3MCAB

Structure of the dom34-hbs1 complex and implications for its role in no-go decay
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
372
structure length
341
Chain Sequence
IEKNSGWITMEPEDMWHLYNILQVGDQLKASTVRRILVENMDFDTKAAQLHIKRTTEYHPMGSYHTLDLELHRNFTLYNEWDAFALDRVDAACNPSAEIGAVVLDEGLANICLITDYMTILRQRIDQVIPRKRRGDSSAYQKGLDKFYDSVFQSINSEFDFDKLKVVILASPGFVARGLYDYIFSMAVKLDLKQIVKSKNKFVILHSSTGHIHSLNEILKDPAVESKLADTKYVQEIRVLNKFYDVMNEDDRKAWYGPNHVLKAFELGAIGELLISDSLFRSSDIATRKKWVSLVEGVKEINCPVYIFSSLHESGKQLDLLSGIAAILTYPVDEEDISEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Dom34-Hbs1 complex and implications for no-go decay
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Translation regulation/hydrolase
molecule keywords Elongation factor 1 alpha-like protein
total genus 88
structure length 341
sequence length 372
ec nomenclature ec 3.1.-.-:
pdb deposition date 2010-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03463 eRF1_1 eRF1 domain 1
B PF03464 eRF1_2 eRF1 domain 2
B PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.870 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mcaB01
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3mcaB02
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3mcaB03
1YI2F 3LFOA 3LWQC 1JJ2F 1W3EX 3NVKE 2OHWA 3LWVC 1S72F 2VGNA 3CMAF 3J80M 1VQOF 1VQ9F 2QA4F 3CCVF 1E7KA 1VQ5F 5FJ4C 2OTLF 1KQSF 2FC3A 1QVFF 1Q82H 5GAPK 1YITF 3AGKA 1XBIA 3J81M 3I56F 3N4YA 4X3MA 3PLAC 1VQPF 2OZBA 3MCAB 3G4SF 3SIUA 1VQMF 3CCEF 3CCSF 3CC7F 1K8AH 5EWRA 4BY9D 1SDSA 3CC2F 1GZ0A 1VQ4F 2OTJF 3LWOC 5A2QM 3CCUF 3SIVA 1Q86H 4NUTA 5GIOC 3E1YA 1T0KB 1KC8H 2I6DA 5DCVA 3JCMM 1W42A 3CG6A 3LWPC 3CCJF 1W41A 1VQ6F 4AF1A 1Q7YH 1K73H 1RLGA 5FLXM 3OW2F 1GO1A 3CCRF 2BO1A 2JNBA 3NMUC 1W2BF 3CD6F 5IT9M 3G6EF 2ALEA 3CPWF 4TZZA 1N8RH 1VQ7F 1PXWA 3E20B 1NMUB 1VQLF 3VI6A 1X7OA 3WXMB 3CCQF 3CCLF 1CN7A 1YJWF 3O85A 3N4ZA 3RA5A 4LCKA 1M1KH 1YHQF 1K9MH 3CC4F 5GANK 2KG4A 3NK7A 3CCMF 3OBYA 2HSTA 1YIJF 2LBXA 4C4WC 1KD1H 1GO0A 2HVYD 3I55F 3CPQA 1ZWZA 2LBWA 2QI2A 1YJNF 3V7QA 1VQ8F 3GYQA 1QVGF 3J7AR 3FFMA 3HJWC 3CXCF 5G4UC 2WALA 5EO3A 3VMFB 3NVIB 1DT9A 2CZWA 1YJ9F 1NJIH 3RA6A 3NK6A 3JAMM 3HAXD 1M90H 2KTUA 3G71F 1VQKF 4BW0B 3LWRC 2KTVA 1RA4A 1IPAA 3CMEF 2AIFA 1W40A 1CK2A 1Q81H 3V7EA 1X52A 3ON1A 5GINC 5G4VC 3PAFA 4X3LA 1H7MA 1X7PA 2QEXF 2VGMA 5GIPC 3IR9A 1VQNF 3OBWA
chains in the Genus database with same CATH superfamily
1K73U 2ZF5O 3T7ZA 2FBXA 2L26A 5FNVA 1HKBA 5CAIA 2Y90A 1MV0B 1V4TA 4KB1A 3UATA 4CZLA 4FYYB 4HUGA 4M41A 2VGNA 1IH7A 4QQDA 4DR1K 1N9SA 3QWYA 2E6ZA 1VQ9F 3SCXA 3OYMA 1NGHA 2D0AA 2K9GA 2E1HA 3THWB 1JFFA 3M0RA 1T0AA 4NWOB 1MGQA 1VQ5F 2A1RA 2FC0A 2PVDB 1HNXK 2FF6A 3CCQA 2QEXN 2YJFA 3HRSA 3DRRA 2CZ6B 3KXTA 2QWQA 5EAZA 3CBMA 1HK9A 4UC4A 1P8ZA 2CKKA 1XHZA 4XU3A 4BT4A 2HD0A 3J81M 5GJWB 1JJ2S 4KULA 4OMOA 2UUAK 2JUFA 5GANg 2RN8A 1KAYA 3LDLA 4CJLA 6AT1B 5JLHA 2V7ZA 4IO9L 1MMGA 4DSFA 3I7TA 4HNAB 1I81A 3CC7F 5EXWA 3RYIB 3LALA 4I9LA 2BTUA 4O8UA 1M90U 3TSUA 1SDSA 5GAMh 2LT1A 2GZLA 3VESA 4LH4A 2FSJA 4XIUA 5J3BA 5LA6A 3V9XA 2AHJB 3NFCA 5KYYB 3ALYA 4PL7A 4LY7A 3H3OB 4J2BA 2V8IA 1VHAA 3PSIA 4K41A 1KAZA 2DILA 1XC3A 3SUQA 1KNKA 1Q8RA 4X1YB 1KC8H 3KLFA 1T0KB 1RDAA 3M5AA 5DCVA 3WNFA 3A8LB 4C8QD 4C8NA 1VQ5N 2DA9A 2QEXQ 1Q7YC 2FSKA 2ESWA 2GTJA 4JKEA 3CCEA 1ATRA 1OULA 5FLXM 2O9SA 3QSUA 3Q8HA 3QNOA 1W2BF 3I8DA 3ID6A 3QBYA 4C8QB 2OX7A 1EETA 3A5LC 4B3RK 3QTYA 3J80O 1Z5VA 3DLKA 1K1ZA 1SEMA 2Q1XA 3QYHB 3RYCB 1QSSA 3ZCMA 2ZGZA 3KLIA 4EB6A 3TI0A 4B1XB 2O8EA 3S03A 3LP2A 3WXMB 3EY1A 3C6HA 2HQHA 3LP1A 2QEXA 1VQ7Q 2ASPA 5FNVB 2D0OA 4Y1DA 1RACB 1BB9A 5AQIA 4BI8B 1RILA 5HY0A 3SIVA 2FB7A 3CC4A 3SNNA 1UA0A 3EE9A 3KLGA 2CHSA 3SWNB 2AKLA 3ME9A 3K14A 4HXJA 2BH1A 3DRPA 3G0ZA 5AQNA 2ZJPL 1RT4A 3PY8A 1G3YA 2PUKB 3CJ9A 5E41A 1HYZA 3E9GA 3AA5X 3O4WA 4YJ3A 2A7YA 5AFUA 4M75E 4AH9A 4TUYA 3S3NA 2LJ1A 4M3ZA 1I4K1 1HNVA 4ZHQA 4A53A 2X78A 4ELVA 2CGLA 5IWAK 4FWRA 3MEVA 2ATQA 3ZP4A 3E9FA 3ITHA 5J2UA 4OPKA 1NK8A 1L5UA 1Q86R 3CC7Q 2XG8D 3MKDA 1CXQA 1Z26A 4BVOA 3AVBA 3AO5A 2O8CA 1ZBLA 2Q0UA 4CEEA 2E5LK 3EG9A 3H0HA 3D2EB 1PWTA 1LWFA 5FU7C 3FZKA 4JYAK 3DLMA 1IGQA 1U6ZA 4DRXB 5CA0B 2P5OA 1LCKA 2FBYA 1CK2A 1BU1A 1TUUA 5CB4B 3V7EA 1YXQA 3M1FA 1X6OA 1SF9A 4OVAA 4M7DE 3HFOA 1VQOQ 3F2KA 4IG3A 4BG8A 4B9MA 1KIKA 3NDKA 2QEXF 3O5ZA 2OAWA 4BGBA 1NG2A 4JKHA 4CJ3A 3F70A 2F9TA 2HBJA 4G4XA 2G8WA 4CI6A 4I4TA 3HKCB 3MWTA 1VQMN 4CEZA 2G8KA 1WGSA 1WQWA 3TAFA 1EWRA 3QDRB 2GNCA 3IQLA 4V19S 2VB6A 1RTHA 2HKNA 1RT2A 4A5AA 3TANA 1GCPA 3L2RA 5ADXA 2WTUA 4G4YA 1R0BG 4Y91A 1MWKA 2L5QA 4ID1A 1U49A 1LPLA 4JLIA 2DEQA 4I2PA 4RUGA 4PJOG 4ID5A 4DBFA 3O9QA 4FK0A 2DIGA 3JB9G 3OJSA 1JD1A 1YI2Q 1GLCG 4OPAA 2JM8A 3NE6A 5HRSA 1VSLA 3SUOA 3E2UA 4DOVA 2RE2A 3J81E 2Z1FA 3VPZA 4G4VA 1RAFB 2FPEA 2IPOB 4RCBA 5A0LA 5EVZA 1QP3A 3CC2F 1KD1U 4YJ3B 1Y97A 4ZI7B 3ZX3A 3LWOC 5LMNK 3I56Q 3UE5A 2MOXA 2RH2A 4X1IA 4F3OA 2G9IA 3CCUF 5GAOm 1Q86H 2ZWHA 3KIOA 2RB6A 5FROA 2QQRA 2PAVA 5GAEP 4ZN3A 2I6DA 3VS2A 4RW8A 5AQKA 2GTDA 4F17A 2K5FA 5KH6A 4ELZC 1J3TA 1W41A 4DFKA 3EGDB 3LWPC 1NM7A 2J6KA 2NUPA 5LL6Z 4CZJA 2HP0A 4LXCA 1LW2A 5TKWA 4GKKK 1VQ4Q 2OTJQ 3EH2A 2X9HA 5CA0A 1KC8C 1EO1A 3ZOPA 4A61A 1YHQQ 3DMJA 4RMOA 4GW6A 3VS6A 1VSEA 4GV9A 2H8HA 2COYA 3U9ZA 1VQNA 1QVPA 3C0BA 3CBPA 5DK5A 4RTTA 3HZ6A 3L42A 4M75A 1CN7A 3JVHA 4ZK7A 2LP5A 1NZ9A 4FPBA 3C0CA 3FFKB 3O8MA 4B9UA 1NK6A 3NTKA 2I5JA 2Z1HA 5KYUB 4FL9A 2HB5A 3MEDA 1OZ2A 3RWUA 4JKBA 3HKBB 3BZKA 4DOWA 2PBDA 1E3MA 4DR3K 2FLOA 4KB0A 4J6YA 2O01E 2QGGA 3AV9A 4CJUA 1U1TA 5HRRA 4KHWA 1VQNQ 2NWMA 4KHYA 2HNZA 4A4FA 3T69A 2E5KA 1A5WA 2E2OA 5FPEA 3DLLL 4DTMA 2DZ9A 3V7QA 3U0OA 3M6GA 4C5GA 1VQLA 1ZC6A 2LCLA 5LJ5j 1KC8R 4OMFB 3L0QA 4A4HA 3OYLA 5EB1B 5LXTB 1WQ7A 5I42A 3UA7A 1JL2A 4HVVA 5KYUA 1KXPA 4RCHA 4XAXB 4FW1A 1RQ2A 2BANA 5C8YA 1NJIH 3NK6A 4C92D 2PZSA 1U2VA 3GF5A 3SUNA 1BI1A 5IYZA 3SQ0A 4DFJA 1J53A 4FSXA 4M8IA 2YNFA 4M75C 4CJRA 1JY8A 2KTVA 3VCZA 1HX1A 4PL6A 4C5EA 2CP7A 4JHDA 1OH5A 4Q0BA 4FJJA 4ZHYB 2ZPHB 2Z1TA 2CW4A 1ASVA 5AQUA 5DM7L 2KW4A 1VQLQ 3SJJA 1U06A 3QEXA 4M7AD 1YJ9N 1UTIA 3R1XA 1VQLF 4AT1B 4I6MB 5CE3A 2CDTA 3LWQC 4N47A 1W3EX 5EIBC 1JJ2A 3QO3A 3SDZA 3JAME 1RT6A 3PMIA 4LUEA 3PV8A 3AAPA 4B8AB 2F7TA 3M59A 5KYNA 3KVGA 5EU7A 3I55A 2EYZA 2UYTA 1HNZK 4DLGA 3OHRA 1ZBHA 4KH5A 1VQ9A 1J6ZA 3HXMA 1HR0K 3SQ2A 5AQGA 3JARB 4I50B 4H4MA 3TD4A 4NQ3A 1QVFF 3VEXA 2KLAA 3EH1A 1ITGA 2R5AA 4CZEA 3KBGA 1BI4B 5GANj 5HP8A 1VQPF 1IV4A 2EJFA 1VQ9T 4PJOF 3WXJA 4KHNA 3EKUA 1K0SA 7AT1B 1TVRA 3I55T 3A8GB 1WJRA 3U3YA 3P8DA 3X26B 1XC9A 2V8KA 5AFUH 3TAPA 4BY9D 2RHIA 4O4JA 3CCRT 1WHGA 2IG0A 4OPJA 3HVRA 3SYZA 2ABLA 3OYYA 4GV6A 2LT4A 4DRXA 1QD9A 4TV9A 2M0OA 1G15A 5AZIA 3B8AX 4R55A 2CH4A 5C25A 1UUEA 5SZTA 2LC4A 3F0FA 3DI6A 1YVNA 1TKTA 3ZLJA 5IJ9B 3ZT3A 2W10A 2ZPGB 2O9VA 5HLFA 3WEEA 2SEMA 3WXLA 5J2NA 4RWTA 3CCJF 3VERA 5AQHA 1X9MA 4XCQA 1T3LA 3QIOA 4CF0A 4FYDA 5GAN3 4FSSA 4FJMA 4ELYC 4EMHA 5J26A 4PKGA 3CD6F 1M2OA 4PJOD 4YOTA 4FL6A 3CD6Q 2P9PA 2DL5A 3S3MA 5M1PA 1I94K 2KK4A 4RTZA 4RW4A 3BZCA 4H0TB 1M1FA 4B1YB 4CZIA 1PXWA 1O75A 4M78A 4NYFA 4JRQA 1U3OA 4Z4FA 5M1FA 4G1QA 1UGVA 3KJVA 3LWHA 1X01A 4FJGA 1JCEA 2GBZA 2J4RA 1TAQA 1SL0A 2DT4A 3CXCA 1WSHA 3ASMA 4LF5K 1NLOC 3FZHA 3SHWA 2HZYA 4PJMA 4CJPA 2KVQG 3MXIA 3NTIA 3JATA 3C9RA 2F2WA 3AARA 2XU8A 1Q82C 4YFUA 4FJXA 3VOAA 3CPWS 4CBWA 4DCHA 4DBQA 2E2PA 5HBMA 2M02A 1CKBA 4M75F 1VQ7T 1BBZA 3N2GA 5K14A 3FLCO 4CJEA 2DRKA 2LCCA 4YOUA 4RW7A 3HRGA 2VAMA 3CC7T 3VS7A 3T19A 1VSJA 4AM7A 2X51A 1WLPB 3R6NA 4BR4A 1RT3A 3V7SA 2W40A 4WFAL 4W5NA 3UT5B 3DLEA 1VQLN 3AY9A 2YYEA 3S06A 1V76A 5FPDA 1HJRA 4CRIA 3JB9I 3LAMA 2P6YA 1IPAA 1B07A 2HF4A 1UHCA 3E66A 1Q81H 3TTCA 1RFQA 3ON1A 3HRTA 2P4RA 4CVNE 2J05A 3JB9J 2HS3A 3D01A 3MPUB 1QP2A 3OTOK 5GMKl 2W0ZA 3V8JA 2VG5A 1S1VA 1TL1A 2ZZDA 1SA0B 4X20A 4M77E 4E7HA 3SLCA 5FW9A 1H3HA 1NEGA 2V51B 4M42A 3TSZA 4TV8A 1MNEA 3M0TA 1QQNA 4NS5A 2DL7A 3EEQA 2GLZA 1TK8A 1K8AU 1W59A 3I0RA 3RYIA 2F8TA 1DJ7B 4F16A 3W3DA 4YJ2B 4B1VA 2OZMA 2GGRA 2QA4F 1FFXA 2J06A 3GBQA 1VYUA 1ZQ1A 1KLMA 2YHYA 1E6GA 4O4LB 2OTLF 2E20A 4Z88A 3LP0A 3CQ8A 2G3RA 2XICA 3L7QA 1VQ7A 1HPMA 4W5RA 1S6PA 2KDSA 4AHTA 2M9UA 3C6UA 2HRYA 1LVKA 4PWDA 2J6FA 1WSFA 3X28B 2GTOA 4CFDA 3I5SA 2CP5A 1K6YA 4JRKA 5KE3A 1S1NA 3CCEF 4DR6K 3S0HA 2UYNA 2LMJA 1Y64A 3QUWA 2YV0X 3C9SA 3TAQA 3KD1E 4NL2A 2EHGA 3H3NO 1T05A 2W41A 4J9HA 2QASA 2BUPA 4C92G 2BE7D 2CS7A 1R0CB 2AMTA 5KYXB 4JK7A 4M4ZA 4F2SA 4E1JA 3M4SA 4ATOA 3CCMN 4U3JB 2HF3A 2DYYA 2EFIA 3KKRA 4KKOA 3H1VX 1VQ6T 2YUNA 3MX2A 2FSNA 3ZEUA 2HBWA 4CJKA 1U04A 1FKOA 2OTLN 4DV7K 1K73H 3PO5A 1ZBJA 2YDLA 3RERA 3LLRA 1LWCA 3C6TA 4BC5A 3CPWM 4J5YA 1U43A 4FFBA 1BO5O 3EG2A 3L2VA 1Z25A 5ELZA 3RMBA 3OA6A 3Q1JA 4KI6A 1SQKA 1MA9B 4F6RA 2AIRB 1LNXA 4CGJA 2VWBA 4CIGA 3OW2A 5IT9M 4M7AB 3D0PA 1M1GA 1RAEB 5M1QA 2F2VA 1VSKA 4O2AA 1WNSA 3PUFA 1WBDA 3LYBA 1PKTA 3RYFB 3PIOA 2FPDA 5T7BA 1D1BA 4XU2A 2ZF8A 5AZJA 1YI2A 1X3MA 1QVFS 3SAGA 5DLOA 2MQEA 3CCQF 5CHIA 1Z6RA 1D09B 1CZAN 3CCEN 2UXCK 1U3PA 2DPPB 1RNHA 5E26A 3JCMV 1IG8A 1R59O 5AQFA 3MAQA 4B9SA 3ERNA 5L8RE 1WXTA 4FYXB 2DXBA 3MXJA 1V29B 2PZ1A 4BI4A 2QA4Q 3H41A 3SFMA 5FPNA 1BUPA 1KG1A 1OAPA 3QDKA 2KNBB 3KUFA 1ZSZC 3M9QA 4MDWA 2KXCA 1YHQT 1BIUA 1QZ5A 3R6MA 4O0JA 3TWHA 3RYHB 1IO2A 4N76A 4C8KA 2K3XA 3VQ6A 2VC8A 1BA1A 4Z94A 4DXDA 3GNFB 5C2DA 1ZWZA 1RTIA 4B9VA 3JSMA 2G8HA 2Q0RA 3I55Q 3GDQA 1S5JA 1VQ8F 4FLYA 5HROA 3O1BA 3ZYYX 4CHYA 4AQYK 1Q81O 4B9QA 1M27C 3CD6N 1WPYA 3G6ET 1NK7A 4N4IA 1QVGP 1LOJA 1YJWT 5DM6L 3MXMA 2UUCK 3EGXB 1WSGA 3SV4A 4IG0A 4C5HA 1VQLT 2VQEK 1IV3A 4KWEA 1HYOA 1NJIC 1KTQA 3NH0A 4NCBA 2E10A 3VQ8A 1OPLA 1PHTA 2HHQA 4II1A 1S22A 5EZYB 2UYJA 3DC2A 3LWRC 1QVGF 2NRZA 2RQVA 2NRTA 2EJGA 3AVGA 4K42A 3RMDA 3JALA 1RGIA 4PJOC 1VQKA 4X34A 2H8CA 2QA4N 5AQRA 5GINC 2IIMA 5AYFA 4F7UE 4DTPA 3UB5A 4OKEA 2RPIA 4F7UB 2ZAUA 3H6EA 4K11A 1GL5A 1VQ4N 2OTJN 1PD1A 4OLBA 3OBWA 2HEQA 4FWMA 4DQQA 5GAN4 3CCLQ 4IO8A 3WUHA 2CGHA 1SZ2A 4DSKA 2YHTA 4DBHA 1VSIA 3EGUA 3I55N 4FK4A 5I2SA 2HQSC 5EB0A 1VQNT 1I0CA 4NCAA 1C0FA 5JCOC 3RYCA 1WLJA 4O5FA 1ZHIA 3ZSRA 3VQDA 1T7PA 4BT6A 2VYTA 5LJWA 2IG8A 4BRCA 4CZHA 2PVGB 1F21A 2AP1A 3C8LA 4ZHQB 1S9GA 1O9SA 2RKIA 3VQ4A 4YORA 4MDBA 1LAVA 3C9TA 2F5TX 2P4TA 4YTLA 3URGA 3DAWA 4WYBA 2DVJA 1EIFA 1JCGA 1WHMA 4PLIA 4JUVA 3VU3C 5HK3A 2YHWA 3QESA 4JKFA 4GV3A 1LWEA 2WSCE 4FT2A 1JB0E 2NUPB 1TL3A 4BWMA 4BGAA 1Q81R 5LJ3h 3PSFA 4BWJA 2JMCA 4BRGA 4IBNA 3OMGA 3VQAA 4M3XA 2A40A 2RHUA 1BA0A 3P8HA 3REAB 2HHVA 2D0QB 4BT7A 4B9LA 2ED1A 3UPUA 5ADXH 2QQBA 1AZGB 2UZHA 4J6WA 2KQ2A 1NJIR 4V2SA 3H08A 3GOXA 1D5AA 3ZSYA 3L2QA 4R79A 5CVIA 1VIEA 2BTTA 3CCJA 3KK3A 1UWBA 2GUPA 5I21A 2GEMA 4HHTA 2M51A 2RK1A 3CCRN 2XY6A 4GLMA 2X4JA 5BREA 4DU3A 4M77F 3KK1A 1YITN 1N34K 4G88A 1U48A 3ENHA 2O4XA 1IKVA 4IOCL 4DUYK 3QKJA 3CJBA 3CF5L 3HJFA 3D6RA 2QYZA 5GAN2 1HYSA 2EKHA 3ULEA 2DO3A 5GADP 1IO6A 4I55A 3NCIA 1JLFA 2Q1NA 2LQKA 2L8DA 1I07A 3I5RA 4TZZA 5LJ3g 4J7FA 2EQUA 3M8PA 4EHUA 2IVPA 3EZWA 4AHCA 1AWWA 5D6WA 3CCLF 3PVLA 1TVKB 1DEJA 3AO4A 3OYIA 3NH2A 2E65A 2Q36A 2Y4YA 2IAJA 3DOKA 2K4YA 3HL8A 3PNWC 4M77A 2DEUA 1L3UA 1YHQF 2RK2A 2C06A 1M1KH 2XRIA 2B33A 1XJWB 3BF3A 3CCMA 3ATUA 3P0ZA 3CMEA 1WI7A 3C65A 1IB8A 5JH7A 4ESRA 4LFAK 2CUDA 4DTNA 3KHYA 2ZVZA 4BRQA 1S72T 3LDNA 2KYMA 1KD1H 2CUBA 4C81A 4BVPA 1I5LA 4R40B 3CEYA 3H8ZA 4XQ3A 1YWPA 4EAHD 4PKHA 3QPHA 1PRMC 4WE1A 4IOAL 3CFPA 2DJQA 4C8MA 2KHOA 5KYWA 1W581 1D0YA 4I6MA 5IT9O 1NJIO 3E9LA 1JXOA 3RNJA 1Z05A 2Z1IA 1B9DA 1FKPA 3K57A 1GXIE 3CD6A 4JD2B 4NXNK 1L3VA 5IJ0A 3FZLA 3MWPA 4DV2K 3QG1A 2COWA 5GANe 3VQPA 1UE9A 1JRIA 2YUPA 3AA4A 2IGIA 3TAGA 3CC4F 3G71A 4C0DC 5KGXA 4JV5K 2YKMA 3C7NB 3QMLA 2HHXA 2JVVA 4F8RA 4OPHA 3CMAQ 3BDLA 1FSZA 1N8RU 1DGKN 4CGDA 1BISA 5MLCQ 1C0GA 3CC4T 2JN0A 1Q82U 4FSVA 4BR9A 2BTOA 2P0QA 1MWMA 3OS0A 3EYZA 1IBLK 4RQOA 4CC2A 1W6XA 1QU9A 2RMOA 5CA1B 5GINA 1GRIA 2ENMA 2FL7A 2I0NA 4OMPA 4LF4K 2P9UB 2O4GA 2YLCA 4JI1K 2LNHB 3EN9A 1D4XA 2RHLA 1VQ8N 1K8KA 3M53A 2K2MA 3SWNA 1KFDA 2FXUA 3OONA 1TV6A 2DZCA 3TAEA 4DV1K 3UA6A 2EW3A 4PJJA 5CK9A 3ZSWA 4DF8A 5LJ5e 4DSIA 2CH6A 3BE3A 4BROA 2FC3A 3JB9H 3AO1A 3CYMA 4ICLA 1X6GA 3MP8A 3QEPA 2F69A 5HXUA 1TVKA 1AOJA 2OTLA 1MU2A 3SV3A 2XDBA 4B3TK 1XNRK 3WGMA 2EGAA 3D2FA 4KUDK 3HSBA 2HL3A 4FOEA 5ECAA 3CHWA 4DFPA 1A5XA 4CK2A 1OH7A 2KZZA 3IMPA 4IIJA 2CGJA 3K5OA 3E22B 3PMTA 4LDVA 3SI6A 1YJWN 4CERA 1K8AH 3L2WA 2O8CB 1IRXA 4ORZA 3AA2A 3CPEA 4MDAA 4MZPA 2EJ9A 2O8DB 2QEXT 1X25A 1M90R 4EI9A 1K76A 3LH5A 4YOWA 4CEFA 2V1RA 3WJQA 2BUDA 4J9EA 3PT9A 3OSSC 2WOMA 3A0IX 5BPMA 3PTAA 4EDUA 1D3BB 4JJNK 3V1OA 4CECA 1SRMA 3FJPA 1WXUA 4BI3A 2KE9A 4JS4A 2EVRA 2NRXA 1TOVA 2EKOA 2D9TA 4F2RA 2RM4A 2MWOA 2QWPA 4DV0K 2CP3A 4E19A 2UU9K 3N4QA 2PNIA 1U2VB 2LCAA 3BYQA 1UOCA 4EI7A 2JNBA 1AEYA 4PWTA 3GBTA 4A54A 2MI6A 3HYFA 1W2BA 2RHXA 4GBQA 3CCET 1KHCA 2F96A 4XTVA 3ENOA 3CC7N 2DFHA 4DMNA 4GY5A 1GLBG 2AJQA 3I33A 1EFNA 4J6XA 1N8RC 1VQ7F 2JS2A 4FU6A 2A28A 2LX9A 3P5JA 5AQTA 3TCJA 3LZIA 1WN7A 3LDPA 1NMUB 3GTZA 4EMKC 1A5VA 2Q97A 5JMVA 1MMAA 8AT1B 4FJ5A 4WF9L 4BRLA 2NMUA 4LCKA 1VAZA 1XUPO 3CJ7A 2QDLA 2KBTA 1DTQA 3QFPA 4MQ3A 4XK8E 2YUOA 2HQEA 1JQQA 3GE1A 1PCXA 4R0KA 4M7DC 2HNYA 4GMJB 4O55A 1RI9A 1K9AA 3MN9A 3RRGA 1Y07A 4XU1A 4DFMA 1UEBA 3CYPB 4BD3A 4C0ZA 1GLEG 3CPQA 1TYQB 4C0GA 4M7DF 1DLOA 4FYWB 1U45A 2R58A 4R56A 2DRMA 2LSNA 1ATSA 4M78B 1TTHB 1MV3A 3RMAA 4JJCA 1S6QA 1YQNA 4IJAA 3SBTA 1D0ZA 4F7UG 2FGYA 4AFSC 4Z0UA 4AHVA 3JCMb 3DXMA 5AQSA 5AR0A 4QOZB 2HBKA 2GWJA 5EOYA 4C92E 1R1MA 3RKWA 4CFAA 4I2QA 2XMFA 4N4GA 4ZHVA 1D1CA 3L1AA 4BQZA 4J9BA 1Z5WA 4BT3A 2A08A 4DQPA 1M5Q1 5AVMA 1K8AR 1AT1B 4B1ZA 1O1WA 4CEQA 4BVSA 2NLXA 3OB9A 1X7PA 4AFQC 1IJJA 2QA4T 5JLFA 1Q86O 2PYJA 4FLXA 3ZL7C 4H5VA 4X9CA 2WBNA 4RW6A 3VA0A 3WGKA 2D0NA 1NBWA 4YDUA 1RBVA 1REVA 4AM6A 2CP0A 4F9OA 1BI2A 1M1KU 1QKXA 2OPPA 5AQOA 3QB0A 2V1QA 2FZCB 3LH0A 5A2QO 4B62A 1VQ4T 2OTJT 1H92A 1T0JA 3EE8A 4DU1A 5EIBD 4B9WA 3CIPA 2O4IA 4C8QF 1NGEA 1TAUA 4R5PA 1BYMA 1U47A 1OFUA 5FJ4C 5C10A 1VQ6Q 2NZTA 4ISFA 2UYPA 4GLKA 3G71N 2OPSA 4M3UA 3CCLT 5JS1A 2CZ7B 3KWGA 4WF2A 2XDDA 3L4IA 5LJ3d 4W5TA 2EQKA 3HI0A 3BFMA 4F14A 5GAMe 2QWNA 5AJ3K 3N4YA 2QG9B 2QWOA 1VQOT 5KYWB 1VK3A 4ZHRA 4Z8AA 4H0OA 2X4XA 1M8VA 3VOVA 1VQMF 3C9UA 4JRPA 5LJ5f 1GOCA 1IKYA 1UAXA 4O4GA 1WJSA 5CYMA 4D8DA 3PLAA 4M45A 4DA4A 4FLZA 3HKEB 1M8MA 1W2BM 1S1TA 3CCEQ 3VQCA 4AILC 3MCQA 4O2AB 3CM6A 2M0YA 3P31A 1SG5A 3HKDA 4KUIA 1U5SA 2XI9A 2CH4W 5BPNA 2VG7A 1W5FA 4LFCK 1YN8A 2C0OA 3UKRB 1D9FA 4BY6C 3CG6A 3CYQA 3TD3A 4KGXB 4FJKA 2X3XD 3J7AF 2P9NB 3HP6A 4A4KA 1ZX6A 4LN2A 2KZMA 3QZ9B 2VXEA 3DYAA 2BO1A 2WSEE 1GOBA 2D5RA 3CMAN 3MECA 4O2BB 1WYXA 1P92A 1BCOA 3KWIA 1IV0A 2QQAA 4RG8A 4LDXA 2Z1GA 3LM9A 1VQ5T 2A42A 1SKWA 3RR8A 2NUTA 2E3IA 2JJ9A 2KR3A 3V9ZA 3CPWF 4Y92A 4KHSA 1IGUA 1YJNA 2B86A 2DD5A 1KVCA 1H47A 3J8AA 2CYZB 2ZD1A 4B6MA 3NMUA 2ZVYA 1VQPQ 3VI6A 2X35A 4OGEA 1XHXA 3A5MC 2CSIA 3F5TA 4XH4A 4E7SA 5LJ5d 3PX4A 5LP6A 1BU6O 1QZ6A 3HOSA 5DY9A 1QWEA 2KT8A 4X66K 2QQ9A 2WACA 2MYSA 3JCMJ 1K9MO 1R8OB 1B3QA 2BDPA 4Z02A 2IS3A 5I9EB 2PFUA 5EG2A 1Z9ZA 3TEEA 3F6MA 4YJ2A 4MLEA 4HNAA 1J7HA 4O2BA 1VA7A 1Q18A 2ROTA 3OYBA 3HVTA 2LBXA 1RDCA 1T3VA 5JICA 4DTRA 5GANf 1IBKK 4QVZA 2DERA 2OTMA 3FD6A 3SK3A 4DTJA 4FK2A 1IV2A 2E8AA 3THXB 1JLGA 2O8EB 1X2QA 3K0SA 4H5TA 1YJNF 3MEAA 3JV3A 1KQSP 1JBMA 2K3BA 3OYEA 1WFWA 4M3RA 3SAHA 4OKKA 3QBXA 4HUFA 4N41A 3GYQA 2MPXC 4X1KA 1RT1A 2QTDA 5KI6A 1D3BA 2HL5C 3JB9F 3A1PA 2H6LA 2CZWA 2ZE2A 2DBMA 3JCMW 4M7YA 1KD1O 1X75C 2M1HA 1ASUA 3W0LA 2F9WA 1XI1A 3G71F 3P1GA 4PA1A 3DXKA 3CC2A 4GVEA 3K5MA 3SQ1A 1QMCA 1PKSA 1VK0A 3O1WA 1OI1A 2CREA 3AVKA 5FRMA 2P9PB 2DAQA 5FDLA 4PKIA 4E89A 4EP4A 5C2FA 1SZQA 3RVCA 4H0XB 1TK0A 1YVUA 4PY5A 3EG3A 4FXDA 1HKGA 4IHJA 1YI2T 2QGFB 2FRYA 3CQYA 2L3QA 2IDOA 2QW9A 5GAMd 3LP3A 2BE2A 5GMKh 1Q82R 3CXCS 5AQYA 5EYPA 3A8HB 4HTLA 1JJ2F 1LW0A 4MFBA 3FB9A 4BR7A 3MEUA 3DJCA 3JASB 4LSLA 3LDTA 3JB9D 4OMQA 1JL1A 3DXKB 4JN4A 4N4HA 3WQUA 4AG1C 1FMKA 4M7AA 1TSFA 1VH8A 5MN4A 3CCVF 1E7KA 4ILJA 4C1NI 1G3SA 4KGZB 3CCVQ 3THKA 5KE2A 3V9UA 4KTWA 5AZIB 3CFOA 2YHAA 1SL2A 4YHHK 1WAFA 3GP8A 4H0PA 1H641 3TPQA 4CJSA 2D1KA 3AGKA 1G3TA 1GBRA 5HP1A 4PK4A 2VKNA 3V7RA 3VS5A 3ZT4A 1XMQK 1XBIA 4BVTA 2OZBA 4C8OA 3TD5A 3HPHA 2AZVA 4QS9A 5GAGP 4TV8B 5FU6B 3M8RA 5BPLA 1RCHA 2F1LA 4VUBA 4MDXA 4CIFA 1KQSM 3L2ZA 2OPQA 2ROLA 3FJ5A 3VTIA 1GLDG 2G8FA 3DDNA 4E6EA 3X20B 1NE8A 1W57A 4IEEA 3NH1A 3JAMO 4DHYA 2LNVA 3OW2M 1M3AA 1WUAA 2LDMA 4C23A 5C0MA 1F1BB 1VSMA 3FGUA 3OA9A 2ETJA 4DQIA 5J2UB 3DXMB 5M1KA 1Q9YA 2LRQA 2PHNA 2ZM6K 4IIOA 2RD1A 1VQ6A 4WFNL 2F9ZC 1NK0A 3EG9B 3OW2F 2WFBA 1UFFA 1T3SA 1KVBA 2GWKA 4MO5A 4XEIA 3CCVA 3QZ5B 4NL3A 1NKEA 3ESJA 3M55A 3CCUN 5TKYA 4CEBA 3CG7A 3LPTA 3LANA 3M57A 1WB9A 2HMPA 5C15A 4A4EA 1RADB 5LJVA 1QVGA 2P9LB 2EWCA 4CFCA 3E20B 3CCUQ 4LNUA 1DKGD 1NG9A 1OVQA 2YCHA 2V26A 2VG6A 4IWVA 1QCNA 4PNOA 2PYLA 1YJNN 1COMA 3QHDA 4O4IB 4B1WB 1NK4A 4PHTX 4BC4A 4ZGEB 4CD1A 5BR9A 4KHPK 1N8RR 2EX3A 3AA3A 1BIZA 1Y0MA 2F8SA 3JAKB 5HRPA 1W55A 3OYNA 4DQSA 4X9DA 1IHWA 2D0BA 4KHQA 2L3SA 1EP4A 1RDDA 3M4YA 2GVIA 3AAQA 5GAOl 5SWMA 3UT1A 1GFCA 1X9JA 2Q3SA 3SBGA 5KYYA 2JTFA 4FJ8A 3MCPA 3ZEHA 1AWOA 1UI9A 5EYPB 1GCQA 2DFEA 4AFUC 5LXTA 2EYYA 1RDUA 4CESA 4LF8K 1Q8IA 3VN5A 1QTMA 3VYHB 1KAXA 1YIJT 3MDOA 4IURA 5M9OA 1EWQA 4UY8O 5C24A 1X27A 3WPWA 1XHOA 1VQKF 5LJ5h 3R9PA 2JNGA 4WBNB 1K8AO 2JMAA 1JXBA 1BI3A 2AIFA 3BEXA 4LD6A 4IUUA 4L6V5 4PFZA 2HVHA 4RTUA 4FLWA 3CC4N 3HKDB 4J2AA 4UQGA 4H5RA 2QKBA 3LWMA 3MEWA 2HW3A 4X3LA 4TSXA 2COZA 1IHVA 3QFUA 1OKJA 1H8KA 2X6NA 3SEMA 1JJ2P 1HPZA 2GQIA 2KY9A 3HSTB 1SV5A 3IR9A 2D0CA 3CC7A 2M16A 5GAOp 4CBUA 4JD2A 2OA8A 1NM1A 3QERA 4E2FB 3QNNA 3KHNA 2BKDN 4DTSA 2FEIA 3CMAF 4LDUA 1YIJN 1RBRA 2NRRA 4JKAA 1WZOA 3G4SN 2GELA 5EX5A 1NK9A 4LH5A 3F0GA 3C95A 2JT4A 1TUYA 2Z1UA 4F04B 5LJ5g 3P4IA 1WHHA 4BC2A 5KYXA 2LZ6B 1C1BA 3NFAA 4XH1A 4BR0A 1G8XA 3ENBA 1NJXA 3NHGA 4BRMA 1JLCA 2XHCA 1HMVA 3O80A 1HQUA 3SMSA 5KPRA 3QUIA 5HY6A 3ZSXA 1R77A 2DKGA 1QSLA 5D6YA 1K9MC 1XNQK 3CCRA 3VS3A 3NVKA 5ITZA 2FYKA 2HBPA 4C92B 3CCLN 1HD3A 1T0HA 1BQNA 1ABOA 2FVUA 1NMNA 2A41A 3O9SA 4DS5A 3THWA 1I39A 3KKSA 2UUBK 1PSEA 4JJDA 1VQMA 3AVCA 4LSNA 2WC9A 2D1XA 3BW1A 3M54A 4C8QC 2MIOA 3MP1A 5HL7L 3KK2A 4XTUA 4BRPA 4O6JA 2EQIA 3VEYA 1V4SA 4QQGA 1NNEA 1QAHA 3J80E 3T1AA 4A2BA 2DX1A 4BACA 2P9IA 3UF4A 4RTWA 5I2MA 1RAGB 3RRHA 3SPYA 3HHTB 1B34A 3P83D 1VQ6F 2KRSA 4BDZA 5AQVA 3HFNA 3CCRF 1H48A 3OYAA 2FBTA 3TREA 3SQ4A 3VYTC 3EHRA 3G6EF 2ALEA 1BCMA 2RN2A 2K79A 4IXCA 3HO1A 4BVQA 4LE9A 3RDVA 5CKEA 3UKUA 3CC2T 1WHLA 4U3JA 2DNUA 3FD5A 3EKSA 1NGAA 4DTUA 5I22A 3OVNA 3ZSQA 1TS9A 1X43A 2B4JA 3RA5A 2DJZA 4Z4HA 1NYGA 3DM2A 2V7YA 4LD0A 3RMSA 1YITT 3G71Q 4JLGA 4BRNA 5DLQE 1VQ5Q 3U9DA 2BZXA 1ZBXA 1Q95G 4C8QA 2NRVA 4FLUA 5AQMA 1SUQA 3VKIA 1G99A 4M63C 4FJHA 4FWOA 2HS0A 4BRKA 1BWFO 4DU4A 2JWKA 2HVYD 4BT5A 5KMGA 1Z9QA 3UWNA 3S41A 2QI2A 4BB7A 3M0UA 2ECZA 1QLYA 4B9TA 3QJYA 4CJ5A 2DF6A 2RJDA 4JPBW 2DIQA 5BR8K 4DG1A 3O6WA 5GAOr 4JS5A 2DYIA 4MMKA 1QS4A 3L4QA 2WALA 3DLLA 4BDPA 3K58A 1TK5A 4BE1A 4XTWA 4C5IA 3DB3A 2BIVA 1Q86C 1RTJA 4G9ZA 3ZX2A 5CR2A 1LCUA 3CPWA 4AFZC 1XMOK 1UFYA 4KBMB 2RQUA 3JCMQ 4M7DB 1WSJA 3O08A 3CCMQ 1FNKA 2RI3A 1TYQA 2EGEA 1VQ5A 5CR4A 2P9SA 4HCCA 4WQ4C 5J2MA 1I5OB 4BRFA 1K0XA 2AZSA 4IFEA 1HJDA 3I0SA 3KK7A 3WXKA 3ZX0A 2W6LA 2ZGYA 1I8FA 5GIPA 1OU9A 4A57A 1Q7YU 3F9KA 3NPFA 4M78G 4NYNA 2YLBA 3RKYA 2ZJQL 1RTDA 3U6FA 3JCMh 4DKWA 2XD0A 3LWVC 1GLLO 2CT4A 3DLGA 2LTOA 5GAMf 1ARKA 4WQ5A 3SMPA 3NF8A 4EZ9A 4KI4A 4OLAA 3N2KB 3AO3A 3C12A 3E9OA 4CJTA 4OX9K 2HS4A 3RESA 1W7AA 1JLBA 1AZEA 3WVEB 4LNPA 4XU0A 3RUXA 3AVMA 3E9PA 4BQLA 1SRLA 2AK5A 3LL3A 4ISGA 1IREB 1YNZA 5GIOA 4BVRA 1J5OA 2P51A 2RI5A 3PFSA 3CCJQ 2R7YA 4MO4A 3IRXA 2YRCA 1TWBA 2P84A 1T03A 2YHBA 3HWUA 3I56A 3S6WA 1NOZA 1YJ9A 3JAKA 2P9NA 5JVDB 5IHKA 4E7LA 2RQTA 2VWKA 5EY4A 3QETA 3O9UA 4FZZA 5EWRA 3CCSA 3MN5A 2E3HA 2O8BA 1T8EA 3CB2A 3T3FA 3G25A 3JAWB 4M7AC 3C6AA 3DLHA 1IV1A 2R751 2PMPA 3OYJA 3TVTA 3A8OB 3FZMA 4JRIA 1YIJQ 5MN5A 2K2VA 1OOTA 3IEQA 2P9LA 1NPRA 3VTHA 4H5WA 4OP0A 1VQ4A 2OTJA 4YY3K 1BIBA 1UGQB 1VOMA 2D8HA 2RHZA 1YT3A 3ZSOA 4CCHA 3MEGA 3KE1A 1XTDA 2VYPA 3VF6A 1X9WA 4M78E 3MO8A 2NUBA 2DL3A 3M0PA 4KH0B 3LWIA 3THYB 3LGFA 2QXFA 1B7TA 2OJ2A 3B6PA 2A3ZA 1FMVA 2RJCA 2QA4A 1KSPA 5CY4A 4BC3A 3VUBA 2IQQA 2QTPA 1J9AA 5J2TB 4RTXA 3CJ1A 4OVLA 3LM2A 4ZI7A 5LYJA 3HKEA 1MMNA 5CYQA 2QK0A 3K5LA 3RSEB 2AIZP 1YJWQ 1M1KR 4E1MA 2RI2A 5KTQA 2V52B 1YJWF 4BE2A 2E6NA 1WHKA 3H9NA 4I7FA 3BGRA 3CMEN 1CKAA 3P8BB 2EYXA 3FIFA 2VQFK 1JN1A 2O4XB 3T1YK 1K9MH 2NLUA 5D6XA 1RABB 1RLQC 3RMQA 1VQKQ 1EQYA 1WHJA 3MDQA 1NOYA 1JFFB 4C8QG 4AHUA 1FFXB 3ULEB 2EBPA 1ZA1B 4KH1B 4C92A 3M8SA 1IBMK 1QVGM 1VRUA 2DTOA 3V7CA 3MN7A 2VCPA 4KTQA 3P4EA 3RMCA 1KFSA 1L3SA 2QWLA 3IDHA 3JCMd 1QVFM 4N0AA 2HBMA 1S72N 1SPKA 2EGCA 3PVQA 4OMMA 1SSHA 3QYGB 1C1CA 2K5IA 4QW2A 2AA4A 4KH6A 5C42A 2OYQA 4TV9B 3PGGA 1ASWA 4DV5K 4XH5A 3OS1A 5I11A 1OX8A 3TU4K 3HJWC 3CXCF 5G4UC 2YNIA 2F2XA 2C0IA 1Q7YO 4BG9A 5JVDA 4NB4A 5CKHA 2H3JA 3DRSA 1M3BA 4IEIA 3HKBA 1W5EA 3MHXA 5JH7B 3I56N 2BTQB 1QWFA 4P5NA 4LF7K 1FNJA 1ILYA 1RBTA 3H1QA 1EKEA 2P1JA 4WQ4A 1NK5A 1PRLC 4JI3K 1HNWK 2YT6A 3HTNA 2G8UA 2E1ZA 5HK0A 2RB9A 4DR5K 3ZO8A 1RAIB 3PAFA 4X1YA 4M75D 2QTVA 1KVAA 1VQ8Q 2K6DA 4OKJA 3V1RA 3VQ5A 4CHQA 3GHZA 5KQDA 3IUCA 2NUZA 1BI4A 3LFOA 2DETA 2FZKB 5CQXA 3QICA 3VGKA 1NGGA 3G4SA 2RF2A 1S72F 3F73A 1W1FA 4MMLA 1FW6A 3LGLA 2IVOA 3WGLA 5J2TA 5FPMA 3CBOA 3VS0A 2K57A 4ANJA 2QXLA 2X6SA 3LDOA 4JJBA 3EFRA 4RW9A 2LJ3A 4K8ZA 5LA6B 3CMAA 4CJVA 5IHNA 4RKUE 4EPCA 3HOTA 3QEWA 4C82A 2NNWA 1UGRB 4BRIA 2RJFA 1OV3A 3DKMA 2CH5A 4PL8A 1S1XA 5AQQA 4U67L 3BDPA 5CIUA 4GKJK 3CCUT 1KC8U 2JM9A 2DFFA 3X24B 2RHKA 2NRWA 3CMAT 4PJNA 1YCSB 4DEYA 3EGXA 2F4VK 3TSQA 2VUBA 3SIUA 2OTLT 4D6WA 1O13A 1QQOA 2GFUA 2L3RA 1VHXA 5ITZB 1P90A 2E64A 2P9KA 4M7AE 5MN6A 4HVUA 4NLBA 1X69A 3KLEA 4J9IA 4NOYA 3OW2P 5F2RA 4BY9C 2HSPA 3SPZA 2VXYA 1Y96A 3ULRB 1QCFA 1JO8A 4B08A 1QVFA 5CQYA 2DFUA 3CCQT 1YTUA 1NGCA 5GMKi 1Q7YH 1JLAA 1FYNA 2RQWA 1GFDA 3L6QA 1VQPA 5EZYA 4DWIA 2CP6A 1QE1A 3I35A 4AMCA 1VQON 1NGDA 1T6CA 4M7DD 1HLUA 3KJJA 3L2UA 2MMPA 1BOTO 3CC2N 3G10A 3M58A 4B46A 3G71T 1UGSB 3AVAA 2YWWA 5CCAA 3M5RA 3CCSN 1X7OA 1FWZA 4RCCA 3P10A 3VRYA 3VTIC 2JWLA 3WEEB 3BDUA 1G83A 2HNIA 1JCFA 5AT1B 1B92A 1ZYQA 1UDLA 1YGYA 4CHNA 2Y1JA 4E7JA 3U3GA 1C0TA 1ODEA 1TUBB 1SS6A 3UT5A 5GANK 4FIBA 2KG4A 4Q5VA 5GMKj 2XK0A 5FWCA 4FYVB 3VQBA 3AVIA 3ATVA 3EFSA 1ZBFA 2FBVA 1VSDA 3ZETB 4FWKA 3SB2A 2E4LA 3HPOA 5DM7R 3CETA 3SZ2A 1M90O 2WONA 3NHNA 3META 2I6RA 4CJ7A 3VIUA 4X64K 3ZP7A 4H0YB 3ZSVA 2OCEA 5DMRA 1QQMA 4J2EA 2AT1B 2DXCA 5C12A 2VXFA 8ATCB 4EMKA 5GANd 3SJHA 3J7ZO 4EZ6A 3J7AR 2Q2RA 2HP3A 4DV6K 1QKWA 3LMEA 2V8JA 3K2XA 4MLHA 2X4WA 4FWPA 3AGRA 1N5YA 3RA6A 4ZTJA 4H5NA 2KTUA 1MMDA 2E2QA 5HY1A 1W9HA 3OW2S 1QW1A 3AVLA 4CK3A 4FJ7A 4CF8A 2HP0B 4FFBB 4O4JB 1S9EA 3F9MA 2QAZA 4DB3A 4F6RB 4C8QE 3M0QA 3QHSA 1FK9A 2HSEB 4JK9A 1BKBA 1GOAA 4F4KA 4M3TA 4Z89A 1H7MA 4JKCA 3BY7A 3VYGA 2B6AA 3VEWA 5AZJB 2DE0X 3T80A 1VQNF 4GY2B 4FJLA 2FRWA 4X62K 1YI2F 5GJVB 1N9RA 3WGJA 3M3ZA 1HXDA 1N27A 1S72A 1BIAA 1SKUB 3EAEA 1W0HA 1X3NA 2OHWA 2PU9B 4M77B 4E0DA 1GBQA 1VQ6N 2CHTA 4RTVA 5GAOq 3CJAA 3IEWA 4BUGA 3CMET 3BUZB 4I55B 2JS0A 3CCMT 1YTAA 3A5NC 3ZT2A 1NGJA 2BGGA 3RYHA 5KPZA 3VA3A 1W97L 2YNGA 4EFHA 1M2VB 1VYVA 5GAMg 4FO0A 4N56A 4CEOA 4W5OA 4FZXC 5A0GA 2G6FX 1B9FA 1YF5L 2EWSA 2H3GX 3HBTA 3O4NA 2JLEA 3V9SA 4O4HA 3ER0A 3THXA 1VQKN 3JRZA 1VQPT 3PX6A 5GAN7 1VUBA 1YITF 3R6OA 1SHFA 1CLIA 4MZMA 2EAYA 2YUQA 4FWLA 2E5QA 1EZZB 2A0FB 3QDFA 4CZMA 1U4BA 3H6ZA 5KCOA 3U23A 1EXQA 3LAKA 4JNEA 3K59A 3KLHA 1Y71A 3MCAB 1E4GT 3A8YA 1C1AA 2KGTA 4N0AC 1FMWA 3QLHA 4JZ4A 3HM8A 3ISNC 2FZGB 3G6EN 5GAOn 2GCXA 2DTIA 3JCMP 4ME7A 1S72Q 1DTTA 5IYZB 1VSHA 4FJNA 5LOVA 2YNHA 1VQ4F 2OTJF 5I3UA 4M7AF 1NBEB 3VF4A 4M78C 1RI0A 4EB6B 4JHDB 1LJOA 1TGOA 5KX5A 4J9CA 4H0VB 1QQJA 1NLVA 1G2BA 5J39A 3JS6A 2G8IA 4M78F 2N48A 2RHHA 2KXDA 1S3XA 3JCMM 2W6KA 5LJ3j 2YXZA 4L8RB 3IKMA 3O4QA 1RLGA 1FXXA 4LD9K 3AO2A 1Q9XA 3M1XA 4JI2K 1JEGA 2ZJRL 3P38A 2H8EA 3PX0A 3JYTA 3ZSZA 1M4ZA 3BY5A 5GANh 1C6VX 2HQXA 1S1WA 3VYUC 5LOVB 1ATNA 1VQKT 3CCRQ 3ID8A 3VEOA 4KT0E 3M4GA 1NJYA 3CM5A 3AT1B 1Q86U 2ITGA 1UA1A 2R57A 3V4DA 4JKGA 2VV5A 4A4GA 2RHJA 1W70A 3G4ST 1KQ2A 3LYIA 5CA1A 1Y7XA 4I9QA 2OZSA 3LZJA 3QWXX 3WNEA 3IAYA 2EQJA 5CO7A 1XNIA 3D2FB 1ABQA 5C8YB 4C1NK 1ZBUA 1N33K 2GUIA 1JXMA 3CCJN 1W2BS 4CBXA 4IIJB 2OPRA 4FM1A 3V8LA 2K3YA 2ASMA 2LX7A 4LDYA 4BY6B 3VYSC 2HCKA 2ZGWA 4B1UB 3JALB 2HNDA 4FPAA 3K0TA 4NO7A 1GO0A 4M77C 3K2PA 3I55F 2PTKA 3CCUA 4G4ZA 2IC3A 1RLPC 5FLXE 4CF1A 3THVA 2L3PA 2IVNA 2VWJA 2RJEA 3NGPA 5B8HA 3N4PA 4IFVA 2HHHK 4FOIA 3WQTA 3R3LA 2OANA 3OYGA 3EL2A 4GNIA 5CZ2A 3VEZA 3PIPL 3QEIA 1VQNN 5LL6S 4HT9A 3JAMM 2E70A 3G7ZA 5KRTA 4ERHA 1RQ7A 3GPLA 2LJ0A 5IH2A 2I7NA 4YNQA 4BW0B 2O8DA 4WQ5C 2LCSA 5GAN8 4KREA 4HTUA 5LP6C 4B5CA 2CZ1B 3ZFJA 2DPNA 3G6EA 4LF9K 4EMGA 4IJNA 1WAJA 2YX6A 5IJ9A 3D7EO 4A5BA 3EORA 5GIPC 4DEXA 3AVFA 2MK5A 3IS9A 1NGBA 1S1UA 4JLHA 3V81A 4QT7A 4AG2C 3H46O 3NVKE 3VS1A 1VQMT 3NVMA 1YP5A 5KQ8A 4IUVA 3OYFA 1YHQA 4CK1A 1VQOF 4PUOA 1G5VA 4E47A 3MQWA 2CGKA 4E7ZA 4YOVA 2PQWA 2PVOB 3K9KA 2WSFE 4DQ2A 3GL1A 5CB4A 3B6OA 4LUDA 1U8RA 2E1YA 3GG4A 4F7UF 1Q82O 1K8AC 3RTVA 1BHLA 3QBWA 2NYSA 2B8AA 3S0YA 5GAPK 1NKCA 3NF9A 3E19A 4BRHA 1WXBA 4I4TB 4WTOB 3LW5E 3PLAC 3RE3A 5L23A 2RHYA 4RHAA 4Y1CA 3MX5A 3A5OC 3NTHA 5JCOA 2ZQBA 5F0XA 2HHUA 1CZBA 1C6VA 1M30A 4CJQA 3DLBA 1GZ0A 3D45A 4ILGB 4M7XA 3JCMf 4K8XA 4TUYB 1VQ8A 1RT7A 1RAHB 3VQ7A 4XTYA 1I3AA 4O5BA 5AQXA 5AQLA 2RF0A 2HVIA 1SHGA 3CCST 1SAZA 4DR2K 4ZN1A 3B6NA 2CP2A 2O88A 1YFNA 3OS2A 4M75B 4NCGA 4OB1B 4BREA 3FPIA 3I56T 2KGWA 1NWKA 4IFYA 1KSWA 4L59A 5EC7A 1LAWA 2CSQA 4AHRA 2R5MA 1TUBA 4X20B 4FWSA 1D9DA 1GO1A 1ZUYA 1OEBA 1M1KO 2XKOC 2Q1YA 3WNGA 3VV0A 1EX4A 3CCQN 2ED0A 1YIJA 3AVHA 3HTRA 2EYQA 5M1NA 3IKFA 1WA7A 3MJXA 3NAEA 2JGUA 3OQ5A 4F7UA 1K9MR 2E6LA 3C4SA 2CT3A 2DBKA 2GX9A 4PQUA 1GX1A 2J6OA 3N2GB 2P0KA 4DLEA 3O85A 3TQ7P 1PF5A 1SA0A 2K7AA 4CGHA 2I2LA 3JCMg 3KZBA 5KGWA 4CEDA 5HY2A 1LV5A 4QVCA 5AQJA 3NMZC 4RTYA 3V6DA 3M56A 3CCJT 4K25A 4LC9B 4FM2A 1AD5A 5FU7B 4DBRA 5IHIA 5LJ3f 2IIRA 2HKQB 2EIFA 2RO0A 4BR5A 3SAFA 4JI8K 3HPWA 3NK7A 1YJ9T 5HKCA 2Z1EA 3I3FA 4M7AG 5FRNA 3F0EA 4KTZA 2NUTB 4QS8A 3KJKA 2HAXA 5JQGA 3VO8A 3GNGA 2HMAA 4X65K 4OGCA 1Q7YR 2RA2A 4CF9A 3K12A 4L5GA 4HKEA 5KX5B 5GAMj 1C0UA 4KH4A 4CD3A 3H0FA 5FU6C 2RPNA 1VIFA 2Y1IA 1W5AA 5GONB 5HP7A 2PUOB 4FCYA 3FFMA 1DBFA 3A5ZB 2I7PA 1K73O 3VMFB 3REBB 2HMIA 2ZODA 2GBQA 3NGIA 3OYDA 1XOVA 1M90H 4HCKA 3K9JA 1JJ2M 4OB3B 3CCVT 1HJOA 4H8KA 1K8KB 1KFZA 2E2NA 1RA4A 4TVRA 2OTLQ 3CMEF 1U40A 4IDHA 4DV4K 1BDGA 5JQGB 1BK2A 1U3LA 3UIQA 3CMEQ 4RG2A 1A0NB 3TAMA 3MBMA 5G4VC 1VQ9Q 1NEBA 2XO7A 5AQPA 1YITA 3MK6A 2VGMA 1YCYA 2FO0A 5IAYA 2UYNB 1TUCA 4KHUA 2P0PA 3A8MB 3EGDA 3CCSQ 1SKSA 2DTHA 1RLUA 3V3TA 4ZHWA 1H1VA 2YI1A 3VEVA 3VF2A 1FX7A 5J2PA 5BMVB 3NGZA 1YJ9Q 4KO0A 3U8XA 2YHXA 3CPWP 3S3OA 1BGXT 1KJWA 4PFOA 2JW4A 3J80M 5LYJB 1QHAA 3EG1A 3OYKA 4PKCC 2P9KB 5AQZA 4WFBL 2VASA 2QWRA 4N5SA 4FLTA 4DSJA 4JZ3A 4M3YA 4C8EA 1KQSF 3D54A 5FLXO 1ZUKA 1HQEA 3FBAA 3WT0A 5KCHA 2PY5A 4CZGA 4DUZK 1KLNA 1VQVA 4RTFD 4C8LA 4YOXA 3WVDB 3TTDA 1KD1C 4PJOE 2KQWA 4BE0A 1YJWA 4HT8A 2HOEA 4X3MA 1HRHA 2RHOA 2JXBA 4B8CA 4O5VA 2P9UA 2VAPA 1OPKA 4OB2B 1UGPB 3RBBB 4DSLA 2O8FA 3OS5A 3EO3A 1ONIA 2K5LA 3O3HA 2CSLA 1PSFA 4CZFA 4CGIA 2IVWA 3D2EA 1UECA 1RUWA 4O8KA 5IT9E 4CZKA 3G1JA 4ELUA 2XHBA 2KT1A 3RR6A 1RDBA 2A37A 3I8BA 3IKEA 5A2QM 4JI4K 4PJLA 5IXBA 3CI5A 1RAAB 3KD5E 3H45C 3RYFA 1M9SA 1KC8O 2Z0WA 3VOBA 5GIOC 3G6EQ 5HXZA 2O2OA 3PIPA 5D3GA 1AWJA 5BRDA 3CCQQ 3TU5A 5B8FA 3E1SA 1OYXA 1K73C 1AWXA 3SWNC 4F3TA 2Z1JA 1OH6A 5JS2A 4ZNXA 2GFAA 3C94A 1BG3A 4OMLA 3JCMe 2YJEA 4Z4GA 1RDWX 4ILHA 2ZPEB 1IG9A 1CSKA 4A63B 4ZGJB 1JLEA 3VENA 2KTQA 3LX7A 1Q81C 2KEAA 2K1SA 4M77G 4QAGA 4J2DA 3D00A 2MAMA 1KHIA 1QCOA 3TABA 3FZFA 4DQ8A 2ZOVA 4W5QA 4HUEA 4LDWA 2ASOA 1HKCA 3EHQA 3VGLA 4FM0A 2E88A 4E7KA 1RL2A 3A98A 5GAN5 4JI6K 4A2AA 4BR2A 1H3ZA 1NLPC 1J54A 3O9TA 2EYWA 3VJPA 4C92F 1NJIU 5BRFA 2W42A 3CFRA 2XY5A 2X74A 1ZBSA 1OZ3A 3N5BB 3L8BA 2QTXA 4M7DG 4U7BA 2DL8A 4WCEL 1YIJF 1OQKA 2HHSA 3ZT1A 2W8BC 3VQ9A 1VYTA 5BRHA 4C4WC 1NGIA 3GLXA 5CKBA 1GLJO 1VRTA 4HCBA 4OO1J 2FG0A 2QM1A 2E12A 3V8KA 2DXUA 2QQSA 1BI0A 4WCIA 4EIKA 4EP5A 1XRGA 1XV2A 4CIEA 1N6QA 2L2PA 4C92C 4CGGA 1HNIA 1BL3A 3J7AP 5HOOA 1W5BA 2Z01A 3J7YP 1J5EK 4E1NA 4IOXA 5EO3A 2RNAA 3HK2A 1CZ9A 5M1OA 4DTOA 3E22A 4O44A 1TXQA 1N6AA 2X3WD 1IKWA 2DY4A 3VQEA 3DOLA 3S9HA 4K0KK 4QCLA 1YAGA 1KNJA 1N5ZA 4QVDA 2J7IA 2DXTA 5KRSA 4OF1A 1WSEA 2DMOA 4CJFA 4Z4IA 3N2KA 4ZOLA 2A36A 3F0DA 4DV3K 1PC0A 1W40A 4U39A 4KFBA 1X52A 3TSWA 4C8GA 4H4OA 3JCMc 1M90C 2YRVA 2LQ8A 3AHUA 4A62A 4CHZA 2HBLA 2ZPIB 3NF7A 1NJZA 3D7SB 2MCNA 4JI5K 2E4HA 5GMKm 4LFBK 1K4US 3FR0A 3WPXA 2ZAEA 3DWLA 2BE9B 4J9FA 3UDCA 3PIOL 3KTQA 4D8KA 3JXUA 1OU8A 2DYBA 4CE9A 3LPUA 2KAFA 3INZA 2GF7A 4KGVB 3T9NA 3L3VA 4JEPA 2ZPFB 4CFBA 5HCKA 1U1SA 2DM1A 3AVJA 4KRFA 2VAWA 4ZOLB 4C0FA 1ZUUA 1E6HA 2A6AA 3ZT0A 4K43A 4QKUA 3CERA 3V4IA 1X2KA 1OH8A 3JAWA 4CHOA 1VQOA 1QVFP 4O4HB 4Z4EA 2P9SB 4B9NA 3WJRA 2ATCB 4JK8A 3PE0A 4CJWA 1ZXOA 2YSQA 3QINA 3UKRA 2GV9A 5D7UA 3V1QA 3ULDA 3I56F 5LMUK 4M75G 2OI3A 1YBYA 3HP9A 3G4SQ 1VQ8T 4FZYA 1E7OA 2LQWA 2E6MA 3G4SF 3VRZA 4BRDA 3CCSF 5BN8A 1KRPA 2CVLA 4ZTFA 4NXMK 2A5XA 3WNHA 1KCFA 2KMTA 3LDQA 1M2VA 2SRCA 3VS4A 1WNLA 1TKDA 2QWMA 1HYVA 3QJ6A 3QIPA 2O31A 3OMCA 3O3GA 4EIAA 2YXYA 3HSCA 1Q81U 1TU0B 5CKFA 1ESVA 1QVGS 4MZTA 1G3WA 3E1YA 2NRHA 5GAHP 4NUTA 1ZSZB 3HKSA 2DD4A 5A2QE 3CC4Q 4HA8A 2L0AA 4DSEA 1VSFA 4DR4K 4PJOB 1JLQA 1YHQN 1PD0A 3QEVA 1PG5B 4AF1A 1UJYA 3EG0A 3RR7A 4DR7K 3O5BA 3WGNA 3NMUC 2QKKA 1IZ6A 1VQ9N 1QSYA 1KD1R 3S02A 5H1SQ 3JASA 1IKXA 3BF1A 1MUZA 4G4WA 3HTVA 4A59A 2VVKA 1V1CA 4E3SA 4C8IA 2E41A 3C7NA 1WDXA 3CPFA 1N8RO 3NBPA 4YOYA 1KK7A 4IIMA 1W2BP 2Y4XA 4FM4B 1KQSS 3FEOA 4X1VA 4Y28E 2KKZA 4B9XA 3CQXA 3GOIA 2MF2A 3Q7BA 4JI0K 4CI0C 1HUXA 1D0XA 3S0WA 4PJOA 1B34B 5C0YA 4KBOA 4FJIA 3MP6A 1M1KC 2KRMA 1I1JA 1WJQA 4KV8A 1PM3A 1WX6A 4M3WA 4IUTA 2JZ2A 3NGYA 5AQWA 3TSPA 4ELTA 1C0MA 3QIIA 3IMXA 1IXDA 5C6SA 2P5GA 3OSVA 1UHFA 4DQRA 1YJNQ 2G8VA 1RBUA 4KPYA 3Q7CA 2LBTA 1GCQC 2LBWA 1X1PA 2D0PA 1OX9A 5E84A 3UKUB 4BRAA 4KAZA 4JKGB 1MNDA 2EPDA 2BTFA 2D4WA 1Y96B 1NU0A 2KFNA 2FPFA 4Y0WA 3LWLA 3P39A 5F1XA 4J83A 4DF4A 4FVUA 1DT9A 4ZGDB 4J8OA 4OB0B 3OY9A 1BQMA 1JU5C 1TUGB 1TKXA 1YJ9F 3CQTA 2KYBA 3QXEB 1QQCA 3V9WA 1T44A 3J81O 1VQPN 3CJCA 3DB4A 4NLCA 4CHPA 4CC4B 2A1SA 1XQHA 4JDSA 3U4LA 4YDUC 3OJUA 4OMNA 3HM9A 1CLQA 2XDPA 2ZPBB 3H0IA 9ATCB 2D6FA 1Y57A 3L3UA 3JARA 4I50A 2HRUA 3R0PA 4X1KB 3CXCM 5JVGL 2DVEA 2RQRA 3JSCA 5LY3A 2DL4A 5GAN6 4DS4A 1X9SA 2HHWA 2XY7A 2O8FB 1KQ1A 1GLFO 2V9YA 2GQVA 1YJNT 2XY8A 3N4ZA 2UXBK 2HHTA 3SD4A 4C0DB 3TR8A 1QHTA 3TARA 4B3MK 1TG0A 4QS7A 4KRTA 5KMGB 2KROA 3FLGA 4IHJB 1T6DA 5LP6B 3ASKA 3WJPA 1Q82H 1W4SA 2L89A 1KQSA 4BDYA 4BT2A 2LVMA 2CZ0B 1LOTB 2UYKA 2F5KA 4L3QA 3FDRA 2YRDA 3AVNA 3K5NA 4CEAA 4FWQA 1XWLA 3IFRA 2YKNA 3LDSA 3ELCA 3VQQA 4E6RA 5J2QA 4B3OA 1NJWA 4HVWA 4M78D 2IOCA 1N32K 2KRNA 3EFOA 4Q5WA 1NPPA 4FT4A 3BP8A 3E01A 5JVHL 5BN9A 3FRNA 4WBNA 2UXDK 1VQ7N 3MEEA 1YI2N 3R8EA 3WXIA 4CF2A 1UG1A 1HSQA 2JOYA 4M7DA 3QO9A 3VETA 4DTXA 3M84A 3M0SA 3FC3A 2Q31A 3FE1A 2JTMA 2KSSA 1SKRA 4CC3A 1L3TA 1D1AA 1W42A 3OYHA 4HCZA 1WSIA 1SSFA 3CCVN 2B5JA 1WBBA 1AHJB 1YWOA 3JCMX 1NKBA 4O4IA 5A0DA 1K9MU 1JKHA 3CC2Q 4H03B 4PFPA 2A3LA 1UB4A 3JATB 4CGFA 4J9DA 2C0TA 3EFOB 2D8JA 5CZ1A 3I9QA 5GMKe 3CD6T 3RKXA 2KFZA 5HY4A 5LJ3e 1VQMQ 3O8VA 3T1HK 4X1IB 2KI7A 4EI8A 5IN1A 4JKDA 3HT3A 1N8RH 3X25B 1YITQ 4J8FA 1E4FT 3SUPA 1ZLMA 1X6BA 4OJRA 4IDKA 2CWJA 4B45A 4FWNA 3ZBDA 3DLRA 3TTFA 1GLAG 1RBSA 5FWBA 1RT5A 5IXFA 3HKCA 2VWFA 2EQMA 2OAUA 3THYA 3O3FA 5J1EA 3O9RA 1XQSC 1TUDA 1JXEA 3A2FA 5KPTA 2R6R1 4M77D 5IJ0B 1TKZA 3CCMF 3OBYA 2HSTA 4AHSA 5CKDA 1MHNA 2QDYB 1NYFA 4CC7A 3CXCP 4EHTA 2MWPA 4ISEA 2DLPA 4CJ4A 4IUQA 4FLVA 1TH7A 2HDAA 4JI7K 2BZYA 1M3CA 3NF6A 3VGMA 1NMDA 5HRNA 2X4YA 4LNUB 2LQNA 3CCLA 1K73R 4LF6K 1WOQA 4XTXA 2JTEA 4JAXA 1WIEA 2BZ8A 4CW7B 1N36K 4FW2A 3VUZA 1CXUA 2QK9A 4J9GA 4E7IA 1ACMB 4QQ6A 2DTUA 4O4LA 1ZA2B 2AKKA 1YUWA 1ZSZA 3HRUA 1SL1A 1D8YA 4HVJA 2HX0A 2P9IB 3HPGA 4FJ9A 4FVMA 3GIBA 3ZEUB 3NVIB 1PNJA 1UJ0A 3PO4A 4IZ9A 3MN6A 5GONA 3KFVA 4HWIA 5BMVA 3HAXD 2H3EB 3OYCA 1ZSGA 4O0IA 2O8BB 3RIRA 5HWEA 4Z4CA 3EZ5A 2XIDA 3ZETA 3IG1A 2FF3B 4J7IA 4IKFA 3MMVA 4GVMA 1NGFA 1ZBIA 1FJGK 1R0AA 4IUPA 3M8QA 1NQ3A 4XTZA 2IAFA 1AVZC 3RSEA 3KIZA 2EWNA 2FHDA 2ITMA 1MDUB 1OVYA 2ZCFB 4EMKB 3FFIA 4B3SK 2WUSA 2DK3A 4PLLA
chains in the Genus database with same CATH topology
1K73U 2ZF5O 3T7ZA 1HKBA 5CAIA 2Y90A 1V4TA 4CZLA 2VGNA 4QQDA 1N9SA 2E6ZA 1VQ9F 3OYMA 1NGHA 2E1HA 1MGQA 1VQ5F 2PVDB 2FF6A 3CCQA 2QEXN 2YJFA 3HRSA 2CZ6B 3KXTA 2QWQA 3CBMA 1HK9A 4UC4A 1P8ZA 2CKKA 4XU3A 2HD0A 3J81M 1JJ2S 4KULA 2JUFA 5GANg 1KAYA 3LDLA 5JLHA 2V7ZA 4IO9L 1I81A 3CC7F 5EXWA 4O8UA 1M90U 3TSUA 1SDSA 5GAMh 2LT1A 3VESA 2FSJA 5J3BA 2AHJB 3NFCA 4PL7A 3H3OB 2V8IA 4K41A 1KAZA 1XC3A 1T0KB 1KC8H 5DCVA 3M5AA 3A8LB 4C8QD 1VQ5N 1Q7YC 2FSKA 4JKEA 3CCEA 1ATRA 5FLXM 3QSUA 1W2BF 3ID6A 3QBYA 4C8QB 3A5LC 3QYHB 2ZGZA 4B1XB 3WXMB 3C6HA 2QEXA 2ASPA 2D0OA 5AQIA 4BI8B 5HY0A 2FB7A 3CC4A 3EE9A 3SWNB 3ME9A 2BH1A 5AQNA 2ZJPL 1G3YA 2PUKB 3CJ9A 3E9GA 3O4WA 2A7YA 5AFUA 4M75E 3S3NA 1I4K1 4A53A 2CGLA 4FWRA 3MEVA 3E9FA 2XG8D 4BVOA 2Q0UA 3D2EB 5FU7C 3FZKA 3DLMA 1U6ZA 1CK2A 3V7EA 1TUUA 1YXQA 3M1FA 1X6OA 4M7DE 4OVAA 3F2KA 3HFOA 4BG8A 2QEXF 4BGBA 4JKHA 3F70A 2F9TA 2HBJA 4CI6A 3MWTA 1VQMN 1WGSA 1WQWA 3QDRB 4A5AA 3L2RA 5ADXA 4Y91A 1MWKA 2L5QA 4JLIA 2DEQA 4PJOG 3O9QA 2DIGA 3JB9G 1GLCG 4OPAA 2RE2A 4DOVA 3J81E 3VPZA 4RCBA 5A0LA 5EVZA 1QP3A 3CC2F 1KD1U 3LWOC 3ZX3A 3UE5A 2RH2A 3CCUF 5GAOm 1Q86H 2ZWHA 2RB6A 5FROA 2QQRA 2PAVA 5GAEP 4ZN3A 2I6DA 5AQKA 2GTDA 5KH6A 2K5FA 3LWPC 4ELZC 1W41A 4CZJA 5TKWA 1KC8C 1EO1A 4A61A 4RMOA 4GV9A 3U9ZA 1VQNA 1QVPA 3C0BA 3CBPA 3HZ6A 3L42A 4M75A 1CN7A 1NZ9A 4FPBA 3FFKB 3O8MA 3NTKA 4FL9A 1OZ2A 4JKBA 4DOWA 2PBDA 2FLOA 4J6YA 2O01E 1U1TA 4A4FA 3T69A 5FPEA 2E2OA 3DLLL 3V7QA 2DZ9A 3M6GA 4C5GA 1VQLA 1ZC6A 2LCLA 5LJ5j 4OMFB 3L0QA 4A4HA 3OYLA 1WQ7A 1KXPA 4RCHA 4XAXB 1NJIH 3NK6A 4C92D 1U2VA 3GF5A 1BI1A 4FSXA 2KTVA 4M75C 1HX1A 4PL6A 4C5EA 4JHDA 2ZPHB 5DM7L 5AQUA 1YJ9N 4M7AD 3R1XA 1VQLF 4I6MB 5CE3A 3LWQC 1W3EX 1JJ2A 3QO3A 3SDZA 3JAME 3PMIA 3AAPA 2F7TA 3M59A 3KVGA 3I55A 2UYTA 3OHRA 4KH5A 1VQ9A 1J6ZA 1QVFF 5AQGA 4NQ3A 3VEXA 2KLAA 2R5AA 4CZEA 3KBGA 5GANj 1VQPF 2EJFA 1VQ9T 4PJOF 3WXJA 3EKUA 3I55T 3A8GB 1WJRA 3P8DA 3X26B 2V8KA 5AFUH 4BY9D 2RHIA 3CCRT 2IG0A 3OYYA 4GV6A 2LT4A 2M0OA 5AZIA 3B8AX 4R55A 2LC4A 1YVNA 2ZPGB 3WEEA 3WXLA 4RWTA 3CCJF 3VERA 5AQHA 4XCQA 5GAN3 4ELYC 4EMHA 5J26A 4PKGA 3CD6F 4PJOD 4YOTA 4FL6A 2P9PA 5M1PA 3S3MA 2KK4A 4H0TB 1M1FA 4B1YB 4CZIA 1PXWA 1O75A 4M78A 4JRQA 5M1FA 3LWHA 1X01A 1JCEA 2J4RA 3CXCA 3FZHA 2KVQG 3NTIA 3AARA 2XU8A 1Q82C 3CPWS 4CBWA 4DCHA 2E2PA 4M75F 1VQ7T 3FLCO 2LCCA 4YOUA 3HRGA 3CC7T 4AM7A 4BR4A 2W40A 3V7SA 4WFAL 1VQLN 3AY9A 5FPDA 4CRIA 3JB9I 1IPAA 2HF4A 3E66A 1Q81H 3TTCA 1RFQA 3ON1A 3HRTA 3JB9J 1QP2A 5GMKl 3V8JA 2ZZDA 4M77E 4E7HA 3SLCA 2V51B 1QQNA 2GLZA 4NS5A 1K8AU 2QA4F 1DJ7B 3W3DA 4B1VA 1ZQ1A 2YHYA 2OTLF 2E20A 2G3RA 2XICA 1VQ7A 1HPMA 2KDSA 2M9UA 3X28B 4JRKA 5KE3A 3CCEF 1Y64A 4NL2A 3H3NO 2W41A 2BUPA 4C92G 2CS7A 4JK7A 4E1JA 4ATOA 3CCMN 2HF3A 2EFIA 3H1VX 1VQ6T 3MX2A 2FSNA 3ZEUA 2OTLN 1K73H 3RERA 3LLRA 4BC5A 3CPWM 4J5YA 1BO5O 3L2VA 5ELZA 3OA6A 3Q1JA 1SQKA 1MA9B 1LNXA 2VWBA 5IT9M 3OW2A 4M7AB 1M1GA 5M1QA 3PIOA 4XU2A 5AZJA 1YI2A 1X3MA 1QVFS 3SAGA 5DLOA 3CCQF 5CHIA 1Z6RA 1CZAN 3CCEN 2DPPB 5E26A 3N4ZA 3JCMV 1IG8A 1R59O 5AQFA 5L8RE 2DXBA 1V29B 4BI4A 5FPNA 3SFMA 1BUPA 1KG1A 3QDKA 3KUFA 3M9QA 4MDWA 1YHQT 1QZ5A 3R6MA 2K3XA 2VC8A 1BA1A 4Z94A 3GNFB 5C2DA 1ZWZA 2Q0RA 3GDQA 1VQ8F 3O1BA 3ZYYX 1Q81O 4B9QA 3CD6N 1WPYA 3G6ET 4N4IA 1LOJA 1YJWT 5DM6L 4C5HA 1VQLT 1NJIC 2E10A 4II1A 1S22A 3LWRC 2NRZA 2NRTA 4K42A 2EJGA 1RGIA 4PJOC 1VQKA 4X34A 2QA4N 5AQRA 5GINC 5AYFA 4F7UE 3UB5A 4F7UB 3H6EA 1VQ4N 2OTJN 3OBWA 4FWMA 5GAN4 4IO8A 3WUHA 2CGHA 1SZ2A 2YHTA 3I55N 5I2SA 1VQNT 1C0FA 4O5FA 1ZHIA 2VYTA 5LJWA 4BRCA 4CZHA 2PVGB 2AP1A 1O9SA 4YORA 4MDBA 2F5TX 2P4TA 4YTLA 3URGA 3DAWA 4WYBA 1EIFA 1JCGA 3VU3C 4PLIA 4JUVA 5HK3A 2YHWA 4GV3A 4JKFA 2WSCE 4FT2A 1JB0E 4BGAA 5LJ3h 4BRGA 3OMGA 2A40A 2RHUA 1BA0A 3P8HA 2D0QB 3UPUA 5ADXH 2QQBA 4J6WA 4V2SA 3GOXA 3L2QA 4R79A 5CVIA 1VIEA 3CCJA 2GUPA 5I21A 2GEMA 3CCRN 2RK1A 2X4JA 5BREA 1YITN 4M77F 3ENHA 2O4XA 4IOCL 3QKJA 3CJBA 3CF5L 3D6RA 5GAN2 3ULEA 2DO3A 5GADP 2Q1NA 2LQKA 2L8DA 4TZZA 5LJ3g 4J7FA 2EQUA 4EHUA 2IVPA 3EZWA 5D6WA 3CCLF 1DEJA 3OYIA 2E65A 2Q36A 2Y4YA 2K4YA 3HL8A 3PNWC 4M77A 1YHQF 1M1KH 2RK2A 2C06A 3BF3A 3CCMA 3ATUA 3CMEA 3C65A 3KHYA 4BRQA 1S72T 3LDNA 1KD1H 4BVPA 1I5LA 3CEYA 3H8ZA 4XQ3A 4EAHD 4PKHA 3QPHA 4IOAL 2KHOA 4I6MA 1NJIO 3E9LA 1Z05A 1GXIE 3CD6A 4JD2B 3FZLA 3MWPA 3QG1A 5GANe 1JRIA 3G71A 4C0DC 3C7NB 3QMLA 2JVVA 4OPHA 3BDLA 1N8RU 1DGKN 5MLCQ 1C0GA 3CC4T 2JN0A 1Q82U 4FSVA 4BR9A 2P0QA 1MWMA 3OS0A 5GINA 2FL7A 2P9UB 2YLCA 3EN9A 1D4XA 1VQ8N 1K8KA 3M53A 3SWNA 2FXUA 2DZCA 5CK9A 5LJ5e 2CH6A 4BROA 2FC3A 3JB9H 5HXUA 3MP8A 2F69A 2OTLA 2XDBA 3D2FA 4KUDK 3HSBA 4FOEA 3CHWA 2CGJA 3PMTA 4LDVA 1YJWN 1K8AH 3L2WA 3CPEA 4MDAA 4MZPA 2EJ9A 2QEXT 4EI9A 4YOWA 2BUDA 3PT9A 3OSSC 3A0IX 5BPMA 3PTAA 4EDUA 1D3BB 4JJNK 3FJPA 4JS4A 4BI3A 2NRXA 2EKOA 2D9TA 2RM4A 2MWOA 2QWPA 3N4QA 1U2VB 4EI7A 2JNBA 3GBTA 4A54A 2MI6A 1W2BA 2RHXA 3CCET 3ENOA 1KHCA 4XTVA 3CC7N 4GY5A 1GLBG 3I33A 4J6XA 1N8RC 1VQ7F 4FU6A 2LX9A 5AQTA 3TCJA 3LDPA 1NMUB 4EMKC 2Q97A 5JMVA 4WF9L 4BRLA 4LCKA 1VAZA 1XUPO 3CJ7A 3QFPA 4XK8E 2HQEA 3GE1A 4M7DC 3MN9A 1Y07A 4XU1A 1UEBA 4BD3A 4C0ZA 1GLEG 3CPQA 1TYQB 4C0GA 4M7DF 2R58A 4R56A 1ATSA 4M78B 4IJAA 3SBTA 4F7UG 2FGYA 3JCMb 3DXMA 5AQSA 5AR0A 2HBKA 2GWJA 5EOYA 4C92E 3RKWA 4N4GA 4BQZA 3L1AA 1M5Q1 4B1ZA 4BVSA 2NLXA 3OB9A 1X7PA 1IJJA 2QA4T 5JLFA 1Q86O 4H5VA 4X9CA 2WBNA 1NBWA 4YDUA 4AM6A 4F9OA 1BI2A 1M1KU 5AQOA 3QB0A 3LH0A 1VQ4T 2OTJT 3EE8A 4B9WA 3CIPA 5FJ4C 4C8QF 1NGEA 1BYMA 5C10A 2NZTA 4ISFA 4GLKA 3G71N 3CCLT 2CZ7B 3KWGA 4WF2A 2XDDA 3L4IA 5LJ3d 2EQKA 3HI0A 3BFMA 2QWNA 5GAMe 3N4YA 2QWOA 1VQOT 4H0OA 2X4XA 1M8VA 3VOVA 1VQMF 4JRPA 5LJ5f 1WJSA 3PLAA 4DA4A 1W2BM 3P31A 4KUIA 2XI9A 5BPNA 3UKRB 4BY6C 3CG6A 3J7AF 2P9NB 4A4KA 3QZ9B 2VXEA 2BO1A 2WSEE 3CMAN 1P92A 3KWIA 2QQAA 4RG8A 4LDXA 3LM9A 1VQ5T 2A42A 3CPWF 1YJNA 2DD5A 3J8AA 2CYZB 3NMUA 3VI6A 2X35A 4OGEA 3A5MC 3F5TA 4XH4A 5LJ5d 1BU6O 1QZ6A 3HOSA 5DY9A 2QQ9A 2WACA 3JCMJ 1K9MO 1R8OB 4Z02A 5I9EB 2PFUA 5EG2A 3TEEA 4MLEA 1Q18A 3OYBA 2LBXA 1T3VA 5JICA 5GANf 4QVZA 3SK3A 2E8AA 1YJNF 4H5TA 3MEAA 1JBMA 3OYEA 3GYQA 3SAHA 3QBXA 2QTDA 1D3BA 3JB9F 2CZWA 3JCMW 4M7YA 1KD1O 1X75C 2M1HA 3W0LA 3G71F 2F9WA 3DXKA 3CC2A 4GVEA 3O1WA 1OI1A 5FRMA 2P9PB 2DAQA 4PKIA 5C2FA 3RVCA 4H0XB 1HKGA 1YI2T 3CQYA 2QW9A 5GAMd 5AQYA 5GMKh 3CXCS 3A8HB 4HTLA 1JJ2F 3FB9A 4BR7A 3MEUA 3DJCA 3JB9D 4JN4A 3DXKB 3WQUA 4N4HA 4M7AA 3CCVF 1E7KA 4ILJA 4C1NI 1G3SA 5KE2A 5AZIB 3GP8A 4H0PA 1H641 3TPQA 2D1KA 3AGKA 1G3TA 1XBIA 4BVTA 3V7RA 2OZBA 4QS9A 5GAGP 5FU6B 5BPLA 4VUBA 4MDXA 1KQSM 3L2ZA 3VTIA 1GLDG 3X20B 1NE8A 4IEEA 3OW2M 4DHYA 2LNVA 1WUAA 2LDMA 4C23A 5C0MA 3OA9A 3FGUA 3DXMB 5M1KA 2LRQA 2RD1A 1VQ6A 4WFNL 2F9ZC 3OW2F 2WFBA 4MO5A 2GWKA 4XEIA 3CCVA 3QZ5B 4NL3A 3M55A 3CCUN 5TKYA 3M57A 2HMPA 5C15A 4A4EA 5LJVA 1QVGA 2P9LB 3E20B 1DKGD 2YCHA 4IWVA 4PNOA 1YJNN 4B1WB 4PHTX 4BC4A 4ZGEB 4CD1A 5BR9A 3CC4F 3OYNA 4X9DA 3M4YA 3AAQA 5GAOl 3UT1A 1X9JA 3SBGA 2JTFA 3MCPA 3ZEHA 1RDUA 3VYHB 1KAXA 1YIJT 4IURA 5M9OA 4UY8O 1VQKF 5LJ5h 3R9PA 2JNGA 1K8AO 1BI3A 2AIFA 3BEXA 4LD6A 4IUUA 4L6V5 3CC4N 4H5RA 4X3LA 3MEWA 3QFUA 1OKJA 3IR9A 2KY9A 3CC7A 2M16A 5GAOp 4CBUA 4JD2A 1NM1A 2BKDN 3CMAF 4LDUA 1YIJN 2NRRA 4JKAA 3G4SN 2GELA 5EX5A 3C95A 1TUYA 5LJ5g 3P4IA 4BC2A 4XH1A 4BR0A 3ENBA 4BRMA 2XHCA 3O80A 3SMSA 5KPRA 3QUIA 5HY6A 2DKGA 5D6YA 1K9MC 3CCRA 3NVKA 2FYKA 2HBPA 4C92B 3CCLN 3O9SA 2FVUA 2A41A 1PSEA 1VQMA 2WC9A 3BW1A 3M54A 4C8QC 3MP1A 5HL7L 4XTUA 4BRPA 4O6JA 3VEYA 1V4SA 4QQGA 3J80E 4A2BA 4BACA 2P9IA 5I2MA 3HHTB 1B34A 4BDZA 5AQVA 3HFNA 3CCRF 3OYAA 3TREA 3G6EF 2ALEA 4IXCA 4BVQA 5CKEA 3UKUA 3CC2T 3EKSA 1NGAA 3RA5A 2DJZA 2V7YA 3RMSA 1YITT 4BRNA 4JLGA 5DLQE 3U9DA 1ZBXA 4C8QA 2NRVA 5AQMA 3VKIA 1G99A 4M63C 4FWOA 4BRKA 1BWFO 2JWKA 2HVYD 3UWNA 3S41A 2QI2A 4BB7A 3QJYA 2RJDA 2DIQA 3O6WA 5GAOr 4JS5A 4MMKA 2WALA 3L4QA 3DLLA 4BE1A 4XTWA 4C5IA 3DB3A 2BIVA 1Q86C 4G9ZA 3ZX2A 5CR2A 1LCUA 3CPWA 4KBMB 3JCMQ 4M7DB 3O08A 2RI3A 1TYQA 1VQ5A 5CR4A 2P9SA 4HCCA 4WQ4C 4BRFA 4IFEA 3KK7A 3WXKA 3ZX0A 2ZGYA 1I8FA 5GIPA 4A57A 1Q7YU 4M78G 2ZJQL 2YLBA 3RKYA 3JCMh 4DKWA 2XD0A 3LWVC 1GLLO 2LTOA 5GAMf 4WQ5A 3SMPA 3C12A 3E9OA 3RESA 3WVEB 4XU0A 3RUXA 3E9PA 4BQLA 3LL3A 4ISGA 1IREB 5GIOA 4BVRA 2RI5A 3PFSA 4MO4A 3I56A 3S6WA 1YJ9A 2P9NA 4E7LA 5EY4A 3O9UA 5EWRA 3CCSA 3MN5A 3G25A 4M7AC 3C6AA 3OYJA 3A8OB 3FZMA 4JRIA 2K2VA 2P9LA 1NPRA 3VTHA 4H5WA 4OP0A 1VQ4A 2OTJA 1BIBA 2RHZA 1UGQB 1XTDA 2VYPA 3VF6A 4M78E 3MO8A 3LWIA 3LGFA 2QXFA 2A3ZA 2RJCA 2QA4A 4BC3A 3VUBA 3CJ1A 3LM2A 3RSEB 2RI2A 2V52B 1YJWF 4BE2A 2E6NA 3CMEN 3P8BB 3FIFA 2O4XB 1K9MH 2NLUA 5D6XA 3RMQA 1EQYA 3MDQA 4C8QG 3ULEB 4C92A 1QVGM 2DTOA 3V7CA 3MN7A 2VCPA 1QVFM 2QWLA 3IDHA 3JCMd 4N0AA 2HBMA 1S72N 3NVMA 2AA4A 3QYGB 2K5IA 4QW2A 4KH6A 3PGGA 4XH5A 3OS1A 3TU4K 3HJWC 3CXCF 5G4UC 1Q7YO 4BG9A 4NB4A 5CKHA 2H3JA 4IEIA 3MHXA 3I56N 4P5NA 1ILYA 3H1QA 4WQ4A 2E1ZA 5HK0A 3PAFA