3MCAB

Structure of the dom34-hbs1 complex and implications for its role in no-go decay
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
372
structure length
341
Chain Sequence
b'IEKNSGWITMEPEDMWHLYNILQVGDQLKASTVRRILVENMDFDTKAAQLHIKRTTEYHPMGSYHTLDLELHRNFTLYNEWDAFALDRVDAACNPSAEIGAVVLDEGLANICLITDYMTILRQRIDQVIPRKRRGDSSAYQKGLDKFYDSVFQSINSEFDFDKLKVVILASPGFVARGLYDYIFSMAVKLDLKQIVKSKNKFVILHSSTGHIHSLNEILKDPAVESKLADTKYVQEIRVLNKFYDVMNEDDRKAWYGPNHVLKAFELGAIGELLISDSLFRSSDIATRKKWVSLVEGVKEINCPVYIFSSLHESGKQLDLLSGIAAILTYPVDEEDISEDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor 1 alpha-like protein
publication title Structure of the Dom34-Hbs1 complex and implications for no-go decay
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Translation regulation/hydrolase
total genus 88
structure length 341
sequence length 372
ec nomenclature ec 3.1.-.-:
pdb deposition date 2010-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03463 eRF1_1 eRF1 domain 1
B PF03464 eRF1_2 eRF1 domain 2
B PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.870 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mcaB01
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3mcaB02
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3mcaB03
1CK2A 3VMFB 2LBXA 5DCVA 5IT9M 1ZWZA 2JNBA 5A2QM 3CPWF 1IPAA 2VGNA 3SIVA 3NK6A 1X7PA 2I6DA 4TZZA 1GZ0A 1VQKF 4LCKA 1K73H 3CC7F 2BO1A 1T0KB 3IR9A 3CD6F 3HAXD 3GYQA 2CZWA 1RLGA 2HSTA 1VQ6F 3CCJF 5GIOC 1VQ5F 3I55F 3V7EA 3OBWA 1GO1A 3CG6A 2FC3A 3LFOA 1YJ9F 3ON1A 1K9MH 1YI2F 3MCAB 3G6EF 1N8RH 1CN7A 3CXCF 1XBIA 4C4WC 2ALEA 1KC8H 3N4YA 3LWPC 2QEXF 1VQ7F 3CC4F 3LWOC 5GINC 1VQMF 1Q86H 1GO0A 4X3MA 5GANK 3LWQC 1VQ9F 3CCUF 1VQOF 1KD1H 2OZBA 1NMUB 3J81M 3I56F 3CCLF 2AIFA 5GIPC 3WXMB 4NUTA 1W41A 3E20B 3O85A 1YJWF 3G71F 1W3EX 1W2BF 1RA4A 1QVFF 3NVIB 1YHQF 4X3LA 1YITF 3NMUC 3SIUA 1QVGF 3CMEF 3OBYA 3CCSF 1YJNF 3CPQA 2OTJF 3RA5A 3NK7A 3JAMM 1W42A 3J7AR 3CCRF 1W40A 3FFMA 1X7OA 3N4ZA 2QA4F 2KTVA 1K8AH 3PLAC 2QI2A 1Q81H 1JJ2F 1S72F 2WALA 3LWRC 5EO3A 1E7KA 3CC2F 1VQ8F 3CCVF 1PXWA 1DT9A 3V7QA 3OW2F 1X52A 2HVYD 3CCQF 1SDSA 3J80M 2VGMA 1KQSF 4BW0B 2KG4A 4AF1A 1H7MA 3PAFA 2OTLF 3CCEF 2OHWA 5G4UC 2KTUA 3CCMF 3G4SF 2LBWA 1M1KH 3JCMM 3RA6A 5FLXM 3NVKE 1NJIH 1M90H 3LWVC 1Q82H 1VQ4F 3AGKA 3VI6A 5G4VC 1VQNF 1VQLF 5EWRA 1Q7YH 3HJWC 5FJ4C 1YIJF 3E1YA 4BY9D 1VQPF 5GAPK 3CMAF
chains in the Genus database with same CATH superfamily
5J2NA 1PNJA 4K8XA 3CD6Q 1BISA 1E7OA 2ROTA 4BDZA 2E2QA 4AT1B 5FPDA 1W2BM 1ACMB 3ZX3A 1E6GA 2O8BA 1FNJA 4R55A 3I3FA 3M1FA 1SKWA 2QWQA 3EGUA 1C6VX 1SG5A 3KD1E 2DD5A 5AQXA 1X7PA 3SQ2A 2P9NB 5IJ9A 1RCHA 1X6GA 2DD4A 1UJ0A 2BKDN 1REVA 1K73H 4H5WA 1YI2T 1YTUA 5GAMj 2PAVA 4FWLA 1GX1A 1MNEA 3RRGA 3CD6F 1X2QA 1X3MA 4FM0A 4FW2A 5HROA 2YXZA 2QEXQ 1V4SA 2DFUA 2FBYA 1YJWA 1UEBA 1VQMQ 1OVYA 2ZPBB 1LWCA 5C15A 2YUOA 4CW7B 4M75G 3E9OA 1M8VA 1A5WA 4NO7A 4MDWA 1GO1A 3C9SA 1TYQB 1Q9XA 1QU9A 3CG6A 3MX2A 2YNGA 1X25A 3FLCO 2CP6A 4HVVA 4JK9A 2RF2A 4BRGA 1WXBA 4AG2C 3JXUA 4YORA 3CCRA 1D0ZA 3V7RA 1N9SA 4IUUA 1BUPA 2B6AA 1QSSA 2HHTA 2HS4A 2QEXF 1AHJB 2I5JA 2EQJA 2BIVA 2GQIA 1VQMF 1Q7YU 2DILA 2MWOA 4IOXA 2P9NA 1YITQ 4L3QA 4TV9B 1VSEA 3PO4A 2HF3A 1LPLA 2DX1A 3LP0A 3G1JA 4IWVA 2HHUA 4EI7A 4ELUA 3T69A 2K2MA 3SV3A 3M3ZA 2A7YA 2RHUA 3EAEA 1Q86R 4EAHD 1IV2A 3M5RA 2AZSA 1QQNA 2D0BA 4CF8A 3O1WA 1J5EK 5JCOC 2P9LA 1TUYA 4RTFD 5FWBA 2ASPA 4NQ3A 2C06A 4BC4A 2BGGA 3ZL7C 1YITF 3SIUA 3VTHA 3UKRA 3H6EA 3BZKA 3X26B 2CKKA 1BI4B 4FWNA 1JY8A 3RBBB 2XDPA 4TUYB 4BI4A 1G2BA 1RTJA 2JJ9A 1VOMA 2ROLA 2IAJA 1N8RO 3VOAA 4FJLA 4C8EA 2X78A 2DZCA 2DAQA 1XQHA 2VWKA 5GANd 4WTOB 4OMLA 8AT1B 1MU2A 3D45A 5E41A 4X1YA 3ESJA 3AAQA 4JUVA 3THKA 5BN8A 2VG6A 3VOVA 2ATCB 2GGRA 1QKWA 4U7BA 5EO3A 3DLMA 3UT5B 3OYAA 1Q9YA 1VQ4Q 1COMA 3TSWA 1Q81O 5KYYB 1XV2A 1HXDA 1LVKA 4U3JA 3INZA 1IBKK 4XCQA 1SKUB 4EB6A 3L0QA 3EL2A 4FZZA 1FKPA 1VUBA 2ETJA 3IG1A 1UA0A 4M3YA 3JCMP 2NUZA 3DOKA 3A5LC 1VQNA 1YCSB 2ESWA 3M55A 4JJCA 4JI5K 1KD1U 1GFCA 2DTHA 4GBQA 1BCMA 1RTDA 4GLKA 1VQ4F 1X9MA 3SQ1A 1NGFA 3JATB 2RI5A 4A63B 3ATUA 4CJKA 4GLMA 3TREA 4CFBA 5FDLA 3MDOA 4X9CA 1U49A 1M90O 1GLCG 1WUAA 4QQGA 1HUXA 4CZKA 4IIJA 2NRVA 4BY9D 3QZ5B 2M16A 3CHWA 1X69A 1W2BP 4BT5A 3BY5A 4JNEA 2RHKA 3QIOA 4IFVA 2JUFA 3L8BA 2OPSA 1EXQA 3CCVN 5HLFA 2ZWHA 5J2PA 5I2MA 3FFKB 5KYYA 1IPAA 4B45A 3KVGA 4BY6B 4B9TA 3V9WA 1UFYA 3CCUA 5FNVB 1YJ9Q 3G0ZA 3EE9A 4BRQA 4MQ3A 3TANA 1TAUA 2RPNA 2RJEA 4M75D 1WHLA 1GOAA 3G6ET 3LDOA 3MN6A 3VA3A 4Z4EA 2QTPA 3K57A 1KVCA 2VWBA 3RR7A 2CS7A 4A4FA 2E3IA 4ICLA 2MYSA 1VQ7Q 4M7DE 1RBVA 2ZGYA 3DXMA 4YOVA 2JNGA 3JATA 4M78E 4DS4A 4IHJB 1YI2A 2HRUA 1RBUA 4CF1A 4FT4A 1I81A 2DM1A 1YJ9F 1KQSP 5LA6A 3QESA 2O8CB 3LLRA 2CH5A 2HKNA 4ISEA 3UPUA 4JHDB 3CXCF 3I56T 4AQYK 3MP6A 2CP0A 2DL4A 2JXBA 3H8ZA 5EYPB 5LJ5d 3SD4A 5GAHP 5IHIA 1HRHA 5LXTA 1VQ7F 2I0NA 4M8IA 2LQWA 3KK1A 3PMTA 2HW3A 3CYPB 4X64K 5BMVA 2RQVA 4L59A 3BP8A 2JWLA 1KC8O 1S5JA 4FSXA 4KWEA 4ZI7B 1QHTA 4D8KA 1RT7A 3K2XA 2BUPA 3CC7N 3VQ9A 3MN5A 8ATCB 3QEIA 3OYGA 1NMUB 2NLUA 4JI0K 2D0NA 1N6AA 2DL7A 3OJSA 4CK2A 1QTMA 2CHTA 3FZMA 4N4IA 3L2RA 3C9UA 3EH1A 3NAEA 5KYXA 2KFZA 1QZ5A 3VV0A 3HZ6A 1GLFO 2GTDA 1KD1C 1RLPC 1QVGS 2PZSA 3M59A 3IS9A 1RAEB 1X9JA 4VUBA 4CIFA 4FWOA 5FU7B 3QG1A 3ULEA 2J6KA 2FRWA 3A8HB 3CJCA 2O8CA 1WQWA 3K9KA 4KH4A 4U67L 1E3MA 4CZFA 3MQWA 1K9MO 1IV3A 4L5GA 4MZTA 4CF2A 3ELCA 3J7AF 2AKLA 3JALB 1LJOA 2CP2A 5GMKe 1MWMA 1S1WA 4PJJA 1H3HA 2P9KB 3RYFB 4KGXB 4DR6K 2ZOVA 2LCLA 5IHNA 3VOBA 3QJ6A 5KYUA 4FJHA 5A2QE 2KTVA 4EHUA 5BREA 4DUYK 3F0GA 3RSEB 3JARA 3V8LA 1ZSZA 3HM8A 3G4ST 3SI6A 4DRXB 2IVNA 3V1RA 2EW3A 3DI6A 2ASMA 1RT2A 4IUQA 5J1EA 1W70A 4O0IA 1YFNA 4BT6A 1FKOA 4Q5VA 2V52B 2KYBA 1BYMA 3UF4A 5AQGA 4CRIA 1QKXA 2K3BA 1Q86U 4OGCA 1IREB 5IXBA 1WNSA 3O3GA 3HRUA 3IRXA 4BQLA 4HTUA 4M75A 1V29B 1IRXA 1X01A 1VQPT 4IG3A 1FFXB 5G4UC 1AVZC 3ZT4A 2YXYA 1SSFA 5AZIA 4M3UA 2EKHA 5AT1B 2B8AA 3QICA 2BTTA 1ZLMA 3K58A 1HKCA 1GBQA 3CJ9A 2I6RA 4DA4A 2Z1EA 3RE3A 3A2FA 3VUBA 3SFMA 3DLLA 1VRTA 2FSJA 5EWRA 2JS2A 3BF3A 3U0OA 2QA4N 4B9LA 3KBGA 1TWBA 4WBNB 2JZ2A 2KQ2A 4FJXA 5JLHA 4DWIA 3QWYA 4JN4A 3T19A 1VQPN 4FM1A 3THWB 4KI4A 3CC4A 3WNFA 3MEDA 4KH0B 5J3BA 3K12A 5GANj 1I0CA 4IEEA 4OPJA 3LYBA 2A08A 3SIVA 5KRSA 1XC3A 3AVMA 4AHUA 3RMQA 5BR8K 3V81A 3HP9A 3ZSVA 1B34B 2O8DB 2IOCA 1LWFA 4FLWA 1YITT 3J8AA 1TGOA 4UC4A 4AHRA 5IYZA 3CCMN 1HYVA 4OMNA 3WNEA 4PLIA 2YI1A 2XHBA 4YJ3B 4BE0A 3TD5A 5CA0B 3LZJA 1QCOA 2FYKA 4XTUA 2CGKA 4KH1B 3JAME 3RMSA 4H0XB 1DJ7B 1K73R 1CZ9A 1W5AA 3G6EA 3QHSA 4FFBA 3WEEB 3RVCA 1NJXA 4NYFA 4I7FA 4QW2A 4LD9K 2KKZA 1ZUUA 1M4ZA 2ATQA 3MWPA 4DLGA 4Z4IA 3HFNA 2BTUA 5GANh 2QWOA 5EIBC 1AEYA 3JB9I 3TCJA 1Z05A 4O4IA 4TV8B 3GNFB 2YSQA 2YV0X 1U06A 5CKFA 3PT9A 2Q97A 4BI3A 4RG2A 2E6NA 2AK5A 1FMVA 4ZHQA 4J6WA 2ITGA 1M1KH 3T1HK 2XY6A 3C9RA 3SK3A 3I56A 4CHOA 5GAOr 2RPIA 2R57A 1VQKN 3TAMA 2GZLA 2ZPIB 1Q86C 3SBGA 1X1PA 3J81M 4LXCA 4RCHA 1L3SA 1UTIA 4I55A 1MV3A 3ZYYX 2RK2A 3SB2A 1W2BA 4LF6K 4QOZB 3U3GA 4QS8A 4XU3A 2OTLA 4XTYA 1BA1A 4R5PA 3F6MA 4CC4B 3VQCA 4AMCA 2DFHA 2DETA 1GLLO 1NJYA 2A3LA 3O9SA 4MMKA 1VSDA 2OPRA 3CIPA 5AQZA 3I55N 4KHQA 2DVJA 1RA4A 3A8MB 3NMUC 1WAJA 2D6FA 1JFFB 1BIAA 4BG9A 1HSQA 3CPWM 4C8QB 1B9FA 3I8DA 3MO8A 4F9OA 3VS1A 3D2FB 3VQ8A 3ZSZA 4GMJB 4O2AB 4H8KA 3AVNA 4KBMB 4J9EA 2RKIA 2FG0A 1RT3A 4EMGA 4IFEA 3O8VA 4H03B 3FFMA 3LDTA 1JL2A 4M7AB 4CFCA 2RHJA 2F2VA 4IIOA 2QXLA 1NYGA 2ZPHB 2AHJB 3H0HA 3I9QA 5LJ5j 2KLAA 3VIUA 1Q95G 4G1QA 4CE9A 4ILGB 2P0KA 2FF3B 5EB1B 3F70A 3A0IX 1GOBA 3U6FA 2LTOA 1NG9A 4AHVA 4CBXA 1QW1A 2CZ6B 3OW2F 1LCUA 3H9NA 1ZUYA 2O9SA 1K8KB 3CM6A 5BR9A 4XTZA 1WSIA 3HL8A 3TAEA 1WOQA 1OU8A 1PWTA 3LDNA 4ZK7A 2SEMA 1AZGB 1CXUA 3HRTA 4ZHVA 5GAOl 4LN2A 2QYZA 3RKXA 1DGKN 3OS5A 3DC2A 4JLGA 5JS2A 3QYHB 5LJ3f 1UHCA 5FU6B 3O8MA 3RWUA 4CF0A 1NJIH 1E4FT 4ZHRA 2HCKA 2KXCA 2UYKA 2ZVYA 4W5NA 5E84A 2E6ZA 2QDYB 3FZLA 2DTOA 3VEOA 3ULDA 2DNUA 1FNKA 5LJ5h 2HOEA 5GANf 1M2VA 1JL1A 2NUTB 3TTDA 3V7CA 5DY9A 1X27A 3AO2A 2O8FA 1F1BB 2QEXA 5HL7L 4RKUE 1VQMA 4DS5A 2F96A 2DBMA 2MPXC 3ZEHA 1S1TA 2FRYA 1Z25A 3AVAA 3LAMA 5CZ1A 1Y96A 1FWZA 5K14A 3EFOB 1TXQA 3E22A 3G71Q 4PFPA 4DR3K 1W5FA 1IO6A 4C0FA 5KCOA 4E1NA 2O4XB 3OYBA 2FEIA 3VS0A 2HQXA 3P8DA 2D0CA 1FMWA 1SV5A 1VSFA 3N2KB 3WGNA 2K6DA 2M0OA 4PJMA 3O4WA 2Q2RA 3VKIA 3EG2A 4DBRA 2R58A 1ASVA 1IH7A 3A5MC 3PSFA 4IXCA 5M1OA 4ERHA 1YITA 4LDYA 5CKEA 1QAHA 9ATCB 1ZSZC 3OMGA 3ATVA 3ZETA 1YIJN 3EN9A 2NUPA 3M5AA 1N34K 4BT7A 3ZT1A 4LY7A 1C1AA 1QQOA 2H3GX 3QUWA 2DTUA 4M63C 1XBIA 5JVGL 2DZ9A 3JCMd 5HRNA 1TG0A 3CJAA 3D00A 4LSNA 3IQLA 1U2VB 3VO8A 4PJOC 3EGXB 1K0SA 4M75C 2EYQA 2YHAA 1TSFA 5BN9A 4N47A 4J9CA 5AQSA 4DFKA 5LYJB 5IHKA 4LNUB 1J3TA 3A1PA 2DK3A 4CZJA 1UB4A 5F1XA 3HKCA 2OTJQ 2P4RA 4MMLA 2DEUA 4O4JA 4J5YA 4R0KA 3P4IA 2EAYA 4C0ZA 3DXKA 3SMPA 3QDKA 1BKBA 1UHFA 4A54A 1JLQA 2GVIA 3QLHA 4BRPA 5GAEP 2KR3A 3VCZA 2E8AA 2EYWA 4A5AA 3TABA 4ORZA 4WF2A 3CPWP 1ESVA 1K73U 3OS2A 2P9SB 3GL1A 2W42A 1OU9A 4DQRA 3PX6A 3S9HA 5IWAK 1CKAA 3IUCA 1U48A 4O2BB 1RLQC 3BUZB 1EZZB 1VQ4A 2BTFA 4CJLA 1T7PA 3THYB 1P90A 1B9DA 2OTJF 3NK7A 1BO5O 3BF1A 5AQYA 5AFUH 3SQ0A 5EZYA 1W6XA 1MNDA 3CCQT 2ZZDA 2RD1A 5LJ5f 2F9ZC 4JPBW 2HNYA 1JJ2S 4ZOLA 2IVWA 5E26A 3WGLA 4LNUA 1K8AH 4JRQA 3WUHA 3VYTC 1WHGA 4CGGA 1BCOA 1G3TA 3UKUB 3LWRC 3L2VA 2L3QA 3VEYA 1T3SA 1V4TA 4PUOA 3PIOA 3AA2A 1PC0A 2RQUA 5J39A 2P9IA 3JCMV 4CHNA 1ZX6A 2DA9A 3UE5A 1I5OB 3RESA 3M84A 2E70A 1NGDA 5F0XA 5F2RA 4WF9L 2RHZA 4W5RA 2BANA 4JKGB 3LDQA 2PMPA 2AP1A 4PL8A 1QQMA 3CMAT 1MV0B 5MLCQ 1NKEA 3HFOA 5KQDA 3OYEA 3CMEN 2OAWA 3BY7A 2H8CA 2JWKA 4F14A 3NGZA 2XIDA 2Q0UA 4WFBL 4BVRA 1RT4A 4GW6A 3ZT2A 1SEMA 4OVAA 3S06A 3GDQA 5DMRA 3ENBA 1YJ9A 5HBMA 4AG1C 4HUEA 2LQ8A 2OZMA 4JI2K 1T3LA 3I8BA 2LX9A 4F6RA 1HQUA 3OY9A 1CLQA 2HEQA 4M75E 4PLLA 4WCIA 4M78B 3EHRA 2H3JA 3RMDA 1IGUA 3ZO8A 4II1A 5GAMd 3CMAN 2Q3SA 3U23A 1BA0A 3SAGA 3KK2A 5AQJA 1QVFM 1ZWZA 2JNBA 3R3LA 1D3BA 2QQRA 3WXIA 3B6OA 3R8EA 5FRNA 4BRIA 3ID8A 1LOJA 2R6R1 3LH5A 4IDHA 5IXFA 1KLNA 2R751 2I6DA 3HKBB 5CA1B 1VRUA 2BZYA 2K5FA 4JKHA 2F8SA 4PL6A 3IFRA 4IDKA 2NMUA 3JAWA 4IUVA 1HMVA 2E1HA 4B3SK 1UGQB 3SHWA 2R5AA 1L5UA 5KRTA 1RAGB 1K73C 3DLGA 3EFRA 4OMMA 3DRPA 3U3YA 1D0XA 4JJDA 3IMPA 5D6WA 5KE2A 3JS6A 5SZTA 4N56A 4E7KA 4DTXA 1OH6A 3FFIA 2JTMA 4WCEL 4YDUA 2D0AA 1KAZA 1XNRK 1C0UA 4HTLA 3C6AA 4Z02A 1VQOQ 4OMQA 3CQYA 1RT5A 1N8RH 1X6BA 2CH4A 3I35A 3JASA 3N5BB 3IMXA 2DYIA 1S9GA 2CGLA 4DV4K 5LOVA 2HP0B 4YJ2A 3P31A 2LQKA 3VGMA 4CC7A 1O1WA 3LP3A 5ADXH 3HKDB 5EAZA 1YJWT 2HBWA 2KAFA 1VK3A 2DBKA 3WT0A 2WONA 2DYYA 3CFOA 1VSMA 5CA1A 1TKXA 4JI1K 2WOMA 3FR0A 1VQOF 3HKSA 5CK9A 5HK0A 2CZ7B 2ZAEA 4DEXA 1ARKA 4H4MA 4DLEA 2HSEB 1PD1A 2G8IA 3VYUC 2E41A 2NRXA 5LP6B 4CC3A 3CCRT 4RTTA 2PUKB 4DUZK 2J05A 3LANA 4DEYA 3TARA 3HSBA 1ITGA 1M3AA 4F04B 4YY3K 1FYNA 2L89A 1ZXOA 3VEXA 3OYFA 1RBTA 1OH5A 4J7FA 2YCHA 4BWJA 1YJWN 3LDPA 1QVGF 3VRZA 3Q7CA 2D1XA 3C0BA 3K2PA 4RG8A 2ZJRL 4ZGDB 1SL1A 4KRFA 1VQVA 3N4PA 2C0OA 3CC2Q 1VQ8T 3HYFA 3CCVQ 3O9QA 5M1QA 1W42A 3RA5A 4QQ6A 3NHGA 4CEOA 4LF5K 1UECA 5MN5A 3V7SA 4NOYA 2OANA 3PIPL 3LAKA 4Z89A 3DB4A 4C5EA 3DWLA 5I9EB 4XEIA 3CCRN 2NNWA 5HK3A 3A98A 4FZYA 4LF4K 4DR7K 4DHYA 4FXDA 4XH1A 5GAOn 5GMKi 4DQQA 1U4BA 5IAYA 2YJEA 2ED0A 1IJJA 4BT4A 2I7NA 4EI8A 4Q5WA 1Y64A 4ZGEB 1N5ZA 1ZBLA 1TTHB 1KHIA 1PHTA 3FEOA 3CJ7A 4B9NA 2HRYA 3A5ZB 3CC2F 1T0HA 3CCVF 1T0JA 2KVQG 1D1CA 4BDPA 2L2PA 4FK4A 3J80M 1KFDA 4J7IA 4BW0B 5HY4A 5GJVB 4JRIA 1LNXA 3EE8A 4B1ZA 1WHHA 3AA3A 3AO1A 4JLHA 1R0AA 4JI8K 1BIUA 2CSQA 1LW0A 2P9PB 1SAZA 1M1FA 2IGIA 5LJ3g 3AV9A 1KCFA 2FPEA 3A8LB 3E9FA 3NF6A 2L3PA 2DL5A 1ATSA 3KWIA 3ZP7A 1TVKA 1WJRA 1EETA 4FYVB 3E01A 2XDDA 4F3OA 3JCMh 1NGIA 1BBZA 1TK5A 3H1VX 3MXIA 4MZPA 1MHNA 1M1KR 3AO5A 3HBTA 4I4TB 2DY4A 2EJ9A 2LJ1A 4RUGA 1XWLA 3CC7Q 1NJIR 4FYDA 4J2DA 3NBPA 2X3WD 2YUQA 3CPWA 4DBQA 1QVFP 5D7UA 4F3TA 5A0LA 1IHWA 5SWMA 3VMFB 4FYWB 1NK6A 4FZXC 2V1RA 3KKRA 2EGEA 4E1JA 2F8TA 2O8BB 1W9HA 3F5TA 5FPNA 2FB7A 1UGSB 3V8KA 5IJ9B 1PRLC 2P5GA 4Z8AA 2ZE2A 2G3RA 4FU6A 3N4QA 3QETA 5GMKm 2FSNA 3RERA 2EQUA 2A37A 3CC7F 1E6HA 4H0VB 3E1SA 3M58A 4CJWA 3DRRA 1Z9QA 2P51A 2D9TA 2RNAA 4M3WA 2RHYA 5HXUA 4OLAA 5GAN8 4B46A 3JB9F 3PIPA 4OO1J 1KAXA 4DTOA 1OQKA 1VQNN 3CQXA 2ZF5O 2EFIA 1RNHA 4DSJA 3K5OA 5JQGA 4BGAA 4YOTA 1X6OA 3OBWA 4E7LA 1VSIA 2VQFK 2Z1JA 4CZMA 5L23A 3MAQA 3LFOA 3FZKA 3BDPA 1Q8RA 1K9MH 2HHXA 1M2OA 3CCUT 2MAMA 2FBTA 4FT2A 1ZUKA 2ALEA 4RTYA 2NWMA 1OH7A 4B9QA 5EIBD 3JB9H 1NGGA 1S1UA 2CGJA 4M45A 3M53A 3KTQA 1NYFA 1QCFA 7AT1B 2RHLA 3D54A 4JLIA 1UAXA 4IZ9A 3IAYA 1KIKA 2HMPA 3C6UA 4F4KA 4O6JA 2LCSA 2AJQA 4ID1A 4M3TA 1B92A 1HKBA 3U9DA 4M77C 3VYSC 5AQIA 1Q86O 4BDYA 3CI5A 1YBYA 1NK8A 2KXDA 3FD6A 2AIFA 2K2VA 5HP7A 2MQEA 2EGCA 2EQIA 4PJOG 3KLIA 3R6NA 2DYBA 2ZGWA 4F7UF 2OCEA 1BI2A 2P9LB 4DF8A 4IUTA 3I0SA 2DFEA 3D2EA 2DT4A 3IEQA 3M4YA 1OV3A 3M54A 2QA4Q 1N9RA 3UKRB 3ZOPA 1GCPA 4X3LA 2ENMA 2VV5A 1J54A 5KPTA 3O3FA 3SWNA 1HPMA 1TK0A 2K79A 1QCNA 2YHBA 4FJIA 3C65A 4BRHA 1YI2N 1HNXK 4B9SA 4FM4B 3E9PA 3M57A 4LUDA 5I11A 5C8YA 3JCMf 1NMDA 1R1MA 3VTIC 1G3YA 1VQMN 4M3XA 5GAMh 4X1YB 4C8QF 4DR4K 1WQ7A 4KTZA 3CCEQ 2QA4F 1U1TA 1HQEA 3JYTA 4PJLA 3DB3A 1VQ8A 5AQPA 5CCAA 2L8DA 3T3FA 4BVSA 3CCMQ 5LJ3e 4B3MK 1WX6A 3A8YA 2F7TA 2W41A 1NKCA 2UUAK 1GLBG 2D0PA 2F9WA 4KHUA 3CBPA 2HZYA 2HVYD 4N0AC 3R6OA 1VQLT 3JCMW 3S3OA 3L2QA 1K8AR 4TSXA 3CEYA 4YDUC 3ZBDA 1NK0A 5C0YA 3LDSA 4EB6B 2CREA 5GANe 3E66A 4O8KA 5ECAA 4A57A 3VYGA 3CCEF 1JKHA 3R6MA 4JKFA 5EY4A 3VQPA 4CJUA 2KBTA 2JVVA 2OHWA 3NHNA 4OKKA 2VKNA 4C8NA 3BDUA 3CCMF 3ER0A 2KZMA 5FLXM 1DTTA 2KDSA 5C2FA 1M3BA 2ZM6K 1YP5A 1FMKA 1OAPA 4BRNA 2QTVA 1B3QA 1KSPA 1AWWA 4IIJB 4AH9A 3RKYA 4NL3A 1VQKQ 3K0TA 1BIBA 1BU6O 1Z26A 2KFNA 4RTVA 1VHAA 1QMCA 2RMOA 1T6DA 3L4IA 5ITZA 4EMKC 3VQEA 3OYMA 3M0TA 4OB0B 4Y92A 1RLUA 2RB9A 2MK5A 1BG3A 4CEFA 1N33K 2QWPA 4WQ4A 3M0RA 3AVBA 1HYSA 2XY7A 2K7AA 1NWKA 3J7ZO 1ASWA 2VGNA 1VQ5Q 3FIFA 2GWJA 2FLOA 3I55Q 2X74A 1KNJA 3MEAA 3TWHA 4PKIA 1VQKF 1QWFA 4CEZA 3HPWA 3VEVA 3AARA 4DMNA 3L2WA 4C8GA 1Y71A 3T7ZA 1RBRA 1W59A 3O4NA 2E4HA 3DXMB 4J2AA 3LWLA 2DJQA 3ERNA 4HCKA 3DRSA 2HSTA 3CC4T 2WTUA 2YNIA 4CHQA 1TKTA 3UIQA 1VQ5F 4BRDA 5C10A 1SF9A 1H3ZA 1UOCA 4DV0K 5J2TB 3I55F 5LA6B 4O8UA 2A28A 3IKFA 2QTDA 3FJPA 1W57A 2B33A 4B62A 5D6YA 5EC7A 3AVJA 3NMUA 2H6LA 2E12A 1Q7YC 1UI9A 2DF6A 2ZD1A 3EGDA 3SEMA 1M1KU 1VA7A 4JJBA 4C0DC 3CCLQ 4CEQA 4J9GA 3SUQA 1NK4A 5LXTB 1NJIU 1QZ6A 1AD5A 3O1BA 5GAMf 5BMVB 3LW5E 4RW4A 4FL6A 1NGJA 1W3EX 4X34A 5I22A 2R5MA 4CGIA 3Q8HA 4PJNA 2DJZA 4D6WA 3JCMX 4PJOD 1N8RR 1YHQT 2GTJA 2EQKA 2H3EB 2J06A 5I21A 3LP2A 2RK1A 2A42A 3CCST 3SAHA 3CCLF 3KXTA 2OPPA 2NYSA 3PGGA 5KYXB 3EG9A 5LJ5e 4FJJA 4M77F 1QVFA 4JI6K 4FLTA 3D7SB 4Z4HA 3LWMA 2YRDA 5CE3A 4KAZA 5J2TA 3ULEB 4CK3A 2P4TA 2WUSA 2KGTA 2V9YA 2X4WA 3D0PA 1AWJA 1UUEA 3OB9A 4ISFA 1WNLA 5AQQA 2DL3A 3TSZA 1ASUA 2Q36A 4M7XA 2LT4A 2WFBA 3G6EN 2GX9A 4FIBA 1SSHA 4ELVA 2LNHB 1J6ZA 4QVZA 2FZGB 3SQ4A 4KO0A 1JLCA 4MO4A 2FF6A 5KYUB 3IEWA 2SRCA 2A3ZA 4ISGA 3HSTB 3QIPA 1SRLA 4LD0A 4BREA 2OTLT 5M1FA 2XY5A 1XRGA 3JARB 5HY1A 1ZSZB 3KIOA 5AQVA 4CJ3A 4OP0A 4DR1K 2QI2A 3GNGA 3SMSA 3H41A 1WXUA 1JJ2F 1IV0A 4PFZA 2BZXA 4BI8B 1BB9A 1VSJA 4M7YA 4KT0E 3OYCA 1B07A 3VQAA 1VK0A 3I56N 3W3DA 1WSHA 4YOXA 3V7QA 1CLIA 4B1WB 2B5JA 2EWSA 3TSQA 1SDSA 2YNHA 3TEEA 4M75B 3VENA 4E3SA 1ZBXA 4BC3A 3CYQA 1YIJQ 1KVAA 1OVQA 3HPOA 3CXCM 3PAFA 4G4ZA 2RN8A 2E64A 2IVOA 1U40A 3WJPA 4EPCA 3BE3A 5AZIB 4BROA 2UZHA 2KTUA 2QDLA 4ZHYB 3VEZA 4KHSA 1VQLA 1AZEA 3WVEB 2FZKB 2M51A 1ZBUA 4RW6A 2IQQA 2ZPGB 1KJWA 4B9WA 4FWMA 5ADXA 4DR2K 2XHCA 3AGKA 3VQ5A 3MECA 3P10A 3P38A 1M1KC 1M1GA 3L6QA 4Y1DA 1RQ7A 1CSKA 3RIRA 1JJ2M 4C8LA 1NJIC 4PQUA 3JVHA 1YIJF 4LH4A 1RQ2A 4CJ5A 2ABLA 2F2XA 1L3VA 5GAPK 3G7ZA 1QSLA 1SL0A 2YT6A 1HJDA 2JMCA 4RTUA 1GLJO 5CB4A 1NPPA 2VC8A 3CD6T 1G5VA 3AGRA 4FLUA 4W5TA 1T03A 2RA2A 4OMPA 1IBLK 4QT7A 5IT9M 2FL7A 2HQHA 3J81E 1RBSA 3KK3A 4M7DF 4PJOA 3VS5A 4PHTX 5GJWB 4A53A 4ESRA 4M78F 4I2QA 3V6DA 3SWNC 4JS5A 1DLOA 3NFAA 4HVWA 1VQOA 1K8AU 2G8WA 5IYZB 4LCKA 4C1NI 4EI9A 4JDSA 2FPDA 4N4HA 3LWIA 1J9AA 4CEEA 4C0GA 3NGIA 2BO1A 3HRSA 3PVLA 3G4SN 3PLAA 1YXQA 3TD3A 2RJFA 4B9MA 3PUFA 4C8KA 1TS9A 3M0UA 4J9FA 4LUEA 4FSVA 1K73O 4FFBB 5A0GA 2QEXT 4LH5A 2V26A 2PVDB 4AFQC 2O9VA 1VQMT 2QGFB 1EWRA 4BE1A 1S6QA 1NGEA 5HP1A 4HCZA 3A5NC 4EMHA 2HNIA 1VQ9Q 5FW9A 5IH2A 1GXIE 2H8EA 4DOWA 3DOLA 5KMGB 4O4IB 3OSVA 3PV8A 4CHZA 4B5CA 4HWIA 3H0FA 4BGBA 4C5HA 3ZFJA 3NGPA 2D0OA 4H0YB 4ZHQB 1NK7A 1W97L 2JW4A 2GBQA 1IGQA 4YOUA 1GL5A 3ZX0A 1K9MR 5BRDA 3F73A 2DO3A 4BR2A 4CEAA 2QEXN 1SA0A 3VQ6A 3HT3A 4CJVA 5GAN7 1A5VA 2JT4A 1A5XA 4D8DA 2GELA 2W6KA 4DTNA 2WBNA 5J2UA 1TUCA 1VQ9F 2C0IA 3CMEQ 2PY5A 3CC2A 1CXQA 4I55B 3CCVA 1YJNQ 2HNDA 2NRTA 3JB9J 5KYNA 1JLEA 2KTQA 3IDHA 2CP3A 3HXMA 1N36K 3UA6A 1YHQA 3DJCA 4IOCL 4O4LA 2UUBK 2F5TX 3NTKA 1RDAA 2DFFA 3FLGA 2Q1NA 1HJOA 3GE1A 5T7BA 3H08A 3CCSA 4PNOA 3GP8A 2HBLA 2XO7A 3K5LA 4I2PA 1VSLA 1IV1A 3MHXA 4C92F 4M77G 3FC3A 1S72Q 3SLCA 3EHQA 3CMEF 5KMGA 1YITN 1G3WA 5FLXO 4WQ4C 1YJNF 4J9HA 4IKFA 4NLCA 1IV4A 2DPNA 4G4WA 4WFNL 1N5YA 1TKZA 4CZIA 2AIZP 2FXUA 5GAGP 1JU5C 5JVDB 1H641 2VAMA 1WA7A 1X7OA 4MZMA 1OPLA 3H46O 3AVKA 2W10A 4KH6A 2YLBA 5C25A 3C12A 3VQDA 2IAFA 1N8RU 2NUBA 1S72F 1RDBA 3FZFA 4OGEA 1KQSS 2O2OA 2NRHA 3EY1A 3NTHA 1K8AC 2RQRA 3TAPA 1VQ4T 2CHSA 1NGAA 2CH4W 4DQIA 1X52A 2VGMA 3CXCP 2Y1IA 4CJQA 3META 3OJUA 1WDXA 3C7NA 4KI6A 1H7MA 2Z1IA 1WLJA 1WBBA 4RTZA 1TVRA 2RQWA 1LW2A 2HNZA 2EHGA 3AVCA 2QWMA 3P5JA 3N2GA 1IKXA 2UXBK 4IJAA 1NNEA 3QO9A 4HNAA 2LBWA 4RQOA 3U4LA 2RH2A 3RDVA 2K5IA 1QS4A 4JS4A 5JS1A 2OX7A 1MGQA 1IKWA 1XOVA 1PSEA 2Z1TA 1LAVA 1YVNA 2EJFA 3P8BB 4K43A 5CYMA 3THXA 2IC3A 1VQ4N 2YUPA 5JVDA 3EZ5A 1M2VB 1C0MA 3E1YA 1VYTA 3UT1A 5AZJA 2VQEK 1Q8IA 3ALYA 4NLBA 3F9KA 2O8FB 4M3ZA 2E6MA 2V7ZA 2EGAA 1I3AA 1B7TA 3KKSA 3S0YA 3F9MA 4A4KA 2JM8A 1VQ6Q 3H6ZA 3CF5L 1Y96B 2WSFE 4JZ3A 3RKWA 3CCJQ 1WBDA 3MEEA 1M8MA 3E22B 3M6GA 3WXKA 2NLXA 5J2QA 3TI0A 1IKYA 3CD6A 1YJ9T 3J7AP 1GZ0A 4BB7A 2DKGA 1BDGA 3RYHA 5CVIA 4E7IA 3OYHA 4YOYA 5CO7A 1NJZA 3TTCA 5EU7A 3ASMA 2X6SA 1I39A 4BR5A 1O13A 2ITMA 3NF8A 4J9BA 4M4ZA 4DTRA 3V4DA 1LAWA 1QQCA 2D0QB 1VQ7T 4MLHA 4CERA 3OA9A 1VQ6F 3CCJF 5GIOC 3ZETB 1YGYA 1OI1A 4UQGA 3BZCA 3PFSA 3GOIA 3QEXA 2NUPB 3QMLA 5KYWA 3OHRA 3RR8A 2DPPB 4CZLA 3ON1A 4FJKA 5MN6A 3OW2M 1D4XA 3MCAB 4YTLA 3QSUA 3P83D 1YJ9N 1N6QA 1ABOA 1GCQA 1C0TA 4X66K 4KUDK 4KPYA 3RYCA 3CJ1A 5GMKl 2CWJA 4DTSA 3ZX2A 1JD1A 4KGVB 3TU5A 2VXYA 3VS3A 4I50A 3LWPC 4B1XB 2QA4A 3MKDA 1JB0E 3H3OB 1GO0A 4O4HA 3KLHA 2V1QA 3ULRB 3LPTA 2HX0A 3IKEA 5GONB 2BH1A 1JCEA 3SUPA 4J9IA 3MJXA 3MK6A 1RT1A 4JKBA 3L42A 3QDRB 3WNGA 2HP3A 6AT1B 3HKCB 4O4JB 2HL5C 5JMVA 3G25A 2PYLA 2HS0A 3KUFA 3ZSWA 3JCMe 2P0QA 3PIOL 3DXKB 4NB4A 4LFCK 1DBFA 5GIPC 4M77D 3KJKA 1XI1A 2CUBA 4NUTA 1ZBSA 2QQ9A 2LC4A 3CCEA 4KHWA 2E5QA 3ZSYA 4LDUA 2KT8A 1JEGA 4PL7A 1X9SA 3G71F 2QTXA 1RGIA 1TL1A 2CZ0B 2FSKA 2KE9A 1W4SA 3CCMA 3ZSOA 1T0AA 4YJ2B 2HD0A 1ZA2B 2PYJA 1WJQA 4IFYA 5KX5A 3NGYA 4Q0BA 4BRMA 4RW7A 3VRYA 1RL2A 3OBYA 2UXCK 5EZYB 3CPQA 2E10A 3EG1A 3UWNA 3OS0A 1HNZK 5GMKj 1RAAB 3SJJA 1XUPO 2LP5A 1LOTB 1VQ5N 1TH7A 4ZOLB 2EBPA 4XAXB 4C92G 4X20A 3M4GA 1D1BA 2LZ6B 1WHMA 4ANJA 3QYGB 4HVJA 4DSKA 5GONA 2K3XA 3PLAC 2YHTA 1K9MU 2QGGA 1AWXA 1IO2A 3AVLA 2BE7D 1OULA 1RACB 1K9AA 4DBHA 1MMGA 2P9IB 5IT9O 3H1QA 1HX1A 4N4GA 5C0MA 2AZVA 1VQNQ 4DB3A 3S02A 2XI9A 1GLAG 3E9LA 3HPHA 1M5Q1 1VQKA 3SCXA 4GV3A 1SRMA 2QQBA 1G8XA 2Q0RA 2GF7A 2DERA 5LY3A 4F8RA 2A0FB 4UY8O 4KH5A 4HUFA 3O5ZA 1JCFA 1XTDA 5GMKh 1ZC6A 4FOIA 3Q7BA 1TV6A 4LD6A 5CHIA 1XC9A 3ZLJA 2N48A 2FC0A 1Q82H 3VQBA 4B3OA 1Z9ZA 1VQNF 3I55A 1WIEA 1QHAA 4O44A 3UA7A 3BEXA 4F6RB 1NM1A 3O4QA 4A4HA 5JH7A 4AM7A 3MXMA 2PZ1A 3TR8A 5BPNA 1ZQ1A 1OFUA 3WQTA 2A40A 3LALA 4E7HA 4DV2K 4BRKA 2M0YA 5DM6L 4R79A 4DFJA 3C9TA 5B8FA 5KH6A 4DTPA 3O9TA 1D3BB 3AA4A 2FBXA 3NTIA 1RTIA 2HHHK 2CGHA 2BZ8A 3LX7A 3WGJA 3CCQN 2G8FA 2KHOA 5FROA 1NBEB 4ILHA 2VAPA 4Y0WA 3JAWB 3V9ZA 4XU1A 1YI2Q 1I4K1 3CCLA 3DMJA 2V8KA 3JSMA 4JI3K 2F2WA 1ZYQA 4M77A 1VAZA 5GAMe 4FO0A 1X9WA 4N76A 4YFUA 3MP1A 2CYZB 2ZGZA 4DQPA 1VH8A 1YJNT 3S0WA 5EVZA 1PG5B 1LCKA 1YQNA 2PHNA 4CFDA 3OQ5A 3ZEUA 5A0DA 1UWBA 2GUPA 4RMOA 2DL8A 4GY5A 3CXCA 2DE0X 3OW2P 4PJOE 1HNVA 1K6YA 2ZPEB 2OJ2A 1Q7YO 1YI2F 2CSIA 1VQ7A 1R0CB 1YWPA 2J6OA 2YWWA 4V2SA 5ELZA 2UYNA 5LOVB 4HVUA 1D9DA 1KFZA 4CGDA 3R0PA 3I33A 4QVDA 4HXJA 2HMAA 3O6WA 4DCHA 3VTIA 3MBMA 2CP7A 4X3MA 1UGRB 5C2DA 3QEWA 4Z88A 2X3XD 2EWNA 4PFOA 3J80E 1JJ2A 1DKGD 1WN7A 3V1QA 1D8YA 3RYIA 1TKDA 3OYYA 3J81O 3GBTA 4X1KA 3DLLL 4NWOB 1NLOC 5CR2A 3IKMA 2QAZA 2VVKA 3AA5X 1N32K 4L6V5 3GLXA 4B9UA 1L3UA 3FBAA 5AYFA 4U3JB 4N0AA 3EO3A 1I94K 2CP5A 4J2EA 5IJ0A 3QWXX 2G6FX 4E7SA 4DF4A 2DXBA 1W1FA 4C92D 2X9HA 1TL3A 4ZN3A 3TSPA 2P84A 2J7IA 2QASA 2Z1GA 2K1SA 2G8KA 4NYNA 2YLCA 4CZGA 4FK2A 2JTFA 3GF5A 5M1PA 1PM3A 2RI3A 1XNIA 3R9PA 4BRFA 2CW4A 1YIJA 1JLGA 2L3SA 2AA4A 2VAWA 4RCBA 4QQDA 1KLMA 4KULA 1JN1A 1W0HA 1HD3A 4JYAK 2CVLA 1Q81H 1G3SA 2P5OA 3F0EA 5D6XA 3CYMA 1RILA 4J9DA 2YHYA 2HS3A 4DSEA 3ZSQA 4DU3A 3HTNA 4EMKA 4BACA 4IG0A 3KE1A 2ZAUA 1DT9A 1KD1O 2O01E 1VSKA 1Y0MA 4QS9A 1U43A 2A36A 3MN7A 5FPEA 4O4GA 2HDAA 4J8OA 4RTXA 3X25B 1U47A 1BHLA 3PTAA 3X20B 1KRPA 1GCQC 4FWQA 4KKOA 4MLEA 3L3VA 3P8HA 4IO9L 4FM2A 4CBWA 4C8QC 1R8OB 2GTOA 1M90H 1G15A 1TVKB 5EB0A 4CJTA 5AR0A 5AQUA 2GFUA 3CFRA 2WSEE 2C0TA 3SV4A 4JEPA 2UYPA 5DM7R 3HJWC 3C94A 2BE2A 4X65K 1NJIO 4M7AC 3FRNA 2X35A 2VWJA 2Z01A 3AAPA 3TAFA 4B1UB 2VWFA 3S6WA 1ZBIA 1JLBA 4K0KK 5DCVA 1VQ8N 4O55A 2AIRB 4KFBA 1U5SA 2F9TA 3HKEA 3F2KA 2EYZA 1QVGM 3M8QA 3MP8A 4CK1A 1VQ9A 4FJMA 1HK9A 2UXDK 2NZTA 4BD3A 4FJ5A 4B3RK 1FJGK 3GPLA 3G71T 2G8UA 4DQ8A 3BDLA 3ZSRA 1MMNA 3G6EQ 1OKJA 4NCAA 2UYJA 3JAKA 3E2UA 2Z1FA 1GFDA 3GBQA 4DBFA 3PO5A 2RHHA 3CPWF 3GYQA 1RLGA 5FU6C 5JQGB 2P9UA 3LDLA 4AHCA 3WJQA 4XU2A 3JCMQ 3ZCMA 5DLQE 5C42A 4KTQA 1YT3A 4CHPA 2E65A 5GANg 4C92A 4CI6A 4GV6A 1JQQA 3DDNA 4FWPA 4KREA 3CMEA 1Y7XA 2DXTA 1YJNA 1GOCA 3G6EF 1M3CA 3K9JA 3I56Q 2PVOB 3JASB 4C4WC 4LDXA 3RR6A 1KC8H 3SPZA 3Q1JA 4CIGA 3VPZA 2RHOA 5KPRA 3QERA 5GINC 4KHNA 1S9EA 1QQJA 1VYVA 1S72A 1ZBFA 3VETA 5CZ2A 3LM9A 4E6EA 3NMZC 3AO3A 5JLFA 1NK5A 2KGWA 3O08A 4AFZC 4J2BA 3X28B 5HRRA 3I56F 5C12A 2OTJT 4XIUA 1ILYA 3HOSA 3W0LA 3WXMB 3L1AA 3OSSC 3RMAA 4DSLA 5HRSA 3JSCA 1PKTA 3D2EB 1KNKA 2W0ZA 5FLXE 3LZIA 4IOAL 4WFAL 2HF4A 4DV1K 4WE1A 3HWUA 1MDUB 2E1ZA 3E20B 1SKRA 3CBMA 2A5XA 3C8LA 1W2BF 3SWNB 1RAHB 3VQ7A 3RRHA 1GRIA 3KWGA 3K5NA 2HQEA 4B8AB 2RHXA 2EPDA 2G8HA 2CSLA 4JKEA 4I6MA 3OVNA 4FJ8A 3RUXA 5C8YB 1HR0K 1J53A 4AFSC 3P39A 4CVNE 1JXEA 5GAN3 3S3NA 4ELTA 3MCQA 1EFNA 3L3UA 1OX9A 4LDWA 4Z4FA 1W5BA 2GBZA 4BT2A 2O8EA 4RW9A 4K8ZA 5FWCA 4X1IA 3RMBA 1TUUA 1W581 2QM1A 5D3GA 1IXDA 1QE1A 3G10A 2Z1UA 3OW2A 3G4SQ 5GAN6 1VSHA 3M8PA 3CCUN 2A1SA 3LM2A 4B8CA 4FYXB 4ELYC 1WB9A 1QP2A 1E7KA 4DFPA 1K8AO 1RAIB 1SS6A 3AO4A 2IIMA 4GVMA 1KQSF 3E19A 1RTHA 2E5KA 4E6RA 1N27A 1SKSA 1GLDG 1C1CA 4F2SA 1I5LA 1OPKA 1VQPQ 2EX3A 4BC2A 4FPBA 2KI7A 4JD2A 2HHQA 2FBVA 1TUBA 1S3XA 3VJPA 2AT1B 3G4SF 1R77A 1PD0A 5AVMA 1VQ6A 5LL6Z 4XTWA 3CCJA 5LJ5g 4GY2B 1RDWX 1M9SA 5HY6A 3VI6A 1XJWB 2M02A 1WSJA 3OYJA 3HP6A 4BVQA 2LVMA 2OI3A 2Z0WA 4CFAA 2YKNA 2DIGA 1VQPF 5J2MA 5ITZB 3J7YP 1Q82R 3LH0A 4M7AF 3M8RA 4PKCC 3DAWA 4H5RA 1KQSM 2EVRA 1T05A 4EP4A 1OX8A 4FLYA 1QVGP 4YNQA 2LBXA 3TD4A 1RUWA 3AHUA 2GEMA 3O9UA 3VF4A 3QBWA 4B08A 4HA8A 3QZ9B 2XKOC 2MF2A 4TZZA 3WPWA 2LJ3A 3QPHA 2E20A 3HK2A 3TQ7P 1RADB 1EP4A 4PKHA 1NU0A 4IEIA 4JK7A 2EYXA 2Q1XA 3WVDB 3G71A 3QIIA 1VQLN 5AQMA 2X4JA 3MEWA 2FVUA 4EDUA 3EGDB 2Y1JA 2WACA 2O31A 1TYQA 3AT1B 1VQOT 2ASOA 4BR4A 4M7DC 2CT4A 4M78C 5LJ3d 4KV8A 1NLVA 3DYAA 3SBTA 3HI0A 3DM2A 3O9RA 2O88A 4M42A 4M77E 3VS7A 3DLRA 1UGPB 1RDUA 4IURA 3D6RA 4DQSA 2YHWA 1W55A 1TU0B 1JLFA 4A2BA 2ED1A 3QFPA 4N5SA 2QW9A 1ONIA 2YHXA 5AFUA 4CD3A 4DXDA 2BTOA 1SQKA 4TV9A 1W7AA 3EG9B 1NPRA 1WXTA 2JLEA 3LPUA 2OAUA 3M8SA 4PWDA 1VQON 5HWEA 4BR9A 5HRPA 1UFFA 1QVFS 4LSLA 1T3VA 3HSCA 1W41A 5EG2A 4RHAA 3NF7A 4CGHA 3O85A 2F5KA 1EQYA 1X75C 4JZ4A 2L0AA 3JB9G 1S22A 2GWKA 2OTJA 1KK7A 3CJBA 5KGWA 4NXMK 4B9XA 4E0DA 2ECZA 2L26A 2HHVA 5KI6A 4KB0A 1R0BG 3OMCA 2VYTA 3CC2T 1BI4A 5BPLA 3CCVT 1WI7A 4E47A 4H0PA 2VB6A 4CC2A 4TUYA 2V51B 5LJVA 3CG7A 2QWLA 2K3YA 4QKUA 4FL9A 3CC4N 1NOYA 5IT9E 1E4GT 4BRAA 3KD5E 3VGKA 1C1BA 3KIZA 2E6LA 4CIEA 3M56A 3HM9A 3CPEA 1IB8A 2YRVA 3NVKA 1D1AA 4CGJA 1TUGB 4JK8A 4IIMA 1MWKA 4L8RB 1BIZA 1FK9A 3MEVA 3J80O 3SPYA 5HP8A 3LGLA 4PY5A 1Z5VA 2IPOB 3V8JA 4C92C 4A61A 2OYQA 5LP6C 2CDTA 3CC2N 1NQ3A 2IIRA 1Q81R 2P0PA 3NH2A 2KQWA 3QBYA 3M4SA 1OYXA 4H5NA 3CQ8A 2HMIA 1G83A 3DLHA 4F7UG 3V9UA 1YHQN 4TVRA 2EIFA 2YNFA 4CD1A 3NCIA 3QTYA 4BR0A 2FGYA 4JRKA 2LMJA 2YKMA 4EFHA 5KQ8A 1EX4A 1YVUA 3C95A 3PX4A 1I1JA 3CCSN 4C81A 1D5AA 2RO0A 1OZ2A 5DK5A 3ASKA 4DV3K 1KXPA 3A5OC 2DXCA 4N41A 3WGMA 2KYMA 4QCLA 3FE1A 5GIOA 1RFQA 5AQHA 2KZZA 1WLPB 5FJ4C 4AHSA 2KT1A 5CY4A 5TKWA 3P4EA 5CB4B 2NRZA 3CC7T 1M90R 4J83A 1C6VA 4C8QG 3S41A 4EZ6A 2IG8A 3ENOA 4ATOA 4CZEA 2ZPFB 4PJOB 5H1SQ 4FLVA 2KW4A 2JN0A 2OA8A 2GNCA 4R56A 1M27C 2I2LA 3EEQA 2ZF8A 3HTVA 4M7AG 2ZJQL 2OTLN 3EG0A 5HXZA 1WHKA 2YX6A 2LSNA 4BVTA 5FNVA 2J4RA 4HT9A 3QJYA 1WYXA 3H45C 2HAXA 3DLBA 4CEBA 5GIPA 2XG8D 1NZ9A 4OPHA 2E1YA 4FW1A 3LWHA 4QAGA 2Q31A 2E2OA 3SZ2A 2JM9A 5AJ3K 3HVRA 3VERA 4IHJA 4H0OA 3MN9A 2DRMA 2GLZA 3MWTA 2P1JA 2D4WA 4H5VA 4C82A 1KG1A 1RABB 1JXBA 1TAQA 4BT3A 1QWEA 3ZP4A 1CN7A 2D8HA 4MDAA 1WSEA 2COYA 2HL3A 5EOYA 1K4US 1H1VA 2XRIA 4JHDA 1UDLA 3VN5A 4DKWA 1Q82U 1DTQA 2JGUA 1EIFA 2FZCB 1SA0B 3LWOC 5EYPA 1WGSA 5J2UB 5GANK 3NF9A 5CQYA 4LFBK 3OA6A 3LWQC 1PCXA 3KFVA 4C92E 1NOZA 1KC8R 3P1GA 5HKCA 4ZI7A 1KTQA 3JB9D 2LCAA 3QB0A 1HLUA 1OEBA 4C8MA 5I42A 4B3TK 4FJGA 4CJFA 3CD6N 3I0RA 3AVFA 4O4LB 1MMDA 2E2NA 4CHYA 1PKSA 3PX0A 4CEDA 3SUNA 1UGVA 3V9SA 1QVGA 4BC5A 4RWTA 2A1RA 1NKBA 1ZHIA 2QA4T 3EKSA 5AQWA 3LYIA 2QKBA 1VHXA 2BUDA 3A8GB 3C4SA 5L8RE 1FX7A 3REAB 4LF9K 5LMNK 4XH5A 3QEPA 3KHNA 2VG5A 1R59O 3AVIA 3VQQA 1QLYA 4HT8A 1AOJA 4JI7K 2KY9A 3EORA 1SHFA 4K41A 3TU4K 3CCQQ 3HHTB 3JCMJ 1S6PA 4G88A 3CM5A 1HYZA 3U9ZA 5KPZA 2VUBA 1U04A 3JALA 1WAFA 4G4VA 3OYIA 3CCET 2P9KA 3RYFA 3DLEA 1BQNA 3UDCA 3JV3A 5LJ3j 1SZ2A 3EKUA 4CI0C 1MUZA 1BGXT 3ENHA 2PU9B 2XU8A 4O0JA 3CCMT 3NH0A 1JRIA 3RSEA 3TTFA 2WALA 3C0CA 1NGCA 2E2PA 3NH1A 2QQSA 4OMFB 1W2BS 1KQ2A 2EJGA 4DRXA 3HPGA 3KK7A 3GHZA 4A62A 4FLXA 2PTKA 3REBB 3C7NB 3E9GA 3CCQF 2HBJA 2XK0A 1H47A 3ME9A 1A0NB 5B8HA 4GVEA 1HNIA 2LJ0A 3AVGA 4AF1A 2LNVA 2E5LK 4FVUA 2RB6A 5AQOA 3N2GB 3ZSXA 4OKEA 4HNAB 1YN8A 2M9UA 3V3TA 3CMAQ 1BWFO 3QNOA 3CCEN 5I2SA 1FFXA 2YDLA 4U39A 1PF5A 2Y90A 4JI4K 3JCMg 4B6MA 1JXOA 3C6TA 3CPFA 3MMVA 5AQNA 3THXB 1ODEA 3HJFA 1X3NA 3CBOA 2UU9K 4C8QD 4CJRA 2LBTA 4IBNA 1RAFB 2MOXA 4CCHA 5LJ3h 5AZJB 1Q7YH 4DOVA 2VG7A 4M41A 4W5OA 1KAYA 3UATA 2WC9A 4G4XA 1Q82C 1VQKT 4LC9B 2A6AA 1Y07A 3GTZA 4C8IA 1BU1A 3TPQA 4GV9A 4WBNA 3CMAF 3SYZA 4E2FB 3H0IA 4M7AD 2IG0A 3NVMA 3QEVA 1CK2A 4RTWA 3B8AX 3THWA 4OB2B 4LDVA 4ZTFA 1U3LA 5AQKA 1S1VA 2V8JA 3U8XA 2P6YA 3PSIA 3QNNA 5A2QM 3CC7A 1VQ5T 5CYQA 1IBMK 4EZ9A 3I55T 3MEGA 4MFBA 3NK6A 4G4YA 3P0ZA 3RYHB 1J5OA 2F1LA 1KVBA 2LRQA 4XTXA 4KHPK 4NXNK 1Q81U 2RI2A 4F7UB 3IR9A 1B34A 2O8DA 1BOTO 1Y57A 2OTMA 1NGHA 2GCXA 2DLPA 3I5RA 2PBDA 1WSGA 2VASA 1VIFA 3F0FA 4OF1A 1JJ2P 2K57A 3FPIA 1VYUA 1IG8A 4YJ3A 5JICA 3GIBA 5KE3A 5KYWB 4BWMA 5GAN5 5CA0A 4FVMA 3V7EA 4F16A 3BGRA 2FPFA 3ZT3A 2FC3A 2EYYA 2Q1YA 1WSFA 2MCNA 3WEEA 4DG1A 4OJRA 4LF7K 2DEQA 1X43A 3RYCB 2ZCFB 1JCGA 4FPAA 3I5SA 4C23A 2E3HA 3CCLT 1RDDA 4DV5K 4I50B 1K1ZA 3K0SA 2COZA 1M90U 1SL2A 1BI0A 1PSFA 2KRMA 5IN1A 1HPZA 4FWKA 4EIAA 5I3UA 1XHOA 2G9IA 4TV8A 4O4HB 4PK4A 3FDRA 1D0YA 2QWNA 2VYPA 3KJVA 1YJWQ 4HCBA 3L4QA 4HCCA 4MDBA 3JCMc 1XMOK 1C0GA 4OB3B 2V8IA 4M7DG 3K5MA 4F7UA 5EX5A 4OVLA 4M78G 1KD1H 3MDQA 2OZBA 2HVHA 2H8HA 1CZAN 3EH2A 1KQSA 4Z4CA 1ATNA 3CCRQ 2L3RA 2GUIA 3CCLN 2PUOB 1AT1B 3TAQA 4YOWA 2JOYA 2EQMA 2DIQA 2X4XA 1YJWF 3NFCA 3NVIB 4J6YA 4Z4GA 5KX5B 1WJSA 3G4SA 3F0DA 1SUQA 4C5IA 1V1CA 3WQUA 5GAN2 4GKJK 4ZN1A 2RE2A 5BRHA 3CFPA 2BDPA 4AHTA 1JFFA 5GAMg 1VQ8Q 4DSFA 2HHSA 4C8QA 3JAMM 4X20B 2Y4XA 1FXXA 1N8RC 3CCRF 3D2FA 1XHXA 4NCBA 3KLGA 3WXLA 3OS1A 1VQ7N 4BY6C 5J26A 2NRRA 4O2AA 1D9FA 1VQPA 4O5VA 3V1OA 4IUPA 3QXEB 4ZGJB 3VS2A 2KROA 1IHVA 3HTRA 3QINA 4ILJA 1F21A 3N4ZA 3CQTA 1NGBA 3O80A 3RMCA 4M7AA 5KTQA 1T44A 1NLPC 4JJNK 1OH8A 4E7JA 2GV9A 3VGLA 1UG1A 3VS4A 4B1VA 4BRLA 4OPKA 4AFUC 1PRMC 1KC8U 3MCPA 4NCGA 4QVCA 5C6SA 4OLBA 1YCYA 4GKKK 1VQ8F 2E4LA 1V76A 1Q81C 3ID6A 4M3RA 3KLEA 2BE9B 1RI9A 1YAGA 4FSSA 3LL3A 2OZSA 1XMQK 2KG4A 2D5RA 1K8KA 1YIJT 4Y1CA 4ID5A 2MWPA 1OZ3A 2QG9B 4CF9A 1XHZA 2VXFA 1EKEA 3M0PA 1ATRA 4CBUA 3FD5A 5DLOA 3VA0A 2Z1HA 2K5LA 4B1YB 3TAGA 1IZ6A 4A4GA 5TKYA 4WQ5A 2IS3A 4CGFA 3UB5A 3ISNC 1NJWA 3NVKE 2X4YA 2RJCA 2IDOA 4Y91A 4A4EA 4A2AA 4FWSA 5G4VC 4QS7A 3JRZA 3OYLA 4WYBA 4GNIA 2LX7A 2XD0A 2M1HA 4BY9C 2RM4A 5JH7B 3VF6A 1S1NA 1U1SA 3GG4A 1M90C 1RDCA 3H3NO 4ELZC 4A59A 1SZQA 4CJEA 3WGKA 4JKDA 2HHWA 2XICA 2AMTA 5BPMA 5M9OA 2NUTA 3BFMA 2RF0A 3L2UA 2QK9A 3EFSA 1TOVA 4BR7A 3D7EO 3T1YK 4NL2A 4KUIA 3QDFA 2O4GA 5GINA 2XY8A 4EIKA 3V4IA 1QP3A 3PE0A 5FU7C 3AVHA 1U3OA 3PNWC 4ZNXA 3KJJA 3EFOA 4M77B 5HOOA 4KRTA 4RW8A 5HY0A 3RNJA 1T0KB 4DU4A 1MA9B 2R7YA 1X2KA 5AQTA 5GAN4 1VQ5A 2YJFA 2O4XA 1QSYA 3QO3A 1BK2A 2CZWA 1WPYA 5KCHA 5FRMA 3ZEUB 3PVQA 4B9VA 1H8KA 1EWQA 4CJ7A 3N2KA 3MPUB 1NM7A 4LFAK 1T6CA 3RTVA 3A8OB 3CXCS 4X1VA 5GAOp 4MDXA 1XQSC 1VQ9T 1YUWA 1Z5WA 4RCCA 2LQNA 1NEBA 3CCUQ 2UYNB 2NRWA 1M30A 2B86A 2EKOA 1AWOA 2E88A 3O5BA 4J8FA 4MO5A 4FJ7A 4LF8K 2KRSA 5HCKA 4M7DD 4CESA 1CKBA 3S03A 4M78D 1FW6A 2GFAA 1U2VA 3PY8A 1Q86H 3B6NA 4DTUA 1MMAA 2RJDA 3HVTA 3EGXA 4XK8E 3URGA 4KTWA 3RYIB 1KC8C 4Z94A 4X1KB 5LYJA 1QVPA 3R1XA 2KK4A 3CCUF 4A5BA 3CMET 3QBXA 3NE6A 1JBMA 1VQ9N 5FPMA 3M9QA 3FGUA 4ZHWA 3GOXA 1O75A 4K11A 2I7PA 1BL3A 5IJ0B 5JVHL 1NE8A 4DR5K 3NPFA 4FLZA 4F17A 4E89A 3DLKA 2JTEA 1QVFF 3HOTA 2DRKA 3WXJA 1UA1A 4JKAA 2W40A 4KB1A 3QKJA 1S72T 2ZVZA 2P9SA 3KHYA 1U3PA 4CJ4A 4AILC 1K9MC 2IVPA 1NK9A 4O2BA 3J7AR 3L2ZA 4EP5A 1WZOA 4OB1B 1NG2A 2HB5A 2VCPA 2KSSA 3THYA 1YJNN 2F4VK 4AM6A 2V7YA 4CECA 4DV6K 1W40A 1WHJA 2A41A 3LGFA 1W5EA 4CJSA 4PKGA 4OKJA 4C1NK 1KQ1A 5CKBA 4BUGA 3MXJA 1YWOA 1H48A 3KLFA 1ZSGA 1ABQA 1DEJA 1U8RA 2LDMA 1D09B 4W5QA 3NDKA 4DTMA 4C8OA 2YYEA 3I7TA 3FJ5A 4EMKB 1SPKA 4M7DB 5CKDA 1NEGA 1S72N 3UKUA 2ZODA 4H5TA 5BRFA 1XNQK 1PXWA 5A2QO 1I8FA 1VQLQ 3OONA 1P92A 1KHCA 2PQWA 3SUOA 4J6XA 3FB9A 2QK0A 3B6PA 4X9DA 4JV5K 5CIUA 4BVOA 2W6LA 4JKGA 1SHGA 4JRPA 2MMPA 4HUGA 2HSPA 2CT3A 3WNHA 4BRCA 3CB2A 1I07A 2OPQA 5M1NA 2FO0A 1P8ZA 5LMUK 3OTOK 4Y28E 3LWVC 3DKMA 1VQLF 1C0FA 2K4YA 2MIOA 4FYYB 3SAFA 1L3TA 3VQ4A 3FZHA 1HKGA 1BI1A 4FK0A 2DVEA 4FCYA 2X6NA 4YHHK 5JCOA 3BYQA 4E19A 4OX9K 4I9QA 4LNPA 4C0DB 1UE9A 5GAOq 3O3HA 2HQSC 4XU0A 5CKHA 4M7DA 1H92A 4BVPA 3X24B 4HHTA 1U45A 3HO1A 4M78A 3HKEB 3VS6A 2LT1A 1Q7YR 1WFWA 4P5NA 1VQ6T 1CZBA 3VESA 3OYNA 4IJNA 4CJPA 1T8EA 3CCJT 4R40B 2RQTA 2DMOA 2L5QA 3OYDA 2PFUA 5DM7L 3T1AA 3QUIA 1Z6RA 2PNIA 4DV7K 2G8VA 3T80A 1KSWA 5CR4A 2KEAA 2CUDA 4G9ZA 1JXMA 4FOEA 3JAKB 4NS5A 4PJOF 2LCCA 2J6FA 1YTAA 3EYZA 3HKBA 4M75F 4V19S 2YRCA 5LJWA 4I9LA 2DXUA 3WJRA 4BQZA 1IG9A 4PWTA 1RT6A 4KBOA 2P9UB 1HNWK 2CH6A 1LV5A 3HAXD 4H4OA 3CC4Q 1M1KO 3WPXA 1ZBJA 4C92B 1S1XA 2XMFA 3THVA 3VUZA 4H0TB 4IO8A 1G99A 3SJHA 2W8BC 1VQ6N 5HY2A 2AKKA 2GQVA 4XH4A 3CCJN 5AQLA 3UT5A 2Y4YA 1Y97A 3C6HA 4PA1A 3CPWS 3TSUA 1K0XA 4DU1A 1QD9A 1O9SA 3VEWA 3AY9A 1EO1A 4BG8A 3LP1A 3L7QA 2BTQB 3JAMO 3QFUA 4X62K 5CQXA 4KHYA 3N4YA 2WSCE 2JMAA 1YF5L 2QWRA 4JAXA 5AQFA 5C24A 3CC4F 2KNBB 3S3MA 3EZWA 4DSIA 4E1MA 3T9NA 1HJRA 5KGXA 2HP0A 1J7HA 1YHQQ 3HKDA 4WQ5C 1JLAA 2VXEA 1K76A 4XTVA 2HVIA 3QHDA 3CCSQ 3MEUA 4CZHA 2QQAA 3CCQA 3ITHA 5CAIA 3M0SA 3V9XA 2COWA 2CZ1B 1U6ZA 3MX5A 5LP6A 2KMTA 2KRNA 1YNZA 4LE9A 5AQRA 1ZA1B 2K9GA 3M1XA 1KD1R 3S0HA 1YHQF 2FHDA 1IKVA 3BW1A 4I6MB 1VIEA 3G71N 1GBRA 2JS0A 1ZBHA 3CCSF 2X51A 4HKEA 2EWCA 4F7UE 3D01A 2O8EB 4K25A 4X1IB 2F69A 5GAOm 1KFSA 2UYTA 4K42A 1TUDA 2OTLQ 2D1KA 3CMAA 4EHTA 4DFMA 1UJYA 5M1KA 3HRGA 1Q18A 4OPAA 5LL6S 3K59A 2ZJPL 1FSZA 3SNNA 3OW2S 2D8JA 4O5FA 2HKQB 5EXWA 1NBWA 1BQMA 2HBMA 3EG3A 1VQNT 1TK8A 2B4JA 4C8QE 2QKKA 2RHIA 4ME7A 4E7ZA 3VF2A 3CERA 2O4IA 4JKCA 2MI6A 4JD2B 2OTLF 3ZT0A 3PMIA 3OYKA 1TUBB 4DQ2A 2QXFA 1NMNA 4XQ3A 2DTIA 4C5GA 5GADP 1OOTA 1BI3A 3VU3C 4F2RA 3M0QA 3JCMM 4ZTJA 3VYHB 2XDBA 4KGZB 4M7AE 3RA6A 3SDZA 2PVGB 2P9PA 2OTJN 3K14A 3CETA 2HBKA 4OMOA 4O5BA 3TVTA 4FJ9A 1JO8A 1GLEG 3KZBA 3JCMb 4FWRA 5MN4A 1LWEA 1RI0A 3LMEA 1HYOA 4BE2A 1Q82O 2UUCK 4Z0UA 2ZQBA 4FJNA 4I4TA 2HBPA 4DTJA 2YUNA 2RN2A
chains in the Genus database with same CATH topology
4BDZA 2E2QA 5FPDA 1W2BM 3ZX3A 4R55A 3M1FA 2QWQA 2DD5A 5AQXA 1X7PA 2P9NB 2DD4A 2BKDN 1K73H 4H5WA 1YI2T 5GAMj 2PAVA 4FWLA 3CD6F 1X3MA 1V4SA 1YJWA 1UEBA 1OVYA 2ZPBB 5C15A 4M75G 3E9OA 1M8VA 4NO7A 4MDWA 1GO1A 3CG6A 1TYQB 3MX2A 3FLCO 4JK9A 4BRGA 3JXUA 4YORA 3CCRA 3V7RA 1N9SA 4IUUA 1BUPA 2QEXF 1AHJB 1VQMF 2EQJA 2BIVA 1Q7YU 2MWOA 4IOXA 2P9NA 4L3QA 2HF3A 4IWVA 4EI7A 3T69A 3M3ZA 2A7YA 2RHUA 3EAEA 4EAHD 3M5RA 1QQNA 3O1WA 2P9LA 1TUYA 4RTFD 2ASPA 4NQ3A 2C06A 4BC4A 1YITF 3SIUA 3VTHA 3UKRA 3H6EA 3X26B 2CKKA 4FWNA 2XDPA 4BI4A 1N8RO 2DZCA 2DAQA 1XQHA 5GANd 3AAQA 4JUVA 5BN8A 3VOVA 4U7BA 5EO3A 3DLMA 3OYAA 1Q81O 1HXDA 3INZA 4XCQA 3L0QA 3EL2A 1VUBA 3JCMP 3A5LC 1VQNA 3M55A 1KD1U 2DTHA 4GLKA 1VQ4F 1NGFA 2RI5A 3ATUA 3TREA 4X9CA 1M90O 1GLCG 1WUAA 4QQGA 1HUXA 4CZKA 4BY9D 2NRVA 3QZ5B 2M16A 3CHWA 4JNEA 2RHKA 2JUFA 3CCVN 2ZWHA 5I2MA 3FFKB 1IPAA 3KVGA 4BY6B 3CCUA 4BRQA 3EE9A 4M75D 2RJEA 3LDOA 3G6ET 3MN6A 2VWBA 2CS7A 4A4FA 4YOVA 3DXMA 4M7DE 2ZGYA 2JNGA 4M78E 1YI2A 4FT4A 1I81A 1YJ9F 3LLRA 2CH5A 4JHDB 4ISEA 3UPUA 3CXCF 3I56T 3MP6A 3H8ZA 5LJ5d 3SD4A 5GAHP 1VQ7F 3PMTA 4L59A 3BP8A 2JWLA 1KC8O 4FSXA 2BUPA 3CC7N 3MN5A 3OYGA 1NMUB 2NLUA 1N6AA 3FZMA 4N4IA 3L2RA 1QZ5A 3VV0A 3HZ6A 1GLFO 2GTDA 1KD1C 1QVGS 3M59A 1X9JA 4VUBA 4FWOA 5FU7B 3QG1A 3ULEA 3A8HB 3CJCA 1WQWA 3K9KA 4KH4A 4U67L 4CZFA 1K9MO 4L5GA 4MZTA 3J7AF 1LJOA 5GMKe 1MWMA 2P9KB 2LCLA 3QJ6A 5A2QE 2KTVA 4EHUA 5BREA 3RSEB 3V8LA 3HM8A 3G4ST 2IVNA 2ASMA 4IUQA 2V52B 1BYMA 5AQGA 4CRIA 1Q86U 4OGCA 1IREB 3HRUA 4BQLA 1V29B 4M75A 1X01A 1VQPT 5G4UC 5AZIA 1SSFA 2B8AA 3QICA 1HKCA 3CJ9A 4DA4A 5EWRA 3VUBA 3SFMA 3DLLA 2FSJA 3BF3A 2QA4N 3KBGA 2JZ2A 5JLHA 4JN4A 1VQPN 3CC4A 5J3BA 5GANj 4IEEA 3SIVA 1XC3A 3RMQA 3HP9A 1B34B 1YITT 3J8AA 4UC4A 3CCMN 4PLIA 2YI1A 4BE0A 2FYKA 4XTUA 2CGKA 3JAME 4H0XB 3RMSA 1DJ7B 3G6EA 3QHSA 3WEEB 3RVCA 4QW2A 4LD9K 2KKZA 1M4ZA 3MWPA 3HFNA 5GANh 2QWOA 3JB9I 3TCJA 1Z05A 3GNFB 5CKFA 3PT9A 2Q97A 4BI3A 4RG2A 2E6NA 4J6WA 3SK3A 3I56A 5GAOr 2R57A 1VQKN 2ZPIB 1Q86C 3SBGA 3J81M 4RCHA 3ZYYX 2RK2A 3SB2A 1W2BA 4QS8A 4XU3A 2OTLA 4XTYA 1BA1A 1VQ5N 1GLLO 2A3LA 3O9SA 4MMKA 3CIPA 5AQZA 3I55N 1RA4A 3NMUC 3A8MB 2D6FA 1BIAA 4BG9A 3CPWM 4C8QB 3MO8A 4F9OA 3D2FB 4KBMB 4IFEA 4EMGA 3O8VA 4H03B 3FFMA 4M7AB 2QXLA 2ZPHB 2AHJB 5LJ5j 2KLAA 4ILGB 2P0KA 2FF3B 3F70A 3A0IX 2LTOA 4CBXA 1QW1A 2CZ6B 3OW2F 1LCUA 1K8KB 5BR9A 4XTZA 3HL8A 1WOQA 3LDNA 3HRTA 5GAOl 1M1KH 3RKXA 1DGKN 3OS5A 4JLGA 3QYHB 5LJ3f 5FU6B 3O8MA 1NJIH 1E4FT 5E84A 2E6ZA 2QDYB 3FZLA 2DTOA 3VEOA 5LJ5h 2HOEA 5GANf 3TTDA 3V7CA 5DY9A 2QEXA 5HL7L 4RKUE 1VQMA 3ZEHA 1Y96A 1FWZA 4C0FA 5KCOA 2O4XB 3OYBA 2HQXA 3P8DA 2M0OA 3O4WA 2Q2RA 3VKIA 3A5MC 2R58A 5M1OA 4IXCA 1YITA 4LDYA 5CKEA 3OMGA 3ATVA 3ZETA 1YIJN 3EN9A 3M5AA 2H3GX 1QQOA 4M63C 1XBIA 5JVGL 2DZ9A 3JCMd 3CJAA 3D00A 1U2VB 4PJOC 4M75C 2EYQA 5BN9A 5AQSA 2DK3A 4CZJA 1UB4A 5F1XA 4MMLA 4J5YA 3P4IA 2EAYA 4C0ZA 3DXKA 3SMPA 3QDKA 1BKBA 4A54A 4BRPA 5GAEP 2E8AA 4A5AA 4WF2A 2P9SB 1ESVA 1K73U 3OS2A 3GL1A 3IUCA 3BUZB 1VQ4A 2BTFA 2OTJF 1P90A 3NK7A 1BO5O 3BF1A 5AQYA 5AFUH 3CCQT 2ZZDA 2RD1A 5LJ5f 2F9ZC 1JJ2S 2IVWA 5E26A 1K8AH 4JRQA 3WUHA 1G3TA 3UKUB 3LWRC 3L2VA 3VEYA 1V4TA 3PIOA 5J39A 2P9IA 3JCMV 3UE5A 3RESA 2E70A 1NGDA 5F0XA 5F2RA 4WF9L 2RHZA 4JKGB 3LDQA 2AP1A 4PL8A 1QQMA 3CMAT 5MLCQ 3HFOA 5KQDA 3OYEA 3CMEN 3BY7A 2JWKA 2XIDA 2Q0UA 4WFBL 4BVRA 4OVAA 3GDQA 3ENBA 1YJ9A 2LQ8A 3I8BA 2LX9A 3OY9A 4M75E 4PLLA 4M78B 2H3JA 4II1A 5GAMd 3CMAN 1BA0A 3SAGA 1QVFM 5AQJA 1ZWZA 2JNBA 3R3LA 1D3BA 2QQRA 3WXIA 3R8EA 4BRIA 5FRNA 3ID8A 1LOJA 4IDHA 2I6DA 2K5FA 4JKHA 4PL6A 3IFRA 4IUVA 2E1HA 1UGQB 2R5AA 1K73C 3EFRA 5D6WA 5KE2A 3JS6A 4E7KA 2JTMA 4WCEL 4YDUA 1KAZA 4HTLA 3C6AA 4Z02A 3CQYA 1N8RH 3N5BB 3IMXA 2CGLA 3P31A 2LQKA 3VGMA 5ADXH 1YJWT 2KAFA 3WT0A 3FR0A 1VQOF 3HKSA 5CK9A 5HK0A 2CZ7B 2E41A 2NRXA 3CCRT 2PUKB 3HSBA 2L89A 3VEXA 1ZXOA 3OYFA 4J7FA 2YCHA 1YJWN 3LDPA 1QVGF 3Q7CA 2ZJRL 3C0BA 4RG8A 4ZGDB 3N4PA 3O9QA 5M1QA 1VQ8T 3RA5A 1W42A 4QQ6A 3V7SA 4NOYA 2OANA 3PIPL 3DB4A 4C5EA 3DWLA 5I9EB 4XEIA 3CCRN 2NNWA 5HK3A 4DHYA 4XH1A 5GAOn 5GMKi 5IAYA 2YJEA 1IJJA 2I7NA 4EI8A 4Q5WA 1Y64A 4ZGEB 1KHIA 3FEOA 3CJ7A 3CC2F 3A5ZB 3CCVF 2KVQG 3J80M 4J7IA 4BW0B 5HY4A 4JRIA 1LNXA 3EE8A 4B1ZA 2P9PB 1SAZA 1M1FA 5LJ3g 3A8LB 3E9FA 1ATSA 3KWIA 1WJRA 2XDDA 3JCMh 1NGIA 3H1VX 4MZPA 1MHNA 3HBTA 2EJ9A 3CPWA 5A0LA 3VMFB 4E1JA 3F5TA 5FPNA 2FB7A 1UGSB 3V8KA 2G3RA 4FU6A 3N4QA 5GMKm 2FSNA 3RERA 2EQUA 3CC7F 4H0VB 3E1SA 3M58A 2D9TA 2RHYA 5HXUA 5GAN8 3JB9F 3PIPA 4OO1J 1KAXA 1VQNN 3CQXA 2ZF5O 2EFIA 4BGAA 4YOTA 1X6OA 3OBWA 4E7LA 4CZMA 3LFOA 3FZKA 1K9MH 3CCUT 2MAMA 4FT2A 2ALEA 4B9QA 3JB9H 1NGGA 2CGJA 3M53A 4JLIA 4IZ9A 2HMPA 4O6JA 1HKBA 3U9DA 4M77C 5AQIA 1Q86O 4BDYA 3CI5A 1YBYA 2AIFA 2K2VA 4PJOG 4F7UF 2ZGWA 2P9LB 1BI2A 4IUTA 3D2EA 3M4YA 3M54A 1N9RA 3UKRB 4X3LA 2VV5A 5KPTA 3SWNA 1HPMA 3C65A 4BRHA 1YI2N 4FM4B 3E9PA 3M57A 3JCMf 1NMDA 1G3YA 5GAMh 4C8QF 1WQ7A 2QA4F 1U1TA 3DB3A 1VQ8A 5AQPA 5CCAA 2L8DA 4BVSA 5LJ3e 3A8YA 2F7TA 2W41A 1GLBG 2D0PA 2F9WA 3CBPA 2HVYD 4N0AC 3R6OA 1VQLT 3JCMW 3S3OA 3L2QA 3CEYA 4YDUC 3ZBDA 5C0YA 5GANe 3E66A 4A57A 4O8KA 3VYGA 3CCEF 3R6MA 4JKFA 5EY4A 2JVVA 2OHWA 3BDUA 3CCMF 3ER0A 5FLXM 5C2FA 2KDSA 4BRNA 3RKYA 4NL3A 1BIBA 1BU6O 1T6DA 3L4IA 4EMKC 3OYMA 4OB0B 1BG3A 2QWPA 4WQ4A 1NWKA 3J7ZO 2GWJA 2VGNA 3FIFA 2FLOA 3MEAA 4PKIA 1VQKF 3HPWA 3VEVA 3AARA 3L2WA 1Y71A 3T7ZA 3DXMB 2HSTA 3CC4T 1VQ5F 4BRDA 5C10A 1H3ZA 3I55F 4O8UA 2QTDA 3FJPA 5D6YA 3NMUA 2E12A 1Q7YC 1M1KU 4C0DC 1NJIU 1QZ6A 3O1BA 5GAMf 3LW5E 4FL6A 1NGJA 4X34A 2R5MA 2DJZA 4D6WA 3JCMX 4PJOD 1YHQT 2EQKA 5I21A 2RK1A 2A42A 3CCST 3SAHA 3CCLF 3KXTA 3PGGA 5LJ5e 4M77F 1QVFA 5CE3A 3ULEB 2P4TA 2WUSA 2X4WA 3OB9A 4ISFA 1WNLA 5AQQA 4M7XA 2Q36A 2LT4A 2WFBA 3G6EN 2GX9A 4FIBA 1J6ZA 4QVZA 4MO4A 2FF6A 2A3ZA 4ISGA 3DLLL 4BREA 5M1FA 2OTLT 5HY1A 5AQVA 4OP0A 2QI2A 3GNGA 3SMSA 1JJ2F 4BI8B 4M7YA 4KT0E 3OYCA 3I56N 3W3DA 4YOXA 3V7QA 1SDSA 4B1WB 3TSQA 2EWSA 3TEEA 4M75B 3VENA 1ZBXA 4BC3A 3PAFA 3CXCM 2IVOA 2E64A 4EPCA 4BROA 5AZIB 2KTUA 3VEZA 1VQLA 3WVEB 2ZPGB 4B9WA 4FWMA 5ADXA 2XHCA 3AGKA 3P38A 1M1KC 1M1GA 3L6QA 3RIRA 1JJ2M 1NJIC 1YIJF 5GAPK 3G7ZA 1GLJO 1NPPA 2VC8A 3CD6T 1G5VA 3AGRA 2RA2A 5IT9M 2FL7A 3J81E 4M7DF 4PJOA 4PHTX 4A53A 4M78F 3SWNC 4JS5A 1VQOA 1K8AU 4LCKA 4C1NI 4EI9A 4JDSA 4N4HA 3LWIA 2BO1A 4C0GA 3HRSA 3PLAA 3G4SN 1YXQA 2RJFA 4FSVA 1K73O 5A0GA 2QEXT 2PVDB 1VQMT 4BE1A 1NGEA 4HCZA 3A5NC 4EMHA 2HNIA 1GXIE 4DOWA 3OSVA 4HWIA 4BGBA 4C5HA 3ZFJA 2D0OA 4H0YB 1W97L 4YOUA 5BRDA 3ZX0A 2DO3A 4BR2A 2QEXN 1VQMN 5GAN7 2GELA 1VQ9F 2WBNA 3CC2A 3CCVA 2NRTA 3JB9J 3IDHA 1YHQA 3DJCA 4IOCL 2F5TX 3NTKA 3GE1A 3FLGA 2Q1NA 1HJOA 3CCSA 4PNOA 3GP8A 2HBLA 3MHXA 4C92F 4M77G 3FC3A 3SLCA 3CMEF 1YITN 1G3WA 4WQ4C 1YJNF 4IKFA 4NLCA 2DPNA 4WFNL 4CZIA 2FXUA 5GAGP 1H641 1X7OA 4MZMA 3H46O 4KH6A 2YLBA 3C12A 1S72F 1N8RU 3FZFA 4OGEA 1KQSS 2NRHA 3NTHA 1K8AC 1VQ4T 1NGAA 1X52A 2VGMA 3META 3C7NA 1H7MA 2QWMA 4IJAA 2LBWA 3U4LA 2RH2A 2K5IA 4JS4A 1MGQA 1XOVA 1PSEA 1YVNA 2EJFA 3P8BB 4K43A 1VQ4N 3E1YA 3UT1A 5AZJA 4NLBA 2V7ZA 3F9MA 4A4KA 3H6ZA 3CF5L 1Y96B 2WSFE 3RKWA 3M6GA 3WXKA 2NLXA 1GZ0A 3CD6A 1YJ9T 4BB7A 2DKGA 1BDGA 5CVIA 4E7IA 3OYHA 4YOYA 5CO7A 3TTCA 4BR5A 1O13A 2ITMA 2D0QB 1VQ7T 4MLHA 1VQ6F 3OA9A 3CCJF 5GIOC 3ZETB 1OI1A 3GOIA 3PFSA 3QMLA 3OHRA 2DPPB 4CZLA 3ON1A 3OW2M 1D4XA 3MCAB 4YTLA 3QSUA 1YJ9N 4KUDK 3CJ1A 5GMKl 3ZX2A 3TU5A 3LWPC 4B1XB 2QA4A 1JB0E 3H3OB 1GO0A 2BH1A 1JCEA 3MK6A 4JKBA 3L42A 3QDRB 5JMVA 3G25A 3KUFA 3JCMe 2P0QA 3PIOL 3DXKB 4NB4A 5GIPC 4M77D 4NUTA 1ZBSA 2QQ9A 2LC4A 3CCEA 2E5QA 4LDUA 4PL7A 3G71F 2QTXA 1RGIA 2FSKA 2CZ0B 1W3EX 3CCMA 1W4SA 2HD0A 1WJQA 4BRMA 1RL2A 3OBYA 3CPQA 2E10A 3UWNA 3OS0A 5GMKj 1XUPO 1LOTB 1TH7A 4XAXB 4C92G 3M4GA 3QYGB 2K3XA 3PLAC 2YHTA 1K9MU 2P9IB 3H1QA 1HX1A 4N4GA 5C0MA 4DB3A 2XI9A 1GLAG 3E9LA 1M5Q1 1VQKA 4GV3A 5LY3A 2QQBA 2Q0RA 2GF7A 4UY8O 4KH5A 1JCFA 1XTDA 5GMKh 1ZC6A 4FOIA 3Q7BA 4LD6A 5CHIA 1Q82H 1VQNF 3I55A 1QHAA 3BEXA 1NM1A 4A4HA 4AM7A 5BPNA 1ZQ1A 3WQTA 2A40A 4E7HA 4BRKA 5DM6L 4R79A 5KH6A 3O9TA 1D3BB 3NTIA 2CGHA 3LX7A 3CCQN 2KHOA 5FROA 4ILHA 4Y0WA 4XU1A 3CCLA 1I4K1 2V8KA 4M77A 1VAZA 5GAMe 4FO0A 3MP1A 2CYZB 2ZGZA 1YJNT 5EVZA 3OQ5A 3ZEUA 5A0DA 2GUPA 4RMOA 4GY5A 3CXCA 4PJOE 2ZPEB 1Q7YO 1YI2F 1VQ7A 5ELZA 4V2SA 3I33A 4QVDA 3O6WA 4DCHA 3VTIA 4X3MA 1UGRB 5C2DA 1JJ2A 2EWNA 3J80E 1DKGD 3OYYA 3GBTA 5CR2A 3IKMA 4L6V5 3GLXA 5AYFA 4N0AA 3EO3A 2DXBA 4C92D 4ZN3A 3TSPA 2YLCA 4CZGA 2JTFA 3GF5A 5M1PA 2RI3A 1XNIA 3R9PA 4BRFA 1YIJA 2AA4A 4RCBA 4QQDA 4KULA 1Q81H 1G3SA 5D6XA 2YHYA 4EMKA 4BACA 1DT9A 1KD1O 2O01E 4QS9A 3MN7A 5FPEA 4J8OA 3X25B 3PTAA 3X20B 4FWQA 4MLEA 3P8HA 4IO9L 4CBWA 4C8QC 1R8OB 1M90H 5AR0A 5AQUA 2GFUA 2WSEE 4JEPA 5DM7R 3HJWC 3C94A 1NJIO 4M7AC 3FRNA 2X35A 3AAPA 4B1UB 3S6WA 5DCVA 1VQ8N 2F9TA 3F2KA 1QVGM 3MP8A 1VQ9A 1HK9A 2NZTA 4BD3A 3GPLA 3G71T 4DQ8A 3BDLA 1OKJA 3GYQA