBGA 1AZSC 2I6XA 1L5HB 5GGYA 3C5HA 1UK8A 3LBAA 3INNA 3T4EA 4I36A 3R8CA 1NZDA 1CUZA 1VHJA 3W7UA 2OIEA 4BVHA 5DM2A 1N3BA 1K92A 4O4IA 5EJIA 1PD1A 3QFRA 3A1VA 3KFLA 5IKOA 2G09A 2RHMA 1RYFA 2VP2A 1FX0B 4F1WA 1PZHA 5EP1A 2EILC 1RYMA 3H8VA 5JFOA 1T5EA 3D3NA 4HAMA 1KJYA 3ZU5A 2B25A 2GHRA 1DC7A 4Z6KA 1XRJA 3TEFA 1DO0A 2O23A 2JBHA 5UKDA 3C90A 4KO8A 4UCUA 2IAFA 4N47A 2X3YA 3PZRA 4I2NA 1VPWA 1IUNA 3BK2A 3BXEA 4KCGA 4IH1A 1B0AA 3VAAA 5HKAA 4EUHA 1E4YA 1VYUA 1NUSA 3T3PB 2LWIA 3KETA 1CULC 4MIEA 4MR8B 1JV2B 3A3PA 4W4TA 4H1WA 4DW0A 7ABPA 3ELYA 3GLFB 3AI7A 1LKZA 1EFRG 3IO3A 5CGQB 2C2AA 3WK6A 3QO8A 5KNCH 5DHSA 2YRXA 3HB7A 4HHEA 3CJHA 2BKUA 3AIOA 2C7GA 3HUDA 5TQ0B 3SR4A 2WYVA 2Q9LA 4QPKA 3JRNA 3B1YA 2JIMA 1YB5A 1QU3A 3ANXA 2VAMA 4WI1A 4JH0A 4CEHA 3RIEA 2BD0A 3MLEA 5KNDH 2KQXA 1JT9A 3WXBA 1WAZA 5ESDA 2ZODA 3CC2V 2A78A 3RS7A 4X1KA 1JYEA 5H81A 2V58A 4TSRA 3D6UA 2ZBFA 5KHOC 3HB4X 1UBUS 4BN0A 2HA3A 1AJEA 3SZGA 4J42A 2HJFC 2X7HA 2R65A 1GR0A 3V97A 4QYIB 5F5LA 3QG1A 2C88A 4ARCA 1AROP 2F8MA 3E1YA 4WASA 1YXMA 1T4CB 4GBGA 4MWCA 2G1UA 2OB1A 3BWVA 2IIQA 3VZPA 3K4QA 4E1AA 2DQ3A 1MGOA 4DQUA 2R751 1VG1A 2Z04A 4IIBA 1UAAA 2BP7B 5TS3A 4J9UE 4KQ1A 5KEIA 3F0TA 1KVUA 4GUNA 2KSDA 1F4VA 4DIMA 3NEYA 5KYVA 1BWSA 5I7VA 2VPPA 1KPIA 1YE8A 4URVR 3WIEA 4S0XA 3RTGA 1XD9A 2JANA 1UFOA 3HA2A 2BTUA 3HDGA 3HFGA 4Y67A 5CT4A 2O8FA 4Z0HO 1TM7E 4C6TB 3B85A 4HMPA 3SDZA 2RGGA 3I72A 2XBUA 2JK5C 1V4BA 2G4VA 2Y1KA 2JH8A 5GADl 5H68A 1C9MA 3GRYA 3PQ7A 4KXQA 3K9GA 4N49A 4BW5A 2F4VB 1GL9B 4B34A 3T3NA 4EZBA 3ZX4A 2W71A 3L0CA 5JNUA 1Q91A 3WKBA 5E0KB 5AJXA 4CKBB 3BGDA 5I51A 3PHGA 2FWAA 2OESA 5BRJA 3HP7A 2XHEA 4QQFA 4ZQIA 3IEIA 2GYUA 4YDHB 1JJOA 3IAFA 4RD0A 2NVWA 3ETHA 2QP9X 2QN8A 3LZCA 3NHKA 3WIUA 3REFA 5B53A 1Z0AA 2QJ1A 4MV3A 1RI2A 4NFSA 3QVNA 4QEKA 2PHZA 4ZHYB 2B4TO 3ZXUB 5EO3A 1XD8A 2XUOA 3OQBA 2QMEA 4BNGA 5IVKA 1QGOA 4PYQA 4F5YA 4EECA 5IANA 1ESNA 3UHJA 1SU4A 2NT4A 1NT2B 2CJFA 3AK3A 2Z0MA 1YCIA 3GB9A 4DANA 1JN1A 3ST7A 3K92A 4HAXA 3NC0C 3L82B 2XT6A 3X1MA 2XWSA 2W2XA 3R5JA 3VR3D 4C7XA 1D9XA 2D2EA 1NFQA 3ZZUA 5B6PA 1UBJS 4OXKA 3IP5A 4LYEA 5COAA 3UH0A 1VECA 4QKQA 4K05A 3QWHA 5EJ7A 1N0VC 4GOND 3BMCB 1QG4A 1L7NA 1Q3EA 1I6LA 3X43A 4WFHA 4FFSA 1WPBA 1HL3A 4QBGB 2OXCA 1EJBA 4ZO7A 3FAKA 2GBIA 3OM9A 3QHAA 1L1EA 2W8BB 4NENB 2QZ9A 3DEAA 3SYTA 3S2IA 5HA5A 1HTBA 2IYQA 3L8FA 4MWEA 3R0IA 5GOTA 5JYDA 5C37A 3I5MA 3TLMA 4A5SA 2BRUC 2VUHB 2ZR0A 1J9EA 5IZCA 4CFSA 3KV1A 1QVFF 2OBNA 1V48A 3U37A 5BXZA 3M3DA 3SQDA 2PIAA 1MG0A 3TD6A 2V6FA 1CTQA 5LGUA 2C2KA 1RBQA 1A69A 2GBFA 4ZAVA 2YJ6A 4JBGA 4FLUA 5KOIA 3ZZ1A 1GN4A 4LHSA 1PX2A 1Z15A 1U7ZA 3O93A 3JCMM 2KHZA 3BXHA 4UNQA 1L8AA 3O21A 2JCYA 5C8VA 5JBQA 2LCAA 4KHPO 2VK4A 5H3LA 4I3HA 3ESQA 1Z8DA 3AP2A 5FLEX 2ZRJA 2R8PA 3NOQA 2A3QA 3N6VA 4RANA 2Q3LA 1F4MA 5FNZA 3R44A 3GFBA 5I7AA 3O2NA 2DPHA 1ND6A 3U7IA 4AX8A 4BJ1A 1TK2A 4D74A 2J3LA 1LDEA 4NNJA 5F7ZA 4Y6PA 3HRIA 4NS4A 3EQ9A 4AKSA 2WB4A 2PKWA 3DUFA 4BLRA 3ZI7A 1AKUA 1W30A 1KI6B 1B43A 1NZFA 4AECA 3QLUA 3HKDB 3FZGA 1OFGA 3T61A 4PLTA 2XUPA 2H1CA 3A1UA 1E32A 3BABA 1OVMA 2A3NA 3VVLA 2HR1A 3QVVA 4YX9A 1SG6A 2IH1C 1AZLA 1ZJYA 4FE4A 3VDMA 1W96A 2W5UA 3ZHOA 1UQUA 5LZ5A 2C7VA 3QFFA 4EY3A 2R6AA 1YMUA 4UM7A 4KQWA 3PUKA 1PS0A 2X2PA 4QPJC 4TN1A 4RTPA 5AVUA 3ES9A 2P9BA 3AZOA 5C5EA 2CLSA 2HRBA 2J08A 3ENKA 1U8CB