3MCAB

Structure of the dom34-hbs1 complex and implications for its role in no-go decay
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
372
structure length
341
Chain Sequence
IEKNSGWITMEPEDMWHLYNILQVGDQLKASTVRRILVENMDFDTKAAQLHIKRTTEYHPMGSYHTLDLELHRNFTLYNEWDAFALDRVDAACNPSAEIGAVVLDEGLANICLITDYMTILRQRIDQVIPRKRRGDSSAYQKGLDKFYDSVFQSINSEFDFDKLKVVILASPGFVARGLYDYIFSMAVKLDLKQIVKSKNKFVILHSSTGHIHSLNEILKDPAVESKLADTKYVQEIRVLNKFYDVMNEDDRKAWYGPNHVLKAFELGAIGELLISDSLFRSSDIATRKKWVSLVEGVKEINCPVYIFSSLHESGKQLDLLSGIAAILTYPVDEEDISEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor 1 alpha-like protein
publication title Structure of the Dom34-Hbs1 complex and implications for no-go decay
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Translation regulation/hydrolase
total genus 88
structure length 341
sequence length 372
ec nomenclature ec 3.1.-.-:
pdb deposition date 2010-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03463 eRF1_1 eRF1 domain 1
B PF03464 eRF1_2 eRF1 domain 2
B PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.870 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mcaB01
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3mcaB02
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3mcaB03
3CXCF 5GANK 1W42A 2QA4F 3MCAB 3J80M 1KQSF 5EWRA 1YJWF 2ALEA 3CC2F 1M90H 1RLGA 3V7EA 3SIVA 3E20B 3NK7A 1H7MA 3RA6A 1CN7A 3JAMM 3G6EF 1NMUB 3WXMB 2VGMA 3NK6A 1Q82H 5A2QM 1KD1H 4X3LA 3G4SF 1YJ9F 3CC7F 5GAPK 2CZWA 1KC8H 5EO3A 1VQMF 3OBWA 1K8AH 2LBWA 3CCLF 1YHQF 1YIJF 1JJ2F 3CC4F 1T0KB 3NVIB 3N4ZA 3VMFB 3CCJF 1W3EX 2JNBA 3CCQF 2OTLF 3VI6A 3IR9A 3PLAC 2OHWA 1W41A 3G71F 3N4YA 2QI2A 1VQPF 1X52A 3CPQA 1VQ5F 1NJIH 1X7PA 1S72F 1VQLF 5FLXM 3HAXD 1XBIA 3CPWF 5GINC 4BY9D 3CCVF 2OTJF 5DCVA 1M1KH 4AF1A 3CCUF 3J81M 3I55F 1IPAA 1W40A 1VQOF 2KTUA 3LFOA 3LWVC 2WALA 3LWOC 1Q81H 3LWPC 1YI2F 5IT9M 1PXWA 1YITF 5G4VC 3O85A 3GYQA 1Q86H 1GO1A 1DT9A 4C4WC 1W2BF 3FFMA 3PAFA 3CMEF 2OZBA 3HJWC 3V7QA 3CD6F 3NMUC 3OW2F 1E7KA 1RA4A 4X3MA 1VQ8F 2VGNA 2I6DA 3CCMF 3CCRF 1K9MH 3CCSF 1VQ6F 3LWRC 5G4UC 1GZ0A 3E1YA 3AGKA 1QVFF 5FJ4C 1ZWZA 3LWQC 3RA5A 3CG6A 2BO1A 3JCMM 2HSTA 1VQ9F 5GIPC 2KG4A 1VQ7F 2QEXF 1X7OA 4TZZA 3I56F 2KTVA 1CK2A 3SIUA 5GIOC 1QVGF 3OBYA 1VQKF 1N8RH 2FC3A 3CCEF 1SDSA 4LCKA 4NUTA 2AIFA 3ON1A 3J7AR 3CMAF 4BW0B 2HVYD 1VQNF 1K73H 2LBXA 1GO0A 1Q7YH 1YJNF 3NVKE 1VQ4F
chains in the Genus database with same CATH superfamily
4CESA 4M77F 4JDSA 2P0KA 3CCST 4DR5K 1N32K 4NLCA 2QQRA 5EWRA 3V7EA 4CHPA 4PQUA 5SZTA 1S6PA 4B1VA 4DSJA 2DA9A 5GANf 3S6WA 5GAN2 3BZCA 2X51A 2XDBA 3RMCA 2DZ9A 2LDMA 4DR3K 5BR9A 1K4US 1ASWA 4YTLA 3V9ZA 1M1GA 3LLRA 3CMAQ 1NLVA 4DHYA 3LP0A 1SS6A 4OPHA 3LYBA 1ARKA 4X1YB 2E20A 1WA7A 2E6NA 2K4YA 2KRNA 4DTJA 2CSLA 1IV3A 2XHBA 3AA4A 1VQ4Q 1SUQA 2MCNA 1RTDA 4R40B 3JB9G 4N76A 2BZXA 2R5AA 1P8ZA 4CF0A 1UEBA 1NK8A 3OYFA 3ZSWA 2NUTB 4GLKA 1JB0E 4C92E 3I56Q 2BE2A 3ZO8A 4DRXB 4EB6B 4I2PA 2O8FB 3WGJA 2AKKA 2LCAA 4F7UG 4B62A 1J6ZA 4ORZA 3ZX3A 3CCQN 1OFUA 2QWRA 2OI3A 2RNAA 1GLCG 4CZHA 4B1UB 4PL6A 5AQJA 4X34A 1ZBXA 1QKXA 2E41A 2P9IA 3VEXA 3DB4A 4L3QA 1NKCA 4NCAA 2O8CB 1K73R 2RO0A 5CK9A 3HO1A 1Y64A 4E7ZA 3DWLA 1YJNA 1YJWT 3G6EN 2QTXA 5DM6L 4X20B 5ITZB 1NNEA 5GANg 3DKMA 3DAWA 4DXDA 3BDUA 5HK0A 1I81A 1RLPC 2RHUA 3CYQA 1YJ9N 5BMVA 4F4KA 1KFZA 1NU0A 1RFQA 3U9DA 5KX5B 2HL5C 1FSZA 2CVLA 5IHIA 4CFAA 2UXCK 3OONA 1B3QA 1WX6A 1TOVA 2W6KA 4FO0A 2NWMA 4DMNA 1TG0A 2CH6A 4NO7A 4JZ3A 2VAMA 3PV8A 4BR0A 5HK3A 3ZLJA 5HWEA 1NZ9A 4WQ4C 4B3OA 2UUCK 4F6RA 1S1UA 1YITT 1SL0A 4M75G 2RHXA 1D3BB 2ZPEB 1VHXA 1ZSZC 2BTQB 3H1VX 1D0YA 1SG5A 3VQ4A 2YNFA 1QHAA 1YTUA 3V1OA 3PMIA 2NRXA 2B33A 2O8EA 3IRXA 4BC2A 3KD1E 1NGEA 2EJGA 2KVQG 4FOEA 3CCQA 3FD6A 2RM4A 1YHQQ 3P1GA 2DVEA 2MWOA 4ZK7A 1Q9XA 1S1NA 1IG9A 1QQNA 4RQOA 1N8RC 1JLGA 5LMNK 3S9HA 4FJKA 1E3MA 2EIFA 3OS0A 1UI9A 4ISGA 1ATNA 3RUXA 3A1PA 3CCRQ 3N4QA 4LF4K 4ME7A 3MAQA 3HKEB 1IKVA 2MYSA 4X1KA 2JTMA 1HNIA 3FE1A 3RYHB 4DFPA 4AHVA 1L3VA 4BT7A 1FFXB 4DA4A 3V81A 1SDSA 5GMKi 3E9FA 5GADP 3NH2A 4RTXA 5AT1B 3LX7A 3NMUA 4HA8A 2DILA 3AVGA 4KKOA 1VHAA 2CP6A 3OYMA 4I4TA 2HVYD 3MKDA 1DTTA 2KTQA 1YI2A 1VH8A 2XY5A 1M3CA 3WEEB 4CGIA 3VCZA 4MZTA 1S1VA 3EO3A 3RYIB 3M5AA 5AQZA 3OYBA 1D1CA 4KBMB 3VTIA 3ZSXA 1YJNF 4LY7A 3CMAN 1VYUA 3PSIA 3EE8A 3JAWB 5LJ3e 2EKHA 4A4GA 1IXDA 1UWBA 1S72F 3HZ6A 4C8QD 1NGJA 1CXQA 4W5NA 1BQNA 3L4IA 1NK7A 4GV9A 4RTZA 1VQ4N 3NTIA 3UA6A 4MLEA 2DPPB 5KYYB 5HLFA 5AQSA 1HKBA 3JYTA 1X9WA 2E70A 4M7DB 1X9SA 1HLUA 2L0AA 3I56N 3SUPA 5J39A 2C0OA 4M77C 3WUHA 1FW6A 4CJUA 3U3YA 1C1AA 2W42A 2X4WA 1NGGA 4UC4A 1BIBA 3CYMA 4CGJA 3THWA 4H4OA 5J1EA 3VA0A 2MI6A 1BISA 1ZSGA 2YUOA 4XTWA 4ANJA 5GMKj 1Q9YA 1JN1A 5LA6A 5J2PA 4C8QA 2D6FA 3T1YK 3TR8A 1TU0B 2YHBA 1VQ7A 3W3DA 2O8DA 3QG1A 4U3JB 3I35A 3V3TA 4KPYA 1YBYA 2YXYA 4MO5A 1QHTA 4B5CA 2XG8D 1XHXA 5HRSA 4PJOB 1EO1A 1KD1U 2Q1XA 4MLHA 5CB4B 3CCQF 2IVWA 3KHYA 1BCMA 3K5OA 3IR9A 4CJKA 1SV5A 3CCET 4RCBA 3VYUC 4CJWA 1RNHA 3FZLA 3G4ST 4BWJA 3Q7BA 4H4MA 4RTVA 2VWKA 1H47A 4H5WA 2ZF8A 2A37A 5KRSA 4HTUA 4DFJA 4J9GA 3SUNA 3CMAA 1UHCA 4Z4EA 3GNGA 1XBIA 1PKSA 4CK2A 5J2MA 3N2GA 3LP3A 4BREA 3BF1A 1Q8RA 3ZL7C 3IEQA 2FG0A 4HXJA 4I7FA 2I7NA 5L8RE 1VQ4A 1YI2F 1M3AA 4JPBW 3CI5A 1W1FA 1WHKA 1DT9A 3CCJQ 4CF1A 2DM1A 3B6NA 2G3RA 3OYYA 3B6OA 4FJ7A 5F1XA 4CJ4A 3C95A 5K14A 1LWEA 2RF2A 3OYAA 1YHQN 1WXTA 1YIJN 1RBSA 1G3TA 3WQTA 2RF0A 3EZWA 3C6AA 3ZT2A 3O4QA 4BRNA 3V7CA 4CW7B 2RHLA 2YCHA 4C8QE 1W581 1ZBJA 2LT1A 4RWTA 1VQMT 3M8SA 1GOBA 4I50A 3BDLA 5AJ3K 3G71N 3S02A 2EJFA 5LJWA 5AQFA 3CCRN 1NGIA 5M1KA 1NYFA 2MIOA 1U48A 1AVZC 3K57A 4KB0A 3M0UA 2EQKA 3H0IA 3UATA 4QVCA 1KXPA 3IMXA 4DQ8A 3QBYA 3FZMA 4I2QA 2W10A 1GXIE 5LY3A 1FNKA 3ZEUB 2BO1A 4C8QF 2HHUA 2CZ7B 4L5GA 2ETJA 5FNVB 1VQ7F 4IJAA 1IJJA 4X62K 1FX7A 4C0FA 2CYZB 1U6ZA 3FGUA 2QWQA 3H3NO 2CSIA 4CFDA 2Y90A 4OMQA 3AVBA 1PSFA 1D09B 2Y1IA 4TUYB 1WJRA 4DBHA 3E66A 4M7AD 2CREA 4O4JB 3ENOA 4CEQA 4EAHD 3CBPA 4F2SA 4IIJB 5HY1A 5LXTA 1U1TA 1KC8O 3JAKB 4BRKA 4LH5A 2O8BB 2BUPA 2CGJA 3LMEA 4LCKA 2HSPA 1I1JA 2EGAA 3OA6A 1UGRB 4UY8O 4BT3A 3CMAF 2XICA 3VKIA 2NRHA 4DR1K 1RBTA 2UYPA 4BVRA 2DTOA 2PVOB 3F73A 4LF9K 4J7FA 3TU5A 1ABOA 2G8KA 3QETA 1IKYA 3ID6A 2DTHA 3P4EA 3OYCA 4FSXA 2HHTA 4O8UA 1NJIO 1M90C 2CWJA 3C9TA 4ILHA 3NGZA 3WGKA 1NEGA 4DG1A 2ZAUA 5AQRA 2AIRB 3UT5A 3I9QA 4FLZA 4JYAK 3CCRA 3QEPA 4YJ3A 5J2QA 5GANh 3P5JA 3HKDA 4OJRA 2HHWA 2O9SA 3HTVA 5DK5A 1WSGA 1T3VA 5AQQA 2LP5A 5AQIA 2Q97A 2X74A 4FJ9A 5I3UA 4CEFA 4JZ4A 3OW2P 1QQOA 2A42A 4IWVA 1G99A 3R9PA 1WHGA 3GNFB 3WJQA 4J8FA 5KYWA 3FJ5A 4WE1A 1MNDA 3VQDA 3K14A 2L5QA 3PVLA 1OKJA 3M4YA 4O2AA 5IHNA 4F7UA 2XY6A 4O4LB 2HDAA 1LOTB 1K9MO 2E2NA 1PKTA 4DTRA 3VMFB 4EI7A 2O31A 5CKEA 3AVIA 1W3EX 3G6ET 1DTQA 4WYBA 1TTHB 4B1YB 4BVQA 3QHDA 2DXBA 2EX3A 4C8OA 1W41A 2PZSA 1JRIA 1RUWA 4HKEA 1YJ9T 4FVMA 2J05A 1IO2A 3T7ZA 3CCJN 2NMUA 4J5YA 3VQPA 4X1IB 3EYZA 2HKQB 4PHTX 1UDLA 3D2FB 1I5OB 1QZ5A 4CJFA 3K0SA 1ZBHA 4M7AE 4F04B 4BY9D 1MMGA 1J3TA 1U04A 1OI1A 2LCLA 2E2OA 1N36K 5GAN4 2QAZA 5GAN6 1QQCA 1K0SA 3ENBA 3LWVC 3VQBA 4O2BA 3ASMA 1PRMC 5BRFA 1QMCA 1F21A 4HVUA 1L3TA 3EN9A 3CCLQ 1U45A 4DSIA 3CC4Q 4RW8A 3K59A 4DV4K 4QAGA 2QA4A 4M7AF 3C65A 4AFZC 1BIUA 3PAFA 1M1KU 1WXUA 4M75A 4C5IA 1TK8A 4KHUA 4FZZA 3WNEA 2YV0X 3NMUC 1D9DA 2RHZA 5IT9E 3MEAA 2VGNA 5H1SQ 3D00A 3CCRF 4AMCA 4LF5K 4RG8A 4VUBA 2HW3A 2K5FA 2LZ6B 4R55A 1H3ZA 2F8SA 1MMAA 2BZ8A 3VTIC 4Q0BA 4DU3A 4F7UE 5AQUA 1GOCA 1J5EK 3CCUQ 3VQ6A 2XKOC 1VQ5N 3LPTA 2ATQA 5I2SA 5CQXA 3JB9F 2Z1IA 3RRHA 4I9QA 2P5GA 2GFUA 2J06A 1NGCA 1IKXA 4O0JA 3QLHA 1MV3A 2O4XB 4CGDA 1YWOA 2BTTA 3CCJA 4DQ2A 3O9QA 4NYFA 4FK0A 4XEIA 5AZIB 4JV5K 2RHHA 5B8FA 3VV0A 2YUQA 5L23A 2E6MA 3I8DA 5E41A 1D9FA 3KVGA 4BDYA 4F7UF 3QWYA 1XNIA 2F9ZC 3C4SA 3A0IX 1XNQK 1PRLC 4DOVA 2HCKA 1K8KB 4ZI7B 4JKEA 3O4WA 2ZJPL 1A5VA 5IN1A 4YJ2A 2D0AA 3P8HA 4C8QC 1XQHA 4KTZA 5KYUB 4KGVB 1KVAA 5MLCQ 1NJZA 3A5ZB 2HF3A 3HYFA 4B1WB 3RR7A 3CD6N 2K2MA 3VRZA 2EQJA 4FK2A 2AJQA 3A5NC 2BIVA 1TK0A 3CMET 1RTHA 3HKBB 3I56T 4ILJA 4PL8A 3SYZA 6AT1B 2FC0A 4MMLA 4XTYA 2K9GA 5HY6A 2XU8A 3HJWC 2KEAA 2QEXQ 4KI6A 5AZJA 5EIBC 3QKJA 4M78D 2DXCA 4B9LA 2QA4F 2JOYA 2L2PA 3MCAB 1E4GT 3CXCS 4M75F 1SF9A 1KTQA 3FC3A 4OPAA 3RTVA 1W2BP 4FPBA 2BTUA 1WJQA 3G10A 4DF8A 2CHTA 3E20B 3FD5A 3LWIA 2ED0A 4DSEA 2F7TA 1ZBLA 1VQ6A 4OMFB 4GVEA 2A7YA 1SSFA 4B9TA 3ALYA 5KMGB 2V7YA 4K41A 1NMUB 4EMKA 3BZKA 1T0AA 2IS3A 1K9AA 1QVFA 1EXQA 3QFPA 4DOWA 2HL3A 3VS2A 3NK6A 4CHZA 1UJYA 3THXB 1R8OB 4IEEA 4M78A 4F14A 4CFBA 1NK9A 1T6CA 3M53A 8AT1B 3JAME 3DRRA 3JXUA 3ZP4A 4W5OA 4JI7K 4FJMA 3DXMB 3ZT0A 4FM2A 1NJXA 4BE1A 2HQHA 4C92G 1ZXOA 3RERA 3ZSQA 1FJGK 5LJ3d 1WIEA 5CCAA 3CCJF 2P4TA 2QK0A 2XY8A 4PLLA 2CGLA 1B9DA 2Q0UA 3TAEA 2JNBA 2K1SA 5CA0B 1WOQA 1QVGA 3UT1A 5JLFA 3CCLN 4Y91A 2I5JA 3LW5E 3KLIA 3CC4N 4DQIA 1ACMB 1IRXA 4WCEL 3NGYA 3JASA 1UUEA 2YHTA 2PBDA 3MN6A 4E2FB 2K5IA 1YIJT 2DETA 1GOAA 3HVRA 3ATUA 2OPPA 2NZTA 1U06A 3ZYYX 3OYHA 3CBMA 3RYCB 3O5ZA 2E3IA 1Z6RA 2KTUA 1HNWK 3G71T 4I55B 4A4KA 1Q81H 2RPIA 3M6GA 3O3GA 3VQ7A 4IO9L 3IKEA 3P83D 1QE1A 3CCUN 1Q86H 4RW6A 3O3FA 1X9JA 1A5XA 1ZBIA 1WPYA 2ZPIB 3IG1A 3V7QA 2GVIA 2VG7A 2NUPA 4YOTA 3E01A 2JWKA 3DXKA 4FM0A 4U39A 3HPHA 1W2BM 3AVNA 4IDKA 2EJ9A 4FK4A 2CH4A 2AZSA 4OO1J 4EI8A 4CBXA 4M78E 5DY9A 1VQ6N 1YT3A 3PY8A 4N41A 3VQ8A 1VQ6F 3LWRC 4JLHA 1QS4A 4LFBK 1JLFA 2RMOA 1QVFF 2ZGWA 1Q81C 2B5JA 1GBQA 1GLEG 4AM6A 5EAZA 2W41A 3CCLA 2KYMA 4KBOA 4FW1A 3CC4A 4M78F 2MK5A 5FROA 4M4ZA 4FJIA 1YCYA 3M1XA 4O2BB 4CEBA 5IWAK 2KHOA 3JSMA 3K9KA 4LF7K 2HVIA 3FLCO 1RT2A 3P8BB 4XU0A 4O6JA 3L2QA 3LDSA 5MN4A 2ROLA 4QQ6A 4HWIA 2FGYA 2QQ9A 5KRTA 1QAHA 4DSKA 3TREA 3HSBA 1KLNA 4JRKA 4F9OA 4HCBA 4ELTA 1XWLA 3T80A 3WJPA 1DLOA 4C82A 4KH1B 3DB3A 1QVGF 2ESWA 4CC4B 3MECA 1ATSA 1VQOT 5GJVB 2C06A 1K8AO 5GAMe 5LP6A 3V4DA 2R6R1 3CCUA 1RT3A 2EHGA 3FZHA 5ITZA 5HRRA 3HWUA 1VSFA 2H3GX 1BK2A 1HR0K 1X75C 5J26A 4N0AA 2P51A 3NF9A 3BY7A 2HBPA 1ZBSA 3R6OA 4FZYA 1VQ9Q 4EMHA 1TSFA 3A8YA 3CB2A 4WBNA 1H641 2HX0A 2VKNA 5CY4A 2K2VA 2HBWA 1A5WA 1JXEA 2J4RA 3QDKA 4YOYA 1WSJA 1CLIA 2RI2A 1D3BA 2FYKA 1K73U 3HK2A 3QIPA 3EG9B 5GIPA 1VQNT 4XAXB 1M90O 2P1JA 3C7NB 1NBEB 2X3WD 1KNKA 3HT3A 4K8ZA 2ASMA 1SKWA 1NG2A 3A98A 3MP6A 1SQKA 3S3OA 2DTIA 2XDDA 4PKIA 4ID1A 2QXFA 1Q82H 2J6KA 4M75C 3L2WA 3SWNB 1NKBA 2LVMA 4RUGA 1UFYA 3JARB 3PT9A 2QEXA 3TD4A 4ZHRA 4FJ8A 1YF5L 1N33K 3OYGA 5MN5A 1WSFA 3CCLF 4ILGB 4O5FA 3N4ZA 1HSQA 3MEGA 1QCNA 2V8JA 3VOVA 3HTRA 1WLPB 4JLIA 5LJ5e 3QJ6A 2WSCE 2LQKA 4E47A 3VI6A 4Y28E 4CF8A 1SKSA 4BR5A 4FYXB 2R751 1NOYA 3K2PA 2V1RA 3RYFA 3VGLA 3O8VA 4FLTA 1PCXA 1X7PA 2Q36A 3WEEA 4M7DD 5IH2A 1LCKA 3NF6A 3M5RA 4HCKA 3TTFA 1ZUUA 1MGQA 1M4ZA 3X24B 3CCUF 1RT5A 4NXMK 2OPQA 2A3LA 2WALA 2FPEA 3ISNC 1W5BA 2K3XA 5LJ5f 1KAXA 3O85A 1VQ5T 1Y97A 5KGWA 2VWJA 5HP1A 1XC9A 1HYSA 5J2TB 1YJWA 1VQLT 1GBRA 1BI2A 4QS8A 4NXNK 4BRFA 1NWKA 4IURA 2DE0X 4XU2A 3V4IA 4C8QG 3D01A 3MEVA 1GLDG 1KAZA 4C23A 2KZZA 4J9HA 2OPRA 4ISFA 1VQPQ 1VQLN 3RRGA 4E3SA 3CCSF 2HP0B 3KHNA 1IGQA 5CO7A 4RCHA 4U3JA 4AM7A 1ILYA 4FLWA 1RDCA 1S6QA 4BRGA 5LJ3j 2DYYA 3F0GA 4YORA 1QQMA 3EAEA 1YFNA 2CS7A 2VCPA 5KPRA 3ZETA 2P9PA 3O9TA 9ATCB 3CD6T 4A2BA 4DR2K 5C6SA 3TAGA 3BGRA 3VETA 2WSFE 4JRIA 2A0FB 3KWGA 4FWSA 5CYQA 1C0TA 3QINA 5EVZA 2BGGA 1I0CA 1G3SA 2QEXF 3ZOPA 2EFIA 5IHKA 5HXUA 3QIIA 3IUCA 4EMKC 2H8CA 3TAQA 2KTVA 1H48A 1OV3A 3CJ7A 3M1FA 1VQ9N 1KIKA 5IYZB 4IUVA 1AEYA 3D2EB 4GV6A 1IBLK 2Z1EA 3S0YA 4M78C 3TSPA 3CC4F 4BE0A 4OMMA 2UYTA 4RW4A 1U3PA 2DFUA 1QP2A 3FR0A 2IAFA 3L2RA 2E64A 4NUTA 4DR4K 2YKNA 3ON1A 3VOBA 4CZKA 4KRFA 2V26A 5IXFA 1TKXA 4NQ3A 2XDPA 4M7DE 4DFKA 5LYJB 1Q7YH 4MQ3A 3FFKB 2FVUA 3RMBA 2GEMA 1YNZA 3N4PA 5HRNA 1NK0A 1T03A 1FK9A 3JCMX 3PIOA 1W42A 1HD3A 2HHHK 3CFOA 3U3GA 1WHLA 2HF4A 2IDOA 2LNHB 3T3FA 4FLYA 1YJWF 2LQWA 2EBPA 3MPUB 4H0TB 5FWCA 4M7DF 4XH5A 3TSQA 3VEVA 4Q5WA 5C8YB 5EZYB 4FM1A 4XU1A 5C12A 1RAIB 3MEUA 1R0AA 5HKCA 3H45C 1LOJA 1QLYA 2YUNA 3AHUA 4BROA 4BT5A 1VOMA 3PO5A 2RJFA 4MZMA 5I42A 4C92A 1H8KA 3V8KA 5A0DA 2EVRA 5JCOA 1KAYA 2WC9A 1GFDA 4E6RA 1BQMA 2F96A 5E84A 3DLHA 4G4WA 5KQ8A 5F0XA 2IQQA 5AQHA 1VQ9A 1OX8A 3A8MB 4CJ5A 4PL7A 3C9SA 5BN9A 5TKYA 4E7HA 3VO8A 3R1XA 2DZCA 2JLEA 2ZGZA 3PTAA 4KH5A 4BRDA 2HRYA 4LNUA 5EY4A 1NLPC 2WACA 3FRNA 5GONA 4OMPA 1RDAA 3DRPA 3VYSC 5AVMA 2KQ2A 1EX4A 1YN8A 3A5OC 5GAEP 3VJPA 2PZ1A 2HNIA 4JN4A 1YJNN 4FJLA 2QI2A 2NRTA 4Y0WA 3N2KB 5EYPB 4BB7A 5CR2A 4M7AG 1PNJA 2JGUA 2YNHA 3KKRA 4FW2A 3V1QA 4CEEA 3ULRB 4OVAA 4WTOB 3CCEA 1NEBA 1KLMA 2KKZA 3KIOA 3THVA 4Z89A 2HMIA 2DY4A 3I7TA 1HKCA 3AO1A 1HNZK 4V19S 3HAXD 4O44A 5I21A 2FXUA 1JKHA 3SZ2A 1W57A 5DCVA 4MDXA 2DAQA 3CC7Q 2X4JA 2Q1YA 1CZ9A 2KROA 4HCZA 2P9KA 1DJ7B 1VSMA 1IHVA 3DLLL 2DK3A 4FWPA 4RTWA 4CI6A 5IT9M 1E6GA 3PMTA 1VK3A 3M58A 3THYB 1KFSA 3CYPB 3GF5A 3H9NA 1ATRA 3FBAA 3VQCA 4CIGA 2QKBA 2DD4A 5HCKA 3J7AF 2K3YA 1MWKA 2P9LB 5LP6C 4BT6A 3S06A 3WGNA 1X6BA 3QZ9B 2L3SA 1JEGA 5IJ0B 4X3MA 4IEIA 2ZPGB 2FBXA 4AQYK 3X28B 1KQ2A 4N0AC 2EAYA 3AVCA 4O8KA 5HBMA 3OW2S 4CD1A 1S72Q 1U2VA 2HD0A 4FLUA 3PO4A 4O4IA 2KRSA 3L2VA 2P9UA 5J2UB 3WGMA 3J7YP 3CCVQ 4JUVA 4KGXB 3OVNA 4C92F 4OKKA 1SA0A 3WT0A 3HHTB 1NKEA 3QESA 1SHFA 4IIOA 4FJJA 1VQ9F 5KE2A 1JFFB 1GFCA 5GIPC 1Y96A 4FWRA 5KYXA 4TV8B 4PJJA 3TARA 4H5TA 1J53A 1NE8A 1NPRA 4LD9K 4MFBA 1IHWA 4FCYA 4DQQA 2GTJA 1VQPA 1YI2N 1CK2A 3KJKA 1KD1O 4A57A 3F0FA 2CT4A 2RK2A 1RDUA 1W0HA 3ITHA 3KLHA 1N8RH 4CJEA 1EKEA 3URGA 3CCEF 4E1JA 4KHNA 3V8LA 1VRTA 2FZCB 3QUIA 1I4K1 4BC3A 4K11A 3WXLA 3HP6A 3BFMA 1IBKK 3IMPA 4EHTA 1BI0A 4BI3A 3DM2A 5C24A 1ZHIA 3BE3A 5JS2A 4AHCA 4ID5A 3JVHA 3KD5E 3A8GB 4MDBA 1IBMK 1W5EA 2RI5A 4C8LA 2DT4A 5A2QE 4J83A 4N4HA 5JVDA 2E10A 4J9IA 5C25A 3KK3A 5JLHA 3V9UA 3SQ4A 3FZKA 2IAJA 4CE9A 2WSEE 4FU6A 2D0BA 3EKSA 4PFOA 3H6EA 5FPMA 2UYJA 1VQ7N 3WPXA 1VQKQ 4YOWA 4OPJA 5FDLA 4O4GA 3M54A 4J9FA 4DV0K 4BRMA 3UKRB 3JAMM 4C5EA 3KIZA 5FLXO 1TYQA 4Z0UA 4WF9L 4KHWA 3Q1JA 2E5KA 3AT1B 5C10A 1OH7A 4FZXC 2QWNA 5BPLA 4EDUA 2XK0A 1D4XA 1Z9QA 4H5NA 1HNXK 2ZJRL 2DVJA 4H0YB 2A1RA 1RDWX 2CZWA 3NDKA 2V9YA 5HOOA 3AA5X 1KC8H 1VQMF 1OPKA 4PY5A 2ZPHB 1OPLA 4CC7A 4JD2A 1TVKB 1BKBA 4IHJB 2C0TA 4O4HB 4H0PA 1S1TA 4IXCA 2E6ZA 4HUGA 1VIFA 1YQNA 4UQGA 1E7OA 2QYZA 3T19A 3JALA 5CYMA 3S03A 1MNEA 2UZHA 5BR8K 3CC2Q 1KJWA 1UTIA 3K9JA 3LH0A 1ZSZB 2DERA 5GAOn 4H5RA 4YOXA 3TABA 2CP2A 2RJDA 2HP3A 1HJRA 4OB3B 4FSSA 2HEQA 4KTWA 4M8IA 1VQPF 1M9SA 4FPAA 4A62A 3VS0A 3AVMA 1NJIH 1M1KC 1ZC6A 1QSSA 2GUPA 3EGXB 4DS4A 2A28A 4CC2A 1CLQA 1RT7A 2LTOA 2FF6A 3ZSOA 4AF1A 5BN8A 3VUZA 2QKKA 1KC8C 3TSZA 1FMVA 4TSXA 3LAKA 5LJ5h 4JRQA 3M0QA 4BC5A 2CGKA 4BR2A 1QVFM 2IG8A 5G4VC 4CRIA 5LJ3f 2E65A 3AVHA 4C4WC 5LJ5d 2OZBA 4CZIA 1RBVA 2OTLQ 3A8OB 2QA4Q 1W2BS 4M78G 2QWLA 4DKWA 3V9SA 3KLGA 3JV3A 3G25A 4I6MB 2CKKA 1NJIC 3UKUB 4M3UA 3OB9A 2I6DA 2K3BA 4G4VA 1K9MH 2COYA 1KCFA 1OOTA 2CP7A 2PNIA 1G3YA 2DX1A 5CQYA 1S9EA 4FYDA 1N5ZA 2CHSA 2XRIA 1QVGM 4HVVA 5T7BA 3CC7A 4ZOLA 2KK4A 1X2QA 2OTJQ 3E1YA 2HVHA 4B8AB 3NH1A 3SMPA 2GFAA 1NYGA 5CZ1A 1W59A 2VUBA 3EFOA 3INZA 1M2VB 4ERHA 4PK4A 4N5SA 1NK6A 2RN8A 2CH5A 3F70A 2M9UA 1LWCA 3BP8A 3HSTB 5AQOA 3PX4A 3OA9A 1XRGA 2FZGB 3DLMA 3MHXA 1X3NA 5GMKm 3LDLA 3L42A 2PY5A 3F9KA 2P0QA 1VSHA 3UIQA 4TZZA 4W5TA 3E22B 2J7IA 4C92C 1CSKA 1COMA 4M77B 3MDOA 1JJ2P 5JCOC 4JHDA 1K9MC 4Z8AA 2FPFA 3AA3A 3QNOA 3FFIA 3SBTA 4B3TK 1S72A 4K42A 4JI0K 2YHAA 3DLBA 3ESJA 3RYCA 3LL3A 4D8DA 4FWLA 1B34A 3LDPA 3SI6A 2KZMA 4E7SA 2P4RA 2P9NA 3CCVA 1ODEA 3H0FA 1N27A 5LJ3g 3MXIA 3I55A 2SRCA 3SAFA 3SQ2A 3SLCA 4OVLA 3S0HA 3EORA 3QTYA 5FU7C 4BT4A 2VASA 5CA1A 4I9LA 2GGRA 1S3XA 2EWCA 1BI3A 1IKWA 2JWLA 8ATCB 3EEQA 3MX5A 1Q81R 4HHTA 4EZ6A 4M3XA 1ZA2B 1WXBA 3H1QA 1Q86R 3CMEA 4O5BA 5M1QA 5A0LA 4Z4GA 1BGXT 3UPUA 3Q8HA 3SEMA 1OVYA 4XTUA 3NPFA 2DRKA 4KHQA 5GANK 2VC8A 4GMJB 4E6EA 1VQ8A 1XJWB 2HKNA 1OYXA 5M9OA 2ALEA 1M90H 1M1KO 3O4NA 5HRPA 4A54A 3X26B 2P9SA 2ZPFB 5JQGB 2KT1A 1G15A 5FW9A 5LJVA 2VXEA 2GLZA 2V52B 2YX6A 2X4YA 1U1SA 1YJNT 1YVNA 2UUBK 1WNLA 1KK7A 4RKUE 1VQ6Q 1Y57A 3E9PA 4B46A 4BRHA 4X3LA 4GVMA 4DTOA 4B6MA 2Z1HA 4ZHVA 3CC7F 3AAQA 4B9UA 3G1JA 2D1XA 2DYBA 2PHNA 3MN7A 4C8GA 3OBWA 1TUBA 2GUIA 3M9QA 4L59A 4M7AA 4HT9A 5C2DA 4PJLA 5IXBA 1BI1A 1BWFO 2QGGA 2AK5A 3QHSA 5GAOm 1O1WA 1WAJA 2FLOA 2G8IA 4EP4A 2Z01A 3LM9A 2KY9A 3VESA 1JJ2M 1DGKN 1VQKA 1TKZA 2E1YA 4ELYC 3LAMA 3TSWA 3L0QA 1XNRK 3DRSA 3GIBA 4QQGA 2CZ0B 5AFUA 4A4FA 2OTLN 3QB0A 1SPKA 2JN0A 3AVJA 3GBTA 4JK9A 2IOCA 3ZT4A 2QA4N 1JL1A 1NOZA 2AA4A 2D5RA 5FRNA 5AQLA 5KPZA 1RT4A 3EY1A 1EETA 4IG3A 1WZOA 2COWA 3CCVF 3DLRA 2AP1A 3CCQT 3I55F 3UDCA 2UU9K 4QS9A 4F8RA 3HKCA 5A0GA 4LSNA 4RW9A 3CXCA 1UOCA 1QKWA 4Z02A 3EG9A 3SFMA 5GAMj 4ZHQA 3P31A 3KFVA 3NH0A 2MOXA 1KQSA 3ZX2A 2HZYA 3CC2A 2M1HA 2Z1GA 1SKRA 2MQEA 4II1A 3D7EO 4PWDA 3WGLA 3E1SA 1WHHA 3RE3A 4IUPA 1H92A 3UE5A 2ATCB 1BHLA 3MXMA 3I0SA 3EG3A 2HHVA 2UYNA 3JATA 2YRCA 3R0PA 3V7SA 4ZTFA 3L2UA 3ZSVA 4YHHK 1YI2T 3AGRA 1QWFA 4B3SK 2PFUA 4XU3A 1VRUA 2YLBA 3QWXX 2VG6A 3NFCA 1Q82R 1MU2A 2DIGA 4PKCC 1T6DA 2QWPA 4OMOA 3RR6A 1T7PA 1N9RA 4OMNA 4G4ZA 2FSJA 2KW4A 4PUOA 4B9VA 2JTFA 4C8KA 1JLCA 2HSTA 2E4LA 2V1QA 4H0VB 1RGIA 4BWMA 1X25A 1QW1A 1V4TA 2P9IB 1XUPO 2OTLA 1VK0A 1JY8A 5C2FA 4G4XA 1B7TA 2QDLA 3V8JA 4JKGA 4BC4A 2FRYA 2V7ZA 3CMEF 1I3AA 4MO4A 3P10A 3J80O 2ZQBA 1QVPA 4GW6A 2ENMA 1D0ZA 4IIMA 3O3HA 3CQTA 4BY6C 3TSUA 3AO4A 4DQRA 4GV3A 5BMVB 3CCMQ 3J7AP 5HP7A 1VQKF 4CF2A 3ULEA 3DLGA 3CPWA 2NLUA 4JS4A 4KUDK 4AFUC 2OTJA 1E6HA 3U4LA 2BE9B 1RQ7A 5LJ5j 1VQ7T 4M7DG 3DYAA 3KLFA 1U4BA 2D8HA 2KBTA 1VQOA 2FBTA 4Z4HA 5A2QO 2FO0A 4J7IA 3QICA 4KH0B 1BI4A 4F6RB 3TD5A 2EYQA 2ZCFB 1QZ6A 3KZBA 1GO0A 1W70A 3T9NA 5KYNA 4DBQA 1GL5A 2NRZA 2FBYA 3AVAA 5AQKA 3VQEA 1WBDA 1QSYA 1WQ7A 3LDQA 1KRPA 3OYKA 4NB4A 4LFCK 2ROTA 2W0ZA 3F5TA 4N56A 4HNAA 3CXCF 1UE9A 2G8WA 5D6XA 3QUWA 1N6QA 2C0IA 3IFRA 7AT1B 5AQNA 1X69A 4DF4A 1KQSF 2O8EB 1PD0A 2M02A 3CC2F 3BEXA 1NGAA 4FJXA 1RADB 1U49A 3CMAT 1VSEA 4FFBA 4E7LA 3CCSQ 3VTHA 3VYGA 4CGHA 4J6YA 1NJWA 2KAFA 1VQ4T 1A0NB 2Z1TA 1UECA 5GIOA 3JCMQ 3EGDA 4X1KB 5BREA 3VF4A 3J81O 3QZ5B 4XTVA 2P5OA 4FYWB 1X1PA 3GOIA 4QVZA 1K8AH 3BW1A 3VOAA 4TV9A 3GHZA 3V6DA 4BG8A 4GLMA 2FEIA 2Z1JA 3ULDA 4DWIA 4I4TB 4JI2K 4DLEA 2B6AA 3Q7CA 3OS2A 4Z4IA 4OLAA 2OTLF 2CW4A 1UFFA 2CP5A 5HY0A 4C8IA 4DTNA 3HPGA 4ZN3A 1UGVA 3MXJA 4JI4K 1OZ2A 1X2KA 2ZODA 3HOTA 3IKMA 4PWTA 1B9FA 3QEIA 2G8FA 1BCOA 1TXQA 1T3SA 1MV0B 2HQSC 4LXCA 2H8HA 3CPWF 3BDPA 3RNJA 3QFUA 1IREB 1GX1A 2O9VA 2OTJF 4WFBL 3W0LA 1NLOC 2YWWA 4JJNK 1K8AC 1RTIA 1OH6A 3DC2A 1RLUA 5IJ9A 1OQKA 1Q7YR 4G4YA 2VXFA 3PIPA 1BYMA 3KKSA 1UG1A 5LJ3h 2GZLA 3IKFA 5M1OA 1PXWA 4KH4A 3F2KA 4WQ5A 3THWB 3GYQA 3VYTC 1QWEA 5LA6B 5CKFA 2NRVA 2O88A 4JKAA 3FFMA 1TL3A 3TPQA 3QYHB 5I2MA 3HI0A 4Z94A 3JCMe 2O8DB 4CZJA 3RKYA 2AMTA 2LBTA 1ZBFA 4P5NA 3VS3A 1FWZA 2YHWA 1YJWQ 2FZKB 4QVDA 4A5AA 3NVKA 1KFDA 2VWFA 3EE9A 3OMGA 3QPHA 1K73O 1VYTA 4LD6A 1HPMA 2VYPA 3VQAA 3WNFA 4GY5A 1WYXA 2A36A 3RR8A 4KT0E 1YHQT 3AY9A 3CCMN 1R1MA 1BU6O 5CZ2A 4CERA 3U6FA 3E19A 3RA5A 3MX2A 3AO5A 2HS0A 5CKDA 1D1BA 3LWHA 1YITQ 3H08A 3N2GB 3ME9A 3JCMf 3CCRT 4JK8A 2JMCA 2JM9A 2MMPA 3O9UA 4DLGA 3P0ZA 3I8BA 1HRHA 1T0HA 1ITGA 2CZ1B 2OPSA 4IKFA 3E9OA 3SJHA 4DSFA 1X3MA 1F1BB 1FMKA 4FWQA 3MDQA 2QQSA 4B1ZA 3VQ9A 2PMPA 2YHYA 4ATOA 5HROA 1CZAN 2COZA 1Y0MA 1N6AA 5FWBA 1TKDA 3SV3A 5HXZA 3D54A 3I0RA 3JB9H 1KHCA 2RQTA 4DTXA 4U7BA 1J9AA 4J2DA 4BR9A 2LCCA 4M7AC 4X1YA 1J7HA 4J9DA 5DM7L 3NMZC 1WDXA 3J8AA 4QOZB 3NFAA 1MMNA 1LW2A 3CCSN 2DYIA 1DBFA 4MDAA 2P9LA 3J7ZO 4I50B 5GAN5 4R56A 3AA2A 2NNWA 3HPOA 5HP8A 2NUTA 4DRXA 5BPNA 2HMAA 5JICA 4EB6A 3NVKE 1Y7XA 2O8FA 4XIUA 4F2RA 3LWLA 1PHTA 2DL5A 3JB9J 1V29B 2RN2A 4E1MA 4BVOA 4LUEA 1N5YA 1QD9A 3CCMA 1VQ4F 4L6V5 4C5GA 2F2XA 5FU6C 2HBKA 2BKDN 2R5MA 3M4GA 1UGQB 3KWIA 4DV7K 2QEXN 4FJNA 2D8JA 2E12A 2O8CA 3NVMA 2RA2A 3SNNA 2DL7A 3C94A 4F3TA 2OAUA 3LGFA 3JCMg 5E26A 3WXMB 1GLJO 4X20A 3R6NA 2EYZA 1V4SA 4FOIA 2W6LA 4CEZA 4KH6A 2EQIA 2I7PA 2DO3A 1XHOA 5LXTB 5GAPK 2YDLA 3CQXA 4NCGA 4CIEA 4XK8E 3HJFA 2XI9A 2QASA 5KX5A 1FKPA 5MN6A 2GX9A 3I3FA 1T0KB 2JS0A 2IIRA 1PSEA 4JKFA 3SJJA 5ECAA 3ERNA 3OYJA 3VA3A 1XQSC 1JQQA 4FIBA 5GAN7 3PUFA 4FXDA 4C0GA 1I8FA 3HSCA 3H41A 4K43A 2LQ8A 1ASUA 2P6YA 1C0UA 2HQEA 1WSIA 3SAGA 4C1NI 4KB1A 2CSQA 3CCSA 1N8RR 3FIFA 5GAMf 4JKBA 4CJRA 4HUFA 1JBMA 2QM1A 3UT5B 1MWMA 3M8QA 2ZJQL 4J9EA 4DV1K 3QERA 1YJWN 4YJ3B 2PUKB 5DLOA 2YT6A 3HKDB 3CCEQ 1SKUB 3CCJT 3RSEB 4XH1A 4IUTA 2P84A 5GAOp 3G4SQ 1HQUA 2G8HA 2J6FA 1JCFA 1WLJA 2DFHA 5FLXE 2ZZDA 1NM1A 3C0BA 2OA8A 3LP2A 4BY9C 1ONIA 2FL7A 2GBQA 2OZMA 4W5RA 3CJBA 4DV3K 3HFOA 5KYWB 1K0XA 4LDXA 1KVCA 5CKHA 2HHSA 3HKEA 3RYHA 2B4JA 4O2AB 1M8MA 1YITN 2A08A 4F7UB 1FFXA 2O4GA 2DFFA 2E4HA 4YY3K 3CCMF 1HUXA 3R8EA 2HBLA 3O1WA 3WNGA 1MHNA 2NRWA 2HSEB 3RKXA 2DTUA 1RI0A 2RHOA 1TH7A 1NGDA 3AVKA 3SPYA 3RYIA 2DL3A 3MWPA 2KXCA 5B8HA 1XMOK 3VF6A 4C8MA 2N48A 4L8RB 2GV9A 3JAWA 2HNZA 1KC8R 4E7IA 5J2NA 3WJRA 1UA1A 1VQMQ 5GAMg 4LDWA 1AOJA 5GJWB 2KG4A 2DKGA 3O6WA 1WB9A 3LWOC 5KYYA 2Q2RA 4A2AA 4B8CA 4DV2K 1TS9A 4LN2A 1VQ6T 4M7DA 4PJNA 4PJOD 1I07A 4YOVA 3O5BA 4JAXA 1SL1A 3SHWA 2RQRA 1M2OA 3SDZA 5GIOC 1CKBA 3P38A 4IOXA 1NJIR 2PQWA 2DFEA 2ZWHA 4M75B 2KDSA 4LDUA 3QXEB 1AWWA 1VSLA 1YVUA 2AT1B 4LDYA 1Q86O 2VAWA 4IFEA 1EFNA 2DPNA 4KO0A 2ZAEA 4W5QA 3J7AR 5ELZA 5GAGP 4A53A 3ZT3A 1YITA 4PJOA 3HVTA 5CB4A 1KSPA 1AWOA 2BANA 2W8BC 3A8LB 3CETA 2OCEA 3UKUA 1SSHA 3ENHA 1HNVA 2LRQA 4GBQA 1OU8A 4J8OA 2XD0A 1M5Q1 4HVJA 3OS5A 3OW2A 3NHGA 5ADXA 1RLGA 1VUBA 3A5MC 2PVDB 4XTZA 2X6SA 3KK1A 4M77D 1RAGB 2WONA 3K5MA 2LSNA 1K9MR 4E19A 5JMVA 3OMCA 2EYWA 1OU9A 2LCSA 4CECA 3SPZA 1NQ3A 1L3UA 1Y07A 5LJ5g 3THKA 2F2WA 4WQ5C 4YJ2B 5J3BA 1RDDA 3FZFA 1G8XA 3BF3A 4M3TA 2AHJB 3TU4K 2BH1A 2WOMA 1KD1H 1EWRA 4B1XB 4C0DC 3E22A 2P0PA 5I11A 5TKWA 4CK1A 1Z25A 3CCEN 3JCMV 2D1KA 2NUBA 1S1WA 5AQTA 5KCHA 1GCQA 1PD1A 4IUUA 4AFSC 3K0TA 4GKJK 2PU9B 1JJ2S 1KVBA 4OB0B 1FKOA 3O9RA 5GAOr 3DDNA 1IV0A 2QG9B 2B8AA 2OHWA 3M0TA 1MDUB 3IAYA 3I33A 5AZJB 1JCEA 5AYFA 1KQSP 4BDPA 3C9UA 1Z05A 1C0MA 4X65K 4PJOE 3G6EQ 3O8MA 5DLQE 4NS5A 3VS7A 3CCLT 1KD1C 3CC4T 4NCBA 3ZEUA 2VXYA 1L3SA 2Y4XA 5FNVA 4ISEA 1YJ9Q 1JCGA 3CEYA 3HRTA 3ATVA 2OZSA 1NK4A 4EMKB 2Y1JA 5JS1A 4JJBA 4EZ9A 4DQPA 4PJOF 1YITF 4TUYA 3OY9A 2RQWA 2GNCA 4E7KA 3B6PA 3T69A 4CJ3A 3V9XA 3OJSA 4M78B 3VUBA 2DLPA 3P39A 5AQPA 3SQ0A 2H8EA 4O4JA 1M8VA 4NOYA 2CT3A 4IIJA 2RHJA 1ZQ1A 3CPEA 1M90R 4H8KA 4DTUA 1XMQK 1Q82O 3JAKA 4CEDA 1VQMN 3WPWA 2BUDA 4X9DA 3WXJA 2GCXA 3CCUT 1Q81U 4N47A 2O8BA 3OW2F 4OKJA 4M63C 2CDTA 1Q86U 4RHAA 1TUUA 2GQIA 1U40A 2EQMA 3M0PA 4KREA 2X6NA 5GANe 1IV4A 3TCJA 3VEOA 3VS1A 3HM9A 4M77E 3TVTA 1LV5A 3MEWA 3G4SA 3MEEA 2EWSA 3H46O 1W55A 2FHDA 5KE3A 1HKGA 3LM2A 4IFVA 2F4VK 1VQPN 3AGKA 4WFNL 1IV2A 1JD1A 5FJ4C 1K76A 4AHRA 2YLCA 1KSWA 3OYNA 3CPWP 3CG6A 2CUDA 3JCMh 1RILA 5D7UA 4CHQA 1M3BA 4G9ZA 5M1FA 1C6VX 5AQVA 1XI1A 4KGZB 3KJJA 1PF5A 3OQ5A 4TVRA 3JCMd 3FEOA 5LMUK 2E5LK 2DBKA 1C0FA 1OX9A 2VG5A 3AV9A 4IO8A 4LD0A 3V7RA 3VF2A 4F3OA 5LOVB 5LL6Z 3S3NA 3CXCM 4BR4A 2ZVZA 4KHSA 2KFZA 3C8LA 1X9MA 3OSSC 1KQSM 2KXDA 4Y1CA 3VQQA 2NUPB 2OAWA 3DXKB 1Z26A 3MEDA 2FRWA 5KGXA 5KH6A 1AHJB 4R0KA 3CBOA 2QEXT 4JJDA 2AIFA 4CC3A 4O4LA 5LL6S 1IH7A 2V8IA 3WNHA 4RCCA 3I55Q 1HJOA 2E1ZA 3VEWA 4BW0B 4ELUA 1VQMA 1W9HA 3NGPA 1W2BA 3HKSA 4BACA 3O08A 1G2BA 3K2XA 4IBNA 1YXQA 3CM6A 3JCMJ 1J5OA 4GKKK 4NWOB 4EIAA 4M3WA 3CMEQ 1TAUA 4X1IA 3OS1A 1O75A 4AT1B 2D0PA 1YP5A 4N4IA 2XIDA 3D2FA 3L3VA 2K57A 2KSSA 4C1NK 3PVQA 2RD1A 1VQ8Q 3MCPA 4ZNXA 3TAFA 1H7MA 3RA6A 2KR3A 1AZGB 2VVKA 3MMVA 3J80E 1DKGD 4GNIA 1QP3A 3ZSRA 2RK1A 4JKDA 4O55A 2E6LA 3G4SF 3S3MA 2IG0A 4KI4A 2I2LA 1YGYA 4ZGEB 3CPWM 3TANA 3RMSA 2GWJA 5LP6B 4GY2B 5EO3A 2Q3SA 3SQ1A 2CP0A 2ITGA 3I5RA 2JS2A 2LNVA 3U8XA 1QVFP 4A5BA 1BIZA 3FB9A 3ZSYA 4QW2A 3M8RA 2NRRA 1Q82U 1W5FA 1GLFO 3MP8A 1K6YA 2CZ6B 3BYQA 4WBNB 5GAMh 2YYEA 4IDHA 4OX9K 3C6HA 2ABLA 2DMOA 1U43A 1Q7YO 1N9SA 4FM4B 5GAMd 3RDVA 2YJFA 4Z88A 2YUPA 3L6QA 1T44A 2M0OA 3NCIA 2O4XA 2XHCA 3UF4A 2CH4W 4B9XA 1QVGP 4CVNE 4WF2A 1WGSA 1YWPA 2JM8A 3CERA 3R6MA 5AZIA 4O5VA 2VQFK 1M1KH 1IGUA 3OTOK 2KGTA 1C0GA 3DOKA 1RAHB 1TUGB 4M7DC 1UAXA 3LFOA 1BBZA 1IZ6A 1TV6A 1K8KA 1OULA 3LH5A 2ZD1A 1Q95G 1PC0A 2Y4YA 5EG2A 2ZE2A 3ZX0A 5ADXH 1YIJQ 1IB8A 3H6ZA 3OYLA 1QCFA 3ZBDA 4PKHA 1W2BF 1YUWA 3K12A 3J81E 3AAPA 3CC7N 1UB4A 3FDRA 3REBB 3CJAA 4EIKA 3D6RA 4QCLA 5KYUA 1S5JA 3QYGB 2HBMA 1OZ3A 2QGFB 4H0XB 3G71Q 3GPLA 1TGOA 4LSLA 4OP0A 1U3OA 1KQ1A 1RAEB 3G6EA 4PJOC 3HKBA 2LC4A 3KXTA 3MCQA 2IVPA 1GLBG 1H1VA 4DEYA 2PYLA 2CP3A 1YJ9A 4H0OA 3PLAA 1GZ0A 3RYFB 2BTFA 4FT2A 4DFMA 4R5PA 4IOAL 2RHKA 4BT2A 2KYBA 4AHTA 3PIOL 1M1FA 3NGIA 1ZWZA 3LWQC 1S72N 1X6GA 4QT7A 1K8AR 5GMKl 3HXMA 2DBMA 2G8VA 4CZFA 2IC3A 2HB5A 3CCVN 4PNOA 2Q31A 1H3HA 5KQDA 2AZVA 1CZBA 1MA9B 3I55N 2YSQA 3RIRA 1JLQA 4FYVB 4YDUA 4M45A 4FJHA 3VS4A 5KMGA 2MWPA 3VS5A 1TUYA 2JJ9A 2EPDA 3EH1A 2EYYA 5EB1B 4B9WA 1XOVA 1BG3A 5HY4A 4DBRA 3LDTA 3CMEN 3TQ7P 3THXA 4DTPA 2XO7A 1SZQA 2HHXA 4CEAA 1VQ9T 3PGGA 1GCQC 1BDGA 3DXMA 4Q5VA 1VQ8N 3C6UA 3KTQA 3ZFJA 3CJCA 3HRUA 3L4QA 3K5NA 3EFSA 1G3WA 4XTXA 1HQEA 2QXLA 3ZT1A 3EG2A 3JCMW 3JB9I 4DB3A 5EIBD 3VN5A 1UA0A 5CA0A 1VQOQ 3BUZB 3C0CA 2EQUA 3ZETB 1BOTO 2P9PB 3P4IA 4BGBA 5JH7B 4ZHWA 4FVUA 5D6WA 3CIPA 4BQZA 3G7ZA 5SWMA 5AR0A 5C0YA 1B07A 1NGBA 2LQNA 3D0PA 1VAZA 3MN9A 4C81A 1Q7YU 3QEVA 3RESA 2IPOB 3DOLA 4JI1K 3NK7A 4Y1DA 1VQ8F 1RQ2A 3E2UA 3AVFA 4NL3A 4ESRA 3L3UA 1NG9A 2AIZP 3LP1A 1BIAA 3G6EF 1QQJA 4YNQA 1I94K 3IEWA 4I55A 2A1SA 4M3YA 5KTQA 2ASPA 3SV4A 4FYYB 1VQKN 4MDWA 1YJ9F 2KT8A 1VQNQ 2EYXA 3NF8A 1TK5A 1WHJA 1T05A 2R58A 5GAOl 4DQSA 3JCMP 1SZ2A 1N8RO 3TD3A 3QJYA 2UXDK 2OANA 2KQWA 2FSNA 5FPEA 3I56A 1BO5O 2FB7A 2GTDA 4IUQA 2K79A 3M3ZA 4O0IA 1SRLA 1WQWA 2DL4A 4A59A 4E89A 1XTDA 2WFBA 1EZZB 2X9HA 4J6WA 4RTYA 4BI4A 4HT8A 4LNPA 3PSFA 1R77A 2LMJA 4RG2A 4JK7A 1UGSB 2EWNA 3QDFA 1R0CB 1XC3A 2D0CA 3LPUA 2G8UA 1X52A 3CPQA 5GAOq 2Z0WA 3GBQA 2GTOA 4FL6A 1JXOA 1TUCA 5AQYA 4OB1B 1U3LA 5FLXM 3IQLA 3QNNA 3CC2N 2M0YA 2XMFA 2L3PA 4N4GA 3WXKA 3QBWA 4JS5A 2YHXA 3VEYA 1I5LA 2D0OA 5DM7R 3QO9A 4FWOA 3M0SA 2WUSA 1REVA 2QWOA 2L8DA 4C92B 3TI0A 2MPXC 2F69A 1VQPT 4R79A 3M0RA 1GCPA 3WVEB 3HL8A 3I5SA 2WBNA 2HNDA 4LNUB 4A61A 1W4SA 1E7KA 3FPIA 3FJPA 1ZLMA 2QTDA 4ZN1A 3CJ1A 4CZLA 5FU7B 4K8XA 5GONB 3ZP7A 1VQ5Q 4CJVA 2YI1A 1XHZA 1WBBA 1VQLQ 3TAPA 1GLLO 1ZA1B 1DEJA 4OGEA 2V51B 5AQMA 5GAN3 4Y92A 1J54A 3KLEA 4EMGA 2QQBA 2K6DA 1YIJA 1YHQA 4J6XA 3AO3A 4DS5A 1X27A 3JCMM 4X1VA 3M57A 2DJQA 2KNBB 4IFYA 1B92A 1JXMA 1NGFA 3SMSA 2OTJN 1UHFA 3JB9D 3C9RA 4BRLA 2JT4A 2P9KB 1RBUA 4OMLA 3G71A 4OB2B 3C7NA 2CGHA 1EQYA 2D0NA 5CE3A 3CD6Q 1LWFA 1VQON 4F16A 3GTZA 1D8YA 3I56F 2F8TA 2OTMA 3SIUA 3RSEA 1RLQC 5KCOA 1Z9ZA 4J9CA 5GANd 2RQVA 3M84A 3SWNA 2DEQA 4X64K 1LW0A 5JVGL 1LPLA 3CPFA 4WFAL 2HHQA 3JARA 3NAEA 3VGMA 2JZ2A 4CD3A 3EGUA 1OEBA 4O4IB 4QS7A 3CF5L 3GP8A 1U2VB 3LDOA 3SAHA 1K73H 2FBVA 1N8RU 3HP9A 1D5AA 4PKGA 2JMAA 2P9UB 2VB6A 1RL2A 4E7JA 1VIEA 2R57A 1PWTA 3RVCA 1SA0B 1WNSA 1VQNN 2JVVA 3DI6A 4AG2C 4M7XA 1N34K 4C8NA 1Y96B 1WHMA 2VV5A 5KYXB 2EKOA 5HY2A 3EG1A 4XH4A 3SUOA 5EXWA 1LAWA 3QBXA 1ZX6A 2O2OA 2RE2A 2LX7A 4M75D 2DIQA 3REAB 4PFPA 4HTLA 2MF2A 2DNUA 4BRIA 2VQEK 3RMDA 1Z5WA 1K73C 3CM5A 5J2TA 1NMDA 1WUAA 4IOCL 4JRPA 3T1HK 1NPPA 4IJNA 4QKUA 3SK3A 4JKHA 4B9MA 2AKLA 3LZIA 2VYTA 2RJCA 3ZEHA 4ICLA 3QEXA 1HX1A 3PFSA 2ZGYA 2LBWA 4C8EA 1YHQF 1YIJF 3L1AA 4PJMA 3QO3A 3CQYA 4AH9A 2ZVYA 3VPZA 3DJCA 5IAYA 1KNJA 3M4SA 2HP0A 4OLBA 4BRQA 4CJLA 3ASKA 4MMKA 3PLAC 3G71F 4BE2A 4PJOG 3JCMc 1KC8U 2A5XA 4BVTA 1U5SA 4PFZA 3CC7T 5JVDB 2Z1UA 3OYEA 3ZCMA 4KHPK 4JNEA 1ASVA 2VAPA 3OW2M 2GBZA 3LWMA 1S22A 4EI9A 2OYQA 4DSLA 4DBFA 2E88A 3K58A 3IS9A 2QTPA 4FT4A 4JJCA 1VQNA 2F9TA 1T3LA 4YDUC 1TAQA 1PG5B 3E9GA 1BL3A 4CJSA 4CJPA 3TAMA 3T1AA 3CFRA 2RI3A 3VS6A 1TYQB 4FL9A 4AFQC 2F9WA 4FJGA 1FXXA 4OGCA 1NJIU 3A2FA 2E3HA 2VWBA 4LDVA 2GF7A 3X25B 1NGHA 1RBRA 2H3JA 3CFPA 1OVQA 4DTMA 4BY6B 4BVPA 1GO1A 2QW9A 3L7QA 3VIUA 3D2EA 5IYZA 2OX7A 1S72T 1BA0A 3HOSA 3VU3C 2G6FX 2HMPA 4FJ5A 3PX6A 1ZBUA 3CHWA 1SAZA 3LALA 5KI6A 4FLXA 4JLGA 3ELCA 1D1AA 4DV6K 3S41A 4JD2B 5GMKe 3CCVT 1XV2A 3KBGA 4LH4A 4C0ZA 5C0MA 2F5KA 2LJ3A 3I55T 5FPDA 4M77G 4JI3K 2RB6A 3F9MA 5CVIA 3BY5A 3JALB 1NMNA 2F2VA 3NTKA 5LYJA 4M3ZA 2UXBK 5G4UC 4DU4A 1WSHA 1LVKA 2O4IA 1KD1R 4ZI7A 1W97L 1I39A 3KUFA 3HRGA 1SL2A 4M75E 2UUAK 4JI5K 3LWPC 2K7AA 1K9MU 4CHOA 3GE1A 1V76A 1VQ8T 3EHQA 2BZYA 5C8YA 2HAXA 3O9SA 5GINA 2BTOA 5EZYA 5BRDA 1QU9A 2F5TX 2D4WA 1X7OA 4LF6K 4C8QB 1AD5A 1P92A 2PTKA 3UA7A 3KK7A 1VQ5A 2ECZA 2QDYB 3OYIA 3TWHA 1HYOA 1KQSS 1QCOA 3AARA 1VSIA 1VQLA 4M41A 2ZPBB 4B3MK 1LNXA 4ZHYB 1TVRA 1FNJA 1T8EA 2JW4A 3MP1A 2D9TA 2DJZA 2R7YA 4ELZC 2QTVA 1UJ0A 4OF1A 4RTTA 2E2QA 3C12A 3PNWC 4DU1A 3F0EA 1W6XA 1MUZA 1GRIA 2NYSA 3VERA 1YCSB 1C1BA 2CUBA 1VQNF 2X78A 4BGAA 2KGWA 5M1PA 3CJ9A 2LBXA 1HXDA 5CKBA 3E9LA 1LCUA 1QSLA 1VQKT 2ASOA 4LFAK 2Q0RA 3M8PA 4RMOA 1IG8A 3CD6A 3EFOB 3PX0A 3N2KA 4YOUA 5EYPA 4IZ9A 3X20B 2LT4A 4KFBA 3WXIA 3J80M 5AFUH 3HTNA 1WI7A 3G0ZA 1SEMA 4J2EA 2B86A 4LUDA 2BDPA 3NE6A 3MBMA 3H8ZA 5C42A 3MO8A 1CN7A 2I6RA 2MAMA 3LDNA 3JRZA 1VYVA 3VYHB 1ESVA 3V1RA 4JHDB 2DEUA 1RI9A 2QQAA 4BR7A 5GAN8 2VGMA 2ED1A 1M90U 4JEPA 4A4HA 2SEMA 3THYA 5A2QM 4QQDA 4B9NA 3CPWS 2FPDA 4HVWA 3A5LC 1B34B 2NLXA 3EL2A 2O01E 2A3ZA 2P9NB 4B08A 3CC2T 5LOVA 2RB9A 4NYNA 3NVIB 5GANj 1CKAA 1SHGA 1S9GA 4Z4CA 1U47A 5CA1B 5IJ0A 4DEXA 1VSDA 4CCHA 2E5QA 2DD5A 4KULA 3EFRA 1VA7A 3AO2A 2L26A 3P8DA 2KFNA 3N4YA 5J2UA 2KLAA 4CBUA 1X43A 1SRMA 1VSKA 3TTCA 4OKEA 1VQ5F 1R0BG 1VQLF 3META 4AG1C 1FMWA 1JLEA 1WN7A 3MK6A 3QMLA 1X6OA 4D6WA 1LAVA 4CZEA 4LF8K 2P9SB 1JFFA 2JUFA 4CBWA 1W7AA 5D3GA 3J81M 2KE9A 1IPAA 3UWNA 2OTLT 4DUZK 2X4XA 1W40A 1Q86C 4H03B 4TV8A 1IO6A 2QA4T 2A41A 2YNGA 4BRAA 2YRVA 5CAIA 3M56A 1NK5A 1Z5VA 4E0DA 1D0XA 1BB9A 2RJEA 4ZTJA 2A6AA 1W5AA 3U9ZA 5DMRA 3SWNC 2X3XD 4M42A 4CEOA 3QEWA 2IVOA 3CD6F 2K5LA 1TUBB 4CHNA 2ZF5O 4OPKA 2UYKA 3EZ5A 4M7AB 2OTJT 5EOYA 4PLIA 1RA4A 2G9IA 2H3EB 3RKWA 1V1CA 2DXTA 4KUIA 2HOEA 2H6LA 3OSVA 2YJEA 2RH2A 3JSCA 1HJDA 3R3LA 2RPNA 4B9SA 4EPCA 1KG1A 1GLAG 1HPZA 3GL1A 3GG4A 2IIMA 1Q8IA 4IG0A 1RTJA 3SUQA 2BE7D 4BUGA 1JU5C 4FWNA 2Z1FA 1IV1A 1ABQA 2PVGB 4A4EA 4B45A 5AQGA 4BQLA 2J6OA 5BRHA 3LANA 2WTUA 1JJ2A 3LYIA 2FF3B 1WFWA 3JS6A 4B9QA 4XQ3A 3DLKA 1QVFS 1EWQA 2KI7A 1WAFA 1HYZA 3VQ5A 3H0HA 3MWTA 4HUEA 5F2RA 1LJOA 5FU6B 1OH5A 5EB0A 4CHYA 3MN5A 3GOXA 1NM7A 2RKIA 2YNIA 3DLLA 3HKCB 4X66K 4KWEA 3EH2A 4BDZA 1UGPB 2DRMA 1HMVA 3UKRA 4DCHA 5FPNA 4JI6K 4J2BA 3SD4A 5GAHP 5D6YA 4ZHQB 3QIOA 3SBGA 1KHIA 4WCIA 3OBYA 1AT1B 1JLBA 3H3OB 2LJ1A 3MJXA 2FC3A 3F6MA 1RCHA 3OHRA 1TUDA 2IGIA 3OJUA 2M51A 3L8BA 2KMTA 1BU1A 1RABB 1QVGS 4FLVA 1L5UA 2JTEA 4X9CA 4KHYA 2HS4A 2UYNB 3JATB 1M1KR 2HRUA 2LJ0A 2I0NA 1TVKA 2IVNA 4IHJA 4O4HA 3AVLA 2OJ2A 4CGFA 4HCCA 4WQ4A 2Q1NA 4NL2A 3ID8A 4CK3A 4KTQA 2RHIA 1T0JA 1ZSZA 2L89A 2HNYA 2YKMA 3SB2A 1O13A 2A40A 3WVDB 3V9WA 1RDBA 4D8KA 4EFHA 1FYNA 4RW7A 5CHIA 3SIVA 3M55A 4NLBA 3EGXA 3OYDA 3NBPA 4KV8A 4RTUA 4JKGB 5CR4A 2PYJA 3ER0A 4AHUA 1C6VA 1WJSA 1HYVA 1Q81O 1Q82C 2GELA 3PIPL 4DUYK 3JCMb 3K5LA 1VQVA 3RBBB 3A8HB 2DL8A 3NF7A 4CZMA 1AWJA 2ZM6K 1RAAB 1Q18A 5AQWA 3ULEB 5M1NA 3QSUA 3RMAA 2D0QB 3HRSA 4LE9A 5C15A 1RAFB 3EG0A 3C6TA 5IT9O 1BA1A 1JJ2F 1YJNQ 1Y71A 3FLGA 1JL2A 4I6MA 3DLEA 1BI4B 1HK9A 4C5HA 2QWMA 3HM8A 4ELVA 4BRCA 4BVSA 4ZOLB 4CFCA 4U67L 4KAZA 3L2ZA 1TWBA 1K8AU 2GQVA 2YRDA 4K0KK 4HNAB 4M3RA 4G1QA 3HBTA 4F17A 2GWKA 3VEZA 1TL1A 1JXBA 1M2VA 4V2SA 1RT6A 3IDHA 1MMDA 4KRTA 3GDQA 4FSVA 1NJYA 4FFBB 5GINC 1RACB 5JH7A 4BD3A 3NTHA 4CJTA 3EHRA 5CIUA 4RTFD 4LC9B 4JKCA 2KRMA 3VENA 4CZGA 3VRYA 1BUPA 1CXUA 1P90A 4J2AA 4Z4FA 4M77A 2XY7A 4BRPA 1VQOF 1NBWA 3EGDB 4B3RK 3WQUA 5FRMA 2RQUA 4MZPA 5EC7A 1G83A 3G4SN 4DR6K 3HFNA 2W40A 3CCQQ 3EKUA 3TEEA 5HL7L 1EP4A 4EP5A 2QK9A 3VGKA 3U0OA 3NHNA 4M7YA 3O80A 2ZOVA 4TV9B 4E1NA 2F1LA 2EGCA 2JNGA 2L3QA 3ZSZA 3CXCP 2HQXA 4BG9A 1X01A 3KK2A 1ZUYA 2HS3A 4CI0C 2EGEA 1EIFA 2L3RA 2JXBA 3S0WA 4J9BA 4FWMA 3SCXA 1C1CA 4PA1A 3M59A 2V8KA 3N5BB 1YTAA 4JI8K 2RHYA 4BI8B 1S1XA 1AWXA 3PE0A 3CG7A 1RT1A 4DV5K 1QTMA 2M16A 3DMJA 1ZUKA 3LZJA 3O1BA 1YI2Q 3RWUA 4ZGDB 4C92D 2PAVA 4CJ7A 3B8AX 5GMKh 3D7SB 3CCMT 1U8RA 3D45A 3UB5A 3GLXA 2X35A 5AQXA 5I9EB 3RMQA 4G88A 1K1ZA 4AILC 4DR7K 5IJ9B 1VSJA 5JQGA 1JO8A 2NUZA 2E8AA 1OAPA 4FWKA 4A63B 1PM3A 4H5VA 5EU7A 4AHSA 1G5VA 1E4FT 4YFUA 3KE1A 3MQWA 4DTSA 1M30A 4CIFA 1R59O 2PUOB 2YXZA 4XCQA 5EX5A 4C0DB 2E1HA 3QDRB 4ZGJB 3JAMO 1TKTA 5BPMA 3KJVA 1OH8A 1O9SA 5I22A 3HPWA 2E2PA 5KPTA 2LX9A 3TTDA 4K25A 1Q7YC 4CF9A 2DF6A 4CGGA 3JASB 1M27C 3F0DA 2HBJA 1AZEA 1ZYQA 2FSKA 1YAGA 3LGLA 2ITMA 1JLAA 3U23A 4EHUA 2EW3A 5JVHL 4CJQA 1WSEA 3CQ8A 2DXUA 1VQ7Q
chains in the Genus database with same CATH topology
4M77F 4JDSA 2P0KA 3CCST 4NLCA 2QQRA 5EWRA 3V7EA 4B1VA 5GANf 3S6WA 5GAN2 2XDBA 2DZ9A 2LDMA 5BR9A 4YTLA 1M1GA 3LLRA 1NLVA 4DHYA 1SS6A 4OPHA 2E20A 2E6NA 2K4YA 3JB9G 2R5AA 1P8ZA 1UEBA 3OYFA 4GLKA 1JB0E 4C92E 4F7UG 1J6ZA 3CCQN 3ZX3A 2QWRA 1GLCG 4CZHA 4B1UB 4PL6A 5AQJA 4X34A 1ZBXA 2E41A 2P9IA 3VEXA 3DB4A 4L3QA 2RO0A 5CK9A 1Y64A 3DWLA 1YJNA 1YJWT 3G6EN 2QTXA 5DM6L 5GANg 3DKMA 3DAWA 3BDUA 5HK0A 1I81A 2RHUA 1YJ9N 1RFQA 3U9DA 4FO0A 2CH6A 4NO7A 4BR0A 5HK3A 5HWEA 1NZ9A 4WQ4C 1YITT 4M75G 2RHXA 1D3BB 2ZPEB 3H1VX 1QHAA 3PMIA 2NRXA 1NGEA 2EJGA 2KVQG 4FOEA 3CCQA 2RM4A 2DVEA 2MWOA 1QQNA 1N8RC 2EIFA 3OS0A 4ISGA 1ATNA 3RUXA 3N4QA 4ME7A 2JTMA 3FE1A 4DA4A 1SDSA 5GMKi 3E9FA 5GADP 3NMUA 3LX7A 4HA8A 3OYMA 2HVYD 1YI2A 3WEEB 4MZTA 3EO3A 3M5AA 5AQZA 3OYBA 4KBMB 3VTIA 1YJNF 3CMAN 3EE8A 5LJ3e 4A4GA 3HZ6A 4C8QD 1NGJA 3L4IA 4GV9A 1VQ4N 3NTIA 4MLEA 2DPPB 5AQSA 1HKBA 2E70A 4M7DB 1HLUA 3I56N 5J39A 4M77C 3WUHA 2X4WA 1NGGA 4UC4A 1BIBA 2MI6A 5GMKj 4XTWA 4C8QA 2D6FA 3W3DA 1VQ7A 3QG1A 3V3TA 1YBYA 4MO5A 2XG8D 4PJOB 1KD1U 3CCQF 4MLHA 2IVWA 3KHYA 3IR9A 3CCET 4RCBA 3FZLA 3G4ST 3Q7BA 4H5WA 1XBIA 3CMAA 3GNGA 3BF1A 2I7NA 5L8RE 1VQ4A 1YI2F 3CI5A 1DT9A 2G3RA 3OYYA 5F1XA 3C95A 3OYAA 1YHQN 1YIJN 1G3TA 3WQTA 3EZWA 3C6AA 4BRNA 3V7CA 2YCHA 4C8QE 2LT1A 4RWTA 1VQMT 3BDLA 3G71N 2EJFA 5LJWA 5AQFA 3CCRN 1NGIA 5M1KA 3IMXA 2EQKA 1KXPA 4DQ8A 4QVCA 3QBYA 3FZMA 1GXIE 5LY3A 2BO1A 3ZEUB 4C8QF 2CZ7B 4L5GA 1VQ7F 4IJAA 1IJJA 1FX7A 4C0FA 2CYZB 1U6ZA 3FGUA 2QWQA 3H3NO 2Y90A 1PSFA 1WJRA 3E66A 4M7AD 3ENOA 4EAHD 5HY1A 3CBPA 1U1TA 1KC8O 4BRKA 2BUPA 2CGJA 4LCKA 3OA6A 1UGRB 4UY8O 3CMAF 2XICA 3VKIA 2NRHA 4BVRA 2DTOA 2PVOB 4J7FA 3TU5A 3ID6A 2DTHA 3OYCA 4FSXA 4O8UA 1NJIO 1M90C 1VQ4F 4ILHA 5AQRA 3CCRA 5GANh 3HTVA 5AQQA 1T3VA 5AQIA 2Q97A 2A42A 1QQOA 4IWVA 1G99A 3R9PA 3GNFB 4J8FA 2L5QA 1OKJA 3M4YA 4F7UA 1LOTB 1K9MO 2E2NA 3VMFB 4EI7A 5CKEA 1W3EX 3G6ET 4WYBA 4BVQA 4B1YB 2DXBA 1W41A 1JRIA 4HKEA 1YJ9T 3T7ZA 3CCJN 4J5YA 4PHTX 3D2FB 1QZ5A 4M7AE 4BY9D 1OI1A 2LCLA 2E2OA 5GAN4 5GAN6 3LWVC 3ENBA 5BRFA 3EN9A 3O85A 2QA4A 4M7AF 3C65A 3PAFA 1M1KU 4M75A 4C5IA 3NMUC 2RHZA 5IT9E 3MEAA 2VGNA 5H1SQ 3D00A 3CCRF 4RG8A 4VUBA 2K5FA 4R55A 1H3ZA 4F7UE 5AQUA 2XKOC 1VQ5N 5I2SA 5CQXA 3JB9F 2GFUA 1NGCA 2O4XB 3O9QA 3CCJA 4DQ2A 4XEIA 5AZIB 3VV0A 3KVGA 4BDYA 4F7UF 1XNIA 2F9ZC 3C4SA 3A0IX 4DOVA 1K8KB 4JKEA 3O4WA 2ZJPL 5IN1A 3P8HA 4C8QC 1XQHA 5MLCQ 3A5ZB 2HF3A 4B1WB 3CD6N 2EQJA 3A5NC 2BIVA 3CMET 3I56T 4ILJA 4PL8A 4MMLA 4XTYA 5HY6A 2XU8A 3HJWC 5AZJA 3QKJA 4M78D 2DXCA 2QA4F 2JOYA 3MCAB 1E4GT 3CXCS 4M75F 4OPAA 3FC3A 4FPBA 3E20B 1WJQA 3LWIA 2F7TA 1VQ6A 4OMFB 4GVEA 2A7YA 1SSFA 2V7YA 4K41A 1NMUB 4EMKA 3QFPA 1QVFA 4DOWA 3NK6A 1R8OB 4IEEA 4M78A 1T6CA 3M53A 3JAME 3JXUA 3DXMB 4BE1A 4C92G 1ZXOA 3RERA 5LJ3d 5CCAA 3CCJF 2P4TA 4PLLA 2CGLA 2Q0UA 2JNBA 1WOQA 1QVGA 3UT1A 5JLFA 3CCLN 4Y91A 3LW5E 3CC4N 4WCEL 2YHTA 2PBDA 3MN6A 2K5IA 1YIJT 3ATUA 2NZTA 3ZYYX 3OYHA 3CBMA 1Z6RA 2KTUA 3G71T 4A4KA 1Q81H 3M6GA 4IO9L 1Q86H 3CCUN 1X9JA 1WPYA 2ZPIB 3V7QA 4YOTA 2JWKA 3DXKA 1W2BM 2EJ9A 4OO1J 4CBXA 4M78E 5DY9A 1VQ6F 3LWRC 1QVFF 2ZGWA 1Q81C 1GLEG 4AM6A 2W41A 3CCLA 4KBOA 3CC4A 4M78F 5FROA 1YCYA 2KHOA 3K9KA 3FLCO 3P8BB 4XU0A 4O6JA 3L2QA 4HWIA 4QQ6A 2FGYA 2QQ9A 3TREA 3HSBA 4JRKA 4F9OA 4HCBA 1QVGF 3DB3A 1ATSA 1VQOT 2C06A 1K8AO 5GAMe 3CCUA 3FZHA 2H3GX 1X75C 5J26A 4N0AA 3BY7A 2HBPA 1ZBSA 3R6OA 4EMHA 3A8YA 1H641 2K2VA 2J4RA 3QDKA 4YOYA 2RI2A 1D3BA 2FYKA 1K73U 5GIPA 1VQNT 4XAXB 3C7NB 2ASMA 3MP6A 1SQKA 3S3OA 2DTIA 2XDDA 4PKIA 2QXFA 1Q82H 4M75C 3L2WA 3SWNB 2LVMA 3PT9A 2QEXA 3CCLF 1YF5L 3OYGA 3CC4F 4ILGB 4O5FA 3N4ZA 2V8JA 3VOVA 4JLIA 5LJ5e 3QJ6A 2WSCE 2LQKA 4E47A 3VI6A 4Y28E 4BR5A 3VGLA 3O8VA 1X7PA 2Q36A 3WEEA 4M7DD 3M5RA 3TTFA 1MGQA 1M4ZA 3X24B 3CCUF 2A3LA 2WALA 2K3XA 5LJ5f 1KAXA 1VQ5T 1YJWA 1VQLT 1BI2A 4QS8A 4BRFA 1NWKA 4IURA 4XU2A 4C8QG 3MEVA 1GLDG 1KAZA 4C23A 4ISFA 3CCSF 4RCHA 5CO7A 4AM7A 1ILYA 4BRGA 5LJ3j 4YORA 1QQMA 3EAEA 2CS7A 2VCPA 5KPRA 3ZETA 2P9PA 3O9TA 3CD6T 4A2BA 5C6SA 3VETA 2WSFE 4JRIA 3KWGA 4FWSA 4BC2A 5EVZA 1G3SA 2QEXF 2EFIA 5HXUA 3QIIA 3IUCA 4EMKC 2KTVA 1VQ9N 3CJ7A 3M1FA 4IUVA 3D2EB 4GV6A 4M78C 3TSPA 4BE0A 2UYTA 1QP2A 3FR0A 3L2RA 2E64A 4NUTA 3ON1A 4CZKA 4NQ3A 2XDPA 4M7DE 1Q7YH 3FFKB 2FVUA 2GEMA 3N4PA 3JCMX 3PIOA 1W42A 2HF4A 1YJWF 4H0TB 3VEVA 4M7DF 4XH5A 3TSQA 4Q5WA 4XU1A 5C12A 3MEUA 5HKCA 3H45C 1LOJA 4BROA 3AHUA 2RJFA 4MZMA 4C92A 3V8KA 5A0DA 1KAYA 2WC9A 5E84A 5KQ8A 5F0XA 5AQHA 1VQ9A 4PL7A 3A8MB 5BN9A 5TKYA 4E7HA 3R1XA 2DZCA 4BRDA 2ZGZA 3PTAA 4KH5A 5EY4A 2WACA 3FRNA 3A5OC 5GAEP 3VJPA 2HNIA 4JN4A 1YJNN 2QI2A 2NRTA 4Y0WA 4BB7A 5CR2A 4M7AG 3CCEA 4OVAA 2KKZA 3HAXD 1HKCA 5I21A 2FXUA 5DCVA 4MDXA 2DAQA 2X4JA 3DLLL 4HCZA 2P9KA 1DJ7B 2DK3A 4FWPA 4CI6A 5IT9M 3PMTA 3M58A 3GF5A 1ATRA 2DD4A 3J7AF 1MWKA 2K3YA 2P9LB 3QZ9B 4X3MA 4IEIA 2ZPGB 3X28B 1KQ2A 4N0AC 2EAYA 4O8KA 4CD1A 3OW2S 1U2VA 2HD0A 3L2VA 2P9UA 4JUVA 4C92F 3WT0A 3HHTB 1VQ9F 5KE2A 5GIPC 1Y96A 4FWRA 4H5TA 1NE8A 1NPRA 4LD9K 1VQPA 1YI2N 1CK2A 1KD1O 4A57A 2RK2A 1RDUA 1N8RH 3URGA 3CCEF 4E1JA 3V8LA 3QUIA 1I4K1 4BC3A 3WXLA 3BFMA 4EHTA 1BI0A 4BI3A 1ZHIA 3A8GB 4MDBA 2RI5A 5A2QE 4J83A 4N4HA 2E10A 5JLHA 3FZKA 2WSEE 4FU6A 3EKSA 3H6EA 5FPMA 1VQ7N 4YOWA 3M54A 3JAMM 4BRMA 3UKRB 4C5EA 1TYQA 4WF9L 3Q1JA 5C10A 2QWNA 5BPLA 4EDUA 2XK0A 1D4XA 4H5NA 2ZJRL 4H0YB 1RDWX 2CZWA 5HOOA 1KC8H 1VQMF 2ZPHB 4JD2A 1BKBA 4H0PA 4IXCA 2E6ZA 1VIFA 3K9JA 3LH0A 4H5RA 4YOXA 5GAOn 2RJDA 1VQPF 4OB3B 1M9SA 4FPAA 4A62A 1NJIH 1M1KC 1ZC6A 2GUPA 2LTOA 2FF6A 4AF1A 5BN8A 3VUZA 1KC8C 5LJ5h 4JRQA 4BC5A 2CGKA 4BR2A 1QVFM 5G4VC 4CRIA 5LJ3f 2E65A 4C4WC 5LJ5d 2OZBA 4CZIA 3A8OB 1W2BS 4DKWA 4M78G 2QWLA 3G25A 4I6MB 2CKKA 1NJIC 3UKUB 3OB9A 2I6DA 1K9MH 5CQYA 1G3YA 1QVGM 3CC7A 2KK4A 3E1YA 3SMPA 2GFAA 2VUBA 3INZA 2CH5A 3BP8A 3F70A 2M9UA 5AQOA 3OA9A 3DLMA 3MHXA 1X3NA 5GMKm 3LDLA 3L42A 2P0QA 4TZZA 4C92C 4M77B 4JHDA 1K9MC 3SBTA 1S72A 4K42A 3LL3A 4FWLA 1B34A 3LDPA 2P9NA 3CCVA 1N27A 5LJ3g 3I55A 3SAFA 3SLCA 5FU7C 1S3XA 1BI3A 3MX5A 2JWLA 3H1QA 3CMEA 5M1QA 5A0LA 3UPUA 1OVYA 4XTUA 5GANK 2VC8A 1VQ8A 1OYXA 5M9OA 2ALEA 1M90H 1M1KO 4A54A 3X26B 2P9SA 2ZPFB 5LJVA 2VXEA 2GLZA 2V52B 2YX6A 2X4YA 1U1SA 1YJNT 1YVNA 1WNLA 4RKUE 3E9PA 4BRHA 4X3LA 3CC7F 3AAQA 3MN7A 3OBWA 3M9QA 4L59A 4M7AA 4HT9A 5C2DA 1BI1A 1BWFO 5GAOm 3QHSA 2FLOA 3LM9A 2KY9A 3VESA 1JJ2M 1DGKN 1VQKA 2E1YA 4ELYC 3L0QA 3GIBA 4QQGA 2CZ0B 5AFUA 4A4FA 2OTLN 3QB0A 2JN0A 1S72F 4JK9A 3GBTA 2QA4N 2AA4A 5FRNA 5AQLA 5KPZA 3CCVF 2AP1A 3CCQT 3I55F 3UDCA 4QS9A 5A0GA 3CXCA 4Z02A 5GAMj 3SFMA 3P31A 3CMEF 1KQSA 3ZX2A 3CC2A 2M1HA 4II1A 3D7EO 3E1SA 4IUPA 3UE5A 1VQ8F 3V7SA 4ZTFA 3L2UA 1YI2T 3AGRA 2PFUA 4XU3A 2YLBA 3NFCA 2DIGA 4PKCC 1T6DA 2QWPA 1N9RA 2FSJA 2JTFA 2HSTA 4H0VB 1RGIA 1QW1A 1V4TA 2P9IB 1XUPO 2OTLA 5C2FA 3V8JA 4JKGA 4BC4A 2V7ZA 4MO4A 1QVPA 4BY6C 3TSUA 4GV3A 1VQKF 3ULEA 3CPWA 2NLUA 4JS4A 4KUDK 2OTJA 3U4LA 5LJ5j 1VQ7T 4M7DG 1VQOA 4J7IA 3QICA 2EYQA 2ZCFB 1QZ6A 3KZBA 1GO0A 3T9NA 2NRZA 5AQKA 1VQ6N 1WQ7A 3LDQA 3OYKA 4NB4A 3F5TA 3CXCF 5D6XA 3IFRA 5AQNA 1KQSF 3CC2F 3BEXA 1NGAA 3CMAT 4E7LA 3VTHA 3VYGA 4J6YA 2KAFA 1VQ4T 5GIOA 3JCMQ 5BREA 3VF4A 3QZ5B 4XTVA 3GOIA 4QVZA 1K8AH 3BW1A 4BG8A 3Q7CA 3OS2A 2OTLF 5HY0A 4ZN3A 1OZ2A 3HOTA 3IKMA 3CPWF 3QFUA 1IREB 2OTJF 4WFBL 3W0LA 1K8AC 4JJNK 1VQOF 2VXFA 3PIPA 1BYMA 5LJ3h 5M1OA 1PXWA 4KH4A 3F2KA 4WQ5A 3GYQA 5CKFA 2NRVA 4JKAA 3FFMA 3TPQA 3QYHB 5I2MA 3HI0A 4Z94A 3JCMe 4CZJA 3RKYA 4P5NA 1FWZA 2YHWA 4QVDA 4A5AA 3NVKA 3EE9A 3OMGA 3QPHA 1K73O 4LD6A 1HPMA 2VYPA 4GY5A 4KT0E 1YHQT 3AY9A 3CCMN 1BU6O 3E19A 3RA5A 3MX2A 5CKDA 3LWHA 3ME9A 3JCMf 3CCRT 4JK8A 2MMPA 3O9UA 3I8BA 2CZ1B 3E9OA 4IKFA 3SJHA 1X3MA 4B1ZA 4FWQA 3MDQA 2QQSA 2YHYA 4ATOA 1CZAN 1N6AA 5HXZA 3JB9H 1KHCA 4U7BA 4BR9A 2LCCA 4M7AC 5DM7L 3J8AA 3CCSN 4MDAA 2P9LA 3J7ZO 5GAN5 4R56A 2NNWA 5BPNA 5JICA 3NVKE 1Y7XA 3JB9J 1V29B 4BVOA 3CCMA 4L6V5 4C5GA 5FU6C 2HBKA 2BKDN 2R5MA 3M4GA 1UGQB 3KWIA 2QEXN 2E12A 3NVMA 2RA2A 3C94A 2OAUA 3LGFA 3JCMg 5E26A 3WXMB 1GLJO 1V4SA 4FOIA 4KH6A 2I7PA 2DO3A 5GAPK 3CQXA 4XK8E 2XI9A 2GX9A 1T0KB 2IIRA 1PSEA 4JKFA 3OYJA 1XQSC 4FIBA 5GAN7 4C0GA 1I8FA 3HSCA 4K43A 2LQ8A 2HQEA 3SAGA 4C1NI 3CCSA 4JKBA 3FIFA 5GAMf 1JBMA 2QM1A 1MWMA 2ZJQL 1YJWN 2PUKB 5DLOA 3CCJT 3RSEB 4XH1A 4IUTA 5GAOp 1JCFA 5FLXE 2ZZDA 1NM1A 3C0BA 4BY9C 2FL7A 3CJBA 3HFOA 4LDXA 5CKHA 1YITN 4F7UB 3CCMF 1HUXA 3R8EA 2HBLA 3O1WA 1MHNA 2NRWA 3RKXA 1RI0A 1TH7A 1NGDA 3MWPA 5B8HA 3VF6A 4E7IA 5GAMg 4LDWA 2KG4A 2DKGA 3O6WA 2Q2RA 4A2AA 1VQ6T 4YOVA 4M7DA 4PJOD 3O5BA 4JAXA 5GIOC 3SDZA 3P38A 4IOXA 2ZWHA 2PQWA 4M75B 2KDSA 4LDUA 3QXEB 1Q86O 4LDYA 4IFEA 2DPNA 3J7AR 5ELZA 5GAGP 4A53A 1YITA 4PJOA 3A8LB 3CETA 3UKUA 3ENHA 2LRQA 4J8OA 2XD0A 1M5Q1 3OS5A 3OW2A 5ADXA 1RLGA 1VUBA 3A5MC 2PVDB 4XTZA 4M77D 5JMVA 3OMCA 1Y07A 5LJ5g 4WQ5C 5J3BA 3FZFA 3BF3A 2AHJB 3TU4K 2BH1A 1KD1H 4B1XB 4C0DC 2P0PA 5TKWA 3CCEN