3MCAB

Structure of the dom34-hbs1 complex and implications for its role in no-go decay
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
372
structure length
341
Chain Sequence
IEKNSGWITMEPEDMWHLYNILQVGDQLKASTVRRILVENMDFDTKAAQLHIKRTTEYHPMGSYHTLDLELHRNFTLYNEWDAFALDRVDAACNPSAEIGAVVLDEGLANICLITDYMTILRQRIDQVIPRKRRGDSSAYQKGLDKFYDSVFQSINSEFDFDKLKVVILASPGFVARGLYDYIFSMAVKLDLKQIVKSKNKFVILHSSTGHIHSLNEILKDPAVESKLADTKYVQEIRVLNKFYDVMNEDDRKAWYGPNHVLKAFELGAIGELLISDSLFRSSDIATRKKWVSLVEGVKEINCPVYIFSSLHESGKQLDLLSGIAAILTYPVDEEDISEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor 1 alpha-like protein
publication title Structure of the Dom34-Hbs1 complex and implications for no-go decay
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Translation regulation/hydrolase
total genus 88
structure length 341
sequence length 372
ec nomenclature ec 3.1.-.-:
pdb deposition date 2010-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03463 eRF1_1 eRF1 domain 1
B PF03464 eRF1_2 eRF1 domain 2
B PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.870 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mcaB01
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3mcaB02
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3mcaB03
4X3LA 3LWVC 1GZ0A 3CC7F 1W40A 1ZWZA 3LWOC 1GO1A 3LFOA 2QA4F 1YHQF 1M90H 5A2QM 3CCRF 4AF1A 5FLXM 5GIOC 4BW0B 1GO0A 2AIFA 1RA4A 1E7KA 3LWQC 3CC2F 3WXMB 2QI2A 3I55F 3CCLF 3CMAF 1VQPF 3O85A 1YITF 1M1KH 1W41A 3RA5A 2BO1A 3CXCF 3I56F 1S72F 1YJWF 3VMFB 1VQ5F 3LWPC 2FC3A 3CG6A 1JJ2F 1YI2F 1KD1H 1CN7A 4NUTA 3ON1A 3CCQF 2I6DA 1X7OA 1QVGF 3CD6F 1VQ4F 3PLAC 3PAFA 2LBWA 3CPWF 1Q7YH 1W42A 3CPQA 1K73H 2OHWA 1NJIH 1K8AH 1SDSA 5DCVA 1QVFF 3FFMA 3CCEF 3CCUF 5GIPC 3G71F 1VQNF 1W2BF 1VQ8F 5IT9M 3CCJF 2OZBA 5G4UC 4X3MA 3SIUA 4LCKA 3CCMF 3MCAB 1VQMF 3CMEF 2ALEA 1T0KB 1RLGA 3OBYA 3VI6A 3NK6A 2WALA 5GINC 1VQOF 2KTUA 3SIVA 3E1YA 3LWRC 1IPAA 1N8RH 2OTJF 3J7AR 3E20B 1XBIA 3JAMM 3V7QA 3NMUC 1PXWA 2HSTA 3CC4F 1NMUB 2KG4A 1Q86H 3RA6A 3HJWC 2VGMA 1W3EX 5GANK 3J80M 3G4SF 1X7PA 5EO3A 2LBXA 1VQ6F 2JNBA 3G6EF 3CCSF 1YJNF 4BY9D 3AGKA 2KTVA 3OW2F 1VQKF 1VQ9F 3V7EA 1KC8H 1KQSF 1CK2A 1X52A 1H7MA 3OBWA 2QEXF 3N4YA 2VGNA 1YIJF 1Q82H 2OTLF 4TZZA 3IR9A 3GYQA 3J81M 4C4WC 5G4VC 3NK7A 1YJ9F 2CZWA 3NVKE 5FJ4C 3CCVF 1DT9A 1K9MH 1VQLF 3NVIB 1Q81H 5EWRA 1VQ7F 3HAXD 2HVYD 5GAPK 3N4ZA 3JCMM
chains in the Genus database with same CATH superfamily
2F9WA 1WJSA 1Q82O 4ELZC 5I2SA 4M7DF 3BP8A 3LFOA 4M75G 1JXBA 3MAQA 1BKBA 1QSYA 2I0NA 1Q82R 3M3ZA 4B1UB 3LMEA 4BT3A 3B8AX 3SQ2A 5FLXM 2YNFA 4BRNA 1QZ6A 2NUPB 2D0AA 1E7KA 3R0PA 2E3IA 5HRNA 3PX0A 1GOBA 1YJNN 3I33A 5JLHA 3S0WA 2GLZA 3RNJA 2A3LA 2OYQA 2A1RA 4F3OA 3AVGA 1IO2A 1ZSZB 1EFNA 5AR0A 4EB6B 1UHFA 1G99A 1Y97A 1U1SA 4HVWA 1UDLA 3FZLA 4FJJA 2QWQA 4XTZA 4CHZA 1KSPA 3WGNA 3JARA 1CKBA 1RTDA 4TV8A 4I2QA 1ZBIA 2QQRA 2UXCK 2UZHA 5AQOA 4NXNK 3FD6A 4OMQA 4DOVA 4RTFD 4J9IA 3L0QA 2JMAA 2HF4A 4AHTA 2IG8A 1BCMA 4M78D 4AG1C 2YKMA 5G4VC 1U45A 4M7YA 1OVYA 2DXUA 3CCVT 5JH7B 3IUCA 4WQ4C 2P84A 3CCUF 2YJFA 1SL2A 2DJZA 5I11A 1WLPB 1U2VA 2KYBA 2X74A 3P8DA 3THWB 3KLIA 4M77G 4C92F 4JS4A 3ZT3A 2Y1JA 4CVNE 5IT9O 1WN7A 1N5ZA 1Y7XA 3EGXA 4LF4K 1WUAA 4KRTA 2RE2A 2VCPA 3F5TA 4JKCA 4RTZA 5C25A 2HBWA 3NHGA 1MMGA 4LY7A 4FW2A 2WALA 3I8BA 3H0IA 2LMJA 2DPPB 3CCRT 1WSHA 3MP6A 3ENHA 2MWPA 4W5OA 4U7BA 3KBGA 3RKYA 3MBMA 3E9LA 5CA1B 1SA0A 1UFYA 1IXDA 3ZX2A 1XTDA 5EVZA 4A5AA 4KULA 2YSQA 2O9VA 4HUGA 3E20B 3S06A 2F2WA 3K0TA 4B45A 1KFSA 5IYZA 1J3TA 4AQYK 1U8RA 1J9AA 2OTJA 5JCOC 4JJNK 1ZQ1A 4CEDA 1C6VA 2OPSA 4R79A 4A4EA 3LDTA 2KYMA 3RA6A 2HMAA 3PY8A 1KVCA 1VQMQ 2D4WA 3DOKA 1SSFA 3TSPA 1HUXA 5C10A 4B8CA 1B3QA 1HSQA 4W5QA 4HVVA 4KRFA 2Q1NA 2QGFB 5TKYA 4CF9A 2RH2A 1SPKA 3EFSA 1FFXB 1ZBFA 2B5JA 2HQHA 2K3YA 3E1SA 1OYXA 1T3LA 3GLXA 4HCZA 2HHSA 3K5MA 3C12A 1Q7YR 1HQUA 2HW3A 4ZHRA 2X51A 4DOWA 3H46O 5LJ5e 5GAMe 1YJNA 3MECA 1VA7A 2K2MA 4BREA 3CCJT 1VQMN 4W5NA 5C2DA 1WOQA 4CJUA 5B8HA 3N4YA 2J4RA 1T8EA 3ERNA 4N56A 3D6RA 4NWOB 3VF2A 2ETJA 2VKNA 1XC9A 1JEGA 1WSJA 1XI1A 1TKTA 2MIOA 2YUNA 4FM1A 3NVKE 2ITMA 3THVA 5HY1A 2MWOA 1BBZA 5EWRA 2CP3A 3U3YA 3WQTA 4RW4A 5GAPK 3N4PA 3JASA 3AA4A 3PT9A 3LZJA 1PKTA 2RK2A 1W9HA 2COZA 2CGJA 2MF2A 2BZ8A 3L42A 3NF7A 2Q2RA 5AQNA 2CP2A 4X34A 5BN8A 1YT3A 1WYXA 1KVBA 1R0CB 3HKDB 3HRGA 4ZHVA 4JKAA 2IVWA 2M0YA 2CGLA 1BOTO 4FLVA 2UYTA 2E6ZA 5LA6B 5ITZB 4BRCA 3QO3A 5E26A 3CMAF 2QYZA 4DXDA 3PO4A 5M1QA 1T0HA 3KWIA 2RB6A 3A2FA 3G10A 1S72F 3G6ET 4UQGA 3UA7A 3IFRA 3GOXA 4B3RK 2B8AA 3LWLA 4CGHA 3L1AA 1VQOT 1VQKT 3GP8A 3B6NA 3M0TA 3JCMW 4H5NA 5MN5A 2HDAA 2FEIA 1RBUA 3WUHA 5SZTA 4XTYA 1RDUA 4O2AB 3C4SA 1JJ2A 3D45A 3OW2M 1YIJT 5HL7L 3NAEA 2QK0A 4MLHA 3CPQA 3QNNA 1GFDA 3D00A 2HCKA 1AVZC 3EE9A 3VF6A 4M75A 3EN9A 4CJ5A 3QEVA 2UYJA 2A5XA 5CE3A 5JLFA 1IKYA 1KC8C 3CCEF 2H3GX 3JYTA 3JCMJ 1QKXA 1IB8A 3BY5A 4LC9B 4IHJA 2RHZA 2LQWA 1G15A 4X64K 1VQ9N 1TK5A 1Q81R 2DEUA 3FC3A 4KH6A 9ATCB 3M0SA 4CIGA 2V1QA 1T6CA 3M8RA 2PZSA 1JRIA 2NYSA 3CBOA 3NFCA 5GMKl 4JRPA 4ID5A 4DU1A 3VQ7A 1M8VA 2DK3A 1OEBA 2HNIA 3K57A 4MMKA 1HKCA 3CCLN 1Q86C 5K14A 3EFOA 3AA5X 4BC5A 5CB4A 2A1SA 4CF2A 4AHUA 4M7DG 1BQNA 3HOSA 4JI5K 1RTJA 2DEQA 3R6OA 3FEOA 2IQQA 3CFRA 3VO8A 2E70A 2QAZA 3F9MA 4CZLA 4J8OA 3I56T 1LVKA 1YJWT 1FNKA 4MZPA 1W5FA 4DR3K 1NMNA 4PHTX 4KTZA 3M9QA 3CYPB 3E2UA 3M59A 5LJ5j 5GAMj 2QWRA 1OU9A 3AVBA 4O4GA 5KQDA 3CCMQ 2BZXA 2RHXA 4O4LB 2KNBB 2ED0A 1QVFP 3FZKA 3VGKA 4YOYA 3VOAA 1WJRA 1HR0K 1RT7A 5JQGB 3OA6A 4RW8A 4M77A 1FMKA 1MGQA 4GMJB 4E1MA 4CHPA 2V1RA 3H45C 2JNBA 1HNVA 2WUSA 4FJXA 2FSNA 4FK0A 4JKGA 4BQLA 4OVAA 2KTVA 4RCBA 4KUDK 3H8ZA 5GAOm 1EETA 1TL3A 2VQEK 1ZUUA 2O8EB 3VGLA 2EQKA 3OSVA 1ATSA 3CCMN 2E1ZA 3QEXA 3OW2A 3DM2A 1VSFA 2QWOA 2FL7A 4DTXA 1WSGA 4BRFA 1Q86O 4Z4CA 1Q82H 5CO7A 1C6VX 1MMAA 2DY4A 3DRPA 2QTDA 4QQDA 1GCPA 3H3OB 4OPKA 5J2UA 4BGBA 4EHTA 2P9LB 3G25A 2CREA 4DR6K 4O2BB 5CA0B 3LL3A 3M8PA 3SJJA 3RWUA 3EZ5A 1JL2A 1N9RA 3CD6T 2IIMA 3HOTA 3FBAA 2Z1HA 2ZZDA 1U3LA 4X1YB 4R40B 2X6NA 3OA9A 1Z9QA 4ISGA 5GANg 4CGDA 1SL0A 3Q7CA 3CC7F 5GANd 5AQVA 3TAEA 2IVPA 4OB0B 1YVUA 2K57A 1C0FA 2V26A 2MK5A 2RJEA 3WEEA 4M78G 3E9GA 3ATUA 5KRTA 3G4SN 3SUOA 1TK0A 3GNGA 2DL4A 3ME9A 2WFBA 4AF1A 4JI1K 2DILA 3PSIA 4AILC 2A37A 2LT1A 4DV0K 1VQ9A 2EWCA 1E7OA 2HP0B 3FJ5A 1YXQA 1Z05A 4KGZB 4B9VA 3I55F 2P4TA 4AFQC 4KAZA 1JY8A 5HOOA 1B92A 2FXUA 4OPJA 1GFCA 4YFUA 4YJ2B 2QQAA 1NJIC 1K8AC 4FLTA 1Q9XA 3CCLA 1BCOA 4GBQA 2M51A 3MXJA 1OI1A 3C6HA 5M1FA 2FLOA 2IC3A 3MX2A 3BUZB 3RSEA 1KSWA 3K9JA 3QHSA 4J83A 1TKDA 1YBYA 3JCMg 3BW1A 3JCMd 2J7IA 4JI8K 4IWVA 2H6LA 3V9SA 1WHJA 5DLOA 4XCQA 1W70A 3CCUQ 4BRLA 2ASOA 2RHKA 4MMLA 3GOIA 4O0IA 3KLGA 1WBBA 4D8KA 2HHUA 1YN8A 4M3XA 4A61A 3C9UA 1NKBA 5GIPC 2JWLA 3HBTA 3L3VA 4F7UB 4QOZB 3ZT4A 2KGTA 4YDUC 3F6MA 4C8KA 1S9GA 3X24B 1IKVA 5HXUA 3EZWA 4JLIA 5EYPA 5A2QE 5DM6L 3VYSC 3DLRA 4PJNA 2X78A 2AK5A 4ZHYB 3CCMA 1OX8A 5FWCA 1NJIO 5JVGL 1K8AO 2KE9A 3HM9A 3SIVA 1K9MC 3V81A 4Z4EA 2O2OA 2V8JA 4M7DB 3CM5A 1NYFA 1YTAA 4EMGA 2VWKA 4FZZA 3LM2A 1ESVA 4HCCA 2X6SA 4CJWA 2CGHA 2HL5C 2DL3A 1XUPO 4BVQA 4FYWB 5AQHA 2HD0A 4IFYA 1NJYA 3N2KB 1H92A 3D2EA 2KMTA 5AYFA 3JB9H 1BQMA 1NG9A 4PY5A 3TPQA 1RGIA 4JI2K 3CM6A 2CZ6B 3V1OA 2QXFA 4C8QE 2ZVYA 5IJ9B 4CC3A 3OMGA 3QZ5B 4AMCA 2D0QB 3MEDA 2O88A 3G4SA 1S5JA 4JI0K 1QKWA 4BRKA 3G71N 1VQNN 1KTQA 5KYWA 4JS5A 2LP5A 1HJRA 4WBNA 1NGDA 4DTPA 3LDLA 3LYBA 2I2LA 4OMLA 1HX1A 4A5BA 2RO0A 3ZEUA 4BWMA 2F8SA 3GL1A 2YXZA 1O75A 3LM9A 3VYUC 3CFOA 1KQSA 2O31A 3DC2A 1QVFS 3QUWA 1D1BA 1OAPA 5CVIA 5I9EB 3GYQA 5CKFA 5GMKi 4IO8A 4C92B 5BMVB 2BH1A 5FNVB 1VQLF 3EG2A 3H1QA 1QP3A 1FSZA 3J7AF 2GGRA 1UHCA 2D5RA 1MNDA 1MNEA 3EGUA 2UYPA 2KHOA 2VYPA 2CP5A 3WVDB 3P4IA 3I7TA 1M4ZA 4M7DC 1N6QA 3UB5A 3DLLL 1SZ2A 1C0GA 2F2XA 4A4HA 4F14A 1YVNA 4H0OA 2IS3A 4LDUA 4QW2A 5F2RA 3V6DA 1COMA 1JXEA 4B3OA 4CJEA 1N32K 4XTXA 1KNKA 1FXXA 1TAQA 3ITHA 4N47A 5J2MA 2AZSA 1T3SA 4LDYA 3KK3A 3KJVA 2OA8A 3JATA 2SRCA 3ULRB 3CMAQ 3HPGA 1B9DA 3OJUA 4X20B 2D8HA 2GCXA 1KIKA 1S72Q 3SV3A 2FVUA 1TK8A 1YITF 5LL6S 4WYBA 2P9KA 3KTQA 3PUFA 2VWFA 3VQQA 3MHXA 1TKXA 3C9TA 4FCYA 1UGQB 3VENA 2E8AA 2FC3A 1U4BA 4J2DA 1L3TA 4XH4A 3BDLA 2VB6A 4L6V5 2JT4A 2YV0X 4PKGA 4ZGDB 2IAJA 4OLBA 2DKGA 1VQVA 2FBXA 4DFKA 3ON1A 3C94A 3UKUA 1QVGF 5HRPA 2K4YA 5EC7A 4A57A 1OX9A 3CJCA 3LWMA 3DI6A 2F4VK 1J53A 2LBTA 4J5YA 4MDBA 3A8MB 4PJOE 1NG2A 3ZSYA 3CCVN 2HHQA 2E6NA 2DZCA 2KRSA 4AT1B 1G3SA 4PK4A 2CKKA 2GNCA 1W6XA 2BE2A 3HP9A 4M78A 5IWAK 3B6PA 4B3MK 3ZSXA 4X1KB 3QBXA 4C92C 2O4XB 4KGXB 3IAYA 3C9RA 1U3OA 2GBQA 1CZBA 3EYZA 3A8LB 3JXUA 1VQNA 3G71A 3DXMA 3K59A 3CCRN 4M3UA 1XJWB 4BDZA 3MCAB 4PKIA 1I3AA 5AQGA 3QXEB 4OMPA 1FX7A 1BHLA 4FJLA 3QUIA 3PVLA 2O8CA 5I22A 3VU3C 5CY4A 1LWFA 5KQ8A 3DDNA 3FLCO 4N4HA 1IV1A 2QK9A 4QS7A 5CQYA 2FBTA 4BR2A 4EHUA 4CIEA 2BKDN 1IH7A 2AP1A 4K43A 3SB2A 4DBFA 2DIQA 1CXUA 1HNIA 1SV5A 3LP1A 3PIPL 5GAN8 3JAMM 1K8KB 5GINA 3C7NB 4C92E 1R77A 2WC9A 2XY6A 2BDPA 5EZYA 3N2GA 2HNYA 3V8JA 1E6HA 1JLEA 1RAGB 3NVMA 2KG4A 1Q86H 3O4NA 4E7KA 1YI2T 1AWWA 3LDOA 4ILGB 1W7AA 3BYQA 3D2FA 4WF2A 3WJQA 3TD5A 3VS1A 4Y91A 4O55A 3U3GA 1RUWA 3VEYA 1BIAA 1N8RO 2BTTA 2LCLA 2HBJA 2UXBK 4FOEA 3O1BA 3CCJN 1N8RR 4QVDA 4LDWA 5KYYB 3K5NA 1VQPN 2R6R1 3ZT0A 3AO3A 1H641 4NB4A 3RYCB 1VRTA 4RTVA 3SQ4A 2P9SB 3SAFA 3LDSA 3E22A 2RMOA 3MP1A 4RTYA 5AQLA 3K9KA 4JD2A 1XC3A 4JKDA 4CEBA 2MYSA 3QERA 3T1YK 1Q8IA 3KJKA 4CBXA 5DM7L 2KGWA 1UECA 3KHYA 4O6JA 3X20B 2GV9A 5HY4A 2QM1A 4DSFA 5MN4A 1D9FA 3QDFA 1H8KA 3VS5A 2CZWA 3VV0A 3ZSZA 2XY5A 4N41A 2GFUA 3CC7Q 3MN6A 4DR4K 4U39A 3UT5B 4BR4A 2DVJA 5KRSA 1S1XA 3L6QA 3SJHA 2FC0A 2O8DA 3CCVA 2BANA 3FZMA 2NRWA 3M0RA 1VQKQ 1TUYA 2RJCA 1D8YA 4FM4B 1PSFA 2YHBA 3KD1E 4WF9L 4J6YA 2G8UA 2ITGA 2EYYA 3TVTA 2ZGYA 3SQ1A 1UUEA 4CBUA 4C8LA 4N0AA 5LJ5g 5GAMg 2Z1UA 5LJ5d 5GAMd 2I6RA 4X9DA 3PIOA 3CCSA 1BIZA 5GIOC 1IZ6A 2LX9A 3I55Q 2OPRA 3CQTA 2YI1A 1VOMA 2RQTA 3ASMA 1X43A 3G6EN 3VS3A 3GPLA 1W97L 3HVRA 2YRVA 3VOBA 3CCRA 1QSSA 2Y4XA 2W6KA 3AVKA 1VQON 1VQKN 4L3QA 4BDPA 3LYIA 2BO1A 4C82A 3CXCF 1C1AA 4JKEA 5HWEA 3SZ2A 2KEAA 4OX9K 4R0KA 4A63B 1NM1A 2EJGA 3CBMA 3LPUA 1YIJN 2E1HA 3E66A 3HM8A 3R3LA 3KHNA 3VRZA 4L5GA 5F0XA 2JW4A 3QBYA 1U1TA 2AHJB 2KZMA 5C15A 5GAN3 4XEIA 5GADP 4OGEA 3G0ZA 3U0OA 4EI7A 3O1WA 1Z5VA 1HYSA 1SRMA 3QICA 3PAFA 2P0QA 4FWNA 2P9NB 1RT1A 4KHUA 1QS4A 3EGDA 3BF3A 5LXTA 1LCKA 2QKKA 1NJIH 1K8AH 3K0SA 1VYUA 1Q86U 1LAWA 4NQ3A 4DQQA 3AAQA 1NK5A 1PM3A 5J2TA 1VYTA 1VAZA 1KHCA 3I56Q 2QG9B 1YJWQ 2QXLA 4A62A 5LOVA 4HT9A 1RL2A 2LX7A 2KK4A 4KH0B 5IH2A 4KTQA 3SIUA 3JCMQ 3L2RA 2IGIA 1U3PA 3CCJA 3MKDA 2DIGA 1VQPA 1KAZA 3ZSQA 4GKKK 4EMKB 1Z26A 4JEPA 3HRSA 4FM0A 4FYDA 1OULA 4KBOA 3I56N 5GMKe 4JNEA 1GLLO 2M0OA 2E88A 4TUYA 2EW3A 4C8QD 3PX4A 3PX6A 2LCAA 2GVIA 2LDMA 4IDHA 2KZZA 1IV3A 3OYEA 4BACA 2KAFA 4E7IA 2DTHA 3F2KA 4M7AA 2K1SA 4RMOA 1VIEA 3THYA 3CC4F 3JAMO 2DERA 5EY4A 4PJMA 4Z4HA 4WCEL 3WXLA 5I42A 4XTWA 5HY0A 3D7EO 4R56A 3QPHA 4FFBB 1W4SA 2Y4YA 4Z88A 4YTLA 3CMEQ 4BDYA 1QE1A 3VTIC 2B33A 2KW4A 4PQUA 5EX5A 4DR5K 5F1XA 1L3VA 1G83A 2OI3A 2CH6A 3P38A 3VQEA 1VQ6F 1OFUA 2LJ0A 3WNFA 4DBHA 3RYHB 4LF8K 2HSPA 4X1IB 4ZHQA 3B6OA 3HKEB 4C8QF 2Z01A 1VQ9F 4PFZA 4FWRA 4KUIA 3G6EA 4FJ7A 1LWCA 2BUDA 3CCUT 4GY5A 2KLAA 3C0CA 1VQOA 1N5YA 3THKA 1P8ZA 3R6NA 3M0PA 2ZF5O 5AQXA 2ZPEB 3I35A 3CYMA 4WQ5A 1HNXK 3HWUA 1RBTA 4PL7A 1K0SA 2G8WA 3CCQN 4ELTA 1X6BA 4MDWA 3CD6N 3T9NA 1WQWA 2X9HA 1NJWA 4EI8A 1YIJA 2HS0A 3O5ZA 4B3SK 3HI0A 4LE9A 4XTVA 2VQFK 4EMKC 2XHCA 1KLNA 1LJOA 1WGSA 2NNWA 2FF3B 2YNIA 1VHAA 5LYJA 2I7PA 1Y71A 2PZ1A 4A59A 2DTIA 3NMZC 3UF4A 4JV5K 4U3JB 3M54A 1G3TA 3S0HA 3P8HA 2CUDA 2RQUA 1NJIU 1K8AU 1MDUB 4M4ZA 2P9UA 3ID8A 4J2BA 3VN5A 1BA1A 1VQ8N 1NEGA 4OMNA 2PVOB 5KYXA 4IOXA 1UFFA 5C24A 1HNZK 3RYFB 1YHQF 1GCQC 2B86A 1WB9A 1VQ7F 1KJWA 5KMGA 4LSLA 4CZHA 1KD1C 4M7DD 1RBSA 2AIFA 1TSFA 1V1CA 2HKQB 1YITQ 3M6GA 5BPNA 4FLUA 1HD3A 2RK1A 3VYGA 1GLFO 1TL1A 2VWBA 3ULEA 5AFUA 3H0HA 4PJOD 3JCMb 4H0YB 2NMUA 5FWBA 1T6DA 1DBFA 4IJAA 1VRUA 5GJWB 1TUUA 1VQ5F 1S1WA 2VUBA 5HCKA 2VG6A 1ONIA 5D6XA 2P51A 1TUBA 4RHAA 4C1NK 4GLMA 3LGLA 4KGVB 3ZP4A 2CH5A 3VCZA 2DT4A 3M8QA 1SUQA 5HKCA 3I56A 5GAOr 2UUCK 3G4SF 4B1ZA 4K8ZA 5FU7B 1LCUA 2EKOA 4KHNA 1RADB 1VQ4F 5AZJB 5AQWA 4CEOA 4PKHA 3HFOA 1J7HA 3OYYA 3CPWF 4VUBA 2PNIA 1B34A 3KLHA 3TAFA 2Q31A 5E41A 1HKGA 3T7ZA 3MJXA 4DR7K 4LH5A 1U40A 3KFVA 2AT1B 4PJOF 4AHSA 3FB9A 5GMKj 3VEOA 1JFFB 4B9LA 3UKRB 4NCAA 1P92A 1KD1O 1VSJA 1U04A 4O5BA 3P4EA 1JU5C 3OSSC 2PTKA 4OKEA 4BG8A 1W2BP 3VQBA 3G7ZA 4C92D 3T1AA 3VUBA 4WQ4A 4DU3A 4JI3K 1OH7A 4I6MB 2YX6A 3C0BA 3ZETB 1Y96A 3OYIA 1QVGM 3MXIA 4BQZA 2KTUA 3ZYYX 2LCCA 1QTMA 1NMDA 3CB2A 1IV0A 5GONB 1FK9A 3VKIA 1N8RH 3SLCA 4PFOA 3CCQA 3TWHA 5GAN7 5LJVA 3CD6A 3CMAT 1U2VB 3JAKB 2NUZA 2E4LA 3AO5A 1S72T 2V7ZA 2CHTA 2HRYA 4C8IA 3D7SB 4IZ9A 4DRXB 3HKBB 3EGXB 4IUVA 1M90C 1M3BA 3JAWA 2NUPA 4CK2A 3IKMA 4BY9C 3TU4K 2CT4A 1MU2A 3VQ9A 5LJ3h 5FU7C 2OX7A 1BG3A 3NHNA 3ZX3A 4CJ4A 4B9NA 1VQ8A 1RT4A 3ELCA 1OPLA 2LT4A 3OYDA 4RCCA 4D8DA 4ZGEB 3HVTA 5AQSA 2PYLA 4FVMA 1IV4A 2E41A 1W59A 2EBPA 2MAMA 5LJ3e 3SUNA 4H0VB 4OP0A 3VYTC 1OH6A 2FF6A 5HP1A 3JCMP 2E4HA 4DSJA 2IOCA 3CCET 4CC7A 2ENMA 4RG8A 5J26A 4B5CA 2VAPA 2QEXF 3RMBA 3O80A 1X6OA 3ZSWA 1QVFM 2E2QA 2OTLF 4C5HA 4TZZA 3IR9A 1RAIB 1ZSZC 5C8YA 3GTZA 4YOVA 3HKCA 5BR9A 3FPIA 3O9QA 2A6AA 1YNZA 3D01A 5JH7A 3AVCA 1DT9A 3LW5E 1SZQA 2ZODA 2K3BA 4PLLA 3THWA 3L7QA 1G2BA 2Q97A 2LVMA 3Q7BA 3TANA 2DM1A 3O4QA 1X75C 2RHJA 2VG7A 1PRLC 5LJ5h 5GAMh 2GF7A 4DG1A 1B07A 2E2PA 1D09B 3KE1A 3TTCA 2DTUA 2LJ1A 2HBLA 2QDYB 4HUFA 1GO1A 3VA0A 4EIKA 3P83D 4JHDB 2QA4F 5CA1A 1NOZA 1BIBA 1LPLA 4Q5VA 1AOJA 5AQUA 2KXDA 1UGSB 2RF0A 4IIMA 2VG5A 2VXYA 3EHQA 1RA4A 3O4WA 2G8FA 4LUDA 4B9QA 4CZIA 4KI6A 4BT6A 1RDAA 1BI2A 1I39A 3LWQC 1AZGB 4ZK7A 3QWXX 2EYXA 4OPHA 1ABQA 4Z4GA 5GMKm 3NFAA 1KHIA 2L3RA 1NLOC 3O9UA 4KO0A 2JTMA 4JZ3A 4X62K 2ZJPL 2PYJA 1G8XA 1QZ5A 2XDPA 1N8RU 1ZC6A 4HNAA 1X1PA 1X2QA 3AVHA 2D0CA 2PBDA 4KWEA 2HAXA 3ASKA 2EJ9A 4C8QG 2NRXA 2GWKA 1TWBA 2EGAA 2FZKB 1J54A 3J7AP 1FFXA 2WSEE 1PWTA 3OYCA 2HSEB 5HP7A 1NGAA 3LP0A 4EZ9A 2W40A 4ORZA 5EB0A 4F4KA 4IEEA 3LX7A 3J80E 3FIFA 1T3VA 2HNDA 4RG2A 3S3OA 3QO9A 3ZCMA 1XMQK 3FFMA 2C0OA 1PCXA 2H3JA 3M8SA 2IG0A 4QT7A 2YUPA 4FZXC 4B1WB 2ZVZA 3NGPA 1NLVA 5BPLA 1QVFA 3CXCM 1GX1A 1NM7A 3CC7T 3SWNB 4A53A 4DV1K 4K11A 2QGGA 4NOYA 1YI2Q 3P31A 5I21A 2JS2A 4Y92A 5FRMA 3MPUB 1Q18A 1RCHA 4IIJB 3K12A 5FLXE 5FDLA 3EG9B 2RN2A 4XU0A 5KE3A 2QKBA 2NUTA 2KXCA 3QZ9B 3GHZA 1TGOA 1C0MA 5CR2A 4DCHA 4EFHA 4CJLA 2HZYA 3M84A 4O4HB 4DB3A 3QYHB 3SEMA 3I55T 3M4GA 1QVGP 1K1ZA 2VC8A 3CC4Q 4CEFA 3RUXA 1FYNA 2P5OA 2H8HA 3SQ0A 1YI2N 5LJ3j 2NRRA 2O8BB 3AVFA 2JZ2A 2E5QA 4CFAA 4YOWA 2HVHA 4IUPA 3HKDA 1OZ2A 4BWJA 4BE0A 4CHQA 3EE8A 4F7UG 4DR2K 1E3MA 3RE3A 1OZ3A 3QJYA 3HJWC 3PMIA 4RW9A 1W55A 4AM6A 3DOLA 1YWPA 1I5OB 1D3BB 2BE9B 3EFOB 4OB1B 4B1XB 4ZI7B 1SRLA 2DX1A 3SDZA 4FL6A 1WSIA 1KQ1A 5CZ1A 2YRDA 1AEYA 4LF7K 2Z1FA 2CP0A 1EKEA 2VWJA 2ABLA 5FPEA 3K5OA 1R1MA 2V8IA 2ZGWA 3CCSF 2BIVA 3PTAA 5C0MA 2A3ZA 1VQMA 5T7BA 2RB9A 3SNNA 3ENOA 1WPYA 4WE1A 4BR9A 2RHLA 4KT0E 3PVQA 4O2AA 3RERA 1TUDA 4XQ3A 1NGEA 4LDVA 3QFUA 4MO4A 4Y1DA 3RMCA 1GBQA 3F0DA 4CGJA 3EG3A 1GXIE 3SYZA 4PJOG 1SKSA 5LY3A 3SWNC 5KTQA 4FM2A 4ID1A 1EX4A 5ADXH 3J81M 3H6EA 4J6WA 2PFUA 4M8IA 1YJ9F 4K8XA 3D54A 1XQHA 2FSKA 4R55A 1JLBA 1WNLA 2A0FB 5KPRA 1C1CA 2QASA 1WAJA 4EDUA 3DYAA 3O3HA 3S41A 3V8KA 1WZOA 1TG0A 1S1VA 3V9WA 1KC8O 3EH2A 2HVYD 3TD3A 2ZE2A 4H0PA 1KC8R 2CP6A 1YHQQ 1W5EA 3WGJA 4MFBA 4MZMA 4BT7A 1AWXA 4F17A 2XICA 3R6MA 4HVUA 3AHUA 1FW6A 1I1JA 5J2UB 1QHAA 1MMNA 3CC2F 3MEEA 1V29B 1VQ5Q 1Q86R 4BI3A 3O6WA 2UXDK 1VQPF 5KE2A 2OCEA 1Z9ZA 1SAZA 3CMET 5GAOn 3BZCA 2JM8A 2O9SA 3M57A 4PNOA 4C92G 4OVLA 4DTUA 3DLMA 4DLEA 2ROLA 5KYUB 5KYNA 3AGRA 3LAKA 4FJIA 2KY9A 2LZ6B 4M75E 4FLWA 5AQIA 3QDRB 3VEXA 4M42A 1KD1H 2OANA 1IBMK 1A5WA 3AVNA 4K41A 5JQGA 5CZ2A 4WFNL 4CJ7A 3AAPA 4PUOA 3WXIA 4C8QB 1DJ7B 2XKOC 3E01A 3I0RA 1M2VA 3TU5A 4CFCA 2OHWA 4DSLA 4CF0A 2O8EA 4LF6K 2ATCB 5J2PA 2BUPA 1JLGA 4OMMA 3U8XA 4ICLA 1FMVA 1VQLT 3WNEA 3IEQA 2J6FA 4OB2B 4BRIA 1W2BF 2RQWA 2XK0A 5GAOq 2CWJA 3ZT2A 3MEAA 3V9XA 3EY1A 4LNPA 4IXCA 3RSEB 2F1LA 3IEWA 2P9PB 4JK8A 2KT1A 4O5FA 4BR0A 4IEIA 1J5OA 5AQKA 5AFUH 1XNIA 4E2FB 4J2EA 2ALEA 1WXBA 4O2BA 3HSBA 5GIPA 5CA0A 3CXCP 1ZX6A 2XMFA 1WHHA 3RMSA 1VQOF 2V7YA 4ME7A 4LUEA 3CJAA 4C23A 4CF8A 2LCSA 3VS2A 1CLIA 1TVKB 4YDUA 4X1YA 4W5RA 4BG9A 3UWNA 3OHRA 1VYVA 4AFUC 1B9FA 3INZA 3CPWM 4PKCC 4RW6A 3V9ZA 1IPAA 1RLUA 1SHGA 4M77E 5CIUA 1YITT 1RI0A 3V7QA 4M41A 3OTOK 2WBNA 3NMUC 4B9UA 1PNJA 3M0UA 1NK6A 1NMUB 3KWGA 1QD9A 1TUGB 4ZTJA 1ZBHA 3VF4A 3SCXA 2NWMA 2QDLA 4H5WA 2DLPA 2KRNA 4DEYA 4C5GA 4E7ZA 2LBXA 4WFBL 3JCMV 1T44A 3FGUA 4J9FA 2GWJA 3HYFA 4ZHWA 4FO0A 4YJ2A 1NOYA 1M30A 1LAVA 4HTLA 4C8QC 3U6FA 4LNUB 1M5Q1 3SFMA 3CCUN 1QVGS 4BRHA 1NWKA 4BY9D 5GAN2 3A0IX 2LQ8A 4J9HA 4Z94A 1WLJA 1ODEA 4I50B 3O3FA 4L59A 3HPOA 2VXEA 1NJIR 2WSFE 2QEXQ 1K8AR 3RRHA 1N33K 2Q36A 3E9PA 1K4US 3SPZA 4G1QA 3A8HB 4CFDA 4GV6A 2CSLA 3TTDA 4GVEA 4RTXA 2VGNA 4FJ5A 5B8FA 1BB9A 1C0UA 1NGCA 4PJOB 2B4JA 4NXMK 1PKSA 4HT8A 5FPDA 2YJEA 4FJGA 4FJ9A 4QAGA 2YNGA 1K73C 1KD1U 2WTUA 4BY6B 3QESA 3FD5A 1M3AA 1Y57A 3J81O 3OYHA 1U48A 1KAYA 1I5LA 1BIUA 4F7UA 1A5VA 3DRRA 4KBMB 1TOVA 3MDQA 2F7TA 2HB5A 3KK1A 4GNIA 4WBNB 3HAXD 2BE7D 4PJLA 4K25A 1ATNA 1Z5WA 3LWVC 1M1KC 4NYNA 3URGA 2QA4Q 3RTVA 1JKHA 1MHNA 3AV9A 1DTTA 3FR0A 2GQVA 3EHRA 3WNGA 3UDCA 4BR5A 5BPMA 4PL6A 4A4GA 3ZOPA 2G3RA 4RUGA 3UPUA 3V9UA 4DMNA 3RR7A 3EEQA 5M1OA 4M7DA 1K9MO 2ZAUA 4I9QA 3LH0A 1IG8A 4DF8A 3PV8A 2COYA 5AQYA 1OH8A 1NQ3A 2BTOA 1K9MR 4XH1A 5E84A 2RI3A 4JN4A 3SUQA 1S6PA 1BA0A 4JAXA 1HMVA 3SK3A 1QAHA 4U67L 2HHWA 2CUBA 3W3DA 3M5RA 5CKEA 4ERHA 1D0XA 3P39A 5CAIA 4ELYC 3CCQF 3MWPA 1N34K 5LMNK 1X25A 1X7OA 2UUAK 3CD6F 5GJVB 3DLGA 4B08A 2YUQA 3OMCA 1A0NB 1ZBLA 2LNHB 3CIPA 2D0BA 4TV9B 4B62A 3TQ7P 3T69A 4PJOC 2JUFA 1M1KO 3DLKA 2P9KB 4CCHA 4FLXA 4JKHA 1P90A 4BY6C 1M1KR 2LQNA 1M1GA 1S1TA 1X9JA 1ZBJA 1CXQA 2I7NA 2AIRB 1EO1A 5A0GA 4O0JA 3JALB 3H0FA 3OYFA 3WGMA 2DXBA 3JSMA 1T03A 1VQ8F 2RHIA 3PIPA 2P4RA 2X4WA 4IIOA 1HRHA 3CCUA 4KHPK 1J5EK 4BRPA 3DLBA 1X9MA 2UU9K 1WXTA 3RR8A 3S03A 5GANf 1T0KB 2HRUA 2O01E 4NLCA 3VRYA 5BMVA 3TD4A 5FNVA 4LFCK 3CMAN 4N76A 1JCFA 1O9SA 2J06A 1S72N 1YAGA 2FPDA 1MA9B 2P9IB 5HRRA 4DFMA 2JN0A 2OTJF 2FG0A 3HRUA 5L23A 1ASWA 3E9OA 2D0OA 4LFAK 4JI6K 3CCEQ 4XU1A 1JXOA 2HSTA 1NZ9A 3A8GB 3CEYA 1LW0A 3CPWP 5AQRA 1IBKK 3DXMB 4FJ8A 4F6RB 5A0DA 4DSKA 4YOTA 2DJQA 3HPWA 3QB0A 4H8KA 4HCKA 3CXCS 2FRYA 4X20A 2KVQG 2JTFA 2JMCA 2M16A 5D6WA 7AT1B 2LJ3A 5C6SA 1WNSA 3TAPA 2O8CB 2L3QA 3DLEA 1KG1A 1TUCA 1WFWA 1N36K 2E5LK 1FKOA 3GBQA 5AZIB 5IXBA 3LZIA 3RKWA 3CCEN 4JLGA 3JCMf 3AA2A 4M3RA 4CZMA 4DU4A 1L3UA 1KNJA 1YJNF 2QWLA 4CESA 1KC8H 4C0DB 3M55A 1YF5L 4E19A 3I9QA 5AQFA 3S3NA 2QW9A 3N2GB 2K9GA 1X3NA 2E6LA 4H0TB 4JKBA 2EWNA 2CDTA 4ILHA 1FWZA 3QMLA 4FK2A 1QLYA 4C8NA 1YJ9Q 1WX6A 2L5QA 3EG0A 1SKRA 5GAHP 5EB1B 4XIUA 5FJ4C 4O4JB 4X1KA 3P10A 2FPEA 1VQ7Q 2DD4A 3REAB 2ZOVA 5GAOp 3DXKB 4DKWA 3ATVA 4BUGA 2FHDA 3RYIB 3VS0A 2DL8A 2CYZB 3MX5A 2DFFA 2P0PA 3BEXA 4CJFA 2MMPA 3LP2A 4KI4A 3E22B 4G4ZA 5LJ3g 4DTNA 1QQMA 1WDXA 5LJ3d 2FGYA 2KROA 3A8YA 4JD2B 4I4TB 4B9WA 1D4XA 4GY2B 5A0LA 4ESRA 4XU2A 3LWOC 1AD5A 1IKWA 1DEJA 3CC4T 1H1VA 2CZ1B 2E12A 2DL5A 4QQ6A 2XY8A 1QW1A 3UE5A 2V9YA 4BE2A 1W0HA 2KSSA 2LQKA 2GTDA 3HSTB 4C8EA 3E9FA 1K8KA 3C7NA 3RA5A 1VQ6T 4CEZA 1EXQA 1JB0E 1KFZA 1KQ2A 2KKZA 5GIOA 4QKUA 1M2OA 3CMAA 4N5SA 1UGRB 4M78E 3X26B 1X01A 1VQ9T 1JJ2F 1I4K1 3TSWA 1S72A 5DM7R 1RBVA 4YNQA 4C0DC 1QCFA 1RAAB 2QTVA 3VERA 1AHJB 4KHWA 3CJBA 2A40A 1OVQA 1TYQB 3HFNA 1BISA 4ILJA 3C95A 4B9MA 1IHWA 2ZGZA 4WFAL 3TARA 4ELVA 4ZOLA 4M75F 4DEXA 2EX3A 1S1NA 2RHHA 4IOCL 2QQ9A 3K58A 3E19A 3DWLA 2CZ0B 2ZPGB 1LW2A 3AA3A 4GKJK 5KYYA 4BVTA 1BI4A 3OYAA 2XY7A 2UUBK 3KK7A 2W41A 3CC7N 4DQ2A 2P9SA 1R0BG 1GLCG 3NF6A 3RIRA 1XMOK 5KX5B 2DPNA 4Z02A 4EPCA 2EFIA 2R5MA 2RHUA 5J39A 1VSLA 2HNZA 4TSXA 1VK0A 3CCEA 1E4FT 4YOXA 1KXPA 2IIRA 2HKNA 4YJ3A 4DTOA 1W5AA 5FPMA 4B1VA 1KC8U 1VQMF 2DD5A 1LOJA 1RLGA 3F0GA 1YHQT 3RMDA 2ESWA 4NL3A 3NCIA 2CZ7B 2M02A 3AARA 4CZEA 2A36A 3I55N 4E1NA 1BO5O 3OS0A 1X6GA 4M45A 1REVA 1WQ7A 1AZEA 4IBNA 2O8FB 5BRHA 2KQ2A 3QYGB 3VQCA 5J2TB 1JBMA 2VAMA 3HRTA 4Q0BA 2L3SA 1V4TA 1PF5A 3QNOA 2UYKA 5LOVB 1ZUKA 1NPPA 1TAUA 2CSIA 5IJ0B 1VQ5T 1D5AA 3DRSA 3KKRA 5LP6B 4A2AA 3P1GA 2M1HA 4IG3A 4CW7B 3SI6A 3T1HK 2HMIA 1W2BM 4M77F 4AFZC 1SS6A 2E65A 5IN1A 3IQLA 3VJPA 2ZJRL 1H48A 3U9DA 4J9CA 2L0AA 4FIBA 3A5LC 2ZM6K 1VK3A 2QTPA 5GANK 2FBVA 4B9TA 1ZHIA 1VQ4T 1UGVA 4WTOB 2XD0A 4JUVA 3AVIA 1I94K 5GMKh 4JLHA 4BVPA 3CQ8A 1NKEA 1RLPC 1UWBA 3UATA 3J8AA 3OW2F 2DBKA 2N48A 3S9HA 4BRQA 4O4HA 3VTIA 4O5VA 5GAN4 1NBEB 3CPWS 1TU0B 3FFIA 3THYB 5EIBD 2XIDA 4DTRA 1YJWN 2CH4A 1R8OB 3JRZA 5ADXA 3VQPA 2P9NA 4KPYA 3O8MA 4NCGA 5EO3A 3LDNA 2F96A 3EL2A 4IO9L 3F9KA 3ESJA 1PD0A 2ROTA 1KVAA 4JI4K 2PAVA 4YY3K 1YUWA 2W42A 1SKWA 1HPZA 3MN5A 1NGHA 4HHTA 5D3GA 2BGGA 1K9MH 4LN2A 3WVEB 1YTUA 3TREA 1N9SA 2PMPA 1RAEB 5JVDB 2GTOA 1MV3A 4IDKA 3N4ZA 2JWKA 4P5NA 3JCMM 4E7HA 3JAME 4BROA 4GV3A 4K42A 3L2UA 4F2RA 1VIFA 5IHKA 1FMWA 1GZ0A 2X3XD 2UYNB 4O4IA 4F16A 3R8EA 1UTIA 4EMKA 1JLCA 1JO8A 3CC7A 3PE0A 2HL3A 4JJCA 3OYMA 3LLRA 3THXB 3W0LA 4HXJA 5LP6C 2P1JA 1VQKA 3CMEN 2RI2A 5HRSA 3J7ZO 1S22A 1VSMA 4DV6K 2V8KA 1HK9A 1QCNA 3GF5A 3UIQA 2Z0WA 3CCLF 4I55B 1M1KH 2DYBA 1W41A 1GCQA 5FROA 2XU8A 3L2QA 2DA9A 1VQLQ 3JVHA 1VSEA 3Q8HA 3VMFB 4RTTA 3I55A 1K0XA 3A5NC 3LWPC 4FFBA 3M1FA 3SHWA 4G9ZA 1ATRA 5AJ3K 3CPFA 2DL7A 3WGKA 4AG2C 3PLAC 4OMFB 1KCFA 3QIPA 2OZMA 1XNRK 2QEXT 5M1NA 4HVJA 5CQXA 3ZSOA 5FU6B 3NH2A 3RYHA 3RDVA 2OTLT 1QHTA 1X9SA 2JLEA 2DYIA 1VQLN 2ZD1A 3ULEB 3HKEA 4IJNA 3SBGA 2COWA 2L8DA 2NLXA 1IGUA 2YLBA 1EZZB 2YCHA 3H3NO 4BT5A 3TR8A 4HKEA 1HYZA 2DFEA 2A7YA 4YOUA 3NTIA 4C8GA 1YFNA 4OPAA 3F73A 3ISNC 2F9TA 3QEPA 1XNQK 2OPQA 4X3MA 2FPFA 3HJFA 3KJJA 3CCMF 1Q82C 4DQRA 4FJHA 4Z4IA 1HPMA 3SD4A 1EQYA 5KCHA 4M7AE 4W5TA 3OBYA 2QA4T 1NJXA 4GVMA 1YJWA 1D9DA 2AKLA 2DVEA 2KDSA 1IV2A 4OMOA 5HP8A 3MQWA 1BU1A 2EYQA 2OTJQ 1YITN 3KKSA 1MWKA 1U47A 3O08A 4CHNA 4U3JA 5LJ5f 5GAMf 2C0TA 3WPWA 3C8LA 5DY9A 1AT1B 2HHVA 5C0YA 5M9OA 4CJTA 3QSUA 4G88A 3C6AA 4JJDA 5BR8K 2D6FA 1XBIA 4DSIA 5TKWA 1N6AA 1PXWA 5DK5A 1NGIA 1K9MU 3CJ1A 1C1BA 4DTSA 4XU3A 2O4IA 4NCBA 1YWOA 3EKSA 3VTHA 1ZYQA 1W3EX 1M1FA 2YDLA 3ZFJA 2Z1TA 1Y96B 2DE0X 3J80M 3MN9A 2E6MA 3JARB 4OO1J 4TV8B 1KD1R 4BC4A 5KI6A 3M1XA 1FKPA 4J2AA 5FU6C 3ZLJA 2NLUA 3LALA 4DV2K 3KD5E 1SKUB 3CF5L 3CMEA 1KQSF 2EGEA 1OPKA 4M63C 2GZLA 2G8VA 4CHOA 1ZWZA 1K76A 2XO7A 1F1BB 5AZJA 1M1KU 1HYVA 3JAWB 2RPNA 1K6YA 4OJRA 1DKGD 3F70A 1ZBUA 3AVAA 1L3SA 3IDHA 2FYKA 4CD1A 2IPOB 1QU9A 3ZO8A 3OYLA 2HBPA 1CZ9A 4FWQA 1RTHA 5J3BA 2Q3SA 4FWMA 3V3TA 2EPDA 4DHYA 2BTQB 2JXBA 4C8MA 5M1KA 3IRXA 1JFFA 5CR4A 4JRIA 3UKRA 1D1AA 5DLQE 3FFKB 3IKFA 1R0AA 4FT4A 1MUZA 1SA0B 5JCOA 1ZSZA 2HS4A 3T80A 4C0FA 2WACA 4EB6A 1VQLA 2ZCFB 1GLAG 2KRMA 1G3YA 3H08A 3U23A 2LNVA 4FYVB 3K2XA 4I6MA 1KAXA 3ZETA 1NK8A 5IYZB 1HJOA 3NVKA 2NZTA 2ZPHB 2DRMA 4Z89A 5IT9E 4CEQA 4DV5K 4E7SA 1RDBA 2D1KA 3HKCB 3A5ZB 4JZ4A 5C8YB 4BW0B 5GONA 3CYQA 5CCAA 2RJDA 4Z8AA 2QI2A 4DQSA 4UY8O 3JAKA 2OZSA 4FW1A 2DFHA 2KFZA 1QP2A 2GQIA 1UG1A 1BDGA 3PNWC 1Q7YC 2E3HA 3KUFA 2K5IA 1H47A 4DRXA 3HKBA 2P5GA 1RDCA 3CCST 2CHSA 4JK7A 4N4IA 1YITA 4DV3K 2D1XA 2EGCA 5CKHA 3I8DA 2DF6A 2I5JA 3MCQA 1M90O 4ANJA 4FWSA 4CGGA 4IUUA 1CN7A 1WHMA 3M58A 2GX9A 2CH4W 3LH5A 2LC4A 4NL2A 1I07A 1M90R 2EQUA 3IKEA 4FXDA 3G1JA 4M78F 1GLDG 2LBWA 5FPNA 3KIOA 1W42A 1QVGA 3DLHA 4XTUA 2Q0RA 1IO6A 4FL9A 2DRKA 4Z0UA 1PD1A 4CJQA 4KHSA 2Z1EA 1YJ9T 4EP5A 2A41A 2NRTA 2V51B 5LMUK 3FLGA 4XK8E 4KKOA 3O9TA 5KPTA 2BZYA 3I3FA 3G71F 1VQNF 5KGXA 1VQ7T 3TCJA 1JQQA 3L2ZA 3V4IA 3BGRA 2OZBA 4C0GA 3O3GA 3CQYA 1XHZA 4HNAB 3JASB 4EMHA 5BN9A 4CEEA 5C2FA 2ECZA 3M0QA 2D0PA 5CHIA 3M4YA 1JJ2M 4PWDA 1Q7YO 4KHQA 1BUPA 5MLCQ 3CFPA 2YUOA 4LXCA 3QG1A 1RDDA 3PGGA 3E1YA 1IRXA 2EYZA 4OGCA 4F04B 1RNHA 3CC2T 2HHHK 3TEEA 1OV3A 2YHTA 3J7AR 5AQMA 2KFNA 5JS2A 4Z4FA 2W6LA 1VQPT 3IG1A 3HP6A 4BT4A 2XI9A 1WHLA 2PQWA 1RT5A 5I2MA 4JHDA 4J6XA 5HK0A 3QINA 2DFUA 1WIEA 5GAN6 3DMJA 3V7CA 1NU0A 2E5KA 5CK9A 1V4SA 1GBRA 4C8OA 3K5LA 3OB9A 4KH1B 3V7SA 3ZBDA 3WPXA 4Y1CA 2NUTB 3MEWA 3KZBA 5BRDA 3J80O 1KRPA 1RAHB 1GLBG 1QWFA 5JVHL 2VXFA 2X4JA 1WJQA 2EQIA 2HQEA 2GUIA 1OU8A 3H1VX 3MWTA 3JCMX 4FJKA 4DS4A 3V1RA 2D0NA 1DTQA 1ZA2B 3MMVA 4B3TK 1CK2A 1Q81C 4M75B 3RVCA 1OH5A 2HQSC 2Q1YA 3META 4FSVA 3JCMc 1HJDA 1UAXA 4IHJB 3OBWA 1WHGA 5FLXO 3BFMA 1ZBXA 2HQXA 4H4OA 1QQOA 3NTHA 3M56A 1D0ZA 1W2BS 3EAEA 3GG4A 1UJYA 3VS7A 5AQTA 1YGYA 4ZGJB 3HTRA 4FT2A 1AWOA 3DAWA 4DV4K 3CCVF 5LA6A 2CW4A 3A8OB 4QVCA 5HY2A 1LOTB 2DXCA 3CQXA 1UA0A 3U9ZA 1VQ6Q 4RCHA 4QQGA 1SEMA 1EWRA 3SWNA 3P0ZA 5CB4B 4FYYB 3CJ9A 3VETA 3CC4N 4EZ6A 1VQ9Q 1CLQA 4BRDA 4CE9A 4FSSA 3S02A 4MZTA 5LJWA 4BVOA 4HUEA 2HBKA 3HTVA 4JRQA 4IIJA 5AVMA 2ZJQL 3I5SA 2NUBA 2MQEA 3EG9A 1NE8A 4H4MA 2HBMA 5A2QM 3CCRF 4A4FA 3VQ8A 2ED1A 6AT1B 3JV3A 2DETA 3CCLQ 3GIBA 4CJSA 1NJZA 1VQ6N 1RBRA 2G8KA 2AMTA 5D6YA 4F2SA 4B9XA 4H0XB 4DBRA 2K2VA 1XWLA 3AVJA 3LDPA 1Q81O 2R751 3CBPA 3O85A 4E1JA 2O8BA 4CFBA 3NPFA 4M77B 1Q8RA 3DB4A 4DBQA 3MEGA 1Y07A 4G4VA 2WONA 1U6ZA 3TAQA 4Y0WA 1RT2A 4RTUA 4JKGB 1SL1A 1V76A 2Z1GA 1VUBA 3CXCA 3ZSRA 5IAYA 1WHKA 4IUQA 2ASMA 1RACB 1X2KA 1BI1A 1IHVA 3CI5A 3NGZA 4G4XA 4ZI7A 1D3BA 4M75C 4RTWA 1ASVA 3NGIA 2MPXC 2G6FX 1E6GA 4II1A 5GAN5 2FRWA 5L8RE 1BWFO 2LSNA 4FWKA 2YNHA 4JK9A 2JM9A 1XHXA 2IVNA 1RQ2A 3F0FA 4J9GA 1IBLK 4CEAA 4M7AD 4YHHK 1SDSA 5DCVA 1QQCA 1GOAA 4FK4A 3HKSA 2F5KA 2GEMA 3VA3A 3MDOA 1RQ7A 3PO5A 5HLFA 2EWSA 2JJ9A 2DNUA 3P8BB 1UB4A 2EHGA 4XH5A 4Y28E 3J7YP 2HX0A 3CCJF 1T0JA 1WI7A 1YHQN 5DMRA 1S6QA 4E6RA 4LCKA 4AHCA 4DF4A 1EP4A 4JJBA 1XOVA 2R5AA 4O4LA 3TAMA 3VQ6A 3JB9J 3H9NA 1VQ4Q 1DLOA 2GFAA 5H1SQ 1LWEA 1D1CA 3AVMA 3WEEB 1M2VB 3RMAA 3EKUA 2ZAEA 4C0ZA 2K7AA 1WXUA 4DSEA 1VSHA 5JS1A 4FLZA 4PJJA 1JJ2P 1HXDA 3HSCA 4ZTFA 1Q9YA 1VQ5N 1IJJA 4M7AF 1YI2A 2X4YA 1X3MA 4DUYK 5M1PA 4H03B 3UT1A 4FWPA 3BE3A 1Y64A 1SHFA 4MDXA 2ASPA 4M77C 1T05A 4BRGA 4M3WA 5EU7A 5KPZA 3ALYA 5EOYA 4X65K 3G4SQ 1VQ4N 1TTHB 4IURA 4WCIA 4V19S 4BI8B 2RQRA 4G4YA 4PL8A 4I2PA 3CCQT 3CC4A 4HTUA 1I0CA 3QKJA 4CJRA 1CSKA 4CBWA 3NMUA 4KREA 1W5BA 5BRFA 4FJMA 4B6MA 2C0IA 4E47A 1M8MA 4BD3A 3JSCA 2X35A 1S3XA 2P9LA 2PVDB 3G6EF 1IREB 4QS8A 3SBTA 4CECA 4JDSA 5KYUA 2KQWA 4LSNA 1Z25A 4KB0A 1VQKF 3A1PA 4OLAA 3F0EA 1G3WA 1VQ6A 5JICA 4DFJA 1RT3A 5HK3A 5HROA 2PHNA 2HF3A 3OYNA 2AKKA 1VQ8T 4OKJA 4CJKA 4C8QA 2WOMA 2KI7A 1S9EA 2QQBA 3MEUA 3VEWA 4CGIA 1SF9A 1YIJF 2VAWA 1U06A 2KT8A 4YORA 3V1QA 3O5BA 1ABOA 3NBPA 3MCPA 4MQ3A 3NE6A 1GLJO 4C4WC 2DZ9A 4LD9K 2RQVA 1RDWX 2GBZA 1NK0A 4QS9A 2RHYA 3T3FA 2AJQA 2HP0A 5EYPB 1NK7A 5CYMA 4F8RA 4BE1A 3NVIB 3RKXA 1MWMA 4NO7A 1KK7A 4M3ZA 1YP5A 4A54A 1QQJA 2FZCB 5HBMA 5J2QA 4CF1A 3LWHA 1ZSGA 5AQJA 4FJNA 5EIBC 2P9PA 1PRMC 2NRHA 2YYEA 2OTJT 4J9BA 4LF5K 4X3LA 1RAFB 4TVRA 4E7JA 3V7RA 4AFSC 4E7LA 1X69A 1TV6A 1AWJA 3VUZA 5EXWA 3CG7A 2MI6A 1KQSM 5BREA 4FZYA 4E3SA 4MDAA 2QTXA 1M90H 4IFEA 3M5AA 5KCOA 1JLAA 5GAOl 5D7UA 1TVKA 2F5TX 4K0KK 1XHOA 3OW2P 2OTLQ 1GLEG 1J6ZA 5A2QO 1OQKA 3DLLA 5C42A 1YHQA 3HXMA 3D2EB 1TKZA 2RA2A 3U4LA 2RM4A 5J2NA 2A42A 2ZPFB 3AO4A 4CD3A 3VYHB 1BGXT 3FJPA 3EO3A 1X9WA 3I56F 1YJWF 1JD1A 1PHTA 4UC4A 1RFQA 2YLCA 4DWIA 1YJNT 1DGKN 1UOCA 3NH1A 5KYWB 4CI0C 2QEXN 3LGFA 2OJ2A 1VQ5A 4NUTA 2OTLN 4X9CA 2F9ZC 1X27A 3S6WA 2I6DA 2CT3A 1JLQA 1YQNA 4BI4A 5HXZA 3ZEUB 1UA1A 1Q82U 2PUOB 4AHRA 4LNUA 2HVIA 3P5JA 3J81E 4A2BA 2IVOA 1Q7YH 4DTJA 2XDDA 3CETA 3L2WA 2BTFA 1VQ4A 3C6UA 3VS4A 3UA6A 4RKUE 1VQNQ 3G71Q 3GNFB 4I50A 3JB9D 5AQZA 3CPWA 2F69A 2R58A 2YHYA 3CPEA 1RLQC 4CHYA 1QCOA 4FYXB 3FE1A 2P0KA 4CJ3A 3C6TA 4DUZK 5KGWA 1NGGA 3K2PA 1QVPA 1OOTA 1XQSC 2XRIA 4DQPA 2QA4N 4PJOA 3QHDA 3HK2A 3X28B 3HO1A 3OJSA 3DKMA 3MO8A 2HMPA 3N2KA 2JTEA 3AY9A 4ISFA 2YKNA 3CMEF 1LNXA 3S3MA 1BYMA 1BL3A 3R9PA 4BGAA 3VI6A 1K73O 2HHXA 5IJ9A 5J1EA 2DBMA 3SMPA 5I3UA 1FNJA 1U5SA 3KVGA 3MN7A 1XV2A 3LWRC 1SQKA 3JATB 1K73R 1RTIA 1TS9A 4V2SA 4QCLA 2K79A 2CSQA 4NLBA 3FZFA 4CJVA 4C81A 3JB9F 3WXKA 1B7TA 3FZHA 1UE9A 1UJ0A 1ZLMA 3IMXA 5EG2A 2L2PA 3SAHA 1UI9A 2E10A 3OY9A 2E2OA 1NLPC 1QMCA 3GDQA 1T7PA 4B8AB 3OONA 4BVSA 4F9OA 2E1YA 2RI5A 2X4XA 4J9EA 1NPRA 1M3CA 2GUPA 3NTKA 3C65A 3JS6A 3MK6A 3UKUB 4LF9K 1JJ2S 1M90U 2V52B 4BRAA 4C92A 5CKDA 1BI0A 1I81A 4I9LA 4BR7A 1I8FA 4CK1A 5GAEP 2YT6A 5FRNA 5JMVA 3MXMA 3V7EA 2CS7A 5ELZA 1NGFA 4M78B 1RILA 1X52A 4DFPA 2XG8D 3EH1A 1GOCA 4F7UE 1O1WA 1U49A 4OB3B 1FJGK 1IKXA 4ISEA 4IKFA 4TV9A 1NK9A 1JLFA 3L3UA 4Q5WA 2KBTA 4KHYA 1BI3A 3CCVQ 1WSFA 2PVGB 3TSUA 3M53A 1VQMT 2C06A 1CKAA 1BU6O 4ATOA 3SPYA 2QEXA 3HZ6A 3TAGA 2HOEA 2YXYA 3WXJA 4JPBW 1PSEA 2OTLA 3JALA 2CP7A 2VYTA 2BTUA 1Q81H 3L2VA 1VHXA 3ZP7A 3LP3A 4M7DE 1WBDA 1UGPB 2W10A 3O8VA 3QIIA 5IHIA 2EJFA 3REBB 3CCSQ 1Q7YU 8ATCB 1JCEA 3CHWA 3BY7A 2ATQA 1M9SA 2B6AA 5IHNA 4PA1A 4L8RB 4MLEA 3CCRQ 3OYJA 1W40A 2H3EB 4C5EA 3NF8A 4CRIA 4M7AG 2PUKB 4OKKA 3VPZA 2KR3A 4CERA 5C12A 1EIFA 5EAZA 5EZYB 2QWPA 3VOVA 3A5MC 2E2NA 1H3ZA 5AQQA 2P9IA 4IFVA 1GRIA 1RABB 1KQSP 1C0TA 2QA4A 5SWMA 1K9AA 4ZN1A 3WXMB 4CZJA 2QWNA 1L5UA 3CCSN 2VV5A 3V4DA 4GLKA 1RT6A 1EWQA 3HTNA 1S1UA 1N8RC 3D2FB 2LTOA 1N27A 3QJ6A 3L4IA 3LDQA 1Q95G 4XAXB 1WSEA 4IUTA 1JN1A 1TH7A 3ZSVA 4F6RA 1NNEA 1KLMA 2O4XA 3VEZA 4MO5A 3A98A 1OKJA 1XRGA 1RI9A 2Y90A 3RMQA 3TABA 4AH9A 3CG6A 3WJPA 2YWWA 2NRZA 2R57A 4M78C 4FOIA 3OYGA 3HPHA 2QWMA 3OW2S 1LV5A 1WAFA 5AZIA 1YJ9N 3MEVA 5KH6A 4CZKA 2O4GA 1QQNA 3IMPA 2L89A 4M75D 3CC2Q 3SAGA 1VQ7N 4KB1A 3H6ZA 3QWYA 2W8BC 3M4SA 1QVFF 3CCJQ 2OTMA 4B1YB 1VQPQ 4EP4A 3I5RA 3NGYA 1SG5A 4FPAA 4CZGA 3SMSA 1HLUA 4JI7K 2J6KA 1ITGA 4DLGA 2J6OA 2EKHA 3QTYA 3LWIA 3VIUA 1GL5A 2K5FA 3OS2A 3CJ7A 2D9TA 2HS3A 4DR1K 1QSLA 3KXTA 1R59O 2O8DB 4G4WA 2RJFA 4E6EA 3FRNA 1HNWK 3RR6A 4O4JA 4IG0A 4JYAK 2CVLA 1F21A 4ZOLB 3CC2N 3DXKA 5GINC 3VEVA 3RYIA 4LD6A 2F2VA 3I0SA 1MV0B 1BI4B 4FSXA 3TTFA 2AIZP 5HY6A 4O8UA 2R7YA 3WQUA 3CCLT 5CKBA 4I4TA 2RKIA 1MMDA 2IDOA 3TI0A 3RYCA 2Z1IA 3L4QA 2OAWA 2SEMA 3EG1A 4AM7A 2G8HA 1Q81U 2FZGB 4HWIA 3DJCA 4CGFA 4M3YA 4YJ3B 1ACMB 2D8JA 4FWLA 2L26A 2K5LA 3QBWA 4A4KA 2DYYA 5GANh 3LPTA 2VGMA 2EYWA 3WT0A 3BDUA 4H5TA 4DS5A 1X7PA 3MP8A 5IXFA 4M77D 3G6EQ 1NGJA 3QIOA 3D0PA 2RN8A 2F8TA 1NGBA 3ULDA 3ID6A 1VQOQ 3K14A 2FBYA 4O44A 2DTOA 5GANe 3EGDB 1VSKA 3UT5A 5LXTB 2L3PA 2AA4A 2RNAA 1TYQA 1YIJQ 3Q1JA 3R1XA 4KH5A 4BC2A 3OS1A 2ZWHA 2EQMA 4E89A 4HCBA 3N4QA 1HKBA 2OPPA 2EVRA 1VH8A 3AO2A 1SSHA 4J8FA 3QEWA 3CCMT 3L8BA 4EI9A 3LANA 3QFPA 4PWTA 1A5XA 3HT3A 1IG9A 3WGLA 4M3TA 4R5PA 2RHOA 3NK7A 1YCYA 3H41A 3OYKA 4BC3A 5KX5A 4FU6A 2E20A 3JCMh 3IS9A 1NK4A 3ENBA 4N0AC 4FWOA 4KV8A 1YJ9A 4PLIA 4CJPA 4O8KA 3PSFA 2M9UA 2DMOA 4QVZA 2YHWA 1JL1A 1WA7A 2ZQBA 4X1VA 4C5IA 4KH4A 4TUYB 2NRVA 4CC4B 4H5VA 2LRQA 3LAMA 1VQ7A 3QLHA 3JCMe 3QEIA 1ZA1B 2GTJA 2MCNA 2HEQA 2CGKA 3VQ4A 1JXMA 4DQ8A 3ZT1A 2PY5A 1W581 3S0YA 4M7AB 3JB9G 1UEBA 2G9IA 1TVRA 8AT1B 4LH4A 3NDKA 2O8FA 3N5BB 1GO0A 3HHTB 4GW6A 3G4ST 2VVKA 3VS6A 3X25B 3EORA 2W0ZA 5FW9A 5IJ0A 5AT1B 5LP6A 2A28A 3CC2A 1ZUYA 3VESA 4CI6A 3RBBB 3TSQA 4DA4A 3BZKA 4NS5A 1W1FA 3ZEHA 4O4IB 4ZHQB 2H8CA 2K6DA 3QDKA 2ZPIB 1YI2F 2AZVA 3CERA 4KFBA 4J7IA 3VQDA 3PIOL 1VSIA 4LD0A 1ASUA 1U43A 2EIFA 2JOYA 3KLEA 2DXTA 3ZL7C 1KQSS 1KFDA 1BK2A 3VQAA 3A5OC 4CIFA 1ILYA 2Y1IA 4M7XA 1K73H 2PU9B 3KK2A 4RWTA 2FO0A 2H8EA 2X3WD 2OAUA 3ER0A 3OVNA 3BDPA 1IGQA 5ECAA 4DQIA 4GV9A 1G5VA 2XHBA 5CYQA 3PLAA 2FSJA 2HP3A 5IT9M 1ZXOA 5GAGP 5LYJB 3WJRA 3AVLA 3WNHA 4I7FA 2IAFA 5G4UC 3KLFA 4IOAL 1TXQA 2P9UB 1W2BA 2FB7A 1NKCA 3CCQQ 5AQPA 3QETA 3CD6Q 2DAQA 2Q0UA 2KTQA 1NYGA 1NBWA 1Y0MA 3NF9A 5LJ3f 5KYXB 3AO1A 3NK6A 1ZBSA 2RF2A 4CZFA 1PC0A 4CK3A 4RQOA 1YCSB 2JS0A 4M7AC 1T0AA 5KMGB 4PFPA 3HL8A 3TSZA 1PG5B 4BT2A 4OF1A 5JVDA 4DV7K 2YHXA 2YRCA 4AHVA 4X66K 2UYNA 4X1IA 4E0DA 5GANj 1ARKA 3JB9I 3OQ5A 4J9DA 2YHAA 3DB3A 1VQ8Q 3EFRA 3THXA 3SUPA 2HHTA 1TUBB 4F3TA 2K3XA 3BF1A 1HYOA 4JRKA 3PFSA 2G8IA 3KIZA 4DTMA 3PMTA 3VQ5A 4I55A 2Q1XA 2ZF8A 5ITZA 4N4GA 4B46A 2EAYA 3OS5A 4EIAA 3GE1A 4HA8A 1NEBA 2JNGA 2QQSA 4FPBA 4C1NI 2A08A 1JCGA 3SV4A 4ZNXA 4NYFA 2MOXA 3V8LA 4WQ5C 1B34B 4D6WA 4ZN3A 3OYBA 3AGKA 3ZX0A 2J05A 1D0YA 4FVUA 2EQJA 5MN6A 2DO3A 3RESA 3G71T 1VQNT 1H3HA 1VSDA 2RPIA 4H5RA 4FLYA 3FDRA 4LFBK 3O9RA 1CZAN 3VGMA 1QWEA 1O13A 5LL6Z 4B9SA 4LDXA 3T19A 3O9SA 1H7MA 3RYFA 3C9SA 1M27C 4F7UF 3GBTA 4BRMA 2VASA 4EAHD 4ELUA 4BB7A 4KTWA 2XDBA 3AT1B 1Z6RA 2Z1JA 4J7FA 1E4GT 2OTJN 2JVVA 2WSCE 2ZPBB 3NH0A 2E64A 1HQEA 3RRGA 1W57A 4RW7A 2RD1A 2JGUA 2P6YA 4BVRA 4JKFA 4CC2A 1YJNQ 2GELA 1K73U
chains in the Genus database with same CATH topology
2F9WA 1WJSA 1Q82O 4ELZC 5I2SA 4M7DF 3BP8A 3LFOA 4M75G 1BKBA 3M3ZA 4B1UB 5FLXM 3B8AX 4BRNA 1QZ6A 1E7KA 1YJNN 3I33A 5JLHA 2GLZA 2A3LA 5AR0A 1G99A 1U1SA 3FZLA 2QWQA 4XTZA 2QQRA 5AQOA 4DOVA 4RTFD 3L0QA 2HF4A 4M78D 4M7YA 1OVYA 2DXUA 3CCVT 3IUCA 4WQ4C 3CCUF 2YJFA 2DJZA 1U2VA 3P8DA 4M77G 4C92F 4JS4A 1Y7XA 1WUAA 2VCPA 2RE2A 3F5TA 4JKCA 2WALA 3I8BA 3ENHA 2DPPB 3CCRT 3MP6A 2MWPA 4U7BA 3KBGA 3RKYA 3E9LA 3ZX2A 1XTDA 5EVZA 4A5AA 4KULA 3E20B 1U8RA 2OTJA 4JJNK 1ZQ1A 4R79A 4A4EA 3RA6A 2D4WA 1SSFA 3TSPA 1HUXA 5C10A 2Q1NA 5TKYA 2RH2A 3EFSA 3E1SA 2K3YA 1OYXA 3GLXA 4HCZA 3C12A 4DOWA 3H46O 5LJ5e 5GAMe 1YJNA 1VQMN 4BREA 3CCJT 5C2DA 1WOQA 5B8HA 3N4YA 2J4RA 3D6RA 3VF2A 3NVKE 2ITMA 5HY1A 2MWOA 5EWRA 3WQTA 5GAPK 3N4PA 3PT9A 2RK2A 2CGJA 2MF2A 3L42A 5BN8A 2Q2RA 5AQNA 4X34A 3HRGA 4JKAA 2IVWA 2CGLA 1BOTO 2UYTA 2E6ZA 4BRCA 3QO3A 5E26A 3CMAF 5M1QA 3KWIA 2RB6A 1S72F 3G6ET 3IFRA 3GOXA 2B8AA 3L1AA 1VQOT 1VQKT 3GP8A 3JCMW 4H5NA 3WUHA 4XTYA 1RDUA 3C4SA 1JJ2A 3OW2M 1YIJT 5HL7L 4MLHA 3CPQA 3D00A 3EE9A 3VF6A 4M75A 3EN9A 2A5XA 5CE3A 5JLFA 3CCEF 1KC8C 2H3GX 3JCMJ 4LC9B 2RHZA 1VQ9N 3FC3A 4KH6A 1T6CA 1JRIA 3CBOA 3NFCA 5GMKl 4JRPA 1M8VA 2DK3A 2HNIA 4MMKA 1HKCA 3CCLN 1Q86C 4BC5A 4M7DG 3HOSA 2DEQA 3R6OA 3FEOA 2E70A 3F9MA 4CZLA 4J8OA 3I56T 1YJWT 4MZPA 4PHTX 3M9QA 3M59A 5LJ5j 5GAMj 2QWRA 5KQDA 2RHXA 4YOYA 3VGKA 3FZKA 1WJRA 3OA6A 4M77A 1MGQA 2JNBA 3H45C 2WUSA 2FSNA 4JKGA 4BQLA 4OVAA 2KTVA 4RCBA 4KUDK 3H8ZA 5GAOm 3VGLA 2EQKA 3OSVA 1ATSA 3CCMN 2E1ZA 3OW2A 2QWOA 2FL7A 1Q86O 4BRFA 1Q82H 5CO7A 2QTDA 4QQDA 3H3OB 4BGBA 4EHTA 2P9LB 3G25A 3LL3A 1N9RA 3CD6T 3HOTA 2ZZDA 4ISGA 3OA9A 3CC7F 5GANg 3Q7CA 5GANd 5AQVA 2IVPA 4OB0B 2K57A 1C0FA 3WEEA 2RJEA 3G4SN 4M78G 3E9GA 3ATUA 1ZWZA 3GNGA 3ME9A 2WFBA 4AF1A 2LT1A 1VQ9A 1YXQA 1Z05A 3I55F 2P4TA 5HOOA 2FXUA 2QQAA 1NJIC 1K8AC 3CCLA 1OI1A 3C6HA 5M1FA 2FLOA 3MX2A 3BUZB 3RSEA 3K9JA 3QHSA 4J83A 1YBYA 3JCMg 3BW1A 3JCMd 4IWVA 5DLOA 4XCQA 4BRLA 2ASOA 2RHKA 4MMLA 3GOIA 4A61A 5GIPC 2JWLA 3HBTA 4F7UB 4YDUC 3X24B 5HXUA 3EZWA 4JLIA 5A2QE 5DM6L 3CCMA 1NJIO 5JVGL 1K8AO 3SIVA 1K9MC 2V8JA 4M7DB 4EMGA 3LM2A 1ESVA 4HCCA 2CGHA 1XUPO 4BVQA 5AQHA 2HD0A 3D2EA 2KMTA 5AYFA 3JB9H 3TPQA 1RGIA 2CZ6B 2QXFA 4C8QE 3OMGA 3QZ5B 2D0QB 3G4SA 4BRKA 3G71N 1VQNN 4JS5A 1NGDA 3LDLA 2I2LA 1HX1A 4A5BA 2RO0A 3ZEUA 3GL1A 1O75A 3LM9A 1KQSA 1QVFS 5CVIA 5I9EB 3GYQA 5CKFA 5GMKi 4IO8A 4C92B 2BH1A 1VQLF 3H1QA 1QP3A 3J7AF 2KHOA 2VYPA 3WVDB 3P4IA 1M4ZA 4M7DC 3UB5A 3DLLL 1SZ2A 1C0GA 4A4HA 1YVNA 4H0OA 4LDUA 4QW2A 5F2RA 4XTXA 1FXXA 4LDYA 2GCXA 2FVUA 1YITF 5LL6S 4WYBA 2P9KA 3MHXA 1UGQB 3VENA 2E8AA 2FC3A 4XH4A 3BDLA 4L6V5 4PKGA 4ZGDB 3ON1A 2DKGA 3C94A 3UKUA 1QVGF 2K4YA 4A57A 3CJCA 4J5YA 4MDBA 3A8MB 4PJOE 3CCVN 2E6NA 2DZCA 1G3SA 2CKKA 3HP9A 4M78A 3QBXA 4C92C 2O4XB 3A8LB 3JXUA 1VQNA 3G71A 3DXMA 3CCRN 4BDZA 3MCAB 4PKIA 5AQGA 3QXEB 1FX7A 3QUIA 3VU3C 5KQ8A 3FLCO 4N4HA 4QS7A 5CQYA 4BR2A 4EHUA 2BKDN 2AP1A 4K43A 3SB2A 2DIQA 3PIPL 5GAN8 3JAMM 1K8KB 5GINA 3C7NB 4C92E 2WC9A 3V8JA 3NVMA 2KG4A 1Q86H 4E7KA 1YI2T 3LDOA 4ILGB 3D2FA 4WF2A 4Y91A 1N8RO 3VEYA 1BIAA 2LCLA 2HBJA 4FOEA 3O1BA 3CCJN 4QVDA 4LDWA 1VQPN 4NB4A 1H641 2P9SB 3SAFA 3MP1A 5AQLA 3K9KA 4JD2A 1XC3A 4JKDA 4CBXA 5DM7L 3KHYA 4O6JA 3X20B 2QM1A 2CZWA 3VV0A 2GFUA 3MN6A 4BR4A 3L6QA 3SJHA 3CCVA 3FZMA 2NRWA 1TUYA 2RJCA 4FM4B 1PSFA 4WF9L 4J6YA 2ZGYA 4CBUA 4N0AA 5LJ5g 5GAMg 5LJ5d 5GAMd 4X9DA 3PIOA 3CCSA 5GIOC 1IZ6A 2LX9A 2YI1A 3G6EN 3GPLA 1W97L 2YRVA 3CCRA 2Y4XA 1VQON 1VQKN 4L3QA 3LYIA 2BO1A 3CXCF 4JKEA 5HWEA 1NM1A 2EJGA 3CBMA 1YIJN 2E1HA 3E66A 3HM8A 3R3LA 4L5GA 5F0XA 3QBYA 1U1TA 2AHJB 5C15A 5GAN3 4XEIA 5GADP 4OGEA 4EI7A 3O1WA 3PAFA 3QICA 2P0QA 4FWNA 2P9NB 3BF3A 1NJIH 1K8AH 1Q86U 4NQ3A 3AAQA 1VAZA 1KHCA 4A62A 2QXLA 4HT9A 1RL2A 2KK4A 3SIUA 3JCMQ 3L2RA 3CCJA 2DIGA 1VQPA 1KAZA 4EMKB 4JEPA 3HRSA 4KBOA 3I56N 5GMKe 4JNEA 1GLLO 2M0OA 2E88A 4C8QD 2LDMA 4IDHA 3OYEA 4BACA 2KAFA 4E7IA 2DTHA 3F2KA 4M7AA 4RMOA 1VIEA 3CC4F 5EY4A 4WCEL 3WXLA 5HY0A 4XTWA 3D7EO 4R56A 3QPHA 1W4SA 2Y4YA 4YTLA 4BDYA 5EX5A 5F1XA 2CH6A 3P38A 1VQ6F 4C8QF 1VQ9F 4FWRA 4KUIA 3G6EA 2BUDA 3CCUT 4GY5A 2KLAA 1VQOA 2ZF5O 1P8ZA 5AQXA 2ZPEB 4WQ5A 4PL7A 3CCQN 4MDWA 3CD6N 3T9NA 1WQWA 4EI8A 1YIJA 3HI0A 4XTVA 4EMKC 2XHCA 1LJOA 1WGSA 2NNWA 2FF3B 2I7PA 1Y71A 4A59A 2DTIA 3M54A 1G3TA 3P8HA 2P9UA 1NJIU 1K8AU 1MDUB 3ID8A 1BA1A 1VQ8N 2PVOB 4IOXA 1YHQF 4CZHA 1KD1C 4M7DD 2AIFA 3M6GA 5BPNA 2RK1A 3VYGA 1GLFO 3ULEA 2VWBA 5AFUA 4PJOD 4H0YB 3JCMb 1T6DA 4IJAA 1VQ5F 1TUUA 2VUBA 5D6XA 4C1NK 3LGLA 2CH5A 5HKCA 3I56A 5GAOr 4B1ZA 5FU7B 1LCUA 2EKOA 1VQ4F 5AZJB 5AQWA 4PKHA 3HFOA 3OYYA 3CPWF 4VUBA 1B34A 2Q31A 1HKGA 3T7ZA 4PJOF 3FB9A 5GMKj 3VEOA 3UKRB 1P92A 1KD1O 4BG8A 3OSSC 3G7ZA 4C92D 3VUBA 4WQ4A 4I6MB 2YX6A 3C0BA 3ZETB 1Y96A 3OYIA 1QVGM 2KTUA 4BQZA 3ZYYX 2LCCA 1NMDA 3VKIA 1N8RH 3SLCA 3CCQA 5GAN7 5LJVA 3CD6A 3CMAT 1U2VB 1S72T 2V7ZA 4IZ9A 4IUVA 1M90C 3IKMA 4BY9C 3TU4K 5LJ3h 5FU7C 1BG3A 3ZX3A 1VQ8A 2LT4A 3OYDA 4RCCA 4ZGEB 5AQSA 2E41A 5LJ3e 2MAMA 4H0VB 4OP0A 2FF6A 3JCMP 3CCET 4RG8A 5J26A 2QEXF 3O80A 1X6OA 1QVFM 2E2QA 2OTLF 4C5HA 4TZZA 3IR9A 4YOVA 5BR9A 3O9QA 2A6AA 1DT9A 3LW5E 4PLLA 2Q97A 2LVMA 3Q7BA 1X75C 5LJ5h 5GAMh 2GF7A 2E2PA 3TTCA 2HBLA 2QDYB 1GO1A 2QA4F 4JHDB 1BIBA 5AQUA 1UGSB 1RA4A 3O4WA 4B9QA 4CZIA 3LWQC 1BI2A 4OPHA 5GMKm 1KHIA 2L3RA 3O9UA 2JTMA 2ZJPL 1QZ5A 2XDPA 1N8RU 1ZC6A 2PBDA 2HAXA 3ASKA 2EJ9A 4C8QG 2NRXA 2GWKA 2WSEE 3OYCA 1NGAA 2W40A 4IEEA 3LX7A 3J80E 3FIFA 1T3VA 4RG2A 3S3OA 3FFMA 2H3JA 2IG0A 4B1WB 1NLVA 5BPLA 1QVFA 3CXCM 3CC7T 3SWNB 4A53A 4NOYA 3P31A 5I21A 5FRMA 1Q18A 5FLXE 4XU0A 5KE3A 3QZ9B 5CR2A 4DCHA 4EFHA 4DB3A 3QYHB 3I55T 3M4GA 2VC8A 3RUXA 1YI2N 5LJ3j 2NRRA 2JZ2A 2E5QA 4YOWA 4IUPA 1OZ2A 4BE0A 3EE8A 4F7UG 3HJWC 1OZ3A 3QJYA 3PMIA 4AM6A 4B1XB 1D3BB 4OB1B 3SDZA 4FL6A 1KQ1A 5FPEA 2V8IA 2ZGWA 3CCSF 2BIVA 3PTAA 5C0MA 2A3ZA 1VQMA 3ENOA 1WPYA 4BR9A 4KT0E 3RERA 1NGEA 4XQ3A 3QFUA 4LDVA 4MO4A 1GXIE 4PJOG 5LY3A 3SWNC 5ADXH 3J81M 3H6EA 4J6WA 2PFUA 1YJ9F 1XQHA 2FSKA 4R55A 1WNLA 5KPRA 4EDUA 1KC8O 1VQ7F 3S41A 3V8KA 2HVYD 4H0PA 4MZMA 2XICA 3R6MA 3AHUA 1QHAA 3CC2F 1V29B 4BI3A 3O6WA 1VQPF 5KE2A 1SAZA 3CMET 5GAOn 3M57A 4C92G 4PNOA 3DLMA 3AGRA 2KY9A 4M75E 5AQIA 3QDRB 3VEXA 1KD1H 2OANA 4K41A 4WFNL 4CJ7A 3AAPA 3WXIA 4C8QB 1DJ7B 2XKOC 3TU5A 2OHWA 2BUPA 3U8XA 1VQLT 4BRIA 4OB2B 1W2BF 2XK0A 5GAOq 3MEAA 4IXCA 3RSEB 2P9PB 4JK8A 4O5FA 4BR0A 4IEIA 5AQKA 5AFUH 1XNIA 2ALEA 3HSBA 5GIPA 3RMSA 1VQOF 2V7YA 4ME7A 3CJAA 4C23A 4YDUA 4BG9A 3UWNA 3OHRA 3INZA 3CPWM 4PKCC 1IPAA 4M77E 5CIUA 1YITT 1RI0A 3V7QA 3NMUC 2WBNA 1NMUB 3KWGA 4ZTJA 3VF4A 4H5WA 4C5GA 2LBXA 4WFBL 3JCMV 1T44A 3FGUA 2GWJA 4FO0A 4HTLA 4C8QC 1M5Q1 3SFMA 3CCUN 1QVGS 4BRHA 1NWKA 4BY9D 5GAN2 3A0IX 2LQ8A 4Z94A 4L59A 2VXEA 2WSFE 2Q36A 3E9PA 3A8HB 4GV6A 3TTDA 4GVEA 2VGNA 1NGCA 4PJOB 5FPDA 4HT8A 2YJEA 1K73C 1KD1U 5G4VC 4BY6B 3OYHA 1KAYA 1I5LA 4F7UA 4KBMB 3MDQA 2F7TA 3HAXD 4GNIA 4K25A 1ATNA 3LWVC 1M1KC 3URGA 1MHNA 3FR0A 2GQVA 3UDCA 4BR5A 5BPMA 4PL6A 4A4GA 2G3RA 3UPUA 5M1OA 4M7DA 1K9MO 3LH0A 1IG8A 5AQYA 4XH1A 5E84A 2RI3A 4JN4A 1BA0A 4JAXA 3SK3A 4U67L 3W3DA 3M5RA 5CKEA 3P39A 5CAIA 4ELYC 3CCQF 3MWPA 1X7OA 3CD6F 3OMCA 3CIPA 3T69A 4PJOC 2JUFA 1M1KO 2P9KB 4JKHA 1P90A 4BY6C 1X9JA 1M1GA 2I7NA 1EO1A 5A0GA 1VQ8F 3OYFA 2DXBA 2RHIA 3PIPA 2X4WA 3CCUA 4BRPA 5GANf 1T0KB 2O01E 4NLCA 3CMAN 1JCFA 1O9SA 1S72N 1YAGA 1MA9B 2P9IB 2JN0A 2OTJF 3HRUA 3E9OA 2D0OA 4XU1A 2HSTA 1NZ9A 3A8GB 3CEYA 5AQRA 3DXMB 5A0DA 4YOTA 3HPWA 3QB0A 3CXCS 2KVQG 2JTFA 5D6WA 2M16A 5C6SA 1KG1A 5AZIB 3RKWA 3CCEN 4JLGA 3JCMf 4CZMA 1YJNF 2QWLA 1KC8H 4C0DB 3M55A 1YF5L 5AQFA 3S3NA 2QW9A 1X3NA 4H0TB 4JKBA 2EWNA 4ILHA 1FWZA 3QMLA 2L5QA 5GAHP 5FJ4C 2DD4A 5GAOp 3DXKB 4DKWA 3ATVA 4BUGA 2FHDA 2CYZB 3MX5A 2P0PA 3BEXA 2MMPA 5LJ3g 1QQMA 5LJ3d 2FGYA 3A8YA 4JD2B 4B9WA 1D4XA 4GY2B 5A0LA 4XU2A 3LWOC 1DEJA 3CC4T 1H1VA 2CZ1B 2E12A 4QQ6A 1QW1A 3UE5A 4BE2A 2KSSA 2LQKA 2GTDA 3E9FA 1K8KA 3C7NA 3RA5A 1VQ6T 1JB0E 1KQ2A 2KKZA 5GIOA 3CMAA 1UGRB 4M78E 3X26B 1X01A 1VQ9T 1JJ2F 1I4K1 1S72A 5DM7R 4C0DC 3VERA 1AHJB 3CJBA 2A40A 1TYQB 3HFNA 4ILJA 3C95A 2ZGZA 4WFAL 4M75F 4IOCL 2QQ9A 3E19A 3DWLA 2CZ0B 2ZPGB 3OYAA 3KK7A 2W41A 3CC7N 4DQ2A 2P9SA 1GLCG 3RIRA 2DPNA 4Z02A 4EPCA 2EFIA 2R5MA 2RHUA 5J39A 4YOXA 3CCEA 1E4FT 1KXPA 2IIRA 5FPMA 4B1VA 1KC8U 1VQMF 2DD5A 1LOJA 1RLGA 1YHQT 4NL3A 2CZ7B 4CZEA 3AARA 3I55N 1BO5O 3OS0A 1WQ7A 5BRHA 3QYGB 1JBMA 3HRTA 1V4TA 1NPPA 1VQ5T 4A2AA 2M1HA 1W2BM 4M77F 2ZJRL 1SS6A 2E65A 5IN1A 3VJPA 3U9DA 4FIBA 3A5LC 5GANK 1ZHIA 1VQ4T 2XD0A 4JUVA 5GMKh 4BVPA 3J8AA 3OW2F 4BRQA 3VTIA 4O5VA 5GAN4 3CPWS 2XIDA 1YJWN 1R8OB 3JRZA 5ADXA 2P9NA 3O8MA 3LDNA 3EL2A 4IO9L 2PAVA 1YUWA 1K9MH 3MN5A 1NGHA 3WVEB 3TREA 1N9SA 3N4ZA 3JCMM 2JWKA 4P5NA 4E7HA 3JAME 4BROA 4GV3A 4K42A 3L2UA 1GZ0A 1VIFA 3R8EA 4EMKA 3CC7A 3OYMA 3LLRA 3W0LA 1VQKA 3CMEN 2RI2A 3J7ZO 1S22A 2V8KA 1HK9A 3GF5A