3MCAB

Structure of the dom34-hbs1 complex and implications for its role in no-go decay
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
372
structure length
341
Chain Sequence
IEKNSGWITMEPEDMWHLYNILQVGDQLKASTVRRILVENMDFDTKAAQLHIKRTTEYHPMGSYHTLDLELHRNFTLYNEWDAFALDRVDAACNPSAEIGAVVLDEGLANICLITDYMTILRQRIDQVIPRKRRGDSSAYQKGLDKFYDSVFQSINSEFDFDKLKVVILASPGFVARGLYDYIFSMAVKLDLKQIVKSKNKFVILHSSTGHIHSLNEILKDPAVESKLADTKYVQEIRVLNKFYDVMNEDDRKAWYGPNHVLKAFELGAIGELLISDSLFRSSDIATRKKWVSLVEGVKEINCPVYIFSSLHESGKQLDLLSGIAAILTYPVDEEDISEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Dom34-Hbs1 complex and implications for no-go decay
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Translation regulation/hydrolase
molecule keywords Elongation factor 1 alpha-like protein
total genus 88
structure length 341
sequence length 372
ec nomenclature ec 3.1.-.-:
pdb deposition date 2010-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03463 eRF1_1 eRF1 domain 1
B PF03464 eRF1_2 eRF1 domain 2
B PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.870 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mcaB01
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3mcaB02
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3mcaB03
2KTUA 3E20B 3GYQA 5GIPC 3PLAC 1KD1H 3LWVC 1X7PA 1N8RH 3HJWC 1YI2F 3VMFB 1M1KH 4C4WC 2JNBA 1K9MH 3N4ZA 1Q7YH 3NK7A 3CC4F 3OW2F 1H7MA 5A2QM 2QI2A 3MCAB 3CG6A 5G4UC 3CMEF 3RA6A 3LWOC 1QVGF 3ON1A 3OBWA 3HAXD 1VQLF 1W3EX 1XBIA 1K73H 2LBXA 3G4SF 1GO0A 2QEXF 1W42A 5FLXM 3VI6A 2OTJF 3V7QA 4NUTA 1VQ7F 1X52A 1SDSA 1E7KA 3CMAF 3J7AR 5EO3A 2KG4A 1VQOF 2VGMA 1IPAA 3CPWF 3G6EF 5FJ4C 3CCVF 1ZWZA 1M90H 3LFOA 3PAFA 5G4VC 1YHQF 1VQ5F 3I56F 5GANK 3NMUC 1RA4A 1GZ0A 2LBWA 2OHWA 3N4YA 1Q81H 1W2BF 1VQ6F 1YJ9F 2OTLF 2KTVA 1CK2A 1S72F 3CCSF 3CCLF 1NMUB 3O85A 1VQ8F 2VGNA 3RA5A 3AGKA 3CC2F 5GAPK 3CCEF 1T0KB 1CN7A 3SIVA 1YITF 4TZZA 1YIJF 1VQNF 1PXWA 4X3MA 4BW0B 1Q82H 3CCUF 1NJIH 3V7EA 3LWRC 1VQPF 3J81M 1DT9A 2FC3A 3CCRF 5GIOC 2ALEA 3SIUA 3LWQC 1VQMF 3CCMF 3J80M 5DCVA 4AF1A 3NK6A 3CXCF 4X3LA 1K8AH 1KC8H 1VQKF 5IT9M 1QVFF 3FFMA 1RLGA 1GO1A 3NVIB 2HSTA 1YJNF 3CCJF 1JJ2F 5EWRA 2QA4F 1KQSF 1X7OA 3IR9A 3OBYA 3WXMB 5GINC 1W40A 4BY9D 2BO1A 3CCQF 3CD6F 3LWPC 4LCKA 2CZWA 2AIFA 1VQ9F 3NVKE 3I55F 3E1YA 1Q86H 1W41A 2I6DA 2WALA 3JAMM 3CC7F 2HVYD 3JCMM 1VQ4F 3G71F 2OZBA 3CPQA 1YJWF
chains in the Genus database with same CATH superfamily
2ZPGB 3QEPA 2RF0A 5IXBA 1FFXA 5EZYB 4BY9C 2D0BA 3RWUA 2HX0A 2R5MA 3NTHA 4WFAL 3E22A 1NLPC 3HPHA 2LJ1A 1L3UA 3H08A 3HZ6A 3EG9A 4C4WC 4B9XA 3SQ0A 4A54A 4MLEA 3EH1A 2DYIA 4DSIA 4F8RA 2ZGWA 3KKSA 1U3PA 3H0HA 2HNDA 1Q82O 2QAZA 1E6HA 3OYHA 4OB0B 1OOTA 1X69A 2L89A 3OW2F 4XEIA 1AOJA 2DYYA 3CMEF 4KO0A 2HSEB 3L2RA 2E12A 4O8KA 3CD6N 2KYBA 3KK3A 1TV6A 2PMPA 4OMOA 2NYSA 4O44A 3VQ4A 2FXUA 2RHIA 5GANf 2RQRA 2DM1A 2ZPBB 3ER0A 3QBYA 4J9EA 3RMCA 5EG2A 4LY7A 3G4SF 2YYEA 2RJEA 2NRXA 2ATQA 1VQ7F 1SL0A 1NJIR 2RHXA 2VB6A 4J9HA 4NL2A 3QFUA 4XU2A 1RDCA 4KUDK 3OYYA 1NPRA 4PJOA 2WFBA 3I33A 1B34A 1MMDA 5KH6A 2E4HA 2BUDA 2I7PA 2IAJA 5AQTA 1C6VX 3DLEA 4F7UG 2KGWA 4M7AG 2A1SA 3DM2A 5LYJA 4IFVA 4I6MA 4HVVA 4FOIA 1OFUA 2G3RA 1UHCA 2EHGA 3WQTA 4BVOA 2HF4A 2R7YA 4BRKA 4ZGDB 1Q7YR 5KRTA 2UUAK 2CGJA 3GL1A 1RBTA 5C12A 2NUPB 3M55A 1QWEA 3QMLA 1E3MA 3VRYA 5KRSA 1GX1A 1X25A 3LGFA 1VQLT 5DY9A 5DK5A 3MN7A 3HXMA 3L2WA 3HT3A 4DTJA 2DZCA 3NMUC 5LOVA 1NGJA 3TAPA 4CI0C 1M90R 4C0DB 3PIOA 1WBBA 1K8AU 4M77C 1G99A 2E2OA 4BG8A 4L59A 4CVNE 1OH5A 1TUGB 4ORZA 4FLVA 5AQZA 3FE1A 3OTOK 4FLUA 4KHNA 3K14A 3UDCA 2HDAA 2O4GA 3BEXA 1G15A 4KH0B 3T3FA 4M3WA 3KXTA 2HBPA 4JHDB 4YOYA 4IG0A 1YIJF 1PNJA 1YITT 1YITA 1X9WA 4BW0B 1S5JA 5LL6S 3CCUF 4NCAA 4I2QA 1HKCA 5GAMj 2VKNA 2XIDA 2ED1A 1ACMB 1IBMK 1CXUA 2FC3A 1SSHA 2QQRA 3OYDA 1E4FT 4M7DG 2BTOA 4I4TA 3META 3HRUA 5HP7A 1RAFB 1VOMA 4RCBA 1LW0A 1TUYA 2L3RA 3A5LC 1YJ9T 1YJ9A 3CIPA 1W5AA 4KWEA 1AT1B 5GAN2 4C92G 1K9MU 4DR3K 2MQEA 4M77F 3CCMT 1T05A 2E5KA 1S9GA 2XK0A 1UI9A 4X3LA 4CJVA 4AG2C 3JASA 1JRIA 2O4XB 3BP8A 3BYQA 4B45A 1QQMA 1KAYA 2J06A 3HOSA 1IGQA 2AMTA 4BRLA 1ZBUA 3J80O 1TKTA 1S72N 3HPOA 2XY5A 1XHOA 3FEOA 1ZUYA 5GAN3 3AVJA 2QEXN 3JCMP 2UUCK 3LWMA 2JVVA 3JB9F 2HOEA 1TAUA 1IV2A 3VEXA 3VIUA 1TXQA 2EBPA 3VESA 3LWPC 3CCRN 3DRRA 2AIFA 1VQ9F 5I11A 4HT9A 3OA9A 3P8DA 4LUDA 2GVIA 5GAMf 1SQKA 1R77A 1HYVA 5M9OA 4FFBA 3V9XA 4J7FA 1QQCA 2L3PA 5GAEP 3CC7F 1VRUA 2RQVA 4RTVA 2UXDK 1L3TA 4O5BA 1WJRA 1BQNA 3WEEA 3ZCMA 3GBQA 3UIQA 1VQNN 3ZT2A 1KD1H 1BA0A 2DRMA 3QICA 1S1XA 3AY9A 4IO8A 2XICA 3LDLA 4YOUA 3V1QA 4M3UA 2HS0A 1PSFA 4M78D 4ZI7A 4NB4A 1VQ7N 5A0LA 5GAN7 3DRPA 3RMAA 4R56A 2OAUA 2GX9A 2KRMA 4IUPA 3BDPA 5AQVA 5LJ3f 2YHAA 3C7NA 1YTAA 3EHQA 2E70A 5M1OA 4JLHA 1YXQA 1WX6A 3MXJA 2KQWA 1VQVA 1M1KO 3PO4A 3JAWA 3VS3A 2G8WA 4WQ5A 2XG8D 2GWJA 4Z4IA 3EFRA 1YIJA 3OBWA 3IMPA 4F7UE 1VQLF 3QO9A 4FFBB 3FRNA 3THWB 5D6WA 1IHVA 2GBZA 1Q81U 3MN9A 2IVOA 5DMRA 4OF1A 3EAEA 3J7AP 1YCSB 4OPAA 1Q7YU 2RQWA 2DFEA 3THXB 1GCPA 1SA0B 4BR9A 2VGMA 3M57A 5EB0A 2QTXA 3G6EF 4DR6K 3EG2A 3MDOA 1NYGA 3CM5A 4ZI7B 3CPWS 1TK0A 1NMDA 2YUOA 4YNQA 3LFOA 1IB8A 1VSHA 4F17A 3CCUT 1G83A 2HNIA 3QNOA 3HM9A 3OMCA 3THKA 2FZCB 4ZTJA 2HB5A 4HXJA 1AWOA 4O0JA 1MU2A 3HKCA 1XNIA 1Q86C 3THYA 3C0CA 3INZA 4CC3A 3ZBDA 2AKLA 3VUBA 2LNVA 2KHOA 1YJ9F 1VQOA 2XMFA 2P9UB 2LZ6B 4WE1A 5GAOr 2D1KA 3JRZA 2DXCA 2QTVA 4R0KA 1RTIA 3O9QA 4G88A 2IVWA 3SQ4A 2M9UA 4TVRA 1JU5C 3GIBA 2F5KA 3H8ZA 3LP2A 1YJWN 4X1VA 2HBMA 5HWEA 3G71A 3DB3A 2K2MA 3VPZA 2VXEA 3BF3A 1M90U 3L4IA 4B3TK 1O13A 3CXCS 1LOTB 1S72Q 2DL7A 3A5MC 1HQEA 3V7EA 1SG5A 5BREA 4GV3A 3C4SA 5J3BA 4G9ZA 3JAKA 3H1QA 4B9VA 5GAOl 4M3TA 3RE3A 1BI0A 2JOYA 1FMVA 1N8RO 2DT4A 1M2VB 5DM7L 2OTLT 4ESRA 1I81A 2OTLA 5EXWA 2JTFA 1S22A 4O2AB 3VENA 4MQ3A 4CFAA 1EWQA 8ATCB 3MEGA 2HEQA 5A2QE 3R6MA 3QUWA 2VC8A 4C8EA 1T6DA 1RT3A 3RR7A 3NVIB 4F7UA 3CERA 5J26A 3MDQA 5ELZA 4BB7A 3DJCA 1JJ2F 1TS9A 3VN5A 2YJEA 5KMGB 3ZYYX 1KQSF 4FW1A 4DB3A 1WGSA 5GINC 4KFBA 2WACA 4CC2A 1W40A 2CYZB 3ATVA 3IRXA 3TARA 3ERNA 1N6AA 3M4SA 3CD6F 3NTKA 1T44A 2CZWA 4QAGA 1SF9A 2KQ2A 3E1YA 3D0PA 3OYIA 1BISA 1YGYA 2OI3A 2J05A 4K43A 5IYZB 2OJ2A 5FRNA 3LWIA 4N76A 2O2OA 1KHCA 4BRPA 4C81A 1KJWA 5CCAA 4FJ5A 4K8ZA 4EI8A 2V1RA 1FYNA 1ZSZC 4NCBA 2GCXA 2LCLA 4IFYA 3M59A 2KZMA 1TH7A 2M51A 3TEEA 1KXPA 4W5QA 2EW3A 2ZPFB 4F7UF 3IG1A 4FYDA 4X1IA 3WNFA 5GIPC 4ZHRA 1RDWX 1XNQK 1TUDA 3VQEA 2F4VK 3CC4A 3PVLA 1X7PA 2GLZA 4O4LB 2OPPA 2DJQA 4KH6A 4ANJA 1NU0A 3UE5A 3VO8A 4OB2B 4CRIA 3VMFB 2UYKA 3HJWC 2IVNA 1GLBG 3EGDA 2KMTA 4LH4A 5BRDA 3EG9B 4MZPA 4AG1C 4YOTA 1VQMT 5HKCA 4AT1B 1NJZA 1VYTA 1NK0A 3NK7A 1AD5A 2ROTA 2P9KA 5AQXA 3O3HA 3MCAB 2XD0A 1X2QA 4RTXA 3FJPA 4F3OA 3QEIA 1BK2A 1OZ3A 3NHNA 4C92A 4Q5WA 5LJVA 5LMUK 5C8YA 3HKBA 5LJ5h 1VIFA 3SJHA 4FLWA 2RHUA 2YCHA 3AVFA 2A3ZA 3AVLA 4AHVA 4E1MA 1ATNA 4DLEA 4QS9A 4BI3A 4LN2A 5IAYA 1LV5A 1VK0A 3HKBB 3T1AA 2P9PB 4J7IA 4B8AB 1WQWA 1FWZA 4X9DA 4DBRA 1H1VA 1P90A 1Z26A 4KBOA 1NG9A 4NUTA 4BG9A 4KHPK 1G3YA 2HAXA 3CMAF 1XV2A 2E3IA 3CCQA 1ABOA 3MXIA 2FF3B 2ZJRL 4FSVA 2E8AA 1H47A 4C8QE 5AQFA 4JI4K 4FT2A 1ZSZB 4FM2A 4Z8AA 3EG1A 4M7DF 4LH5A 3Q8HA 2LQKA 2K2VA 4CJLA 5MN4A 2FZGB 5CVIA 4M78B 1BWFO 4PK4A 1QQJA 4AFSC 1DJ7B 2Q3SA 1K4US 2A5XA 3OS0A 2BTFA 1BBZA 2HL3A 2AIZP 1VQ5F 3QUIA 3O9RA 1WXTA 1KLMA 4CEEA 1REVA 5AQRA 5FNVA 2CP5A 2CGHA 3SI6A 4CECA 2OTLF 2H8HA 3M0UA 1AHJB 4CW7B 1GCQC 4ERHA 2G6FX 4H0OA 2GEMA 1Y57A 5BPMA 3CC7Q 3O85A 4DOWA 2RB6A 1RDUA 3T69A 5GAPK 4BRGA 4B9QA 7AT1B 4BVSA 1T0HA 1VQLA 2Z0WA 3JV3A 1VIEA 2EWNA 3WVEB 1GBRA 2PY5A 2VASA 3A98A 5CY4A 1J5EK 2P5OA 2ZAUA 3JSCA 5AR0A 3TD4A 2O01E 2JXBA 5HK0A 4IIOA 2EQIA 3SBGA 3SWNA 4Z94A 3SZ2A 2L3SA 1QU9A 4DKWA 4RKUE 1CKBA 2ZF8A 1NKBA 4U7BA 3RVCA 2P9NB 4BR7A 1NGDA 2HNZA 3MWTA 2IIMA 3SLCA 1OI1A 5JQGB 4DF8A 2KR3A 4JJCA 5EWRA 2QA4F 1YJWA 1GLEG 4WF9L 2V7ZA 1H3ZA 4DV4K 1ABQA 4C23A 4CC7A 1BIUA 3CCRT 5BMVB 3EL2A 3R6OA 1Q82R 3M0QA 1C6VA 1LOJA 2A0FB 3VYHB 2QWPA 1QVFM 1JJ2S 2LCSA 1QCOA 4PL7A 2ASMA 1Q82C 3O80A 1RI0A 4H03B 4AFZC 4HCCA 1IKXA 4EI9A 4CD1A 3IDHA 4Z4GA 3O8VA 1YJNN 4G4VA 2YI1A 1RILA 3VQ9A 3QHDA 4XH1A 2K5FA 2E6LA 4BWJA 3C6UA 2MI6A 4B9LA 1VQ9Q 1IJJA 1NJIO 2BZ8A 4FJNA 3NH1A 3WGJA 4C8QA 3HJFA 3RUXA 1KQ2A 4DUYK 5FPMA 2FL7A 3MN5A 5ADXA 4LFAK 2YSQA 4FWNA 4CD3A 4IOCL 2QWLA 2CH5A 5HY4A 1RDDA 3B6OA 1JN1A 2L0AA 3LMEA 4FWPA 1JL2A 2F5TX 2P4RA 2KI7A 3EO3A 3T19A 3TSQA 4NOYA 4FLYA 1KK7A 1K73C 4J6XA 3RR8A 4C8QF 3P8BB 2YT6A 4OPJA 1YWOA 3JCMd 4FJXA 3EKUA 4AMCA 1GLCG 3RA6A 2E41A 3LYIA 3JCMQ 3ZT3A 1UA0A 3MPUB 2K9GA 1QSSA 2HHSA 2JM9A 2GTJA 2BE2A 3J8AA 2EWSA 1T3VA 3MP8A 2F2VA 1D09B 1PKSA 3CCEA 3CXCP 1W42A 2DBKA 2PVGB 4G4YA 1U06A 1X27A 2W8BC 3R3LA 4FOEA 3RKYA 4ISFA 4GNIA 3LDSA 4H8KA 3AO5A 3THXA 2P6YA 4O4IA 1VQLN 2KNBB 1I07A 4XU0A 1VQ7A 2YNIA 4ZK7A 1IV4A 3JCMe 4M77B 1IPAA 3KIOA 2KXCA 5AFUA 4IG3A 1HPZA 2QTDA 5AQQA 3JSMA 2AKKA 5D3GA 2QWMA 3AO4A 3REAB 3O5BA 1W55A 4DU3A 5IXFA 2WC9A 2K3BA 3A0IX 4B9SA 4NLCA 4C8KA 5AQLA 3QERA 1V4TA 2QA4Q 2KRSA 3CC2Q 2DJZA 3NPFA 5DLQE 2A3LA 2RHKA 2RPIA 3AGRA 2QEXT 2DTHA 1RBRA 2HQEA 3ID6A 3JCMg 3UKUA 4W5OA 1XC3A 3NVKA 4C5EA 2LBXA 1PRMC 3TU5A 4N4HA 5M1PA 3CCRA 1XQHA 3HL8A 6AT1B 3DKMA 4B1YB 3PNWC 1A5XA 2COYA 3K9JA 4X1IB 1Z5WA 3OMGA 3S6WA 2QEXA 2EYWA 1WZOA 1JLBA 3EE8A 3VQPA 2AZVA 3A8OB 2KKZA 2ZF5O 3F0EA 5CYQA 4ME7A 4BE2A 2OCEA 3QB0A 5LP6A 1VQNF 3NFAA 3NFCA 4II1A 3RMQA 3AVAA 2VWJA 2YHWA 2UU9K 3HP9A 4PNOA 4DBHA 3J80E 5LY3A 1HJRA 1CLIA 3M84A 3QDKA 2QK9A 4IDHA 3RYHB 3QDFA 1U1SA 4O2BA 3AAQA 2KDSA 3SIUA 1NMNA 2H3GX 4AQYK 4FZXC 3K59A 2MIOA 2Z1HA 4JI8K 1RT5A 2A37A 4FSXA 1K0XA 3V8LA 5M1FA 1KHIA 5M1QA 4DQPA 5J2NA 4ZTFA 2HHVA 5J2TB 2X3WD 1ZBXA 4LDVA 1YJNT 5AQMA 2OTMA 1A5VA 3CCJA 3F6MA 2O8DA 1CZAN 1BU1A 5LP6C 4WBNA 5JQGA 3GNGA 2KROA 4YDUC 1K8AC 2V8IA 4ZOLA 1Y96B 5LJ5g 1YJNF 2C0IA 4LFCK 4R79A 1LVKA 3X28B 4QOZB 2I6RA 1X75C 5HOOA 1Z5VA 4KTWA 4JRKA 3P4IA 1NEBA 4E6EA 1UGVA 5IYZA 3CQXA 1Q9YA 2WBNA 3A8LB 3IUCA 1RTDA 3WGLA 3PTAA 4C8LA 1JJ2M 2I6DA 3RRGA 4FJMA 4IFEA 5EB1B 3KHYA 4GW6A 1I94K 2GQVA 1NE8A 1IG9A 2CKKA 5T7BA 5ITZB 2HS3A 1JKHA 3FR0A 1W2BS 4CJ5A 4G4ZA 3SFMA 2IPOB 2HQXA 2OZBA 4KI6A 3DLKA 1VQ7Q 4JHDA 1ATRA 3VF6A 5L8RE 4CJTA 2EYZA 4CC4B 4PL8A 3SMSA 5I2SA 2OPQA 4K0KK 2BZYA 4MDWA 5KYWA 5LJ3j 4BR5A 4DR7K 4MO5A 4N4IA 1KRPA 2DIQA 3LWHA 5DM7R 3KJVA 3RMSA 4B1XB 4CERA 4M3XA 4JD2B 1SPKA 1QHTA 1Q7YO 3ISNC 4V19S 3S3OA 1K9MR 2C06A 3HPGA 4NL3A 4JNEA 1K9MO 2ASOA 4N0AA 1TTHB 2FSNA 3SAHA 2F9ZC 2QQAA 2L26A 2HKNA 5C42A 2JN0A 3K9KA 2HHHK 2HSPA 2FBTA 3NH0A 1XMOK 4J2DA 4BDZA 4HVUA 1NJIC 3CFOA 3AVMA 2FPFA 1XBIA 4O2BB 2QEXF 3VI6A 5C24A 3MMVA 5LA6B 3RR6A 1UEBA 2XDPA 2V8KA 2A40A 5FLXE 2AP1A 4PKGA 3S9HA 4AHRA 1SDSA 2GUIA 1X3MA 3TR8A 5F1XA 1QCNA 3UATA 1M3AA 3ULRB 1HNVA 1X9SA 1N8RR 2D8HA 3KKRA 2JM8A 4PHTX 3FIFA 3ASKA 1ZBSA 2COWA 2CZ0B 4DSKA 3THYB 4HA8A 1WXBA 1WXUA 2E3HA 4ATOA 1Y97A 4XH4A 3PAFA 2NWMA 4M78A 4ELVA 3S02A 5I21A 4BC4A 2JW4A 2DETA 3AVHA 2CZ7B 2X4WA 3VYSC 2IVPA 4CEOA 3IEWA 5GANK 3SV3A 2JNGA 3CMEN 3LZJA 3MBMA 3CPWA 4J8OA 4ZHYB 1YJWQ 1VUBA 1TYQB 2GELA 3H3OB 3ZL7C 2O9SA 3KWGA 1KC8O 2YXZA 4ZNXA 4F4KA 1NK6A 1RLUA 5KPTA 4DXDA 5HBMA 4FJKA 1TVKA 2WONA 4O4LA 3NGYA 1AZGB 2HRUA 1XC9A 3CCVT 4AHUA 1H641 3SQ1A 5IHIA 3I35A 1SV5A 1D5AA 1B3QA 3KUFA 1Q9XA 1COMA 4HVJA 1YJNQ 2OZMA 2XRIA 1KNKA 1HPMA 4LUEA 3H1VX 3QIOA 1B07A 4CBWA 4C0ZA 1PRLC 4QVCA 3OYNA 4DUZK 1RCHA 2LP5A 3VQ7A 4DR1K 3JALA 5ADXH 2OTJT 4ZHQA 1BUPA 4AILC 1IBLK 3IS9A 4A59A 5GAGP 1Y64A 3FPIA 1N9SA 2RM4A 1K8AR 1CZ9A 3ULEA 1RTHA 5DCVA 1C0FA 5GANg 3PIPA 3M56A 2B86A 1GL5A 1VSLA 3L4QA 2WTUA 1N34K 2Z1EA 1KC8H 4EPCA 1TK5A 2HS4A 2J6KA 2ZGZA 2FO0A 3OS1A 3VGLA 2RHHA 5KMGA 3L7QA 1X2KA 3HSTB 3L3VA 2HZYA 3ZEHA 1VQPT 5IH2A 4WFNL 3CPWM 2X4JA 1RBUA 1BGXT 1PD0A 3CCMA 2E88A 3HSCA 4OGCA 2KAFA 3O6WA 1HR0K 3IAYA 2RHLA 3TVTA 1U2VA 4HTUA 4Y92A 4BRMA 1KLNA 1RQ7A 2WALA 1GRIA 3KTQA 4EMKA 1OQKA 1UGPB 3UF4A 1W0HA 4RCHA 4BR4A 3TSWA 4MDBA 3JCMM 1QVGA 1QTMA 3MP6A 4M75A 5CKDA 4OX9K 4IURA 1AVZC 3E20B 2Q1NA 4DTOA 4DFJA 4M7AF 5IN1A 4WYBA 4BWMA 3KE1A 4ILJA 2KT1A 3ATUA 3I7TA 2KVQG 1N8RH 4E7HA 2YHBA 1VQ6T 4ZGJB 4FYVB 1I1JA 1XQSC 4F3TA 1HMVA 4DTPA 3TSZA 2HKQB 4E19A 1VQMA 3H3NO 4MMLA 3VYUC 3LGLA 2FSKA 1WB9A 4KHWA 4M3YA 1HNIA 1R8OB 3PGGA 1AWWA 4C0DC 2DXUA 2W41A 2JGUA 3EGXB 2G8FA 4F2SA 5AVMA 1DTQA 4CE9A 3CC4T 1YJWT 3VKIA 3V7RA 2YXYA 1PD1A 1BKBA 1ASVA 1JCFA 4JKGB 3JAMO 1W59A 3K0TA 2X4YA 4JYAK 2ZPHB 3OVNA 1VQPN 4B1VA 2KW4A 2JZ2A 3MWPA 2RK1A 3HYFA 2MYSA 2D9TA 1XOVA 5GMKi 3CCQQ 2G8UA 2A28A 1BU6O 3C0BA 4F04B 4H5WA 3R8EA 4KTQA 4AHCA 1V1CA 1VYUA 1YITN 5BRHA 1VA7A 5EO3A 4B9WA 1D1AA 2RF2A 3C6TA 1NBEB 2DE0X 3CCSN 4FT4A 4KH5A 1VQ8N 4YHHK 1NK8A 3G4SA 1ZA1B 3CCVF 1M4ZA 2Z01A 3ZX3A 3BY7A 3PLAA 2E1ZA 5EY4A 4M75E 4M78G 1BDGA 3CCSQ 2E64A 5JLFA 4IJAA 3TAGA 3JYTA 1KTQA 1HX1A 1UDLA 3QWYA 4LF7K 4Z4FA 1T0AA 1C0TA 1SL2A 2EWCA 3C9RA 2QKBA 2V26A 4M7AC 3K5MA 1W4SA 2BGGA 5ECAA 4JJBA 4CIFA 2OHWA 5JH7A 2DFHA 2CS7A 3I0SA 2ZAEA 2PZSA 4QS7A 2P0QA 1IXDA 2EGEA 3D6RA 5GINA 4NQ3A 2FB7A 2GQIA 4N41A 1N8RC 1KSPA 2PQWA 2B4JA 2EJGA 3AGKA 3HRTA 3CC2F 2RI3A 4B46A 2LT4A 3GE1A 3P31A 2CHTA 2K57A 5L23A 4QVDA 4Z0UA 4FZZA 4PL6A 4JDSA 2QASA 4D8KA 5FU7C 3OYLA 1H92A 2ZPIB 3HWUA 4FYWB 3HKDA 2YUPA 3EH2A 4RTFD 4FVUA 5GMKh 1UFYA 1H8KA 1QLYA 1SRMA 5KE2A 2IIRA 3CJBA 4DBQA 5GAOn 4G4WA 3CD6A 2DXTA 3CD6T 2HMPA 5J2PA 4OO1J 4E89A 4CK2A 4CJRA 4BT3A 4KRFA 3CMEQ 3ID8A 2FBXA 1K8AH 4PLLA 2EYQA 1NGHA 3BZCA 4CJUA 3K0SA 4KBMB 4DQSA 1VQKF 4OMFB 4C8QB 1OULA 1RGIA 4AHSA 1Q86R 1GO1A 2UYPA 5K14A 4OLAA 2K3YA 1NJYA 3MAQA 1IHWA 3JS6A 4M45A 3DYAA 3F9KA 5CR2A 3HKSA 1OVQA 4M7AE 3WXMB 5KPRA 1VQ5N 3OYMA 3CPFA 2MOXA 2XY6A 4XU3A 4I50A 3VQ6A 1WNLA 3AO3A 2NNWA 4XK8E 1M30A 1IKWA 3V7CA 3CI5A 4TUYA 1VRTA 3CMAA 5LJ3h 1X3NA 4FZYA 1VQ6Q 3I55F 4KGZB 3LP0A 3B6NA 5AZIA 4I4TB 4EI7A 4GKKK 2D0QB 2JUFA 1AWXA 1M3BA 4J9BA 4ZN1A 2IC3A 4DQQA 2LX9A 3JB9H 4AM6A 1W57A 3JB9G 1MMNA 2Q2RA 2VG6A 4KTZA 4X62K 5AQWA 4TV8B 4CZFA 3I55N 4M75G 1NGBA 5AQPA 5J2MA 1YIJT 2VYTA 1NJIU 1EXQA 3WGKA 4A53A 5M1NA 2YKNA 1QQNA 4GY2B 5D6XA 1P8ZA 3JCMb 1TKZA 3NGZA 4JKBA 4CEZA 4WCEL 4RW4A 4BRIA 1L5UA 2IGIA 3BF1A 4IIMA 4PJOG 5J1EA 2G8VA 3SNNA 3D2FB 1WSGA 1IGUA 2RD1A 3VYTC 2CP3A 4CHNA 1WHKA 2OAWA 3H0FA 5LJ3d 3AVGA 4OKKA 1WSFA 3I3FA 5A2QM 4M7DD 3JAKB 5LA6A 2ZPEB 4LXCA 3HFNA 4M7DE 1J3TA 2ITGA 1B92A 3VS2A 4RMOA 5HL7L 3CFPA 1VQ9N 1JFFA 1D9FA 1W70A 4JI5K 5IHNA 1JD1A 3N2GA 4CK1A 1YP5A 4OVLA 4FIBA 2DL5A 5E26A 4CGFA 1VQ4Q 3EY1A 3PV8A 4LF9K 4DRXA 5FDLA 4Y28E 3A5NC 1YVUA 4BE0A 1ODEA 4JI7K 4JV5K 1VQ6N 2HD0A 4Y1DA 2KYMA 4CHOA 1TWBA 2LTOA 2X51A 1OX9A 1VQ9T 2DFFA 2FBVA 4CGHA 3TSUA 2CVLA 1WQ7A 3J7AR 4J9DA 1S1VA 3X20B 1X6GA 3JCMX 2ZD1A 2LQ8A 2OX7A 2FRYA 4A4FA 3I8BA 3QFPA 1RTJA 4DWIA 4IZ9A 3M8RA 1Q95G 3SJJA 3BDLA 4CJ3A 5IJ0B 4B3MK 4DFKA 4FLZA 2QM1A 3CD6Q 4F2RA 1BO5O 1U43A 2W6LA 1RAGB 5G4VC 3Q7CA 5HXZA 3CJ7A 2K5LA 1TVKB 3L2UA 1G2BA 1BG3A 2VQEK 4XTWA 3QWXX 1EIFA 4KB0A 2LBWA 1ZUKA 4CJQA 1S1NA 2ASPA 2Z1JA 4LF6K 3L2VA 3EZWA 3CCLF 2DPNA 1JLCA 2QDLA 4WF2A 3E01A 1EETA 1D0XA 2O31A 2BIVA 5AQHA 5GMKm 4DTNA 3KLGA 4M78C 3FC3A 1HJDA 2JTEA 1YITF 1J6ZA 3FZKA 1NJXA 5IT9E 1Q81R 2AIRB 1Y96A 5LMNK 2UYJA 1Q82H 4EMGA 4RTWA 4IJNA 5C8YB 2O8BA 4B3RK 3DI6A 2WOMA 4FK4A 4DTXA 2BTTA 2CP2A 2ROLA 3NF9A 3U23A 3CCRF 2F96A 4BRCA 1IV0A 4BD3A 2VWKA 2GUPA 4OMMA 3CCMF 3J80M 1OAPA 4PKHA 2ZJPL 1S3XA 3T1HK 3DLRA 3KK7A 4B9NA 2Z1UA 1QVFF 4NXNK 1U4BA 2YUNA 2EGCA 2VCPA 3SDZA 2PBDA 3KVGA 3LLRA 3LDNA 3OBYA 3N2KA 2K7AA 3UPUA 2RHYA 3CMAQ 2G8HA 3URGA 2Q36A 3LWLA 3GNFB 4GV9A 1FJGK 3U3YA 3D01A 2EQMA 2FYKA 3RDVA 2QWOA 3H45C 2DL8A 4DTRA 1M1FA 3CCUN 4ID5A 4C8QD 4I7FA 3OYCA 3M53A 3DLMA 4B6MA 1N5ZA 1FW6A 3LYBA 3AA4A 2RNAA 4JKGA 3OS2A 1W9HA 5JLHA 3V9UA 2YUQA 4IHJB 3EYZA 3PX0A 4CGGA 4F6RB 3MEEA 3SMPA 2YRVA 2CH4A 3TQ7P 4D8DA 1C0GA 5BRFA 3E9PA 3BDUA 3EGXA 4CJ7A 4DR2K 3U6FA 3NGPA 3GP8A 1FKOA 1G3WA 4N56A 3REBB 2I5JA 3JCMW 3FBAA 5KYYB 4BE1A 2ZM6K 4E7ZA 3AT1B 5FWBA 3BFMA 4CF1A 1JLAA 1JLFA 1O9SA 3B8AX 5EU7A 2YDLA 1U40A 2DA9A 2GTOA 1BI2A 3VEVA 2O4IA 1C0UA 2E6MA 3CC7N 3CG6A 4H0PA 4DTUA 4RQOA 3G71Q 1PC0A 1WDXA 1DKGD 2QTPA 4B9UA 2RJFA 2G8IA 2E6ZA 2NRRA 1QVGF 3SQ2A 3VQ5A 1KFSA 2ENMA 2X35A 1SSFA 1M1KU 2VXYA 3LDTA 4LD6A 1YI2N 3V8KA 4JJNK 4TUYB 2ECZA 3X24B 3VQBA 3O9UA 3DWLA 2YWWA 1RT7A 3VS6A 5AT1B 1D1BA 2KE9A 4D6WA 3CCLT 3LALA 4KAZA 2KG4A 5IJ9A 2DRKA 1QVGS 2K79A 2W42A 4DEYA 1S1WA 4M77G 3QETA 1KFDA 3WPXA 3CCLN 4C8GA 5FRMA 3ZOPA 1R0CB 3RYIB 2EPDA 2CT4A 2QA4A 3F2KA 5CIUA 4FWMA 2R58A 3H9NA 3X26B 3JATA 5CO7A 3A8GB 1QW1A 4O0IA 4CHYA 2B33A 1GOCA 1M1KR 2DD4A 3SYZA 1YBYA 3I56F 3VQAA 4U39A 5GAHP 3QYHB 1LCKA 4JRIA 4NWOB 1Q81H 2MAMA 3M0SA 5KQDA 3VS5A 2KTQA 1IZ6A 2P9IB 5JS1A 2EKHA 2VG5A 1IREB 3RYFB 3C95A 5I3UA 1P92A 3A1PA 2HQHA 5AYFA 1KQSS 3JALB 2KEAA 1EP4A 3C65A 3JB9I 2FHDA 5AQKA 2AZSA 1VSMA 2F8TA 4DQIA 4FJJA 4A2AA 4QCLA 1VQOQ 2A6AA 1IKYA 3VOVA 1NLVA 4E7LA 5HRPA 1NJIH 3LWRC 4DV1K 1B9DA 1V76A 3J81M 4M7AB 4B1WB 4OPHA 4X1YA 4HKEA 3F9MA 4X1KB 1FK9A 1BIZA 3QDRB 2M02A 4LF5K 2LNHB 2E4LA 4FM4B 3CMAT 3ASMA 3GG4A 5MLCQ 3JARA 3TAEA 4QS8A 4JI6K 4E47A 1OU8A 2KXDA 1BCMA 4QQDA 3CCST 1NGFA 4DR4K 3ZP4A 1D0ZA 2DTIA 5HY6A 1O75A 4JAXA 3E22B 5KYXB 1YHQA 1HQUA 2CSLA 1ZLMA 3WNGA 1Q81O 4J6WA 3CG7A 5KQ8A 5J2UA 4O8UA 5EZYA 3IEQA 3UB5A 4RW8A 3H0IA 3V7QA 1WHJA 1QVFP 1KQ1A 1F21A 1ZSZA 4N0AC 2OTJN 3M1FA 4EMHA 2R751 4IIJA 4ELUA 1QCFA 4YOVA 3MXMA 1U04A 1MDUB 4CHPA 5MN6A 5CKHA 3MEAA 1WYXA 4JLGA 2P1JA 3F5TA 2QQ9A 4ISGA 4B62A 4A57A 2ATCB 2NMUA 3NVKE 2LSNA 1NLOC 5GJWB 1UECA 3CCVN 2E10A 1TYQA 4L5GA 3QZ5B 2CH4W 1TUUA 1JCEA 1UOCA 2GV9A 3JCMf 3JB9J 2A1RA 4E7IA 3CEYA 1JLQA 1KQSA 4BT4A 4EFHA 3G71T 4R55A 2FRWA 4LNPA 5EAZA 1HNWK 3KBGA 5FWCA 1NK5A 1AWJA 3JASB 2CP6A 3JAME 5SWMA 2CH6A 5AQOA 1TAQA 1S9EA 4H5RA 1M1KH 4HCZA 5FPEA 5GONA 2GF7A 3EGDB 3FZFA 3QNNA 2YLCA 1H3HA 2EX3A 3MN6A 3C6HA 3LP1A 3HTVA 2QQBA 5CK9A 3I56A 1D0YA 4M7DC 2Q0RA 3H46O 4LSNA 4CGJA 2FGYA 3KLFA 3CFRA 2YV0X 3WJQA 5FPDA 4RWTA 3G6EN 4LE9A 1BB9A 2FPEA 3CETA 2FPDA 2CDTA 2P4TA 3NVMA 5AZJB 3NE6A 1C0MA 2DK3A 5CKBA 3OJUA 4N5SA 2ED0A 4DU4A 3ON1A 3CYPB 4JEPA 2QA4T 3HAXD 2Y90A 3TTDA 1K73H 1Q86O 4WQ4A 3I56T 1YI2T 4Z89A 2H8CA 4PFPA 1ONIA 3CC2N 3VA0A 4M7AD 5B8FA 1QZ5A 5AQUA 1VSFA 2P9KB 3O1WA 4CBXA 2M0YA 3O3GA 3E9FA 2HBLA 5FW9A 4B1ZA 3D7EO 1IO2A 3DXMA 1NM1A 1Q8RA 3PE0A 1W581 1J54A 4J6YA 4HUGA 3S0YA 1BA1A 3I55Q 4OMQA 3G0ZA 1YN8A 1QZ6A 1SUQA 4DV5K 2P9SB 3HKEA 1WNSA 4C8OA 3SD4A 3VEZA 1RLQC 4PFOA 4DHYA 1T03A 3QEXA 1I3AA 3QIIA 3CCJT 1NGAA 3FFKB 3VEYA 3JATB 3M8PA 1JJ2P 3N4PA 5C0MA 3OYGA 3HVTA 3PUFA 1N6QA 4E1JA 3E9LA 4PWDA 2E6NA 3G7ZA 2Q0UA 4CBUA 2DL3A 5DLOA 1SRLA 4PA1A 9ATCB 2UUBK 3C9TA 1U49A 5CZ1A 5ITZA 3QXEB 4JD2A 4ZHWA 4FJ7A 3RESA 4QT7A 4OB3B 4NS5A 3JCMV 4J9CA 1FX7A 1KD1C 4CZEA 4FWOA 2PYLA 3LANA 4M3ZA 1I4K1 3CCSF 5EOYA 2PVDB 4OKJA 2HBJA 3P4EA 1QKWA 4X66K 1RUWA 4OMPA 4CCHA 2RKIA 2YNFA 1VQKN 2CSQA 1Z9QA 1YCYA 4O4JA 2P5GA 2A08A 1YHQT 3C6AA 4YJ3B 4J2AA 4EMKC 3FGUA 2UYNB 4FJHA 2MPXC 3EORA 5LYJB 4A4KA 1X01A 3E2UA 3TCJA 4F7UB 4PJLA 1VQPF 2C0TA 2JMAA 2L5QA 1VSIA 3TWHA 5KYUA 3RBBB 3SHWA 2CW4A 1X6BA 3A5ZB 2PTKA 4ELZC 3ESJA 3QYGB 3M0RA 4HTLA 3LH0A 3EFOA 3ZFJA 1W6XA 5D7UA 1K8KA 4K42A 4JRQA 1QE1A 5HP8A 4O55A 3AA5X 3WPWA 3HKCB 1QS4A 1WAFA 5C15A 3HOTA 3LW5E 2HW3A 2IG8A 4OGEA 3OYJA 3CJ9A 2I0NA 4BQZA 4DTMA 3FFMA 3GDQA 1V4SA 3C12A 2DERA 2LCCA 3CCRQ 2F9WA 4IHJA 3QESA 1OKJA 4BVQA 4BR0A 2LJ3A 4OLBA 4JLIA 4FYYB 3CCUQ 1MWMA 3I56N 3H41A 3QJ6A 4MZTA 2Z1GA 3J81O 4GKJK 3DLLL 1NK7A 5HROA 5IWAK 3KLEA 5C10A 1K6YA 3DLBA 3PT9A 3WXJA 4O4GA 3RYHA 2EYYA 1BI4B 2DVEA 2QQSA 1K0SA 2RN2A 3U8XA 4GMJB 1NPPA 2MWOA 4CGDA 1XRGA 5HCKA 4IIJB 4NYFA 2CGKA 3SBTA 2P0KA 2X6NA 1WHMA 4NLBA 2CUDA 1PXWA 1YJWF 4BC5A 3RMDA 3CJ1A 1WSHA 2KTUA 1M8MA 5FU6B 3K2PA 4EHTA 4RTZA 4FPBA 3EZ5A 3PLAC 4Z88A 4X9CA 3DXKB 2QK0A 2RH2A 3G1JA 4PKCC 4ID1A 5C0YA 1YI2Q 5MN5A 1Z6RA 1JO8A 4XH5A 1DBFA 1JB0E 5M1KA 4A4EA 2DTOA 3SUPA 2LC4A 3GOIA 3ZSZA 2SEMA 1VHAA 3FDRA 2V7YA 3LM2A 2HBKA 3ZEUB 3ZSOA 1GLFO 3RMBA 2CP0A 1J53A 3AO1A 3CQYA 4K41A 4KV8A 4X1YB 3S06A 4LNUA 1YI2F 4CJEA 3TI0A 3LWOC 3QPHA 4M75F 1NBWA 1ZC6A 3SK3A 2WSEE 1QVGP 2E65A 3WJPA 3V81A 2F2XA 4LC9B 2FLOA 2KT8A 1OU9A 4J5YA 1QQOA 3IQLA 1DTTA 2XKOC 4ZGEB 3KLHA 4PJOF 5GANh 1VQ9A 3S41A 1NOZA 2QDYB 3CCEQ 2B5JA 3HI0A 1C1AA 1HK9A 2IAFA 1ZWZA 1TU0B 1YT3A 2NUZA 4LF4K 3A2FA 1UJYA 3ENBA 2VYPA 2CWJA 4UQGA 4G1QA 2L8DA 1M90H 3CC2T 4CJPA 1JJ2A 1M90C 1MV3A 1JLEA 4NXMK 2VUBA 1QHAA 4BREA 2ZOVA 3F0DA 1KIKA 2DPPB 5IHKA 5KX5A 4UY8O 4MO4A 2D1XA 4FYXB 3VQDA 3RYFA 2P9LB 1XHXA 3UT5A 4JKEA 3HVRA 1CZBA 1NOYA 1GZ0A 1VQ5Q 2FVUA 3N4YA 4H5VA 4PY5A 4O2AA 2J4RA 1X9MA 4LDUA 1T8EA 1VHXA 1U47A 2M1HA 1NEGA 2CT3A 3FZMA 3N5BB 5KYWB 3OW2M 2JTMA 5J2QA 5F2RA 1CXQA 5HY0A 1X9JA 3BUZB 1NYFA 1M5Q1 5JVDB 4MMKA 3S03A 3QEWA 2PFUA 3M4YA 4K25A 4JK8A 1VQPQ 3CMAN 4FJ8A 3L3UA 1TKDA 3I0RA 4FK0A 1WI7A 3MEWA 1LWCA 4QKUA 4YDUA 2LCAA 3ZO8A 1N32K 3WQUA 1VH8A 5AQJA 4U67L 1U45A 2HF3A 2IG0A 3QO3A 2QWNA 1UG1A 1OEBA 2VV5A 3VEOA 2DF6A 2RJCA 2ALEA 3ME9A 2VQFK 1NGCA 2RI2A 3I5RA 3VS4A 3VOAA 1ZBJA 5KGWA 4FSSA 1ZHIA 4O5VA 4KHUA 5JVGL 2O8FA 3I5SA 1CLQA 3P1GA 2QWRA 3CXCF 1YI2A 2ZCFB 2P9LA 1JCGA 2RPNA 5HP1A 1QVPA 4HVWA 4IUVA 3CYQA 1RT1A 3S0HA 3ZSYA 3E9GA 2QGGA 3P83D 3FJ5A 4H0TB 3PSFA 4IWVA 2WSCE 3JAWB 3FLGA 2RHJA 5E84A 3GHZA 3VEWA 1A0NB 4IDKA 4YJ3A 4J8FA 4JKFA 1K73U 3SUOA 4O4JB 3RYIA 3MCQA 4LF8K 4BT6A 1IKVA 1JLGA 1MMAA 4OMNA 5KYYA 4J2BA 1FMKA 3CCQF 2W6KA 4N47A 4IUUA 4DV6K 1L3SA 3V3TA 1Q86H 2NLUA 4XU1A 1SKSA 2LRQA 1JXMA 4W5RA 4YTLA 4HUFA 4CFDA 3M54A 1E7OA 4M63C 4L3QA 1KC8U 1VQ4F 3G10A 5LOVB 1WUAA 1ZBLA 1ESVA 4Z4EA 1QKXA 4PUOA 4CEQA 4WBNB 4E7JA 2BH1A 2RHOA 3LWVC 5CZ2A 4CZKA 1PF5A 3OW2P 5KE3A 1KAXA 1VQ4N 1WJQA 3AVNA 1ASUA 1HYZA 3ZEUA 2QW9A 4I6MB 4PJOE 2PZ1A 4LFBK 2LQWA 2JNBA 2BANA 3DXMB 4FVMA 5AQYA 5A2QO 2EIFA 1TGOA 3TSPA 5C6SA 3CF5L 3A8MB 4E6RA 1OPKA 1HXDA 3QZ9B 3AVBA 4CZMA 3PIOL 2E2NA 2EYXA 3NAEA 1ILYA 4BRDA 1D4XA 1H7MA 3DC2A 3KHNA 3WEEB 3NDKA 4FW2A 3CMET 1D3BB 1LW2A 2AA4A 1NJWA 5BR8K 2EJ9A 5HRRA 2ZJQL 3HHTB 2A36A 1D3BA 3DMJA 1GO0A 2JJ9A 4IEEA 1KVAA 5AZJA 2CUBA 3G4ST 4KRTA 2F69A 1KNJA 5FROA 1VQ7T 4V2SA 1BI4A 3HRGA 4CJWA 1X52A 4KKOA 2ZQBA 1WHLA 1R0BG 3OYFA 2WUSA 4DA4A 1Q8IA 4B9TA 1D9DA 2KLAA 1JY8A 1CSKA 1GLLO 2LT1A 1RT2A 2O8BB 4I55A 3M0PA 4FO0A 3NMZC 2EGAA 3L8BA 4VUBA 4IKFA 4FWQA 4PJJA 1TUBB 1HD3A 1RDAA 3NCIA 2UXCK 1VQMN 1OH7A 4F16A 2VAWA 3EGUA 4L6V5 2LBTA 2ZGYA 5D6YA 1KSWA 1J5OA 2L2PA 4XTVA 2XHCA 1YJ9Q 1DGKN 1HLUA 5TKYA 3CXCM 3O4NA 5JVHL 2HL5C 3GPLA 4ZHVA 3CCMQ 4JK9A 1I0CA 2GFAA 4OPKA 2QWQA 2DIGA 4CJ4A 2MWPA 3QJYA 1VQ6F 2AHJB 4I9LA 3EFOB 1K8KB 3AVKA 1M1KC 4C5HA 4AFQC 1VYVA 4M7AA 3CYMA 4HCKA 4BGBA 1Q81C 5CA1A 3P5JA 2VWBA 1X43A 2AK5A 4JN4A 4BY6C 3V9SA 4CF0A 5GMKj 5A0DA 1UWBA 4BRFA 2W0ZA 3TU4K 2ITMA 1K76A 2CZ6B 3CCMN 2HHXA 4NYNA 3C9SA 1T3SA 1DT9A 1RAAB 4JKHA 2RN8A 1W5FA 4CF8A 4YJ2B 5CAIA 4TV9B 4PQUA 4Z02A 2FBYA 3O9TA 3K12A 4CEAA 4JS4A 2HRYA 1RI9A 1N36K 3QKJA 4KUIA 4EB6A 5LXTB 4A2BA 4DRXB 4JJDA 3LWQC 3X25B 1VQ6A 3D2EA 3ZT4A 4EIAA 5EIBD 1M2VA 1MV0B 1PKTA 2DFUA 1SKWA 1JXOA 3NK6A 4B08A 2DY4A 1Q86U 1BCOA 2HMAA 3UKRB 4GLKA 3J7AF 4MZMA 3U9ZA 3ZX2A 4ZOLB 1VSJA 4JI2K 2WSFE 3DLGA 3VU3C 2BTQB 3GTZA 2L3QA 5GANe 3L2QA 1WSJA 2DBMA 1E4GT 4FM1A 3CBOA 2QXLA 3A8YA 4IOAL 1R1MA 2PYJA 1Z9ZA 5JS2A 3ZT1A 3CCJF 3ULEB 3NHGA 2GGRA 4DFMA 1KC8R 2YX6A 3DOLA 3T7ZA 1EQYA 2O8CB 1JL1A 1NKCA 1K8AO 3WXLA 3MP1A 2O8EA 1U2VB 1KD1R 4KHYA 4ZHQB 3ZSVA 3G4SQ 2O8CA 2ZODA 2QXFA 5C25A 2J6FA 2DD5A 1UGRB 2LMJA 3GLXA 3MHXA 3VRZA 2KGTA 3V7SA 3OYBA 2NLXA 2ZWHA 3EE9A 4FPAA 4CIGA 2X3XD 4M78E 3AVCA 3RYCB 1RLPC 1ZBFA 2DEUA 1WSEA 4DU1A 5EC7A 3WNHA 1K73O 4J83A 3CMEA 1VQLQ 3QINA 3OW2A 2Y4YA 2LVMA 2FZKB 4JS5A 4B3OA 3K57A 1HJOA 4BRAA 3AO2A 4BQLA 1KD1O 1UA1A 1K9MH 2X6SA 1S6QA 2GFUA 3O8MA 4IEIA 4OMLA 5J2TA 1Q7YH 4R40B 1LNXA 1VQ5A 3CC4F 2DAQA 2DLPA 3H6ZA 3FZHA 3NF7A 5CA0A 4YJ2A 1N9RA 1YWPA 2E2QA 3K5NA 2DNUA 2PUOB 3HPWA 1E6GA 2X4XA 4C92E 2D0NA 5KYXA 1VQMQ 1D1CA 1F1BB 2DO3A 5GAN6 1WSIA 5CKEA 3LDQA 1S1TA 3WT0A 3ZSQA 1N5YA 4FK2A 1OVYA 2QKKA 1OV3A 2NRZA 5EVZA 1DEJA 1W5BA 3F73A 4C8QG 5HK3A 4FM0A 4HT8A 4YOWA 3VGKA 2P84A 3K2XA 1RADB 3QHSA 3TAMA 3GOXA 3I55T 4BRHA 4RUGA 3MEUA 2VWFA 4E3SA 3VTIC 3VTHA 4C0GA 1MNDA 4WCIA 3CCJQ 1UGQB 1SZ2A 5AQNA 3THWA 5FJ4C 2VG7A 1QWFA 1DLOA 1NK9A 3IKEA 4O4HB 1O1WA 1M90O 4KHSA 5LL6Z 3TREA 4H4MA 4F6RA 2RA2A 1YTUA 2HP3A 2OTLQ 4LD9K 4WFBL 5CA1B 2DXBA 5LJWA 4CZIA 2J6OA 4HHTA 1UTIA 3M58A 3SPYA 1ZYQA 2P9IA 1BI1A 1TUBA 2RO0A 3JVHA 4M75D 4BVTA 1AZEA 1QP2A 3UA6A 3BY5A 4K11A 1VSEA 4O4IB 5GMKe 4C82A 4ISEA 1U6ZA 1ATSA 4A5AA 1VQ8F 2NRHA 3O4WA 2RE2A 4AM7A 2EAYA 3J7YP 4KULA 1ARKA 3BZKA 3ELCA 4IUTA 4M4ZA 2UYNA 3TD5A 3JCMc 2QGFB 2YNHA 2XHBA 1OX8A 3V9ZA 2GWKA 2KFNA 2JMCA 3ENHA 3LDOA 5KGXA 3G4SN 4EIKA 2M0OA 5B8HA 5IJ9B 3M9QA 1VQ8A 1V29B 1JXBA 3VUZA 3CCSA 1S72T 3KFVA 1J9AA 2B6AA 3G25A 3VETA 3Q1JA 3HK2A 2LX7A 5GIOC 5GAMh 4KI4A 2D0AA 3CCJN 5C2FA 1R0AA 2K1SA 3CM6A 4HUEA 4JUVA 2DX1A 5LJ5e 1TK8A 4AF1A 1T3LA 2Q1XA 4HCBA 4DFPA 4M7DB 2V8JA 4EZ9A 2RB9A 3OY9A 4M7YA 3T9NA 3CBMA 4M78F 2HSTA 4CGIA 3AA2A 4PJNA 3VOBA 5BPNA 3HTNA 4CEDA 4M75B 2RMOA 1KD1U 4CZLA 2VAMA 4F14A 1VQKA 1WHGA 2LJ0A 5GMKl 1VQ4A 5IJ0A 2A7YA 5FU6C 1OPLA 2D5RA 3THVA 4JI3K 1KFZA 2W10A 4XTXA 4JZ3A 1YNZA 2EQJA 4Y1CA 1MGQA 1CKAA 3M8SA 5BPLA 3N4QA 4PJOB 4X65K 3ZSWA 3EG0A 3RTVA 1LCUA 4DTSA 3TAQA 1XNRK 1GCQA 2PU9B 1HSQA 2D8JA 3BGRA 4X20A 1OZ2A 3G6ET 4EP4A 4C8QC 2YHYA 1T7PA 2JS2A 4W5NA 2HVYD 5LP6B 3RERA 5SZTA 3N2GB 3CPQA 3LZIA 1NG2A 4PLIA 1G3TA 1NM7A 1QMCA 4C92F 2QEXQ 1M8VA 3NF8A 4Z4HA 5C2DA 2BZXA 2O8DB 2P9NA 1JEGA 1I5OB 1S6PA 1U1TA 4FL9A 2P9SA 1MUZA 4KB1A 2UYTA 3JCMJ 1I8FA 1QP3A 3DAWA 3D2EB 4BI8B 3E19A 2XY7A 4ILHA 1QSYA 1ZBIA 4BDYA 3D2FA 3CPEA 3U9DA 3S3MA 4DV2K 1OYXA 3DRSA 3FZLA 2IDOA 3NMUA 4TV9A 3RRHA 1D8YA 4BT2A 5A0GA 5HLFA 3OSSC 1X6OA 2QI2A 4FLTA 5JCOC 2FEIA 3MX2A 2CGLA 4YY3K 1L3VA 3ZSXA 1FSZA 3HTRA 3R0PA 1LJOA 4MFBA 2H8EA 4FCYA 3KD1E 1RACB 3PMTA 3VQQA 1Q82U 1B7TA 1U8RA 2XY8A 3G6EA 1W2BM 2AJQA 1VSKA 4BRQA 3CCEN 5FLXM 2DL4A 5GIOA 4PWTA 4GY5A 3QSUA 2V9YA 5HY1A 2F8SA 4A4HA 2RJDA 1EO1A 3HRSA 1WOQA 4XQ3A 1XJWB 1WJSA 2FF6A 2XO7A 5AQSA 2H3JA 5EX5A 4BC3A 1VQ8T 3AHUA 3P38A 3SUQA 2Y4XA 1K1ZA 4DSLA 1Y0MA 5GONB 1W7AA 3FB9A 5GANj 4ELTA 1BOTO 5FPNA 3AV9A 2OYQA 4EZ6A 2BE9B 3HBTA 1NKEA 2JLEA 2ESWA 1XWLA 2H3EB 5GAMg 4MDAA 3U3GA 1SAZA 1YHQF 3F70A 1QVFS 2EJFA 4DR5K 3QLHA 3CQTA 3SB2A 1TL3A 5HRSA 4DS5A 4GVMA 3CCVA 1PWTA 3WGMA 2D0OA 2H6LA 4A63B 4DLGA 3M5AA 3VV0A 1VQKQ 1IV1A 5IT9O 1LWEA 1IV3A 2IS3A 1BQMA 3M1XA 4CJKA 1NMUB 2DKGA 4Y0WA 4M7XA 1Z05A 4A62A 4M41A 3ULDA 1PSEA 2OTJA 4WQ4C 1ASWA 4I50B 4MLHA 2OPRA 3O08A 3KD5E 4HNAA 1YAGA 3I9QA 1HNXK 3L0QA 3RKXA 5LJ3g 3S3NA 4E1NA 4H5NA 1YF5L 1KCFA 2F1LA 4X34A 4JK7A 2EVRA 2XDDA 1LPLA 3KZBA 3VQCA 3E1SA 2V51B 3R9PA 2DYBA 2RI5A 5I2MA 2NUTA 3VF2A 3PX6A 1VQMF 1S1UA 5GAOm 2E5QA 1GLDG 4W5TA 2F9TA 3SCXA 3QG1A 2KK4A 3MEVA 3CC4Q 1FMWA 3DLLA 3B6PA 1SL1A 5IT9M 1KG1A 1XUPO 4DSFA 1FKPA 1FNJA 3CJCA 3OSVA 4KT0E 4DV7K 3KLIA 4C8MA 5G4UC 4JKDA 1ZUUA 3G71F 5JICA 2BE7D 5CQXA 2KRNA 3ZX0A 4IOXA 2XI9A 4XTYA 4N4GA 4WQ5C 3A8HB 2E1YA 4X20B 4LCKA 3SWNC 1GLJO 4CHQA 2ZVYA 2O8EB 4M77E 2PNIA 1RT4A 3JAMM 1ZXOA 3MEDA 2G9IA 4FWLA 3LPUA 2P51A 5AQGA 3IFRA 3VS0A 5GIPA 5BMVA 3ZETB 3V6DA 1MHNA 2OA8A 4L8RB 4UC4A 3OHRA 4NO7A 2JT4A 3H6EA 1J7HA 1RQ2A 3P8HA 4FL6A 3LPTA 4EAHD 2W40A 2F7TA 1LAWA 4JI0K 4CIEA 1NZ9A 1YHQQ 1UE9A 3CCLA 2RHZA 2DILA 1M27C 2HP0A 1RL2A 2VAPA 2K5IA 2GTDA 1XTDA 2P9UA 2O88A 1QD9A 1HNZK 1HKBA 3CC7T 3LL3A 3HFOA 3V1OA 2OPSA 5KYUB 3A5OC 1SKUB 3OA6A 3EG3A 1Y07A 4M75C 3CCQN 1YFNA 2CHSA 2D4WA 4OP0A 3O1BA 2HBWA 3EFSA 4QVZA 1UGSB 2BTUA 3VGMA 4DMNA 3KIZA 1SEMA 1EX4A 1R59O 1YVNA 2D0PA 4H0XB 4PJMA 3CC7A 2OZSA 1W3EX 3F0FA 4EMKB 1JXEA 1WAJA 4DV3K 3KJJA 3L6QA 4C8IA 1EWRA 4PFZA 5LJ5j 4F9OA 2M16A 1T0JA 3J81E 2C0OA 1KC8C 1W1FA 3VA3A 1E7KA 3HM8A 2EQKA 4O5FA 3TTCA 2CZ1B 3L42A 1XI1A 1I39A 1WLPB 4JKAA 3VS7A 5GAN4 4M42A 4MDXA 5GAN8 4XTUA 4RG2A 2GNCA 2HP0B 3WXKA 5BR9A 4CEBA 3OONA 5KI6A 3GBTA 4RTUA 5GAN5 4BY6B 2ABLA 2QG9B 4K8XA 1QVFA 2LQNA 4DOVA 1RAHB 1UUEA 5GANd 3D7SB 2DTUA 1VSDA 5TKWA 2YHTA 4GLMA 3CXCA 3VCZA 1RA4A 1M2OA 2NRWA 2VVKA 1B9FA 2NUBA 3WUHA 2I2LA 1U3LA 2KTVA 4M8IA 1SA0A 3C8LA 3UT1A 1B34B 3J7ZO 3WGNA 2OANA 5I9EB 2KY9A 1JQQA 1VQOT 2HHQA 4U3JB 4DF4A 4E2FB 3NH2A 3RA5A 3HO1A 3SEMA 3QEVA 1RAEB 3R6NA 1UAXA 4HWIA 4C1NI 3KK2A 5CB4A 1K73R 2HVHA 3N2KB 3SIVA 4FJGA 3OJSA 2N48A 3FD6A 4OVAA 4HNAB 4TZZA 1SHGA 4C5IA 3NF6A 4OKEA 1UB4A 3VQ8A 4B1UB 3RSEB 1VQNT 3TANA 2Z1FA 2Q31A 4X3MA 4GV6A 3CHWA 3CC2A 4CF2A 3MO8A 4GVEA 3D00A 3CCVQ 1YITQ 1TOVA 1NGIA 2YNGA 3S0WA 4CK3A 2HCKA 3C7NB 1ZSGA 4KGVB 3ZT0A 2D0CA 3ZSRA 1BI3A 4A61A 4BC2A 5JH7B 3D45A 1RBSA 4ZN3A 1KVBA 2YLBA 2OTJQ 4CFCA 1WLJA 3V4IA 2DVJA 1GBQA 1MWKA 4CEFA 4EP5A 1RLGA 3CCET 4RW9A 4LD0A 2OTLN 2D6FA 3NTIA 4BROA 3K58A 2UXBK 5E41A 4G4XA 1TVRA 4BT5A 3RIRA 2Z1TA 3V1RA 5I22A 1X7OA 5HY2A 4EDUA 5HXUA 2ZVZA 4BRNA 4XCQA 2YRDA 1N27A 4B9MA 3M0TA 3OB9A 1EKEA 4IBNA 3AA3A 5CR4A 1KQSM 3G71N 3EEQA 2MF2A 2SRCA 3EHRA 3PIPL 3I8DA 4X1KA 5EIBC 1BIBA 3EKSA 3PX4A 4OB1B 2X78A 1G3SA 5EYPA 1I5LA 2Z1IA 4BDPA 3OYKA 1T6CA 1VK3A 2UZHA 5KTQA 2Y1JA 5GJVB 3KWIA 2E20A 2JWKA 5AFUH 4ELYC 3CB2A 2DEQA 1WN7A 1JFFB 2Q1YA 2KBTA 2E1HA 3JB9D 4C1NK 2AT1B 1RT6A 2LDMA 4PJOD 1YJNA 3JCMh 1NGEA 1Q18A 4RW7A 3DOKA 4IUQA 3FD5A 3GYQA 5J2UB 3IMXA 4CI6A 4XIUA 5CA0B 2YHXA 4ILGB 4AFUC 1NGGA 4FWRA 3MJXA 5CHIA 4Y91A 3MQWA 1VAZA 3NBPA 4BT7A 2A42A 3LAKA 4ICLA 5H1SQ 2Q97A 1ZX6A 2YKMA 3N4ZA 2DMOA 2YRCA 3TAFA 4O6JA 1YHQN 4YFUA 2FSJA 4BR2A 3OYAA 2CP7A 2CSIA 3ITHA 1NK4A 3U0OA 1RAIB 3LH5A 2HHTA 4J9FA 2BUPA 3V4DA 3UKRA 1SKRA 4TV8A 3HKEB 1HYOA 3DB4A 4B8CA 3SWNB 1VQ5T 5FU7B 4JKCA 1OH6A 5LXTA 2RQUA 2PAVA 2K4YA 1YIJN 3E9OA 4EHUA 3AARA 1UJ0A 1VQNQ 2J7IA 4RTTA 1TL1A 1HYSA 1VQOF 2EKOA 1W2BA 2E2PA 2R6R1 5LJ5d 3DDNA 4BACA 4FWKA 5CYMA 4JRPA 1BIAA 1WHHA 1WPYA 3M4GA 3QBWA 4FJIA 1GXIE 5KX5B 5KCHA 1BL3A 5CKFA 4BI4A 5GAOp 3WJRA 3TTFA 4KH1B 2E5LK 4AHTA 2IQQA 3SPZA 2R57A 1G5VA 4R5PA 3PO5A 2HHWA 3F0GA 4RHAA 1LAVA 3W3DA 1ZA2B 3CJAA 3FFIA 1C1BA 1ITGA 2NUTB 4EB6B 4FXDA 4I2PA 4LDXA 1QVGM 2QA4N 1GOAA 2VGNA 4Z4CA 2I7NA 1NQ3A 1GLAG 4RG8A 1YIJQ 1OH8A 3RSEA 3KK1A 2VXFA 3CCEF 1T0KB 1CN7A 3LP3A 3ALYA 4KH4A 5AQIA 3CQ8A 1RDBA 3HSBA 2X74A 1K9AA 1TKXA 5AJ3K 1EFNA 3M8QA 3WVDB 4C92B 4H0YB 3SAFA 4CJSA 1H48A 3MCPA 4I55B 3L1AA 3OQ5A 4A5BA 4DG1A 4LNUB 4CESA 3SAGA 1PHTA 2R5AA 2GBQA 3MECA 1X1PA 3P39A 1S72A 4J9GA 3TPQA 2CREA 2KSSA 2MMPA 2K3XA 4B5CA 1W2BP 3OYEA 3LAMA 3IKFA 4CJFA 3RNJA 4FJLA 3OS5A 4XAXB 1W97L 2YJFA 3QIPA 5GADP 1AEYA 4BVPA 3L2ZA 5JMVA 1W5EA 1FFXB 3KJKA 4YORA 4M3RA 1YJ9N 2HNYA 4B3SK 1ZBHA 1HUXA 4E0DA 3OW2S 1C1CA 1RBVA 3IKMA 2O4XA 2NRTA 4O4HA 1NWKA 3V9WA 2X9HA 1N8RU 4C92D 2KFZA 1WBDA 4FWSA 4RTYA 4DSJA 4BY9D 4H0VB 1IBKK 3P0ZA 1XHZA 3R1XA 3CPWP 4TSXA 2PVOB 3K5OA 4C8NA 3G6EQ 1MMGA 3AAPA 4KHQA 1Y7XA 4IO9L 1HRHA 1K9MC 2KZZA 3VYGA 4Q0BA 3CC4N 3HKDB 2HVIA 1PM3A 3CCUA 2P9PA 5I42A 2JWLA 4AH9A 1IH7A 3LDPA 2NRVA 2FC0A 2A41A 4RCCA 4DCHA 2F2WA 2ZZDA 3PFSA 1WFWA 5KCOA 4QQ6A 1M1GA 3LM9A 3SV4A 4U3JA 4DQ2A 1A5WA 5J39A 3MX5A 3M3ZA 4JI1K 2Y1IA 3RYCA 2O8FB 5CE3A 1SS6A 3QTYA 1Z25A 4CF9A 5JCOA 4M77A 4BVRA 3PY8A 2P0PA 3ZLJA 2HHUA 4XTZA 3EN9A 5KPZA 1U48A 3TABA 1U5SA 2GZLA 1KQSP 1EZZB 1YUWA 1VQPA 2BDPA 4LSLA 3PVQA 1JBMA 4GBQA 2IOCA 3O5ZA 4M7DA 5GAOq 3Q7BA 4Q5VA 5HRNA 4QQGA 3CBPA 3AVIA 2OTJF 4C92C 4DQ8A 2EFIA 1IRXA 3VS1A 3GF5A 2MCNA 2O9VA 5KYNA 2PHNA 4FU6A 4DEXA 5LJ5f 3NGIA 4FLXA 4BUGA 2RK2A 5CQYA 4H5TA 3CPWF 1RFQA 1RABB 1TSFA 1XMQK 3E66A 3ENOA 1TUCA 3WNEA 3UT5B 1HKGA 3VERA 4CZGA 4DQRA 4M77D 4KPYA 4QW2A 1GFDA 4WTOB 4YOXA 2NUPA 5JVDA 1QAHA 4LDYA 3BW1A 1UHFA 3ZETA 2EQUA 1PCXA 4J2EA 4J9IA 4A4GA 1W2BF 1Q7YC 4E7KA 2ZE2A 3UKUB 1VQON 1CK2A 1U3OA 3O3FA 1S72F 3V8JA 5LJ3e 1IG8A 4CFBA 3O9SA 3HP6A 3P10A 4C0FA 4DBFA 1YQNA 1M9SA 1MNEA 2HQSC 4FJ9A 5GAMd 4KGXB 4JZ4A 3LX7A 2QYZA 1LWFA 3W0LA 4BGAA 1RNHA 4X64K 3T1YK 3ZP7A 4DS4A 4PKIA 3UWNA 4KREA 1ZQ1A 3VJPA 1NNEA 3PMIA 1VQ8Q 3JXUA 2COZA 4H4OA 2BKDN 4CZHA 3VF4A 4CZJA 3UA7A 1UFFA 1KVCA 3O4QA 1TG0A 2RQTA 4LDWA 4P5NA 2V1QA 1BHLA 5AZIB 3VTIA 3WXIA 5BN8A 4E7SA 3I56Q 3RKWA 2XU8A 3C94A 1SHFA 3CCLQ 5BN9A 3PSIA 4PJOC 4I9QA 5GAMe 4CHZA 4DSEA 3FLCO 3QBXA 2PUKB 3DXKA 4DV0K 2V52B 2JS0A 1VQKT 1M3CA 1KAZA 4RW6A 1IO6A 3DLHA 3K5LA 3M5RA 1GFCA 3D54A 1BYMA 2HMIA 3IR9A 3T80A 3U4LA 2NZTA 4C5GA 1Y71A 3CCQT 2BO1A 1WIEA 1WA7A 2G8KA 5FLXO 5EYPB 1GOBA 2DZ9A 3JARB 2FG0A 5F0XA 1FXXA 3I55A 4IXCA 1W41A 4JPBW 2K6DA 1MA9B 3BE3A 1SZQA 1PG5B 1FNKA 2XDBA 2ETJA 3MK6A 4OJRA 1QSLA 2MK5A 3SUNA 3MKDA 1VQNA 5FNVB 1VQ4T 1N33K 5DM6L 1G8XA 2B8AA 4NCGA 5CB4B 3C9UA 3TD3A 8AT1B 3M6GA
chains in the Genus database with same CATH topology
2ZPGB 4BY9C 2R5MA 3NTHA 4WFAL 3HZ6A 4C4WC 4B9XA 4A54A 4MLEA 2ZGWA 1Q82O 3OYHA 4OB0B 2L89A 3OW2F 4XEIA 3CMEF 3L2RA 2E12A 4O8KA 3CD6N 2FXUA 2RHIA 5GANf 3ER0A 2ZPBB 3G4SF 3QBYA 5EG2A 2RJEA 2NRXA 1VQ7F 2RHXA 4NL2A 3QFUA 4XU2A 3I33A 4KUDK 3OYYA 1NPRA 4PJOA 2WFBA 1B34A 5KH6A 2I7PA 5AQTA 2BUDA 4F7UG 4M7AG 4I6MA 4FOIA 2G3RA 4BVOA 3WQTA 2HF4A 4BRKA 4ZGDB 2CGJA 3GL1A 5C12A 3M55A 3QMLA 3LGFA 1VQLT 5DY9A 3MN7A 3L2WA 2DZCA 3NMUC 1NGJA 4CI0C 4C0DB 3PIOA 1K8AU 4M77C 1G99A 2E2OA 4BG8A 4L59A 5AQZA 3FE1A 3UDCA 3BEXA 3KXTA 2HBPA 4JHDB 4YOYA 1YIJF 1YITA 1YITT 4BW0B 5LL6S 3CCUF 1HKCA 5GAMj 2XIDA 2FC3A 2QQRA 3OYDA 1E4FT 4M7DG 3META 3HRUA 1TUYA 3CIPA 4RCBA 3A5LC 2L3RA 1YJ9T 1YJ9A 5GAN2 4C92G 1K9MU 4M77F 3CCMT 2XK0A 4X3LA 1JRIA 2O4XB 3BP8A 1QQMA 1KAYA 3HOSA 4BRLA 1S72N 3FEOA 5GAN3 2QEXN 3JCMP 2JVVA 3JB9F 2HOEA 3VEXA 3VESA 3LWPC 3CCRN 2AIFA 1VQ9F 4HT9A 3OA9A 3P8DA 5GAMf 1SQKA 5M9OA 3CC7F 4J7FA 5GAEP 1WJRA 3WEEA 1VQNN 1KD1H 1BA0A 3QICA 3AY9A 4IO8A 2XICA 3LDLA 4YOUA 1PSFA 4M78D 4NB4A 1VQ7N 5A0LA 5GAN7 4R56A 2OAUA 2GX9A 4IUPA 5AQVA 5LJ3f 3C7NA 2E70A 5M1OA 1YXQA 2KQWA 1M1KO 4WQ5A 2XG8D 2GWJA 3EFRA 1YIJA 3OBWA 4F7UE 1VQLF 3FRNA 5D6WA 3MN9A 1Q81U 2IVOA 4OF1A 3EAEA 4OPAA 1Q7YU 4BR9A 2VGMA 3M57A 2QTXA 3G6EF 3CPWS 1NMDA 3LFOA 3CCUT 2HNIA 3OMCA 4ZTJA 1XNIA 1Q86C 3INZA 3ZBDA 3VUBA 2LNVA 2KHOA 1YJ9F 1VQOA 2P9UB 5GAOr 2D1KA 3JRZA 2DXCA 3O9QA 2IVWA 2M9UA 4TVRA 3GIBA 2F5KA 3H8ZA 1YJWN 2HBMA 3G71A 3DB3A 3VPZA 2VXEA 3BF3A 1M90U 3L4IA 1O13A 3CXCS 1LOTB 3V7EA 3A5MC 4GV3A 5BREA 3C4SA 5J3BA 4G9ZA 3H1QA 5GAOl 1BI0A 2JOYA 1N8RO 5DM7L 2OTLT 2OTLA 1I81A 5EXWA 2JTFA 1S22A 3VENA 5A2QE 3R6MA 2VC8A 1T6DA 3NVIB 4F7UA 3CERA 5J26A 3MDQA 5ELZA 4BB7A 3DJCA 1JJ2F 2YJEA 3ZYYX 1KQSF 4DB3A 1WGSA 5GINC 2WACA 1W40A 2CYZB 3ATVA 1N6AA 3CD6F 3NTKA 1T44A 2CZWA 3E1YA 3OYIA 4K43A 5FRNA 3LWIA 1KHCA 4BRPA 5CCAA 4EI8A 2LCLA 2GCXA 3M59A 1TH7A 3TEEA 1KXPA 2ZPFB 4F7UF 5GIPC 1RDWX 2GLZA 3CC4A 1X7PA 4KH6A 3HJWC 3UE5A 4OB2B 4CRIA 3VMFB 2IVNA 1GLBG 5BRDA 2KMTA 4MZPA 4YOTA 1VQMT 5HKCA 3NK7A 2P9KA 5AQXA 5G4UC 3MCAB 2XD0A 3FJPA 1OZ3A 4C92A 4Q5WA 5LJVA 5LJ5h 1VIFA 3SJHA 2RHUA 2YCHA 2A3ZA 1ATNA 4QS9A 4BI3A 5IAYA 2P9PB 4J7IA 1WQWA 1FWZA 1P90A 1H1VA 4X9DA 4KBOA 4NUTA 3V7QA 4BG9A 1G3YA 2HAXA 3CMAF 3CCQA 2FF3B 2ZJRL 4FSVA 2E8AA 4C8QE 5AQFA 4FT2A 4M7DF 2LQKA 2K2VA 5CVIA 4M78B 1BWFO 1DJ7B 2A5XA 3OS0A 2BTFA 3QUIA 3O9RA 5AQRA 2CGHA 2OTLF 1AHJB 4H0OA 2GEMA 5BPMA 3O85A 4DOWA 2RB6A 1RDUA 3T69A 5GAPK 4BRGA 4B9QA 4BVSA 1VQLA 3WVEB 1VIEA 2EWNA 3JSCA 5AR0A 2O01E 5HK0A 3SBGA 3SWNA 4Z94A 4DKWA 4RKUE 4U7BA 3RVCA 2P9NB 4BR7A 1NGDA 3MWTA 3SLCA 1OI1A 5EWRA 2QA4F 1YJWA 1GLEG 4WF9L 2V7ZA 1H3ZA 4C23A 3CCRT 3EL2A 3R6OA 1LOJA 3VYHB 1QVFM 2QWPA 1JJ2S 4PL7A 2ASMA 1Q82C 3O80A 1RI0A 4H03B 4HCCA 4EI9A 4CD1A 3IDHA 3O8VA 1YJNN 2YI1A 4XH1A 2K5FA 2MI6A 1NJIO 1IJJA 4C8QA 3RUXA 1KQ2A 5FPMA 2FL7A 3MN5A 5ADXA 4FWNA 4CD3A 4IOCL 2QWLA 2CH5A 5HY4A 4FWPA 2F5TX 3EO3A 3TSQA 4NOYA 1K73C 4J6XA 4C8QF 3P8BB 3JCMd 3EKUA 1GLCG 3RA6A 2E41A 3LYIA 3JCMQ 3J8AA 2EWSA 1T3VA 3MP8A 3CCEA 1W42A 2PVGB 3R3LA 4FOEA 3RKYA 4ISFA 4GNIA 1VQLN 4XU0A 1VQ7A 3JCMe 4M77B 1IPAA 2QTDA 5AQQA 2QWMA 3O5BA 2WC9A 3A0IX 4NLCA 5AQLA 1V4TA 2RHKA 2DJZA 5DLQE 2A3LA 3AGRA 3ID6A 2QEXT 2DTHA 3UKUA 2HQEA 3JCMg 1XC3A 3NVKA 4C5EA 3TU5A 4N4HA 5M1PA 3CCRA 1XQHA 3HL8A 3DKMA 4B1YB 3PNWC 3K9JA 3OMGA 3S6WA 2QEXA 3EE8A 3A8OB 2KKZA 2ZF5O 4ME7A 4BE2A 3QB0A 1VQNF 3NFCA 4II1A 3RMQA 2YHWA 3HP9A 4PNOA 3J80E 5LY3A 3QDKA 4IDHA 1U1SA 3AAQA 2KDSA 3SIUA 2H3GX 4FSXA 3V8LA 1KHIA 5M1QA 4ZTFA 1ZBXA 4LDVA 1YJNT 5AQMA 3CCJA 1CZAN 3GNGA 4YDUC 1K8AC 2V8IA 1Y96B 5LJ5g 4R79A 3X28B 1X75C 5HOOA 4JRKA 3P4IA 3CQXA 2WBNA 3A8LB 3IUCA 3PTAA 1JJ2M 2I6DA 4IFEA 3KHYA 2GQVA 1NE8A 2CKKA 3FR0A 1W2BS 3SFMA 2HQXA 2OZBA 4JHDA 1ATRA 3VF6A 5L8RE 4PL8A 3SMSA 5I2SA 4MDWA 5LJ3j 4BR5A 4MO5A 4N4IA 2DIQA 3LWHA 5DM7R 3RMSA 4B1XB 4JD2B 1Q7YO 3S3OA 2C06A 4JNEA 1K9MO 4NL3A 2ASOA 4N0AA 3SAHA 2FSNA 2F9ZC 2QQAA 2JN0A 3K9KA 4BDZA 1NJIC 1XBIA 2QEXF 3VI6A 3MMVA 1UEBA 2XDPA 2V8KA 2AP1A 5FLXE 2A40A 4PKGA 1SDSA 1X3MA 5F1XA 4PHTX 3FIFA 3ASKA 1ZBSA 2CZ0B 4HA8A 4ATOA 4XH4A 3PAFA 4M78A 5I21A 4BC4A 2X4WA 2CZ7B 2IVPA 5GANK 3CMEN 2JNGA 3CPWA 4J8OA 1VUBA 1TYQB 2GELA 3H3OB 1KC8O 3KWGA 5KPTA 3CCVT 1H641 3KUFA 1HPMA 4CBWA 3H1VX 4C0ZA 4QVCA 3OYNA 5ADXH 2OTJT 1BUPA 4A59A 5GAGP 1Y64A 1N9SA 2RM4A 3ULEA 5DCVA 1C0FA 5GANg 3PIPA 3M56A 3L4QA 1KC8H 4EPCA 2ZGZA 3OS1A 3VGLA 3ZEHA 1VQPT 4WFNL 3CPWM 2X4JA 3CCMA 2E88A 3HSCA 4OGCA 2KAFA 3O6WA 1U2VA 4BRMA 2WALA 4EMKA 1UGPB 4RCHA 4BR4A 3JCMM 4MDBA 1QVGA 3MP6A 4M75A 5CKDA 4IURA 3E20B 2Q1NA 4M7AF 5IN1A 4WYBA 4ILJA 3ATUA 2KVQG 1N8RH 4E7HA 1VQ6T 4ZGJB 1XQSC 1VQMA 3H3NO 4MMLA 3LGLA 2FSKA 1R8OB 3PGGA 4C0DC 2DXUA 2W41A 3CC4T 1YJWT 3VKIA 3V7RA 1BKBA 1JCFA 4JKGB 2X4YA 2ZPHB 1VQPN 4B1VA 2JZ2A 3MWPA 2RK1A 2D9TA 1XOVA 5GMKi 1BU6O 3C0BA 4H5WA 3R8EA 1YITN 5BRHA 5EO3A 4B9WA 3CCSN 4FT4A 4KH5A 1VQ8N 3G4SA 3CCVF 1M4ZA 3ZX3A 3BY7A 3PLAA 2E1ZA 5EY4A 4M75E 4M78G 1BDGA 2E64A 5JLFA 4IJAA 1HX1A 4M7AC 1W4SA 2OHWA 2CS7A 4QS7A 2P0QA 3D6RA 5GINA 4NQ3A 2FB7A 1N8RC 2PQWA 3AGKA 2EJGA 3CC2F 3HRTA 2RI3A 2LT4A 3GE1A 3P31A 2K57A 4QVDA 4PL6A 4JDSA 5FU7C 3OYLA 2ZPIB 4RTFD 4FVUA 5GMKh 5KE2A 3CJBA 2IIRA 5GAOn 3CD6A 2DXTA 3CD6T 2HMPA 4OO1J 3ID8A 1K8AH 4PLLA 2EYQA 1NGHA 4KBMB 1VQKF 4OMFB 4C8QB 1RGIA 1GO1A 2K3YA 3JS6A 5CR2A 3HKSA 4M7AE 3WXMB 5KPRA 1VQ5N 3OYMA 3CPFA 4XU3A 1WNLA 3CI5A 2NNWA 4XK8E 3V7CA 3CMAA 5LJ3h 1X3NA 3I55F 5AZIA 4EI7A 2D0QB 2JUFA 4ZN1A 2LX9A 3JB9H 4AM6A 3JB9G 2Q2RA 5AQWA 4CZFA 3I55N 4M75G 1NGBA 1YIJT 2VYTA 1NJIU 4A53A 5M1NA 1QQNA 4GY2B 5D6XA 1P8ZA 3JCMb 4JKBA 4WCEL 4BRIA 3BF1A 4PJOG 3D2FB 2RD1A 5LJ3d 5A2QM 4M7DD 2ZPEB 4M7DE 3HFNA 5HL7L 4RMOA 1VQ9N 4FIBA 5E26A 4Y28E 3A5NC 4BE0A 1VQ6N 2HD0A 2LTOA 1VQ9T 3J7AR 3TSUA 1WQ7A 3I8BA 3X20B 5M1FA 3JCMX 2LQ8A 4A4FA 3QFPA 4IZ9A 3BDLA 2QM1A 1BO5O 5G4VC 3Q7CA 5HXZA 3CJ7A 2K5LA 3L2UA 1BG3A 4XTWA 1EIFA 2LBWA 2ASPA 3L2VA 3EZWA 3CCLF 2DPNA 4WF2A 2BIVA 5AQHA 5GMKm 4M78C 3FC3A 1YITF 1J6ZA 3FZKA 5IT9E 1Y96A 1Q82H 4EMGA 4IJNA 3CCRF 4BRCA 4BD3A 2GUPA 3CCMF 3J80M 4PKHA 2ZJPL 1S3XA 3KK7A 1QVFF 2VCPA 3SDZA 2PBDA 3KVGA 3LLRA 3LDNA 3OBYA 3UPUA 2RHYA 3URGA 2Q36A 3GNFB 4GV9A 2EQMA 2FYKA 2QWOA 3H45C 1M1FA 3CCUN 4C8QD 3OYCA 3M53A 3DLMA 4JKGA 3OS2A 5JLHA 3SMPA 2YRVA 5BRFA 1C0GA 3E9PA 3BDUA 4CJ7A 3GP8A 1G3WA 3JCMW 4BE1A 3BFMA 3B8AX 1O9SA 1BI2A 3VEVA 3CC7N 3CG6A 4H0PA 1DKGD 2RJFA 2E6ZA 2NRRA 1QVGF 2X35A 1SSFA 1M1KU 4LD6A 1YI2N 3V8KA 4JJNK 3X24B 3O9UA 3DWLA 4D6WA 3CCLT 2KG4A 1QVGS 4M77G 3CCLN 5FRMA 2QA4A 3F2KA 5CIUA 4FWMA 2R58A 3X26B 5CO7A 3A8GB 1QW1A 2DD4A 1YBYA 3I56F 5GAHP 3QYHB 4JRIA 1Q81H 2MAMA 5KQDA 1IZ6A 2P9IB 1IREB 3C95A 1P92A 5AYFA 1KQSS 3C65A 3JB9I 2FHDA 5AQKA 4A2AA 2A6AA 3VOVA 1NLVA 4E7LA 1NJIH 3LWRC 3J81M 4M7AB 4B1WB 4OPHA 4HKEA 3F9MA 3QDRB 5MLCQ 4FM4B 3CMAT 3GG4A 4QS8A 4E47A 1NGFA 3CCST 4QQDA 2DTIA 5HY6A 1O75A 4JAXA 1YHQA 1Q81O 4J6WA 5KQ8A 4O8UA 3UB5A 1KQ1A 4N0AC 2OTJN 3M1FA 4EMHA 4YOVA 1MDUB 3MEAA 5CKHA 4JLGA 3F5TA 2QQ9A 4ISGA 4A57A 3NVKE 3CCVN 2E10A 1TYQA 4L5GA 3QZ5B 1TUUA 1JCEA 3JCMf 3JB9J 4E7IA 3CEYA 1KQSA 4EFHA 3G71T 4R55A 3KBGA 3JAME 2CH6A 5AQOA 4H5RA 1M1KH 4HCZA 5FPEA 2GF7A 3FZFA 2YLCA 3MN6A 3C6HA 3HTVA 2QQBA 5CK9A 3I56A 4M7DC 3H46O 2Q0RA 2FGYA 5FPDA 4RWTA 3G6EN 3CETA 2P4TA 3NVMA 5AZJB 2DK3A 5CKBA 3ON1A 4JEPA 2QA4T 3HAXD 2Y90A 3TTDA 1K73H 1Q86O 4WQ4A 3I56T 1YI2T 3CC2N 4M7AD 1QZ5A 5AQUA 2P9KB 3O1WA 4CBXA 3E9FA 2HBLA 4B1ZA 3D7EO 3DXMA 1NM1A 4J6YA 1BA1A 1QZ6A 2P9SB 3SD4A 3VEZA 4DHYA 3QIIA 3CCJT 1NGAA 3FFKB 3VEYA 3N4PA 5C0MA 3OYGA 4E1JA 3E9LA 2E6NA 3G7ZA 2Q0UA 4CBUA 5DLOA 3QXEB 4JD2A 3RESA 4OB3B 4NS5A 3JCMV 1KD1C 1FX7A 4CZEA 3CCSF 4FWOA 1I4K1 5EOYA 2PVDB 2HBJA 1VQKN 1YCYA 1YHQT 3C6AA 4EMKC 3FGUA 4A4KA 1X01A 3TCJA 4F7UB 1VQPF 2L5QA 3A5ZB 4ELZC 3LWQC 3QYGB 4HTLA 3LH0A 3ZFJA 1K8KA 4K42A 4JRQA 5C15A 3HOTA 3LW5E 4OGEA 3OYJA 3CJ9A 4BQZA 3FFMA 3GDQA 1V4SA 3C12A 2LCCA 2F9WA 1OKJA 4BVQA 4BR0A 4JLIA 1MWMA 3I56N 3QJ6A 4MZTA 3DLLL 5C10A 3PT9A 3WXJA 2DVEA 2QQSA 3U8XA 1NPPA 2MWOA 2CGKA 3SBTA 2P0KA 4NLBA 1YJWF 4BC5A 3CJ1A 2KTUA 5FU6B 4EHTA 4FPBA 3PLAC 4X9CA 3DXKB 2RH2A 4PKCC 5C0YA 1Z6RA 4XH5A 1JB0E 5M1KA 4A4EA 2DTOA 2LC4A 3GOIA 3FDRA 2V7YA 3LM2A 2HBKA 3ZEUB 1GLFO 3CQYA 4K41A 3LWOC 3QPHA 4M75F 1ZC6A 1NBWA 3SK3A 2WSEE 2E65A 4LC9B 2FLOA 4J5YA 1QQOA 2XKOC 4ZGEB 4PJOF 5GANh 1VQ9A 3S41A 2QDYB 3HI0A 1HK9A 1ZWZA 5HWEA 1M90H 3ENBA 2VYPA 2L8DA 3CC2T 1JJ2A 1M90C 4BREA 2VUBA 1QHAA 2DPPB 4UY8O 4MO4A 2P9LB 4JKEA 1GZ0A 3N4YA 2FVUA 4H5VA 2J4RA 4LDUA 2M1HA 3FZMA 3N5BB 3OW2M 2JTMA 5F2RA 5HY0A 1X9JA 3BUZB 1M5Q1 4MMKA 2PFUA 3M4YA 4K25A 4JK8A 3CMAN 3MEWA 4YDUA 3WQUA 5AQJA 4U67L 2HF3A 2IG0A 3QO3A 2QWNA 2VV5A 3VEOA 2RJCA 2ALEA 3ME9A 1NGCA 2RI2A 1ZHIA 4O5VA 5JVGL 2QWRA 3CXCF 2P9LA 1YI2A 2ZCFB 1JCGA 1QVPA 4IUVA 3E9GA 4IWVA 4H0TB 2WSCE 3FLGA 5E84A