The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
88
|
sequence length |
372
|
structure length |
341
|
Chain Sequence |
IEKNSGWITMEPEDMWHLYNILQVGDQLKASTVRRILVENMDFDTKAAQLHIKRTTEYHPMGSYHTLDLELHRNFTLYNEWDAFALDRVDAACNPSAEIGAVVLDEGLANICLITDYMTILRQRIDQVIPRKRRGDSSAYQKGLDKFYDSVFQSINSEFDFDKLKVVILASPGFVARGLYDYIFSMAVKLDLKQIVKSKNKFVILHSSTGHIHSLNEILKDPAVESKLADTKYVQEIRVLNKFYDVMNEDDRKAWYGPNHVLKAFELGAIGELLISDSLFRSSDIATRKKWVSLVEGVKEINCPVYIFSSLHESGKQLDLLSGIAAILTYPVDEEDISEDE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Elongation factor 1 alpha-like protein
|
publication title |
Structure of the Dom34-Hbs1 complex and implications for no-go decay
pubmed doi rcsb |
source organism |
Schizosaccharomyces pombe
|
molecule tags |
Translation regulation/hydrolase
|
total genus |
88
|
structure length |
341
|
sequence length |
372
|
ec nomenclature |
ec
3.1.-.-: |
pdb deposition date | 2010-03-28 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF03463 | eRF1_1 | eRF1 domain 1 |
B | PF03464 | eRF1_2 | eRF1 domain 2 |
B | PF03465 | eRF1_3 | eRF1 domain 3 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Roll | SH3 type barrels. | SH3 type barrels. | ||
Alpha Beta | 2-Layer Sandwich | Nucleotidyltransferase; domain 5 | Nucleotidyltransferase; domain 5 | ||
Alpha Beta | 2-Layer Sandwich | 60s Ribosomal Protein L30; Chain: A; | 60s Ribosomal Protein L30; Chain: A; |