3MCAB

Structure of the dom34-hbs1 complex and implications for its role in no-go decay
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
372
structure length
341
Chain Sequence
IEKNSGWITMEPEDMWHLYNILQVGDQLKASTVRRILVENMDFDTKAAQLHIKRTTEYHPMGSYHTLDLELHRNFTLYNEWDAFALDRVDAACNPSAEIGAVVLDEGLANICLITDYMTILRQRIDQVIPRKRRGDSSAYQKGLDKFYDSVFQSINSEFDFDKLKVVILASPGFVARGLYDYIFSMAVKLDLKQIVKSKNKFVILHSSTGHIHSLNEILKDPAVESKLADTKYVQEIRVLNKFYDVMNEDDRKAWYGPNHVLKAFELGAIGELLISDSLFRSSDIATRKKWVSLVEGVKEINCPVYIFSSLHESGKQLDLLSGIAAILTYPVDEEDISEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation regulation/hydrolase
molecule keywords Elongation factor 1 alpha-like protein
publication title Structure of the Dom34-Hbs1 complex and implications for no-go decay
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 88
structure length 341
sequence length 372
ec nomenclature ec 3.1.-.-:
pdb deposition date 2010-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03463 eRF1_1 eRF1 domain 1
B PF03464 eRF1_2 eRF1 domain 2
B PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.870 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mcaB01
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3mcaB02
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3mcaB03
3GYQA 1KD1H 3CC4F 1GZ0A 3HAXD 3NMUC 1VQ8F 4BW0B 4NUTA 1Q82H 1N8RH 1YJWF 1NJIH 1PXWA 3CCUF 3JAMM 1CK2A 3CPQA 5EO3A 3CMEF 3LWVC 1KQSF 1Q86H 2WALA 1T0KB 2CZWA 3CCVF 2FC3A 2OZBA 2LBXA 5GIPC 2HVYD 1YJNF 1XBIA 2AIFA 3PLAC 1W42A 3CC2F 2VGMA 3NK7A 5G4VC 3OBYA 3WXMB 3J80M 4BY9D 3E1YA 3NVIB 1RA4A 4X3LA 3CCJF 5GAPK 3O85A 2VGNA 5IT9M 3V7QA 1YI2F 1M90H 1S72F 3CCMF 1VQLF 1VQMF 3I56F 3HJWC 2OTLF 1X52A 1VQ4F 4LCKA 1QVFF 3OBWA 3N4YA 3OW2F 1E7KA 5GIOC 1K9MH 5A2QM 1VQNF 1SDSA 1RLGA 3FFMA 3CG6A 5DCVA 1CN7A 3CCRF 1KC8H 5FJ4C 3N4ZA 3CXCF 2KTUA 3AGKA 2OTJF 3JCMM 1YJ9F 2QI2A 3NK6A 3CPWF 3G4SF 1VQOF 1VQ5F 1VQKF 1GO0A 1K8AH 3MCAB 3LWQC 3VMFB 3G71F 2KG4A 3CCEF 3E20B 2QA4F 1DT9A 3SIUA 3IR9A 4TZZA 1W41A 2I6DA 1IPAA 3RA5A 5GANK 1YHQF 1H7MA 3V7EA 1VQPF 1NMUB 1X7PA 3CCQF 2LBWA 1Q81H 4X3MA 5FLXM 1K73H 3LWOC 3CCSF 1QVGF 3CD6F 3J7AR 1ZWZA 2ALEA 4C4WC 1Q7YH 5EWRA 3J81M 3LWPC 3SIVA 3LFOA 2HSTA 1VQ9F 1W40A 3NVKE 1YIJF 3RA6A 2BO1A 2KTVA 2JNBA 1YITF 3I55F 1M1KH 1GO1A 3ON1A 3CC7F 1W2BF 3CMAF 3LWRC 1VQ6F 5GINC 3VI6A 1X7OA 3G6EF 2QEXF 4AF1A 1W3EX 3CCLF 2OHWA 5G4UC 3PAFA 1JJ2F 1VQ7F
chains in the Genus database with same CATH superfamily
1X9WA 3NH1A 1RL2A 2MF2A 3WUHA 4L8RB 2E5QA 3I5SA 4CHNA 1PKSA 2QWNA 4BVOA 2V1QA 3CM5A 4PJOE 3PO5A 1ZBIA 2DYYA 1M8MA 1ZA1B 4JV5K 5C0MA 5C8YB 1IRXA 1KRPA 5JLFA 3NAEA 4CJTA 3EGUA 4M3XA 1QAHA 5FROA 2IDOA 1IV1A 4LSNA 1M3BA 3CPQA 1J9AA 4C92G 1ZUUA 2RK2A 2LNVA 3MX5A 1VQNN 2ATQA 2B86A 3M84A 2LDMA 4RTFD 2QA4Q 3VA0A 3K0TA 2YDLA 2DKGA 2RJFA 3TCJA 5C8YA 1D3BB 2RB6A 2HVYD 3E66A 2KYBA 2E70A 1VQ4T 1Y71A 5G4VC 1M8VA 3HSBA 3FE1A 4XQ3A 1RA4A 2NRVA 3CCSQ 2D6FA 2DE0X 3NGYA 4VUBA 2G8VA 1YHQT 1PD1A 1E7OA 3GIBA 2PYLA 4EZ6A 4F2RA 1Q7YR 2D0PA 3LDLA 1D3BA 1NYGA 4ZGJB 2GEMA 1TSFA 5GJWB 3D2EB 3EL2A 3Q1JA 3QINA 3HPOA 2QA4N 3ENHA 3MPUB 2GQIA 1J3TA 4QOZB 2PMPA 3S3NA 2R57A 3OBWA 5GANj 1ZBUA 1GOBA 4KHUA 4X1KB 5GIOC 4AM6A 4M7AG 1YT3A 4C8IA 1WHHA 4F14A 3WNFA 2R6R1 3KLGA 3QKJA 2Q0UA 1FWZA 3FZMA 3J7ZO 2OZSA 3D2EA 4LY7A 3CCSN 2C0OA 4AFZC 1CXQA 4R79A 3JARB 3CXCF 1WNLA 1NGCA 4X66K 2A1RA 3NFAA 5HP7A 4RTVA 2DJQA 2IVWA 3M57A 4BY6C 4X1KA 3CMAT 1BB9A 2XHCA 1S6PA 2DA9A 3IFRA 3M5RA 3QFPA 2OZMA 1QVFA 1RCHA 3SMPA 3K5LA 1ZXOA 1VAZA 3HZ6A 1U3PA 2DT4A 3MMVA 2E1YA 3VS5A 3BGRA 4Y1DA 1BOTO 3CPWM 1TL3A 3DKMA 4MDWA 3AGRA 1NKCA 3E20B 3JARA 4O4JB 1DT9A 4C81A 3L0QA 3CCRA 3URGA 3M9QA 5EXWA 4BRDA 3C9TA 1VQ8T 4B9TA 2RK1A 1I0CA 2K4YA 4KBMB 1H641 2M0OA 1KAYA 1NK7A 4XH5A 3LLRA 4GKKK 4QCLA 3V3TA 3CD6F 1MHNA 1NZ9A 1QSYA 4CJ3A 1JFFB 4O4JA 1N27A 2ETJA 5KPRA 1OYXA 1TKDA 3M5AA 3JB9H 3PIOA 5CKEA 4GBQA 4NO7A 2K57A 3VO8A 1OV3A 5IHIA 5JICA 1K73C 3T9NA 2EIFA 5CHIA 4RTZA 1KD1U 3NVKE 3QMLA 4NYNA 1W59A 3MXJA 1WBDA 4O4IB 2F8TA 2RHZA 2X4XA 4JJBA 2CH6A 2OJ2A 2E2QA 3SJHA 4M78D 3BZKA 1JFFA 2D5RA 3BW1A 1PSEA 4A4FA 1YF5L 2EHGA 4CJPA 3J81O 5HLFA 2EYXA 1SL2A 1SSFA 1EXQA 4FLUA 2I7NA 2KRNA 3WJQA 1WSEA 1CKAA 1OH6A 5CCAA 1QE1A 1U2VB 4CF0A 3ESJA 1W2BS 1VRTA 2ZPHB 1XUPO 1KG1A 4O4IA 1OKJA 2UYNA 2IOCA 1PM3A 2L3QA 3H3NO 4PKIA 3JCMQ 4BVQA 5J1EA 3NPFA 2RHHA 4PJLA 4FJGA 2RA2A 3MAQA 4BRMA 1ACMB 3JB9D 1VQMN 3UIQA 2Y90A 2BZYA 4KT0E 3G6EA 2VWKA 3G4SQ 5FLXO 2OYQA 1GLCG 1M90R 4H4MA 2Q0RA 1Q9YA 2HKNA 2ZOVA 4Q5WA 2HAXA 1XHZA 4CEZA 5AT1B 3M1XA 3VEZA 4M7YA 2W40A 1TUUA 3RR7A 3E1SA 4D8KA 4GVMA 3DDNA 2OZBA 3PMTA 3UDCA 4DU3A 4IUTA 4DBRA 3G71T 2C0TA 1U1TA 3I56T 3CCET 3NVMA 5JS2A 4IEIA 4BT6A 3LDNA 1JXMA 3DRPA 4GY2B 1BU6O 5GAN8 3CQYA 2P5GA 3S0HA 5AQYA 3G4SN 2YRDA 4LDUA 1HYVA 4DTJA 3CCUA 3LALA 2G6FX 4B3TK 3SFMA 4IO9L 1RQ7A 1NPPA 3T19A 4FYDA 3EGXB 3WNEA 2LBTA 1VSJA 4M45A 4GKJK 2Y4YA 4CFCA 2VAPA 4J9BA 3F9MA 3VQPA 3VEVA 4M4ZA 4DSFA 3DC2A 4ERHA 4OB0B 4PJOG 2X9HA 4IG3A 5CYQA 3LWMA 3UPUA 3J7YP 2HB5A 3M0QA 4H4OA 3KLEA 4IJAA 1GLEG 4BR5A 3QB0A 2K2VA 2J06A 5CR2A 2KR3A 2XIDA 2ESWA 3EGXA 3ER0A 2J4RA 4CJWA 4A63B 4B1ZA 4BGBA 1C0GA 4HT8A 3JVHA 5GINA 4FW2A 1VRUA 2X74A 3TAFA 3U3YA 3QO9A 3UKRB 3E2UA 1FKOA 3L4IA 4OVLA 4DQPA 2DETA 2CVLA 3ZP7A 2BTUA 2COZA 4KUIA 2YUOA 3O9RA 1IGQA 1OEBA 4A62A 1ABOA 3SV4A 3LDQA 4RG2A 1GO0A 2P0KA 3BP8A 3OA9A 3VGLA 1SF9A 4IURA 4C8QD 3AO4A 4CGHA 4FZXC 2EBPA 3T1HK 1FMVA 1Y57A 1HJRA 1JCEA 3CPEA 2G8KA 2HD0A 3IR9A 1NGJA 1OH8A 1U4BA 4KO0A 1IG9A 1W41A 5JCOA 1MA9B 4LUEA 2OTJA 3MEGA 2KFNA 4EDUA 4I7FA 1QVFS 4FYWB 2HHXA 4KHWA 5EG2A 2HHUA 1H7MA 1OFUA 3FPIA 4IUPA 2K1SA 3MN7A 3CCQF 3RERA 4AG2C 4DR2K 3PV8A 4O55A 1ZWZA 1TUYA 3WT0A 2B8AA 1Q7YH 7AT1B 3P39A 2HMIA 5ADXH 5TKYA 3I8DA 3A8HB 2E88A 4Z02A 2K9GA 4J6XA 3O9UA 4JLGA 1BYMA 3LX7A 3L2UA 3CCJQ 2RN8A 1YJNT 1SG5A 1B9DA 1Z26A 4FL9A 5HRSA 1S72Q 4RHAA 5EOYA 3O8MA 4CJFA 4N76A 1UAXA 3OVNA 1VQLQ 2E3IA 4C8KA 5EC7A 4XU2A 1I4K1 2RI5A 2RHYA 4Y0WA 1L3VA 4YOWA 1YI2T 3LL3A 3MWTA 3D0PA 3DOKA 2UZHA 4LFCK 3G1JA 1LOTB 1TKTA 4N47A 2XK0A 3H0IA 3B6OA 3QBXA 1MV0B 4MO4A 4EI9A 3RKWA 4DTNA 3CCJN 2QDLA 1R1MA 1Q8RA 1GOAA 1HRHA 4ILHA 1VQLN 1WDXA 3SB2A 4B9WA 4KB0A 4FJ5A 1AT1B 4JRPA 2UUBK 1VQ4N 4JHDB 1IREB 4DV5K 2O4IA 5BN8A 2L8DA 1TKXA 2QWRA 3SBGA 1TKZA 3A2FA 2YHWA 4BACA 4I9LA 4DV7K 1VQKQ 1QQMA 4I2QA 4C92D 1L3UA 4QS8A 2DTUA 1YHQN 3GOIA 3X26B 1JJ2A 3S9HA 1VQOT 3SUQA 1W97L 1VQ5T 1V4SA 1Z9ZA 1QCNA 1OH5A 2DTIA 1CSKA 4E7HA 1WNSA 3UKRA 2ECZA 4JHDA 4BRQA 1Q86U 4H5WA 3CETA 3JCMd 4CJVA 3CJAA 4CZFA 2Y4XA 1W55A 3FDRA 3LDTA 3OMGA 3WXMB 5GAOr 1K6YA 3GLXA 4IWVA 3PIPL 4DR6K 2IAFA 1N9RA 2CT4A 1Z5VA 3R3LA 3VTHA 5GAPK 2VGNA 3META 5CO7A 1YWPA 3QJ6A 5DM7R 3BY7A 2CGLA 1NK6A 3VKIA 3JCMf 5J2NA 1VQKN 4PFOA 4E7ZA 4WQ4C 3PVLA 4K0KK 4IIMA 3U23A 4ZTFA 4GLMA 4PWTA 2DRMA 2KQWA 3MEAA 3EH1A 3RIRA 1D09B 1YIJQ 3CMAN 4JI1K 4EHUA 1RNHA 3N4YA 1Q7YO 2FC0A 4K25A 4KWEA 5AQNA 2LZ6B 5CQXA 2GVIA 1IJJA 3LDSA 2L3PA 1VK0A 1W4SA 1QSLA 3ERNA 2JS2A 2DIGA 3ZO8A 1XQSC 1UG1A 2Z1GA 3K14A 1DJ7B 4WE1A 2X3XD 5AJ3K 1RT1A 3JAMO 4RCCA 4FYVB 1VQ8N 4N4HA 2PBDA 3ASMA 3R0PA 2RI2A 4ZHQB 1LV5A 1IKWA 2EKHA 1K73R 1YIJN 4XEIA 2HS0A 4HKEA 2P9IB 4YJ2B 4ZHYB 1ESVA 2V8JA 2FSJA 3M4SA 1K8AH 4H5NA 3TU5A 1D1CA 1TS9A 2DJZA 1SHFA 2K3BA 4CZJA 1JCFA 4H0VB 5EX5A 2I6DA 3TSUA 2YXYA 3CXCA 2F8SA 2DLPA 1Q82R 4FT2A 3ID8A 2WTUA 4YJ2A 2P9IA 4F04B 1IKYA 4OMFB 1ZBXA 5FWCA 1VQ9T 2CS7A 4M7DE 1B3QA 2QQ9A 3KD5E 4ELUA 5LP6C 1QVGF 3RYIB 4KB1A 4IKFA 4FWQA 3ZT4A 1E6GA 1NKEA 1U3OA 5KPZA 3MHXA 3AA5X 5GAMg 1KHCA 3J81M 3ZL7C 3Q7BA 4X1IB 2DZ9A 1WJQA 4X65K 1N5ZA 2L3RA 2DILA 3RMAA 3SQ1A 3BF1A 4FWPA 1W5FA 3PSFA 1HKGA 4OPKA 4BC3A 5C12A 2E64A 3RYIA 2HQEA 2RHXA 3NHNA 4J7IA 2COYA 3HKSA 5CAIA 4C8MA 3OS0A 5BPMA 2YNGA 3X20B 3CD6A 1IBKK 2HNIA 5LJ3f 1WQWA 2D0OA 3FFKB 1YFNA 3I56Q 3L2ZA 3RRGA 2ZF8A 4X1IA 1W581 1N9SA 4BVRA 4OB2B 5EB1B 5I22A 5GAMe 1LCKA 1OH7A 3RYFB 2ZWHA 2O01E 4FO0A 3AARA 5J2TB 4BC2A 2J6OA 1M2OA 3WXIA 2MPXC 2QQSA 2DL7A 2A37A 4A2AA 4MFBA 4AQYK 5G4UC 4FJHA 4BD3A 3GNFB 4CK1A 1BI1A 2GFAA 4RTTA 2CSQA 3V1RA 3CJCA 3V4DA 2XY6A 4FIBA 3RYFA 1XWLA 3DJCA 3RMCA 1M30A 4G1QA 4E1JA 1PCXA 3CCRT 2RQWA 2ZF5O 3FEOA 2KRMA 2AP1A 1BKBA 3I56N 3TANA 2MAMA 5CIUA 4JK7A 1QSSA 2Q1YA 4PJNA 2E4HA 2O9VA 1QP2A 1U1SA 3FZLA 3SUOA 4FJ8A 3S03A 2LVMA 1CK2A 1BI3A 3DRRA 5JQGA 3TI0A 3HL8A 1JXEA 1T0HA 3DMJA 2WALA 1NJIU 1VIEA 3ZFJA 2RHKA 4L6V5 3B6PA 2HZYA 1UJYA 4DRXB 5GAOm 3JCMP 1AEYA 4M41A 3EE9A 4M7DB 4CIEA 5GIPC 1WOQA 2HMPA 1KQSM 1MGQA 4JI6K 4J9CA 1K8AO 2R751 3M53A 5CKFA 1ASVA 2VGMA 3OYNA 1W5BA 3CC2F 5GAOl 3HPWA 4HT9A 3NVIB 1KC8U 3ME9A 3V7SA 3V7QA 1JJ2S 2M51A 3CCMF 1OX8A 4DRXA 3RR6A 1OOTA 4RCBA 1WB9A 4M7DA 1EETA 4KBOA 4NCAA 2CZ0B 3AO5A 3RYHB 4BVTA 3T3FA 3HJWC 1AZEA 4A2BA 4CC2A 1E4FT 1ABQA 3QHDA 2YJFA 3PIOL 3IKFA 1Y07A 3O3GA 4ID5A 4UC4A 2HQXA 3EEQA 3EKUA 1NGAA 3QESA 3ZT3A 1TXQA 1VQ7A 3K2PA 4DU1A 1YITQ 3DM2A 2FXUA 4KTZA 3HM9A 4DB3A 4FWNA 4W5QA 2DD5A 5LJ3j 3L42A 2YV0X 3VQQA 4KI4A 1R59O 3RYHA 3OYIA 3AGKA 3H3OB 4WYBA 5JVDB 4ZK7A 3VCZA 5HCKA 1WSFA 2QI2A 3MBMA 1RDCA 5A2QO 3G6ET 3GHZA 3C12A 4FWLA 2KBTA 2PZSA 1IV4A 2JUFA 4BREA 1J54A 4CGDA 3V81A 4DTRA 1UDLA 1BI4B 4EMKC 1D0ZA 4C0DC 1JQQA 4QVDA 2HBLA 4HTUA 2NLXA 1WSIA 3AO3A 1YITN 2VQEK 1OX9A 2WSCE 1WLJA 4CBWA 5JVDA 2JTEA 2GV9A 4LFAK 2BZXA 3M8PA 2MWOA 2RD1A 5CE3A 4IDKA 3GP8A 4LC9B 3M59A 3H08A 4O0IA 5BREA 2JTMA 1VOMA 1BI4A 4C1NK 3I7TA 3WNGA 3KLFA 4IOAL 2F9WA 2FG0A 4FJKA 5AR0A 3QEPA 3LP1A 4C4WC 3NDKA 1COMA 4F7UE 1OPKA 2O9SA 3KZBA 3I5RA 5C0YA 3I55T 3VS2A 2G9IA 3P1GA 3CXCS 5HL7L 5BPLA 3LZJA 4I4TB 3O4WA 1C0FA 4DR1K 3WPXA 1XMOK 2O4GA 1HYOA 1VSEA 2WSEE 1Q7YC 1SUQA 1QWEA 4LH4A 4AHRA 3TD3A 4P5NA 4LF4K 2JM8A 1ZBLA 3V8JA 3FZFA 3CCQA 1BCMA 1U8RA 3VUZA 3QICA 4FK0A 3CC7F 1LVKA 4B1WB 2OTLQ 4J83A 3NBPA 4IXCA 2KRSA 3R8EA 2G3RA 1GCPA 2A36A 3H45C 5JH7B 1X7OA 1YJ9A 5HY1A 4HA8A 1ILYA 2VB6A 4FYXB 5LJ5d 2QWLA 3SUNA 1IBMK 4MDXA 3DXKB 5LA6B 4AHUA 3MWPA 4M7DG 4OMMA 3A5NC 1EIFA 3ZX0A 1SL1A 1VQ5N 3I3FA 5JH7A 1M5Q1 3HAXD 5GAHP 3EG0A 3VGMA 3GG4A 4JK8A 3VQ9A 4HVVA 3C6TA 1U47A 1T6CA 2OTLN 3KJKA 1HK9A 1UA1A 1Q82H 1XC3A 1RAAB 2KFZA 3REAB 1JLQA 3DXKA 4OJRA 2OTJT 1D5AA 3M56A 1PXWA 1ZSZB 5LA6A 2M16A 3KK3A 2DMOA 1M9SA 4ISFA 1LOJA 2HBWA 5LL6S 4M8IA 4DFPA 4YOYA 1X25A 5DK5A 1QLYA 3U6FA 4DSLA 1HYSA 4M7AC 4CE9A 4E2FB 1NJZA 1IV3A 2DYBA 2ED1A 2QYZA 3VRYA 3KK7A 3NF6A 5JMVA 3RMBA 1ZSZA 3N4QA 1D9DA 2KNBB 2ROTA 1OULA 3K57A 3TQ7P 1SKRA 3AO1A 2CYZB 1D9FA 2X3WD 4BI3A 3EFOA 4M77E 4JN4A 5AQSA 4WCIA 3L3UA 5HRNA 3M0RA 4JKBA 3WVDB 3JATB 5FU6C 3IMXA 3EG2A 2NMUA 2FGYA 2DD4A 5DLQE 1WXTA 3OS2A 3ZOPA 3S3MA 1VQ9Q 4M7AE 3DWLA 4J9DA 4AT1B 2YHAA 3M4GA 3OA6A 4H0YB 4F7UA 4OPHA 4E47A 4R0KA 2FF6A 3BUZB 3LANA 4J2BA 4LF9K 1VQNF 5KGWA 4X20B 1SA0B 3JATA 2DF6A 4E0DA 5LJ5g 3VYUC 2KMTA 4YOVA 2JNGA 3JRZA 3WJPA 2Z1JA 1I1JA 4CFBA 4HHTA 2LSNA 1NGEA 3LAKA 3D6RA 4NB4A 5M1NA 4LUDA 2V7ZA 2EQKA 1NLPC 4RW4A 2E3HA 1IV2A 1VQ9N 4X20A 2DERA 1SA0A 1ZQ1A 2QWQA 2GTDA 2F4VK 2D0AA 2IGIA 3TREA 2OPQA 2DZCA 5J2PA 4LF5K 2ZODA 2QM1A 1CZ9A 4J9EA 2B4JA 1RI9A 2CHSA 2KG4A 1GBQA 4KTWA 2JWKA 5KYYB 3MN6A 2LP5A 2QA4F 2WSFE 4ISGA 4O2BB 8AT1B 2FSKA 4RG8A 2E20A 3CJ1A 2K3YA 3U0OA 1K8AC 4XU3A 1BG3A 5JLHA 4E6RA 4DBQA 5IYZA 2DXUA 4A4KA 2RQTA 2LBWA 2VXEA 3CCSF 2Q1XA 3CCVQ 5KYYA 1Q82O 5J39A 5BR8K 4CGGA 1X1PA 1TUDA 3EFSA 3TAEA 4O2BA 1VYVA 4CZMA 3E9OA 3TSPA 4NLBA 1V1CA 5AQZA 3SAGA 3L2VA 4F4KA 1Y0MA 3KHNA 2OANA 2Z0WA 3VV0A 3F2KA 3EHRA 4BQZA 3VYTC 4NS5A 2MOXA 3HTNA 3TAPA 1P92A 4HUEA 2EQMA 4ESRA 4YTLA 3ASKA 5J26A 1J5EK 1VSIA 2FPFA 4QW2A 1R77A 5SZTA 1LCUA 1QVGA 2D1KA 4LSLA 2QXFA 4PKHA 2V1RA 3CCVN 1IHVA 2D8JA 2QDYB 2R5AA 3QO3A 3SI6A 3VENA 3K59A 2FZCB 3O9TA 1O13A 3HFNA 1BIZA 4GVEA 3OY9A 3BE3A 1IH7A 5GAN6 1QTMA 2RPIA 1KHIA 2CP3A 2RM4A 2X4YA 5GANd 2RHJA 2E6LA 2NRHA 4CJ4A 1JLGA 2HP0B 2HSEB 2ZGZA 1PRMC 3JALB 2KZMA 2N48A 3QEWA 3NGZA 4JKEA 4KPYA 2CZ6B 2W10A 3QEIA 4F7UG 1W2BA 4YY3K 5GMKe 2G8FA 2DRKA 4FPAA 4O4LB 3S3OA 1VSFA 4X64K 3VTIA 2EYYA 3VQ7A 2ZGYA 2DL8A 3VF6A 2HQHA 1IO2A 3V9ZA 4J6WA 2P9PB 2HP0A 3CQTA 3VYSC 4YOUA 5A2QE 3OYCA 4PJOC 3I33A 5LJWA 2X51A 1Q86H 3C6AA 1UFFA 1XJWB 5C42A 3OONA 1HNVA 1RBUA 3N2KA 3VQ6A 2FC3A 1Z6RA 4QKUA 4O4LA 3AVBA 5FJ4C 4M75F 1SKWA 1VQNQ 2YXZA 3WEEB 2GF7A 4B1XB 5GADP 4AFUC 2P9PA 2WC9A 4F6RA 3ISNC 3OSVA 2XO7A 1LW0A 1JN1A 5LY3A 4EP4A 2BIVA 1ZSGA 1C0MA 4M3RA 3SWNC 1I94K 1YWOA 1P8ZA 3U8XA 4DEXA 3O6WA 1VQMF 4J2EA 2HS3A 3CD6T 5KE2A 4LH5A 3WEEA 3AA2A 2W42A 4Z4FA 2QEXA 3SAHA 4H03B 4BR4A 4CJUA 4KHQA 3UATA 1M3CA 3CC2A 4DQRA 4WFBL 3ZSOA 3CFRA 5A2QM 4FLZA 2ZPGB 1WAFA 3NH2A 3HK2A 2MQEA 2ZE2A 1EWRA 5DCVA 1MMNA 1RAEB 1NNEA 4AHTA 4CJRA 1UWBA 1QVFM 2EQIA 3I55Q 3QUWA 2EJFA 4PFZA 2A5XA 5GANg 3EYZA 2DXTA 3CCMA 2HS4A 4BGAA 2RQUA 1WHGA 3OYFA 3JAKB 3KWIA 2RJDA 3O80A 3CYQA 4B9NA 3CCLQ 4KRTA 2HL3A 1X43A 3G4SF 2YNHA 1YQNA 2HL5C 3CMEA 3C9SA 4M77G 4MO5A 1OU8A 2UYTA 4XTWA 5AQVA 2DBMA 3L4QA 3M54A 3I55N 1JL1A 5GONB 4PLIA 3PY8A 1KSPA 3DOLA 1WQ7A 4ZN3A 2KI7A 1BA1A 4FJ9A 1YJWQ 4OX9K 4ELYC 3MEEA 4DA4A 1SEMA 2VVKA 3LM9A 1BL3A 3HHTB 2QTVA 2BTTA 1X3NA 4K42A 5F0XA 3UA7A 2HF4A 3CCLN 3A8OB 3ELCA 4Z4IA 2Z1TA 3M58A 3K0SA 3MP1A 4N0AA 1XOVA 2FPEA 1NGIA 3QIOA 4YORA 4CECA 4HVWA 4O5VA 1DBFA 5EWRA 1KNJA 3QLHA 1S3XA 2GBQA 5CKDA 1NJWA 1Q86O 3OYYA 4DQIA 4C8GA 3ENBA 1LAVA 1MU2A 3GNGA 1YJWN 1X6BA 2GWJA 3M1FA 4EP5A 4CC4B 2CREA 1B7TA 3CFPA 3AVGA 1LNXA 5C25A 1VQ7T 3VETA 3L2WA 1T6DA 1R0CB 2LCCA 4J7FA 4M7XA 4CZLA 2ATCB 3Q8HA 1RBVA 3WJRA 5GINC 1QS4A 4NCBA 2YUPA 5AQJA 1VSLA 1T05A 4J8OA 2WOMA 3C4SA 4KFBA 3REBB 3JB9I 1HNXK 1FYNA 1BIBA 4X9CA 3SV3A 3CPFA 5J2MA 3VOVA 4C5IA 3C94A 4E7SA 2HF3A 1QVGS 2OPRA 2EPDA 4ELTA 2A28A 3SMSA 4KH0B 1EX4A 1JCGA 1E4GT 4CESA 3JCMb 2RKIA 3NTIA 1NK0A 3EG3A 3M0TA 3CC7A 3QBYA 1V29B 2E8AA 1IB8A 3HVRA 4C8OA 1KIKA 1X3MA 2LNHB 3IKMA 4HWIA 1W6XA 2EGAA 2PVGB 2QQRA 5JCOC 1NJIH 2OCEA 1TGOA 1D0XA 4FSSA 4CJ7A 2XY5A 5HP8A 4CJQA 4DXDA 1G3SA 3ZT2A 2X6NA 1VQMQ 1JU5C 4KGXB 4Y91A 1N8RU 1N34K 2O31A 1Q82C 4L3QA 2CZWA 4OGCA 1XNRK 1RI0A 2QKBA 4C82A 4J8FA 1LPLA 4RTXA 5M1QA 3QETA 4B9LA 1KJWA 2UXBK 3LPTA 3QZ5B 3DLMA 5HY6A 2W6KA 2HBMA 5ITZB 1GCQA 3S0YA 3L2QA 1BCOA 1M27C 3E19A 1NU0A 4IJNA 2X78A 3AV9A 2HSPA 4X3LA 4FZZA 3CCJF 4PKGA 2MYSA 1SKUB 3QZ9B 4IIOA 4PLLA 2HOEA 3BY5A 4CGJA 4DS4A 1S72F 2QTXA 3WPWA 5L23A 1YVNA 2EKOA 1U2VA 4BVPA 3BEXA 4CEQA 1XRGA 2ROLA 3CCQT 1ITGA 5AYFA 4PHTX 3SYZA 2UUAK 4WBNB 4ANJA 2GELA 4BRHA 1VQ4F 4CFAA 2K3XA 3FJPA 4BWJA 5B8HA 5GAN7 3JCMJ 1YJ9T 3OW2F 1UGVA 1TUCA 1NOZA 4DTSA 2VUBA 3NTKA 1K8AR 4ILJA 3SNNA 4UQGA 4LFBK 3TU4K 4OF1A 3O3FA 4WBNA 1JEGA 1RLQC 3TSZA 1K9MU 4JYAK 1VQ6Q 4FWSA 3N4ZA 1T3LA 1NK8A 1YUWA 2D0NA 1RUWA 5M1OA 3JXUA 1W7AA 4XCQA 1TVKB 1LWEA 2UYPA 5FPNA 5I11A 2COWA 2AA4A 3CC4Q 2Z1UA 1RADB 1VQKF 4U7BA 3NMUA 2RHLA 1RT5A 1CLIA 2UYJA 5GAOn 5KRSA 2XY7A 3B6NA 2F69A 4BDZA 2YJEA 5FW9A 1TV6A 2HVIA 2CGHA 4RTYA 2YCHA 1TVKA 1DTQA 2YX6A 3MN5A 1DKGD 2FF3B 2F2XA 4CBXA 1VQ6N 3HWUA 4DMNA 3O4QA 4O44A 4BY6B 5GANK 2I5JA 4FYYB 1WLPB 3A1PA 4CK2A 8ATCB 3V7EA 1RDWX 3ULDA 5MN5A 4RW8A 5E26A 3D7SB 3ZYYX 2A08A 4M78F 4FOIA 2I7PA 1JY8A 2JM9A 3JCMV 1NJIO 3SQ0A 3EE8A 3CC4N 1ZYQA 1FX7A 2VAWA 4YFUA 4M75E 1IBLK 1Q81U 4DSIA 3OYBA 2QA4A 5CY4A 2KGWA 1ZLMA 2ASMA 2QWOA 3SJJA 1NEBA 3HPGA 1HUXA 1YIJF 1G2BA 2AIRB 3DB3A 2R5MA 2Y1JA 1U43A 2H8EA 5BRHA 4B46A 4JUVA 1OVYA 3RESA 3VQDA 3WGJA 5B8FA 2B6AA 3CCSA 1WHKA 4B3MK 2D0QB 2XDPA 2JLEA 1RABB 4F9OA 3DLHA 4B6MA 4LD0A 1YNZA 2FVUA 1RLPC 3JB9F 3SHWA 1M1FA 4FOEA 3C0CA 5FU7B 3NF7A 3MK6A 1M1GA 4BRAA 1C1CA 4XAXB 1RDAA 1HJOA 4LDVA 2GNCA 5GAMh 1ZC6A 2F7TA 4DF4A 2FBXA 3EHQA 4NQ3A 5KMGB 4JDSA 3HJFA 4DHYA 1HNZK 3KTQA 1JJ2M 1LW2A 2YNFA 2E6MA 3PO4A 4G4VA 2HNDA 3GBTA 2Q97A 3ZBDA 1Y96B 4A53A 2QTDA 2X4WA 4CEAA 4B9UA 4J2AA 2WACA 3MJXA 4NUTA 4JAXA 5E84A 2JZ2A 1R0BG 2PUOB 2XDDA 4DR5K 3QHSA 5K14A 2NRZA 1BIUA 3MXIA 3VEYA 5KMGA 1QP3A 2M9UA 1VQ4Q 2VG5A 2CZ1B 1G5VA 3P38A 3AVMA 1DGKN 3FIFA 4OVAA 3G0ZA 4NCGA 1BHLA 3R9PA 1Y96A 5AZJB 4IEEA 4NL2A 2YRCA 1AWXA 3LYIA 1Q86C 3WNHA 1I07A 2XDBA 3OBYA 3HSCA 3UKUB 1YHQQ 1KFZA 1JXBA 1O1WA 3AVKA 1KXPA 4JKAA 4N41A 1LJOA 4Z4GA 1OZ2A 1IXDA 4M75B 4I9QA 3O85A 3CPWP 4ZHVA 5KH6A 2D8HA 3ZX2A 1RQ2A 3EAEA 1I39A 1QMCA 5D6XA 2MIOA 2L89A 3J7AF 5AZJA 3I56F 1NMDA 2J05A 3UKUA 1IV0A 1X69A 1W9HA 4CZEA 4TUYB 1JXOA 3BDUA 4M75A 1X2QA 3KLIA 2EW3A 1RDDA 1RTHA 5AQQA 2D0CA 3QERA 3X28B 3V7RA 2WFBA 2HHQA 3TPQA 2LJ1A 1YXQA 4ZI7B 2FRYA 1PRLC 4C8QF 3CMAQ 4FWKA 2DPPB 3VS6A 1F21A 1WJSA 1PHTA 1PG5B 4TUYA 1GLAG 1NM7A 2CGKA 1WHMA 2DNUA 4GLKA 3DAWA 2NNWA 3TAMA 3VJPA 4PKCC 2V52B 3CXCM 2FRWA 1WXBA 1QHTA 5I42A 2YHTA 4KH6A 3JCMX 3BFMA 3O1WA 1VQPT 3O9QA 3U9ZA 3FLGA 1KD1R 1EKEA 4ZI7A 4M77D 2YKNA 1VQ8Q 3HT3A 5DMRA 2QXLA 1X9JA 3Q7CA 2RQVA 4BR7A 2KROA 5EB0A 3FFIA 2G8UA 2LX9A 3SLCA 4DV6K 4DOWA 1N32K 2RN2A 4CF2A 3HP9A 3PVQA 4M7AD 3HKCB 2X35A 4ZTJA 1NMUB 3QNNA 4LDYA 3RKYA 1HSQA 3G4SA 5GAGP 3M55A 4CJLA 3WGNA 3VOAA 1VQ7N 3RMSA 4C0FA 4A5BA 4A54A 3LP2A 3DLBA 4B5CA 3PLAA 2YLBA 2JWLA 2PNIA 4M7DC 3SIVA 1SZ2A 3GTZA 2FHDA 2KY9A 2HSTA 1ZBHA 4FW1A 3HKCA 2I2LA 3VS4A 2QEXT 3FBAA 1KCFA 3A5ZB 2FZGB 1SQKA 4YDUA 1RFQA 2VC8A 1OU9A 3EN9A 1S1TA 3VQ4A 3CHWA 4JD2B 1YP5A 1TVRA 2P9UB 1YITF 2GX9A 3JB9J 3CQXA 1LWCA 4EIAA 4ZHQA 1XNIA 4C0ZA 4YNQA 5EYPB 1IGUA 3LWRC 5HK0A 2KZZA 3CCMT 4LF7K 2CP6A 3VU3C 4OPAA 1M1KU 3GDQA 3JCMg 4JNEA 2O8FB 2H8CA 4M3ZA 3EGDB 1W3EX 1BK2A 4KRFA 4J9IA 4KH1B 1Y64A 4JD2A 2P9UA 2H3EB 3SBTA 4A61A 2FZKB 2JW4A 1KFSA 3QSUA 1GLJO 3QDKA 2P9NB 4C92F 3CMET 2DY4A 5ECAA 3TVTA 5EYPA 3A98A 3A0IX 2PYJA 4B1VA 5AQKA 4CERA 4FJNA 5LJ3d 2O8FA 3PUFA 4M75G 2BE2A 4N56A 3EGDA 3V7CA 4CFDA 1GRIA 3CJ9A 1W2BF 4OMQA 3IUCA 3VQBA 1UHCA 3JCMe 3OB9A 2HKQB 2P9NA 3LWVC 1I8FA 1PKTA 5IHKA 3HRGA 1T0KB 3CCEQ 3G71Q 1TYQB 4BR0A 1NJIC 3E9PA 3D00A 2F2VA 2BH1A 3ZSVA 3AT1B 3EG1A 3ZX3A 4CJSA 3HVTA 2LBXA 3P0ZA 2E10A 2PZ1A 3M6GA 2FSNA 4O2AB 3WGKA 4H8KA 2K5IA 3TTCA 1YVUA 1F1BB 1YJ9N 4QVZA 2IG8A 4MQ3A 5MN4A 1TUGB 4M78E 1RBTA 4N5SA 3H0FA 1QD9A 3KIZA 3JV3A 4K11A 4Z8AA 1TYQA 2K79A 3O1BA 4X62K 4DV3K 1S1VA 4ZNXA 3KXTA 1WA7A 2LCLA 2DYIA 3KUFA 2KVQG 1KVBA 5CA1B 4O2AA 5LXTA 2KK4A 4WFNL 5KRTA 5T7BA 4H0PA 5AQRA 2K2MA 3G71N 3CCEN 2OTLF 3F73A 4JI0K 2GCXA 2DEQA 3LP3A 1OAPA 1NE8A 3KHYA 5HP1A 4DBHA 4IFVA 1WI7A 3QWXX 1X27A 3F0DA 2GBZA 3ULRB 4XU1A 2K5LA 1UGRB 5GAMj 4ID1A 3NE6A 1TK5A 4W5NA 2AT1B 3CG6A 5CA1A 3CCJA 5FPEA 3LH5A 1S72A 2EQUA 2RHUA 1JJ2P 2KTUA 5LYJB 1VQLA 2BUPA 1KLMA 2AZSA 3ZCMA 2Q1NA 4WQ5A 1G3TA 4AMCA 3CC7T 3V4IA 5IAYA 1TOVA 2SEMA 3KIOA 3BYQA 4YHHK 2HBJA 2NRTA 5LJ3g 4CEOA 5AQXA 3TABA 1VUBA 3OW2A 1A0NB 4FT4A 1RT3A 1NGGA 5FRNA 2OPSA 2ZZDA 1VYUA 5LYJA 2RF0A 1WBBA 1NMNA 4DQSA 4C8LA 4A4HA 4DQ2A 1HNIA 5GAEP 4PJOD 5AQIA 2HHHK 3GF5A 3SK3A 2VXFA 3RDVA 2OPPA 3ENOA 2CHTA 3DLKA 1HLUA 3RR8A 3RSEB 5EIBC 3QIIA 5LJ5h 3RTVA 4O8UA 4CEDA 3VIUA 4O5FA 3DB4A 5JVHL 3TTDA 1PC0A 3ZSYA 4FLWA 2YWWA 1VQKA 5I21A 4OMOA 2VWBA 1YJNQ 3GBQA 4M78B 5DY9A 1G15A 1VQLF 1EO1A 3MO8A 1VQ9F 3QDRB 1SL0A 2E2NA 3RSEA 1N6QA 1W40A 2EWCA 1JLCA 2GTOA 5KTQA 1XV2A 2GTJA 2NUPB 1TK0A 3UT5B 1HX1A 1YI2Q 4PUOA 2J6FA 4QVCA 1H3HA 1BISA 4PL8A 3VN5A 1Y7XA 3HRTA 3TR8A 3KLHA 4J2DA 2ZM6K 4M78A 1BA0A 1D1AA 4K43A 4F3OA 4GV6A 2QWMA 4NWOB 3VGKA 2F1LA 3AVAA 2HBPA 4IG0A 3E9GA 1S9GA 2A42A 1S1WA 1AHJB 2NUPA 1S6QA 4CC7A 1YJNN 2OX7A 3UT5A 2DO3A 4HUFA 4OMNA 2XMFA 1Q18A 1MNDA 2P1JA 3OHRA 2UYKA 1YIJA 1Q8IA 5KQ8A 1Q86R 4N4IA 3CCUT 1KD1H 4OMLA 3KD1E 1YI2N 2NZTA 3NHGA 4FXDA 3CJ7A 3F70A 4OLBA 3OYAA 4M3TA 2JJ9A 2P0QA 2XD0A 3PX4A 4OKJA 1H48A 3KE1A 3VRZA 5M9OA 4PY5A 4HTLA 3D2FB 3EFRA 4EMHA 1N8RH 1SSHA 3VS3A 1VQOQ 1RT7A 2F2WA 4QT7A 1VQ5Q 4DV4K 1UHFA 4E7LA 5D6WA 4EAHD 4CD3A 4AHSA 2A40A 2JT4A 1Z05A 4CHOA 5GMKh 5D6YA 1TUBB 4KKOA 5KYNA 1HKBA 3CCVF 2ASOA 4BT5A 3LW5E 3WVEB 4HXJA 4Q0BA 5LMUK 4GW6A 3D2FA 2I6RA 1MV3A 2PVDB 1UFYA 4DV1K 1XBIA 2ZVZA 2QA4T 2YSQA 1C6VX 1JO8A 3TSQA 1QU9A 1VQPQ 4FPBA 4IHJB 2L5QA 4PJOF 2EGCA 4CI6A 2QWPA 3THVA 2A3LA 4EIKA 2FYKA 5LXTB 1TUBA 3M3ZA 1VQON 5IN1A 3E9FA 4FM0A 4BG9A 2E41A 4C5HA 2Z1IA 3FZKA 3PT9A 4XTVA 1KAXA 4K8XA 2VV5A 3HSTB 3PSIA 1FSZA 3CCST 1JLAA 4H5RA 2GLZA 4DKWA 3AVNA 5AQTA 3JCMW 1K8KB 1BI0A 4M77C 4O0JA 3LGFA 3AA3A 4QAGA 3RVCA 1OI1A 4IHJA 3IDHA 3ZP4A 1E7KA 1K9MH 1GXIE 4LN2A 4KREA 4TV9B 2YUNA 3P4IA 1VQPN 1KFDA 3O5ZA 4AG1C 4E7KA 2UXCK 4OB1B 4OP0A 1GLBG 3ATUA 1M1KR 1VSKA 2BTFA 2ZJQL 5CYMA 1BQMA 3IG1A 4XH4A 1WPYA 1K8KA 4DFMA 3CERA 1ODEA 3PGGA 3I56A 4CHYA 4C8QB 5LJVA 3CPWF 4MDAA 4TV9A 1AVZC 3JCMc 2G8IA 4XU0A 2Z1FA 3H1VX 4BE0A 3P83D 4K41A 5J3BA 1UA0A 3I9QA 2KHOA 1QWFA 3IEWA 3VTIC 2DTHA 5KCHA 4M78G 3L8BA 1U49A 1Y97A 1HR0K 3CG7A 1JLBA 3ZSQA 1RBRA 3JYTA 4OGEA 5GAOp 4WCEL 3SIUA 4C8QA 3HXMA 1RTJA 1KD1O 2DL3A 2HVHA 4FFBB 1IPAA 3RA5A 1XHXA 2YNIA 2QEXN 4DWIA 4L5GA 2RO0A 1N36K 3OW2S 3AVJA 1BU1A 2JOYA 1GOCA 2PAVA 3AA4A 4XTUA 5GANh 1NKBA 2LCAA 1NK5A 1Q81H 1U45A 1YGYA 4I50B 1UGPB 1N8RO 2BTQB 1L3SA 2HMAA 3X24B 4WTOB 4EMKB 5IT9E 3WQTA 4MLEA 4BE1A 3CEYA 5EY4A 4FFBA 1QVGM 2LQ8A 4JJCA 3BDPA 3HTRA 4BRKA 4B9MA 4FJ7A 4BC4A 5BRFA 1QKWA 3LMEA 4G4WA 3P8HA 2EYWA 4MMKA 3OYEA 4JS4A 3JSMA 4I50A 1WHLA 1H3ZA 3JAWB 4QQGA 4BDPA 4EMKA 3MP6A 5LJ5e 2NUBA 4TSXA 3CMEN 2NRWA 4CEBA 4BB7A 1GO1A 4BVSA 3I55F 2LTOA 1KQSP 2IVPA 2JGUA 3VF2A 3WQUA 1W1FA 1NJIR 3HPHA 4WFAL 3P31A 2NRRA 2QK0A 1W2BM 1XMQK 3QTYA 3AVHA 4DQQA 3J80E 2O8CB 3CCLF 4U39A 3H1QA 1FKPA 1NBEB 1B9FA 1TWBA 3CJBA 4DSKA 3JAWA 4JKHA 3OTOK 3S06A 1BI2A 3CCRQ 2CKKA 4FSXA 3QXEB 4CIFA 1KC8R 4PJMA 3WXLA 4E89A 1VSDA 1K9MO 1YITA 1U40A 1Z25A 5AQHA 4BT4A 1RAGB 3PMIA 1PSFA 1NM1A 1X75C 4C92B 1M3AA 3C65A 2UU9K 2E5KA 3QUIA 1UOCA 4CRIA 2O8CA 2ZCFB 3RNJA 4PL7A 3MKDA 4JRIA 1YJWF 2BUDA 2QAZA 4HCKA 1G8XA 1Q95G 4LDWA 4DSJA 4DFKA 1H8KA 1GLFO 1JLFA 3AVLA 3G10A 1DTTA 4JKGB 2YHXA 5FDLA 2GQVA 4C8NA 4AILC 3O3HA 3ATVA 4I55B 1XTDA 3G4ST 4AM7A 4ZHWA 2HHVA 2EX3A 3CCRN 4C92A 3F9KA 9ATCB 5A0GA 4II1A 4V2SA 3DYAA 1CLQA 5CZ1A 3RRHA 1ZBSA 3NK7A 3J80M 3MCQA 2AZVA 3JALA 1GLLO 1CZAN 4JKGA 2LQKA 4I55A 1TAQA 1KNKA 1TK8A 1NQ3A 4D8DA 4JJNK 1ZBJA 4WF2A 1NJXA 4C8QG 3T69A 2ZD1A 3HYFA 4B1YB 5LMNK 4E3SA 4B9VA 2BTOA 3D01A 1X6OA 5F2RA 1M90U 1Q81O 1WYXA 3SZ2A 2O8BB 4LCKA 3P8DA 4JI4K 3HKEB 4LNPA 4KH5A 2AMTA 3C0BA 2CP0A 1GX1A 2LT4A 4E7IA 2KDSA 4LD9K 1SDSA 1UTIA 5GMKl 4R40B 1X9SA 1EP4A 4JLIA 2VWFA 3QJYA 5BMVB 5KQDA 2KW4A 1SKSA 4Q5VA 5FU6B 1N5YA 2O8BA 1WJRA 3G6EQ 3VS7A 1S1NA 2O88A 1NWKA 2Z1HA 3HKEA 1VHXA 4E1NA 2OTLA 3V9UA 1X6GA 1T3VA 3WGMA 2UXDK 1RAIB 3QG1A 1RAFB 3WXJA 2MCNA 4KGZB 4BDYA 4DR4K 3K5NA 2QW9A 3R6MA 5GMKj 3MCPA 5BMVA 4KAZA 4Y1CA 4JLHA 3FRNA 5C15A 3LWLA 1IG8A 2NUZA 3OYLA 3U4LA 5CQYA 2HRUA 2G8WA 2VKNA 5KI6A 4M3YA 4CGIA 2E12A 4AHVA 2KEAA 4KULA 3G6EN 3GE1A 1K76A 3P8BB 4RUGA 2O2OA 4DLEA 3RMDA 4ILGB 3CCUQ 4RTWA 1YAGA 3MXMA 1GCQC 4RW9A 1X7PA 3TAQA 2LQNA 3OQ5A 4X3MA 2W0ZA 3KKRA 3KBGA 4HCCA 5CKHA 1AD5A 3NFCA 2D4WA 2FB7A 2ALEA 3DXMB 2LC4A 5FPDA 4FK2A 4IDHA 1BUPA 5EVZA 4KUDK 3G25A 3C9RA 3LWPC 2XI9A 2D9TA 2VCPA 1VSMA 4KV8A 4NXNK 4FK4A 3AVFA 3F0FA 4CHZA 4CZHA 3RA6A 2F5KA 3TEEA 1NPRA 3CCUN 3DXMA 1DEJA 4DLGA 4PL6A 4DS5A 4K8ZA 5JS1A 2PFUA 2VAMA 3JAKA 2DVJA 1M1KH 5GANe 3CCJT 4F17A 4HCBA 4MZMA 1VQ6F 1S72T 2O8EB 1P90A 2CH4A 1UE9A 1VQLT 2RNAA 1K9AA 2LT1A 1ZA2B 1ASWA 3VPZA 4NL3A 3MDQA 3ULEB 5AFUA 3LZIA 1HKCA 3V9SA 3N5BB 1VQ9A 2L2PA 2DIQA 2LRQA 4LF8K 3CB2A 5LOVB 1D4XA 4FLXA 3HKBB 4FWOA 1B34B 4MMLA 2K6DA 4CZIA 1TH7A 1T03A 3PAFA 4DBFA 4Z0UA 1N6AA 2K5FA 4AH9A 4NXMK 3HOTA 1UI9A 5GONA 3C6UA 3CC4F 3A8GB 3CF5L 3NMUC 4LXCA 2H3GX 4DU4A 2HNZA 3QEVA 2O8EA 2OTJQ 2ZJRL 4J5YA 4DOVA 3ULEA 2EJ9A 4LE9A 1KD1C 3M0PA 2YKMA 2ASPA 3K5OA 4UY8O 5LOVA 2SRCA 4O5BA 3HKBA 2V26A 1B34A 1MUZA 3ALYA 5AQMA 1ZX6A 5LL6Z 4HUGA 1KVAA 1S1UA 2P51A 3MDOA 3K58A 1HYZA 2L3SA 3M4YA 1N8RC 1MMAA 2BANA 2V8KA 5IHNA 2FBVA 1VQKT 4FLVA 4B62A 5CA0B 1NYFA 3DLLL 1QVGP 3MEUA 1NK9A 1T0AA 4TV8B 5MN6A 3SPZA 1SPKA 3OS1A 4JZ3A 4IBNA 5AQLA 2OTJN 1WXUA 4C5GA 3FD5A 2P9KB 5HBMA 2CW4A 4RTUA 3MX2A 5AQOA 4M7DD 3FGUA 2IIMA 3JS6A 4GMJB 2M02A 1XNQK 1QCOA 3CI5A 3HP6A 3QIPA 3TTFA 2P4RA 4PJOB 3VQAA 3OYMA 4B08A 3TARA 4TV8A 3P4EA 2X4JA 4FCYA 4IZ9A 5CA0A 1I5LA 3CCVA 1V76A 3X25B 1NG2A 1HJDA 2P9KA 3EKSA 3KK1A 3I8BA 1EWQA 2XHBA 1W2BP 3MECA 3T80A 2LX7A 4EI7A 3RBBB 1YTUA 4FM1A 1X01A 1Z5WA 5EAZA 3EORA 1R0AA 1RLGA 4PJOA 1YIJT 1QW1A 5KYWB 1UEBA 2MI6A 2EYZA 4KGVB 1L5UA 1KC8H 2AKLA 3SWNB 5AQUA 1K9MC 2EFIA 1JLEA 2JXBA 4OKKA 1UUEA 3TD5A 3ZSXA 2W6LA 3K5MA 2DVEA 4QQ6A 4J9HA 1T44A 5AQWA 3NGPA 4NOYA 1M1KO 3NK6A 1SRLA 5D3GA 5FU7C 2LCSA 1DLOA 5KYWA 1CKBA 5BR9A 2EJGA 2UYNB 5M1FA 2ZAEA 4BR9A 2E6NA 2QQBA 5HKCA 1D8YA 3SWNA 1NJYA 3VMFB 4DV2K 5ITZA 2BE7D 3DI6A 3H9NA 1QVPA 1SS6A 4U67L 1NG9A 3JSCA 4I4TA 4JKDA 2M0YA 3I35A 3TWHA 4DFJA 4V19S 3OYJA 2FBTA 3R1XA 3UE5A 1K0SA 1YHQF 1TTHB 2RI3A 3CPWA 1A5VA 3CBPA 4EZ9A 1NGBA 5BRDA 4EB6B 5IXBA 3RUXA 4EPCA 4DCHA 3THYB 1S9EA 3MEDA 4PWDA 4BY9C 2ZVYA 3F0EA 3OS5A 2NLUA 4JEPA 5BPNA 1K73U 3K9KA 3LYBA 4G4XA 5FNVB 1Q81C 4H0XB 1LWFA 3LPUA 5GAOq 2JS0A 1X2KA 1YBYA 3SCXA 1T7PA 4BI4A 2L0AA 3IMPA 4EB6A 2V51B 1VQNA 4QQDA 4F6RB 4PFPA 2B33A 4M75C 4EHTA 2OAUA 3THYA 4F2SA 4CK3A 2CP5A 4CBUA 4Z94A 2PUKB 2O8DB 1Q82U 4M7DF 5FNVA 5C6SA 4QS7A 5E41A 3WXKA 1W5EA 1MWKA 4AFQC 1H1VA 3CQ8A 3F6MA 3HKDB 3CMAF 4ME7A 4B3OA 5I2MA 1HQUA 5GIOA 4B3RK 4W5TA 3PNWC 1NGDA 3MEVA 4JI7K 2HHTA 2MK5A 2M1HA 3CIPA 2CWJA 1VQ7F 4OMPA 4MZPA 2O8DA 2XY8A 4JKCA 3VS0A 3DLRA 4JK9A 5I9EB 4FVUA 3HKDA 3QWYA 3K12A 1AWJA 5HXZA 4JI3K 1EZZB 4TVRA 1VH8A 1VK3A 1UECA 1VQ8F 1ZUKA 2DM1A 3I55A 2R7YA 2J7IA 4IUUA 2CZ7B 5FRMA 2DK3A 4KI6A 3R6NA 1KC8O 4JI8K 3QFUA 4BT2A 2E1HA 1T3SA 2CGJA 3LDOA 3NCIA 1QVFP 3ZT0A 3SQ4A 3PX0A 2XICA 4Z4HA 2PY5A 2GUPA 3CCLA 2RF2A 1KQSF 2IVNA 5HRPA 1WHJA 1M4ZA 3NVKA 3KVGA 5EIBD 4L59A 3KJVA 4Z89A 3JCMh 2AIFA 2D1XA 3FZHA 2HRYA 3PLAC 2PU9B 1KVCA 2UUCK 4X1VA 3E1YA 3CBMA 5CZ2A 1OZ3A 3OJUA 1YJWA 3HI0A 3CD6Q 5J2UB 2DXBA 4YDUC 2GFUA 4U3JB 4JS5A 1MNEA 1S5JA 4LNUB 1NGFA 4RMOA 2G8HA 4YOTA 3V9XA 2DXCA 4BRNA 1XQHA 4H5TA 2ED0A 1RT4A 1U6ZA 4I6MB 1E3MA 1YTAA 3SDZA 2E1ZA 3NTHA 2LJ3A 2OI3A 4DTUA 3V8LA 2XKOC 3FD6A 2EYQA 5J2UA 2LJ0A 4BRGA 4U3JA 3FFMA 2MWPA 4LNUA 1OQKA 3T1AA 1K0XA 2AHJB 3CD6N 2AJQA 1H47A 4DQ8A 1QZ6A 1UGSB 4IO8A 1RT6A 3GL1A 4FU6A 2FLOA 4I6MA 1IKVA 3U9DA 3V1OA 3DLGA 1MDUB 4KHNA 3I0RA 5EZYB 1YITT 3JCMM 1VQVA 2VYPA 4BRPA 4GV3A 1YJ9F 1FNJA 2DFHA 5I2SA 1PD0A 5IWAK 2D0BA 5IH2A 1RBSA 1FW6A 4C23A 4R5PA 1ONIA 1IKXA 3V8KA 2CP2A 5HY2A 4RKUE 2KT1A 3O8VA 5C24A 3O08A 5HROA 2CSLA 3CCEF 5HRRA 5C2DA 3G71F 2FL7A 4CC3A 1R8OB 2Q2RA 5EZYA 1QZ5A 2CT3A 2NUTB 3NMZC 2DPNA 5JVGL 3C6HA 4BWMA 2WONA 4JI5K 2W8BC 4CF1A 4DTMA 5GAN4 3LDPA 2CH4W 2HEQA 4C0GA 2DFEA 1BBZA 1D0YA 5HK3A 2RH2A 4LD6A 3LWIA 3L6QA 2NYSA 4J9FA 3VQ8A 2DX1A 4JI2K 2KKZA 1VQMA 2NUTA 3J8AA 3THKA 1S72N 4CCHA 3VESA 2IS3A 5IXFA 5LJ3h 3VYHB 2NRXA 2RMOA 3HTVA 2XU8A 4M42A 4CD1A 1W70A 4JPBW 4BUGA 2QG9B 2ZGWA 4A4EA 3OYGA 1VQ7Q 1BQNA 3QPHA 3CPWS 1VSHA 1PWTA 4H0TB 2AIZP 5AVMA 2DEUA 1J53A 1GLDG 2QQAA 4PNOA 2KTVA 1J6ZA 3HO1A 4FWMA 4OKEA 1VA7A 2BKDN 2F5TX 1JB0E 5F1XA 3FB9A 4DUZK 3M8RA 3AAQA 2QK9A 4MLHA 2QASA 4YOXA 2VQFK 2P5OA 4MZTA 3VI6A 4E6EA 4B3SK 1N8RR 3C7NB 1QQJA 4CJEA 3RKXA 1ZUYA 3FLCO 4BQLA 4F7UF 5HY4A 4Y28E 3KK2A 3SEMA 1M1KC 2OTLT 1WAJA 2RJCA 4WQ5C 2BDPA 4HNAB 5AZIB 3VOBA 1WX6A 4BG8A 3VERA 3D54A 3GYQA 3HRUA 3LM2A 4RCHA 4BT3A 2B5JA 5GAMd 3ZT1A 4IOCL 2GWKA 1TL1A 3C7NA 3M8QA 4CHPA 1ATNA 3AY9A 1HMVA 4G9ZA 3OMCA 1VQ6A 4A57A 3ZSWA 4HNAA 3D45A 3KFVA 1TG0A 1O9SA 1U5SA 5AZIA 5GAMf 1NEGA 3CC2T 3IRXA 4XH1A 4IOXA 1D1BA 4ELVA 1RT2A 4KHPK 2PHNA 2PVOB 3QYGB 3AHUA 2E2PA 2PQWA 4CEFA 4E19A 4J6YA 1WSJA 4J9GA 3CC4A 1G99A 2HBKA 3VUBA 3LWHA 5CVIA 4CHQA 4B1UB 5KGXA 3NF8A 4WF9L 4DTOA 1YJNF 1VQ5F 4FM4B 4M63C 4LDXA 4HCZA 2DTOA 3J81E 2P9SB 1K9MR 3S0WA 4N4GA 4XTYA 2IQQA 3CCQQ 4R56A 2I0NA 3I0SA 4ELZC 4CZKA 4FJMA 4FSVA 2KGTA 3EH2A 3OYDA 3K9JA 3M0UA 4FJIA 2A0FB 4DR7K 2L26A 1YI2F 1M90H 2EQJA 3S41A 1B07A 5BN9A 1RACB 4JRQA 3CM6A 1YJ9Q 5AFUH 3HM8A 5CB4B 1RTDA 3IAYA 1KSWA 4M78C 2P9SA 2ZJPL 4BC5A 4LF6K 1WGSA 4X1YB 1N33K 3E22B 3HFOA 2AKKA 5GMKi 2ZQBA 3L7QA 1WN7A 5IT9O 1JKHA 4IIJB 1S1XA 1ATRA 2ITGA 4F3TA 3H6ZA 3CCQN 4C8EA 3W3DA 2VG6A 5FLXE 1WUAA 5M1KA 4CJ5A 3OW2M 4FWRA 1CXUA 5CB4A 2RJEA 2A3ZA 2IPOB 4M77F 2CUBA 4B9XA 5DLOA 4X1YA 2IG0A 3E22A 4ZOLB 2E6ZA 2A7YA 3VQCA 1JD1A 4IIJA 1M2VB 3G7ZA 3INZA 1KC8C 1QKXA 1Q81R 1QHAA 4IFYA 5AQFA 1VQOF 4BR2A 1ZBFA 4M7AF 2F96A 1RAHB 2GGRA 2RE2A 4ZGDB 2HCKA 3HOSA 2Q36A 3MCAB 2R58A 1J7HA 2QTPA 4IUQA 3H46O 1A5WA 2LQWA 5CK9A 1S22A 2JMAA 5C10A 3IEQA 2DFUA 4FJJA 5GAN2 4ZOLA 1I5OB 3J80O 1SV5A 2C06A 4JKFA 1M2VA 1C0UA 1WSGA 3U3GA 4AFSC 3THWB 2YUQA 1V4TA 4EMGA 1ATSA 5CR4A 4C5EA 2IVOA 1VQPF 1C1AA 1Q9XA 2Q3SA 1RTIA 1IO6A 2IIRA 3MEWA 3CYMA 1PNJA 3EY1A 2HP3A 4ATOA 5FLXM 2CP7A 4XK8E 3UB5A 4FJXA 1E6HA 1C1BA 4OO1J 4BT7A 1MMDA 1JBMA 5JQGB 3LH0A 5GAN5 1J5OA 1EQYA 3THWA 4A59A 1VQ4A 4W5RA 4B45A 3CCVT 4ORZA 3SQ2A 3SUPA 4RW6A 2DL5A 1NBWA 2HHWA 4FL6A 1UGQB 4PK4A 3DLLA 1YHQA 4O8KA 3L1AA 3OYKA 2Y1IA 1FJGK 3TD4A 4WQ4A 5HOOA 2YI1A 1L3TA 4I2PA 3IKEA 1GFDA 1VYTA 3W0LA 1QCFA 1JL2A 5KYUB 1RGIA 2KSSA 1QQOA 1XC9A 4BE2A 2KXDA 1M90O 3L2RA 1ASUA 2QEXF 4AF1A 1T0JA 3M8SA 4KH4A 1ZSZC 3KWGA 1VIFA 1PF5A 5LJ3e 1LAWA 2OHWA 4EI8A 2K7AA 1GZ0A 2ABLA 3HRSA 1MWMA 2XRIA 2P4TA 3L3VA 3A8YA 3PX6A 4PJJA 2QGGA 1QQNA 4Y92A 5KYUA 3B8AX 5ELZA 2Z01A 2V8IA 4OLAA 4FJLA 1I81A 2JTFA 4JZ4A 3CMAA 2E2OA 3OJSA 3NF9A 2YYEA 4M3WA 1FMWA 2VASA 4C8QC 1HPMA 5HWEA 1HXDA 3EZWA 3VYGA 1H92A 4DG1A 3T1YK 3PE0A 2MMPA 4ZHRA 5EO3A 3CMEF 1CZBA 2ZPFB 1I3AA 4DTPA 4PA1A 4GV9A 2Q31A 1AWOA 1VQ8A 3QEXA 4PQUA 1W42A 3CXCP 4DUYK 2CSIA 5KE3A 2F9TA 2W41A 4X9DA 4OPJA 3ZLJA 1W5AA 4C8QE 1BWFO 1VQNT 2E65A 1WZOA 2BZ8A 2P84A 3HBTA 1XI1A 4CJKA 2ENMA 4GY5A 1KQSA 1BDGA 2YT6A 2EWNA 3IQLA 4RW7A 1X52A 1HQEA 3VQEA 5HY0A 1NGHA 1QVFF 2YLCA 4MDBA 1W57A 4DEYA 2JN0A 3AVIA 2P0PA 2HQSC 1FNKA 3FJ5A 1ARKA 3P5JA 3CCRF 4CF8A 1BIAA 3TAGA 3GOXA 3F0GA 1FMKA 1U48A 4M3UA 2OAWA 3UF4A 1OPLA 1SRMA 4FVMA 1UB4A 1G83A 1REVA 3BZCA 3BDLA 5TKWA 3NGIA 1A5XA 2ZPEB 5CKBA 2AK5A 1C6VA 2BGGA 1RILA 3ZEHA 2ZAUA 1K4US 2X6SA 4B9SA 4XTZA 2KQ2A 3CCLT 3LWQC 5GJVB 5KPTA 3H0HA 1W0HA 5MLCQ 4G4ZA 4FZYA 1MMGA 4BROA 5D7UA 2FEIA 4TZZA 2H6LA 2DFFA 5LP6B 1GL5A 3OSSC 3N4PA 4C92C 4ICLA 4JRKA 2YHBA 1HNWK 1K1ZA 2QGFB 5EU7A 5H1SQ 1XHOA 1WIEA 5DM7L 2KAFA 3LGLA 4ISEA 1K73H 1BO5O 2DBKA 1YJWT 4KHYA 3A5MC 3O4NA 4CEEA 1G3WA 4DV0K 5J2QA 3A8MB 3VEWA 3VA3A 1ZHIA 4NYFA 5GIPA 4BRFA 4G4YA 3A5OC 2OA8A 2QEXQ 1FFXB 5LP6A 5A0LA 2JMCA 2EWSA 3CCEA 3G71A 4EFHA 4CVNE 4FLYA 3SPYA 2VXYA 2DAQA 2KTQA 3CC2Q 5LJ5f 3C8LA 1Q7YU 3LP0A 1KAZA 1RDBA 1BGXT 4ZN1A 3LAMA 4E1MA 1YN8A 4C92E 3V9WA 2EAYA 3H8ZA 1RLUA 4DF8A 3H6EA 3RYCB 2RHOA 3THXB 3V6DA 2HX0A 1UJ0A 4BRCA 3QNOA 1KLNA 3JAME 3CCMQ 2C0IA 4QS9A 2KYMA 3OW2P 1FFXA 3ON1A 3EFOB 4W5OA 2OTMA 4FM2A 4IUVA 2A1SA 5HXUA 4OB3B 2YHYA 3G6EF 3C95A 3T7ZA 2HDAA 2HHSA 1KTQA 2RHIA 5J2TA 4X34A 2O4XB 3CMEQ 3THXA 3CC2N 3N2GB 3RYCA 2LMJA 4F16A 5KCOA 4FLTA 2CDTA 1KQ1A 2XG8D 4F7UB 4GNIA 4C1NI 3P10A 3O9SA 3JASB 3LWOC 4C0DB 4DR3K 2YRVA 3CCMN 1NLOC 3JB9G 1TAUA 3UT1A 4BW0B 4NLCA 2E5LK 3MQWA 3CYPB 2O4XA 3N2GA 4O4HB 1KQ2A 4B8AB 3VEXA 1B92A 4DSEA 3A5LC 5KX5B 2KT8A 4A4GA 4A5AA 2A41A 4O6JA 2IC3A 1FK9A 3FR0A 3JAMM 3CCUF 3JASA 2CUDA 3DRSA 2KE9A 4H0OA 1NOYA 3UA6A 5DM6L 5AQPA 1SHGA 5IJ9B 4JJDA 3OYHA 5M1PA 4B9QA 4DTXA 2A6AA 1AZGB 1GFCA 1QQCA 3RMQA 4O4HA 2WBNA 3PFSA 4ZGEB 1VQMT 3ID6A 3KKSA 3RE3A 2H8HA 4HVJA 5KX5A 4BY9D 1IZ6A 1NK4A 5IYZB 2KLAA 1U06A 4BRLA 4KHSA 3CBOA 5IT9M 5IJ9A 4IFEA 2F9ZC 3F5TA 2EGEA 2ZPBB 1KK7A 2JVVA 2NWMA 1AWWA 1U04A 2HNYA 1FXXA 1YCSB 1JRIA 3SAFA 4M75D 1K73O 4E7JA 4Z4CA 5IJ0B 2VG7A 1M90C 2FPDA 4CI0C 5LJ5j 1WSHA 5ADXA 1EFNA 1YJNA 1C0TA 5C2FA 3KJJA 3AVCA 3GPLA 4F8RA 2FO0A 3BF3A 4H5VA 3RWUA 4O4GA 2KXCA 6AT1B 2ITMA 2V9YA 2EVRA 1CN7A 1KQSS 3CC7Q 3C9UA 4CIGA 1YI2A 3VF4A 4N0AC 3E01A 4AHCA 3A8LB 5IJ0A 4RQOA 5FPMA 3M0SA 2HW3A 1VHAA 2OTJF 5L8RE 5FWBA 3V1QA 3S6WA 3SD4A 4M77B 1VQ6T 4Z4EA 3ZETB 1Z9QA 2P6YA 4D6WA 2QKKA 5AQGA 1SAZA 3TSWA 4HVUA 3R6OA 2V7YA 1G3YA 3VEOA 3ZSRA 4RWTA 1RDUA 3O5BA 5A0DA 2DL4A 4KTQA 4CGFA 4M7AB 2H3JA 2VYTA 1HPZA 2E4LA 2CH5A 1T8EA 3CC7N 3CC4T 2FBYA 1K8AU 3MP8A 5GMKm 3PIPA 1IHWA 4M77A 3DLEA 1NLVA 3QBWA 4CF9A 2Z1EA 3ZSZA 3VS1A 2RPNA 3QDFA 3ZETA 3VQ5A 3ZEUB 2ZPIB 3IS9A 1X9MA 1SZQA 3S02A 1OVQA 1YCYA 4BI8B 3WGLA 4Z88A 3CFOA 3MN9A 2PTKA 1VQOA 4R55A 3J7AR 1VQ5A 4CZGA 4M7AA 4YJ3B 3E9LA 5SWMA 3ITHA 1AOJA 2J6KA 4B8CA 4XIUA 3FC3A 1TU0B 3EG9B 4XTXA 3ZEUA 3AAPA 3LFOA 3N2KB 2VWJA 3H41A 5GANf 5GAN3 3J7AP 4G88A 3NH0A 3PTAA 2BO1A 4YJ3A 5KYXB 2WUSA 1VQPA 1U3LA 2P9LB 2JNBA 3UWNA 3QYHB 4CW7B 5I3UA 3K2XA 3EG9A 1O75A 4BRIA 1WFWA 3EZ5A 2GUIA 2RQRA 1HD3A 1GBRA 2RB9A 2BE9B 2IAJA 5KYXA 3AO2A 3D7EO 2GZLA 1JJ2F 3EO3A 2P9LA
chains in the Genus database with same CATH topology
1RL2A 2MF2A 3WUHA 2E5QA 2QWNA 4BVOA 4PJOE 5C0MA 5JLFA 5FROA 3CPQA 4C92G 3MX5A 2RK2A 2LNVA 1VQNN 2LDMA 4RTFD 2DKGA 2RJFA 3TCJA 1D3BB 2RB6A 2HVYD 3E66A 2E70A 1VQ4T 1Y71A 5G4VC 1M8VA 3HSBA 3FE1A 4XQ3A 1RA4A 2NRVA 2D6FA 4VUBA 1YHQT 3GIBA 2D0PA 3LDLA 1D3BA 4ZGJB 2GEMA 3EL2A 3D2EB 3Q1JA 2QA4N 3ENHA 3S3NA 2R57A 3OBWA 5GANj 5GIOC 4AM6A 4M7AG 3QKJA 2Q0UA 1FWZA 3FZMA 3J7ZO 3D2EA 3CCSN 4R79A 3CXCF 1WNLA 1NGCA 3M57A 2IVWA 4BY6C 3CMAT 2XHCA 3QFPA 3IFRA 3M5RA 1QVFA 3SMPA 1ZXOA 1VAZA 3HZ6A 3MMVA 2E1YA 3CPWM 1BOTO 3DKMA 4MDWA 3AGRA 3E20B 1DT9A 3L0QA 3CCRA 3URGA 3M9QA 5EXWA 4BRDA 1VQ8T 2RK1A 2K4YA 4KBMB 1H641 2M0OA 1KAYA 4XH5A 3LLRA 3V3TA 3CD6F 1MHNA 1NZ9A 1N27A 5KPRA 1OYXA 3M5AA 3JB9H 3PIOA 5CKEA 4NO7A 2K57A 5JICA 1K73C 3T9NA 2EIFA 5CHIA 1KD1U 3NVKE 3QMLA 2RHZA 2X4XA 2CH6A 3SJHA 2E2QA 4M78D 3BW1A 1PSEA 4A4FA 1YF5L 1SSFA 2I7NA 5CCAA 1U2VB 1W2BS 2ZPHB 1XUPO 1KG1A 1OKJA 3H3NO 4PKIA 3JCMQ 4BVQA 2RA2A 4BRMA 3JB9D 1VQMN 2Y90A 4KT0E 3G6EA 1GLCG 2Q0RA 4Q5WA 2HAXA 3VEZA 4M7YA 2W40A 1TUUA 3E1SA 2OZBA 3PMTA 3UDCA 4IUTA 3CCET 3G71T 3I56T 1U1TA 3NVMA 4IEIA 3LDNA 4GY2B 1BU6O 5GAN8 3CQYA 5AQYA 3G4SN 4LDUA 3CCUA 3SFMA 4IO9L 1NPPA 2Y4YA 3F9MA 3VEVA 4OB0B 4PJOG 3UPUA 4IJAA 1GLEG 4BR5A 3QB0A 2K2VA 5CR2A 2XIDA 3ER0A 2J4RA 4B1ZA 4BGBA 1C0GA 4HT8A 5GINA 3L4IA 4KUIA 3O9RA 4A62A 3LDQA 4RG2A 1GO0A 2P0KA 3BP8A 3OA9A 3VGLA 4IURA 4C8QD 3CPEA 1JCEA 2HD0A 3IR9A 1NGJA 1W41A 1MA9B 2OTJA 4EDUA 1QVFS 5EG2A 1H7MA 4IUPA 3MN7A 3CCQF 3RERA 1ZWZA 1TUYA 3WT0A 2B8AA 1Q7YH 3P39A 5ADXH 5TKYA 3A8HB 2E88A 4Z02A 4J6XA 3O9UA 4JLGA 1BYMA 3LX7A 3L2UA 1YJNT 4FL9A 5EOYA 3O8MA 4XU2A 2RI5A 1I4K1 2RHYA 4Y0WA 4YOWA 1YI2T 3LL3A 3MWTA 1LOTB 2XK0A 3QBXA 4MO4A 4EI9A 3RKWA 3CCJN 4ILHA 1VQLN 4B9WA 3SB2A 4JRPA 1VQ4N 4JHDB 1IREB 5BN8A 2L8DA 2QWRA 3SBGA 2YHWA 4BACA 1QQMA 4C92D 4QS8A 1YHQN 3GOIA 3X26B 1JJ2A 1VQOT 1W97L 1VQ5T 1V4SA 2DTIA 4E7HA 3UKRA 4JHDA 4BRQA 1Q86U 4H5WA 3CETA 3JCMd 3CJAA 4CZFA 2Y4XA 3FDRA 3OMGA 3WXMB 5GAOr 3GLXA 4IWVA 3PIPL 1N9RA 3R3LA 3VTHA 5GAPK 2VGNA 3META 5CO7A 3QJ6A 5DM7R 2CGLA 3BY7A 3VKIA 3JCMf 1VQKN 4WQ4C 4ZTFA 3RIRA 2KQWA 3MEAA 3CMAN 4EHUA 3N4YA 1Q7YO 4K25A 5AQNA 5CQXA 1IJJA 1W4SA 2DIGA 1XQSC 1DJ7B 4RCCA 1VQ8N 4N4HA 2PBDA 2RI2A 1YIJN 4XEIA 4HKEA 2P9IB 1ESVA 2V8JA 2FSJA 1K8AH 4H5NA 3TU5A 2DJZA 4CZJA 1JCFA 4H0VB 5EX5A 2I6DA 3TSUA 3CXCA 4FT2A 3ID8A 2P9IA 4OMFB 1ZBXA 1VQ9T 2CS7A 4M7DE 2QQ9A 1QVGF 4IKFA 4FWQA 5KPZA 3MHXA 5GAMg 1KHCA 3J81M 3Q7BA 2DZ9A 1WJQA 2L3RA 3BF1A 4FWPA 1HKGA 4BC3A 5C12A 2E64A 2HQEA 2RHXA 4J7IA 3HKSA 5CAIA 3OS0A 5BPMA 3X20B 3CD6A 2HNIA 5LJ3f 1WQWA 2D0OA 3FFKB 1W2BF 3L2ZA 4BVRA 1N9SA 4OB2B 5GAMe 2ZWHA 2O01E 4FO0A 3AARA 4BC2A 3WXIA 2QQSA 4A2AA 5G4UC 4BD3A 3GNFB 1BI1A 2GFAA 3CJCA 4FIBA 3DJCA 4E1JA 3CCRT 3I56N 2ZF5O 3FEOA 2AP1A 1BKBA 2MAMA 5CIUA 4JK7A 3FZLA 1QP2A 1U1SA 2LVMA 1CK2A 1BI3A 3HL8A 2WALA 1NJIU 1VIEA 3ZFJA 2RHKA 4L6V5 5GAOm 3JCMP 5GIPC 3EE9A 4M7DB 1WOQA 2HMPA 1KQSM 1MGQA 1K8AO 3M53A 5CKFA 3CC2F 2VGMA 3OYNA 5GAOl 3HPWA 4HT9A 3NVIB 1KC8U 3ME9A 3V7SA 3V7QA 1JJ2S 3CCMF 4RCBA 4M7DA 4KBOA 2CZ0B 3HJWC 4BVTA 4A2BA 1E4FT 2YJFA 3PIOL 1Y07A 4UC4A 2HQXA 3EKUA 1NGAA 1VQ7A 2FXUA 4DB3A 4FWNA 2DD5A 5LJ3j 3L42A 1R59O 3OYIA 3AGKA 3H3OB 4WYBA 2QI2A 3G6ET 3C12A 4FWLA 2JUFA 4BREA 4EMKC 4C0DC 4QVDA 2HBLA 2NLXA 1YITN 2WSCE 4CBWA 2MWOA 2RD1A 5CE3A 3GP8A 4LC9B 3M59A 5BREA 2JTMA 4C1NK 4IOAL 2F9WA 5AR0A 4C4WC 4F7UE 3KZBA 5C0YA 3I55T 3CXCS 5HL7L 5BPLA 3O4WA 1C0FA 2WSEE 1Q7YC 4P5NA 3V8JA 3FZFA 3CCQA 1U8RA 3VUZA 3QICA 3CC7F 4B1WB 4J83A 4IXCA 3R8EA 2G3RA 3H45C 1X7OA 1YJ9A 5HY1A 4HA8A 1ILYA 5LJ5d 2QWLA 4MDXA 3DXKB 3MWPA 4M7DG 3A5NC 1EIFA 3ZX0A 1VQ5N 3HAXD 1M5Q1 5GAHP 3VGMA 3GG4A 4JK8A 1T6CA 2OTLN 1HK9A 1Q82H 1XC3A 3DXKA 2OTJT 1PXWA 3M56A 2M16A 1M9SA 4ISFA 1LOJA 5LL6S 4YOYA 4M7AC 3KK7A 5JMVA 3N4QA 2CYZB 4BI3A 4JN4A 4M77E 5AQSA 4JKBA 3WVDB 5FU6C 3IMXA 2FGYA 2DD4A 5DLQE 3OS2A 3S3MA 4M7AE 3DWLA 3M4GA 3OA6A 4H0YB 4F7UA 4OPHA 4E47A 2FF6A 3BUZB 1VQNF 5LJ5g 2KMTA 4YOVA 2JNGA 3JRZA 4NB4A 1NGEA 5M1NA 3D6RA 2V7ZA 2EQKA 1VQ9N 1ZQ1A 2QWQA 2GTDA 3TREA 2DZCA 2QM1A 2KG4A 2JWKA 3MN6A 2QA4F 2WSFE 4ISGA 2FSKA 3CJ1A 4RG8A 2E20A 2K3YA 1K8AC 4XU3A 1BG3A 5JLHA 2DXUA 4A4KA 2LBWA 2VXEA 3CCSF 1Q82O 5J39A 3EFSA 4CZMA 3E9OA 3TSPA 4NLBA 5AQZA 3SAGA 3L2VA 2OANA 3VV0A 3F2KA 4BQZA 4NS5A 1P92A 2EQMA 4YTLA 3ASKA 5J26A 4QW2A 1LCUA 1QVGA 2D1KA 2QXFA 4PKHA 3CCVN 2QDYB 2R5AA 3QO3A 3VENA 3O9TA 1O13A 3HFNA 4GVEA 3OY9A 5GAN6 2RM4A 1KHIA 2X4YA 5GANd 2NRHA 2ZGZA 4JKEA 2CZ6B 4F7UG 1W2BA 5GMKe 4FPAA 3S3OA 3VTIA 2ZGYA 3VF6A 4J6WA 2P9PB 4YOUA 5A2QE 3OYCA 4PJOC 3I33A 5LJWA 1Q86H 3C6AA 2FC3A 1Z6RA 4M75F 3WEEB 2GF7A 4B1XB 5GADP 2P9PA 2WC9A 3OSVA 5LY3A 2BIVA 3SWNC 1P8ZA 3U8XA 3O6WA 1VQMF 3CD6T 5KE2A 3WEEA 2QEXA 3SAHA 4H03B 4BR4A 3CC2A 4WFBL 5A2QM 2ZPGB 5DCVA 1QVFM 2EJFA 2A5XA 5GANg 2DXTA 3CCMA 4BGAA 3OYFA 3KWIA 2RJDA 3O80A 3G4SF 3CMEA 4M77G 4MO5A 2UYTA 4XTWA 5AQVA 3L4QA 3M54A 3I55N 4PLIA 1WQ7A 4ZN3A 1BA1A 4ELYC 4DA4A 4K42A 3LM9A 5F0XA 3HHTB 1X3NA 2HF4A 3CCLN 3A8OB 3M58A 3MP1A 4N0AA 1XOVA 1NGIA 5EWRA 4YORA 4O5VA 1S3XA 5CKDA 1Q86O 3OYYA 3ENBA 3GNGA 1YJWN 2GWJA 3M1FA 1LNXA 1VQ7T 3VETA 3L2WA 1T6DA 2LCCA 4J7FA 4M7XA 4CZLA 5GINC 5AQJA 4J8OA 3C4SA 3JB9I 1BIBA 4X9CA 3CPFA 3VOVA 4C5IA 3C94A 2HF3A 1QVGS 3SMSA 1E4GT 1JCGA 3JCMb 3NTIA 3CC7A 1V29B 3QBYA 2E8AA 1X3MA 3IKMA 4HWIA 2PVGB 2QQRA 1NJIH 4CJ7A 1G3SA 4Y91A 1N8RU 2CZWA 1Q82C 4L3QA 4OGCA 1RI0A 4J8FA 5M1QA 3QZ5B 3DLMA 5HY6A 2HBMA 3L2QA 3E19A 4IJNA 4X3LA 3CCJF 4PKGA 3QZ9B 4PLLA 2HOEA 1S72F 2QTXA 1YVNA 2EKOA 1U2VA 4BVPA 3BEXA 1VQLF 3CCQT 4PHTX 5AYFA 1VQ4F 2GELA 4BRHA 2K3XA 3FJPA 5B8HA 5GAN7 3JCMJ 1YJ9T 3OW2F 2VUBA 3NTKA 4ILJA 3TU4K 4OF1A 1K9MU 3N4ZA 4FWSA 1YUWA 5M1OA 4XCQA 3JXUA 5FPNA 2AA4A 1VQKF 4U7BA 3NMUA 5GAOn 2F69A 4BDZA 2YJEA 2CGHA 2YCHA 2YX6A 3MN5A 1VQ6N 1DKGD 2FF3B 4CBXA 5GANK 4BY6B 3V7EA 1RDWX 5E26A 3ZYYX 4M78F 4FOIA 2I7PA 3JCMV 1NJIO 3EE8A 3CC4N 1FX7A 4M75E 1Q81U 3OYBA 2QA4A 2QWOA 2ASMA 1HUXA 1YIJF 3DB3A 2R5MA 5BRHA 4JUVA 1OVYA 3RESA 3CCSA 2D0QB 2XDPA 4F9OA 2FVUA 3JB9F 1M1FA 4FOEA 5FU7B 3MK6A 1M1GA 4BRAA 4XAXB 1HJOA 4LDVA 5GAMh 1ZC6A 2F7TA 4NQ3A 4JDSA 4DHYA 1JJ2M 3GBTA 2Q97A 3ZBDA 1Y96B 4A53A 2QTDA 2X4WA 4NUTA 2WACA 4JAXA 5E84A 2JZ2A 2PUOB 2XDDA 3QHSA 2NRZA 3VEYA 1QP3A 2M9UA 2CZ1B 1G5VA 3P38A 3R9PA 1DGKN 3FIFA 4OVAA 1Y96A 5AZJB 4IEEA 4NL2A 3LYIA 1Q86C 2XDBA 3OBYA 3HSCA 3UKUB 1KXPA 4JKAA 1LJOA 1OZ2A 4M75B 3O85A 5KH6A 3ZX2A 3EAEA 5D6XA 2L89A 3J7AF 5AZJA 3I56F 1NMDA 3UKUA 4CZEA 3BDUA 4M75A 5AQQA 3X28B 3V7RA 2WFBA 3TPQA 1YXQA 4FWKA 4C8QF 2DPPB 1WJSA 1GLAG 2CGKA 4GLKA 3DAWA 2NNWA 3VJPA 4PKCC 2V52B 3CXCM 2YHTA 4KH6A 3JCMX 3BFMA 3O1WA 1VQPT 3O9QA 3U9ZA 3FLGA 4M77D 2QXLA 1X9JA 3Q7CA 4BR7A 2LX9A 3SLCA 4DOWA 3HP9A 4M7AD 2X35A 4ZTJA 1NMUB 4LDYA 3RKYA 5GAGP 3G4SA 3M55A 1VQ7N 3RMSA 4C0FA 4A5BA 4A54A 3PLAA 2YLBA 2JWLA 4M7DC 3SIVA 1SZ2A 2FHDA 2KY9A 2HSTA 2I2LA 2QEXT 3A5ZB 1SQKA 4YDUA 1RFQA 2VC8A 3EN9A 3CHWA 4JD2B 2P9UB 1YITF 2GX9A 3JB9J 3CQXA 4EIAA 3LWRC 1XNIA 4C0ZA 5HK0A 3CCMT 3VU3C 4OPAA 1M1KU 3GDQA 3JCMg 4JNEA 1W3EX 4JD2A 1Y64A 2P9UA 3SBTA 4A61A 3QSUA 1GLJO 3QDKA 2P9NB 4C92F 3CMET 3A0IX 4B1VA 5AQKA 5LJ3d 4M75G 3V7CA 3CJ9A 3IUCA 3JCMe 3OB9A 2P9NA 3LWVC 1I8FA 3HRGA 1T0KB 1TYQB 4BR0A 1NJIC 3E9PA 3D00A 2BH1A 3ZX3A 2LBXA 2E10A 3M6GA 2FSNA 2K5IA 3TTCA 1YJ9N 4QVZA 4M78E 1TYQA 3O1BA 3KXTA 2LCLA 3KUFA 2KVQG 2KK4A 4WFNL 3G71N 3CCEN 4H0PA 5AQRA 2OTLF 2GCXA 2DEQA 1NE8A 3KHYA 4XU1A 2K5LA 1UGRB 5GAMj 3CG6A 3CCJA 5FPEA 1S72A 2EQUA 2RHUA 2KTUA 1VQLA 2BUPA 2Q1NA 4WQ5A 1G3TA 3CC7T 5IAYA 2HBJA 2NRTA 5LJ3g 5AQXA 1VUBA 3OW2A 4FT4A 1NGGA 5FRNA 2ZZDA 4A4HA 4DQ2A 5GAEP 4PJOD 5AQIA 3GF5A 3SK3A 2VXFA 3ENOA 1HLUA 3RSEB 3QIIA 5LJ5h 4O8UA 4O5FA 3DB4A 5JVHL 3TTDA 1VQKA 5I21A 2VWBA 4M78B 5DY9A 1EO1A 3MO8A 1VQ9F 3QDRB 1W40A 2E2NA 3RSEA 1HX1A 4QVCA 4PL8A 1Y7XA 3HRTA 4M78A 1BA0A 4GV6A 4K43A 2QWMA 3VGKA 2HBPA 3E9GA 2A42A 1AHJB 1YJNN 2DO3A 1Q18A 3OHRA 1YIJA 5KQ8A 4N4IA 3CCUT 1KD1H 1YI2N 2NZTA 3CJ7A 3F70A 3OYAA 2XD0A 2P0QA 5M9OA 4HTLA 3D2FB 3EFRA 4EMHA 1N8RH 4E7LA 4EAHD 5D6WA 4CD3A 2A40A 1Z05A 5GMKh 5D6YA 3CCVF 1HKBA 2ASOA 3LW5E 3WVEB 3D2FA 2PVDB 1XBIA 2QA4T 3TSQA 4FPBA 2L5QA 4PJOF 4CI6A 2QWPA 2A3LA 2FYKA 3M3ZA 1VQON 5IN1A 3E9FA 4BG9A 2E41A 4C5HA 3FZKA 3PT9A 4XTVA 1KAXA 2VV5A 3CCST 4H5RA 2GLZA 4DKWA 5AQTA 3JCMW 1K8KB 1BI0A 4M77C 3LGFA 3RVCA 1OI1A 3IDHA 1E7KA 1K9MH 1GXIE 3P4IA 1VQPN 4E7KA 4OB1B 4OP0A 1GLBG 3ATUA 2BTFA 2ZJQL 4XH4A 1WPYA 1K8KA 3CERA 3PGGA 3I56A 4C8QB 5LJVA 3CPWF 4MDAA 3JCMc 4XU0A 3H1VX 4BE0A 4K41A 5J3BA 2KHOA 2DTHA 5KCHA 4M78G 4OGEA 5GAOp 4WCEL 3SIUA 4C8QA 1KD1O 1IPAA 3RA5A 2QEXN 4L5GA 2RO0A 3OW2S 2PAVA 2JOYA 4XTUA 5GANh 1Q81H 1UGPB 1N8RO 3X24B 4EMKB 5IT9E 3WQTA 4MLEA 4BE1A 3CEYA 5EY4A 1QVGM 2LQ8A 4BRKA 4BC4A 5BRFA 3P8HA 4MMKA 4JS4A 3OYEA 1H3ZA 4QQGA 4EMKA 3MP6A 5LJ5e 3CMEN 4BVSA 2NRWA 3I55F 4BB7A