3MCAB

Structure of the dom34-hbs1 complex and implications for its role in no-go decay
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
372
structure length
341
Chain Sequence
IEKNSGWITMEPEDMWHLYNILQVGDQLKASTVRRILVENMDFDTKAAQLHIKRTTEYHPMGSYHTLDLELHRNFTLYNEWDAFALDRVDAACNPSAEIGAVVLDEGLANICLITDYMTILRQRIDQVIPRKRRGDSSAYQKGLDKFYDSVFQSINSEFDFDKLKVVILASPGFVARGLYDYIFSMAVKLDLKQIVKSKNKFVILHSSTGHIHSLNEILKDPAVESKLADTKYVQEIRVLNKFYDVMNEDDRKAWYGPNHVLKAFELGAIGELLISDSLFRSSDIATRKKWVSLVEGVKEINCPVYIFSSLHESGKQLDLLSGIAAILTYPVDEEDISEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Dom34-Hbs1 complex and implications for no-go decay
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Translation regulation/hydrolase
molecule keywords Elongation factor 1 alpha-like protein
total genus 88
structure length 341
sequence length 372
ec nomenclature ec 3.1.-.-:
pdb deposition date 2010-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03463 eRF1_1 eRF1 domain 1
B PF03464 eRF1_2 eRF1 domain 2
B PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.870 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mcaB01
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3mcaB02
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3mcaB03
3CCQF 3RA6A 1NJIH 5GINC 3CXCF 3MCAB 2LBXA 1JJ2F 4X3MA 2BO1A 2JNBA 2ALEA 5IT9M 3OW2F 1YJ9F 3CMEF 4TZZA 3V7EA 1X52A 3CPWF 3HAXD 2KTVA 1PXWA 1H7MA 4C4WC 3CCMF 1Q81H 3JCMM 3LWVC 1E7KA 5GIPC 1YJNF 1Q86H 5GANK 3AGKA 1VQMF 4BY9D 3N4YA 3CCLF 5FJ4C 3FFMA 3CCUF 2VGMA 1K9MH 2QI2A 5GAPK 3CC7F 1VQNF 3OBYA 3NMUC 2QEXF 1M90H 3SIVA 1CK2A 4LCKA 3PAFA 2OZBA 3CD6F 3HJWC 1GZ0A 1NMUB 1X7PA 1YHQF 1M1KH 5G4UC 3JAMM 1KD1H 3E20B 3I55F 2OTJF 3NK6A 1VQ8F 1YIJF 3CCVF 3I56F 5DCVA 3CCRF 3G4SF 3WXMB 1RA4A 1YJWF 3LWPC 1VQ5F 3V7QA 2AIFA 3NVIB 1VQLF 3NVKE 1YITF 1VQOF 5EWRA 3N4ZA 5A2QM 3NK7A 3J7AR 1T0KB 1CN7A 2VGNA 3E1YA 1K8AH 2FC3A 3PLAC 1VQ9F 1SDSA 1W42A 3J80M 5G4VC 3J81M 2OHWA 3OBWA 1W3EX 1GO1A 4X3LA 2HSTA 1DT9A 1VQ4F 3IR9A 1KQSF 1RLGA 3SIUA 3VMFB 1VQPF 1ZWZA 3CPQA 3LWOC 1VQ7F 1X7OA 3ON1A 3RA5A 3CMAF 1YI2F 1QVGF 4BW0B 1W2BF 2QA4F 5GIOC 1QVFF 3G71F 1W40A 1IPAA 2HVYD 3VI6A 1GO0A 1XBIA 5EO3A 3LWRC 3G6EF 2KTUA 3CCJF 2CZWA 3GYQA 1S72F 3LWQC 2KG4A 1Q82H 2WALA 4NUTA 1N8RH 1KC8H 3CCSF 4AF1A 3CCEF 2I6DA 2LBWA 1VQ6F 1Q7YH 5FLXM 2OTLF 3LFOA 1W41A 3CG6A 1VQKF 3CC2F 1K73H 3CC4F 3O85A
chains in the Genus database with same CATH superfamily
5AZIA 1AOJA 1TXQA 1YIJT 3D2EB 3FZKA 2EQJA 4CJKA 4BC5A 3ULRB 2E8AA 5CHIA 3CCEN 4HVWA 4XTWA 4DA4A 4RW8A 3SYZA 4CF1A 4TV8B 2O9SA 4JI8K 3HKBB 3UF4A 5LA6A 3LP1A 3K59A 3H1VX 1NBEB 3MKDA 4C92B 1NJIR 3CPEA 5JLFA 4CFAA 2GTJA 3QJYA 3PV8A 2YX6A 4ISEA 1KAXA 3T1YK 1BKBA 4KB0A 1BCMA 4I55B 1WLPB 3M4YA 3VGKA 5BN8A 3NTIA 3I56T 2GQVA 1QVGM 4H5RA 3ME9A 2IVOA 4PFZA 4FW1A 5KPRA 5GIPC 3G4SQ 5IYZB 3JAWB 1SL1A 3IQLA 4ILGB 1OULA 3R6NA 1MNEA 5E84A 4CJFA 5FJ4C 1WHGA 3H9NA 3KJVA 2PFUA 3MEAA 2FSNA 3QUIA 2CZ0B 4N4IA 3QNOA 3SAHA 2HRUA 2L8DA 1E7OA 3EFSA 3THKA 2UYTA 1Y71A 4KHUA 4EAHD 1HUXA 1RT2A 2QA4N 4DR1K 1JFFB 2Q3SA 2QXFA 3VQPA 1FNJA 3HKEB 1JBMA 2VXFA 3SFMA 4AHVA 5HY6A 3NDKA 3RBBB 4H0OA 4IHJB 1GXIE 4XH5A 4M8IA 1SPKA 4M78C 2DYIA 1BI4A 2HHSA 4HNAA 3QWXX 4PA1A 4JJNK 5HP1A 5GAN8 1PSEA 3H3OB 3ID6A 4NL2A 4C8MA 2I7NA 3G10A 3R9PA 1Q82O 2X6SA 1MV3A 1ZBJA 2LBTA 5CQXA 1VQ8F 3CCVF 3I56F 1OKJA 2M0OA 2P9UA 2E64A 5GMKi 2DA9A 3GBTA 1RI0A 3L2WA 2A41A 4EFHA 1U4BA 4IUQA 2DY4A 2CGJA 2IG8A 3CERA 3MMVA 1QSYA 3RKWA 2RKIA 1UEBA 3V7QA 2OAUA 4I50B 4J83A 1PKSA 2J05A 2NNWA 3CMEQ 4E7ZA 2D0OA 3WXLA 2EIFA 2LP5A 3DB4A 3M9QA 2KBTA 2LCSA 3V7CA 4YOUA 2X4XA 3CXCP 1KNKA 2L0AA 5EU7A 2YHTA 4OMPA 4F8RA 3PX4A 4DTXA 1TK8A 2FC3A 2E4HA 2PTKA 2HSPA 4YORA 1G99A 2K79A 3EG9A 3JCMQ 4L5GA 4BROA 5LP6B 1QVFP 4GY2B 1K73C 2MCNA 4C1NI 3KLHA 3ZL7C 4PQUA 3VESA 5HLFA 2IPOB 5FRMA 4X20A 3K2XA 3WT0A 4FM2A 3M0QA 1GRIA 4C8QE 1UAXA 5KPZA 4BE1A 3RNJA 3DOLA 2CGKA 5IHNA 1NLVA 4F7UA 5KCHA 4M78A 4IFVA 4DTOA 3TAPA 2MOXA 1U1TA 4CK1A 1U49A 2B6AA 4NXMK 1FMVA 1BI3A 2J6KA 2LQWA 2CHSA 1KD1O 2AJQA 1ZUYA 5KRSA 2UUBK 2UXDK 3CBMA 3NF7A 1RAFB 1MV0B 3NGZA 4JI6K 5EVZA 2R7YA 1Z6RA 1FJGK 1RDCA 1WAFA 4IG0A 1S1WA 2IC3A 3LALA 2A08A 2XKOC 4CC4B 4QW2A 1VQ9T 3NGIA 2KG4A 3HM8A 3IMXA 4U39A 2Q0UA 3P5JA 1SQKA 1KG1A 5EX5A 3THXA 1J53A 2RHXA 2CSQA 4DUYK 1BIZA 2KZMA 5FU7C 3N2GA 2KT8A 4NB4A 4OX9K 2HKQB 3OYIA 3CCJT 4J6YA 4GMJB 3ZETA 2ZODA 2FPEA 4CZHA 1G15A 1WHKA 2FZCB 4LY7A 3HJFA 4IO8A 2COWA 2EYWA 3HOTA 2O8DA 4I55A 2OAWA 3RYIB 5C6SA 4JRQA 4CEBA 3JAMO 1GLCG 1IG8A 1MGQA 2JMCA 4N5SA 5BPNA 3O85A 4A4GA 5BMVA 1JL2A 2LQ8A 2NRRA 2H8EA 5DM7R 1VRUA 1HYVA 3L2UA 3JALB 3O4NA 2X4WA 1I3AA 4C23A 4CJSA 2LCAA 5AQGA 3GG4A 4CIEA 4QS9A 2X3WD 2NUPA 4O4HA 4QT7A 1BHLA 1OPKA 4ZN1A 5C0MA 1FYNA 4H4OA 2HAXA 4KHPK 4R40B 2YNHA 3IRXA 2JS2A 5JVDB 5KGXA 4DU3A 4EMGA 4DR6K 1JFFA 5AQSA 2VAWA 2HBJA 2JMAA 2Z1EA 3HAXD 4FYDA 1UUEA 3WEEB 1JN1A 1K8KB 1WUAA 2XHBA 2K7AA 2DIQA 1UOCA 3EL2A 4O5FA 4C8QF 1KFSA 2RB6A 1T7PA 3M53A 5T7BA 3V3TA 5GANK 2DYYA 3WGMA 4ELVA 4LDXA 3PUFA 4M7DC 3EFRA 1W55A 2EKHA 1RADB 5C8YA 3CCMT 3VS1A 3QZ5B 4DEXA 1RGIA 4B45A 5MN5A 3DKMA 1HQEA 5LXTB 3SD4A 2OTMA 2R57A 3MK6A 3C94A 3SMSA 4FJIA 4RCBA 1Y96B 2P0KA 4XCQA 4BGAA 4L3QA 5FW9A 5IN1A 3TTCA 3IMPA 4O4LB 2IDOA 1UTIA 1SKWA 3KTQA 4DV7K 4BUGA 4R5PA 1RDBA 1K4US 2P9LB 3RKYA 3G0ZA 4CJVA 1X7PA 1YHQF 5M1FA 2P84A 1C1CA 4IIJB 2HVHA 4QS7A 4JJCA 1AWWA 1S22A 4CJ4A 3SQ1A 2HBWA 2RJCA 3CCQT 2E2PA 3FE1A 3MX2A 2BKDN 2FHDA 3V7SA 1YT3A 4ZOLA 1M90H 3NVIB 2K3BA 1X6OA 2HBPA 1VA7A 2LT4A 2P9IA 4DQQA 2G6FX 4CJUA 3EKUA 1KD1C 3JARB 1HNVA 4YJ3B 1H3HA 2BTUA 1ZA1B 5BR8K 1Z9QA 2JW4A 1XRGA 3HFOA 2QGFB 1VQKN 1QVFS 1QVGP 2KZZA 2XO7A 2HCKA 2CH6A 3JATA 3J81M 3ULEB 5GINA 2YKNA 5HCKA 2KR3A 5CYMA 4JZ3A 5FWCA 2ZGZA 1NK0A 1UHCA 3WXJA 4X3LA 3R0PA 4RUGA 1JY8A 3J80O 4FFBA 5AFUA 4F4KA 1TUGB 5CIUA 1K8KA 3LAKA 3G4SN 2X35A 4ESRA 3QJ6A 4X9CA 3KXTA 3CD6Q 1BG3A 3H08A 2G3RA 4M75F 4ID1A 2CP6A 3WXIA 2HDAA 3O4WA 2IIRA 4C0FA 3TD5A 4M75D 3VF4A 3CPWM 4DWIA 4KTQA 4JKDA 3MXMA 1NWKA 2OZSA 2HRYA 5DLOA 3LDQA 3RYIA 3M59A 4M7AB 2HOEA 5C12A 3A5MC 3THVA 3K2PA 3HXMA 3TR8A 1XBIA 2BZ8A 1MMDA 5SWMA 3CCSQ 2K6DA 3VF6A 2MIOA 4FZZA 4Z8AA 2RJDA 2ITGA 4KUDK 4I7FA 3CC4N 4LN2A 3LWQC 1NQ3A 2PNIA 3G4SA 1SA0B 1H48A 1NLPC 1YJWA 3AO3A 2XY5A 4NOYA 3A8YA 4B1YB 1V29B 3CCQA 4G4VA 3H41A 3UA7A 5GANh 1I5LA 1KQ2A 2AA4A 2BUDA 1YHQQ 4LD9K 4CERA 2SRCA 3TI0A 4GVEA 1RFQA 1NBWA 1KJWA 4GKKK 1HD3A 2DZCA 2YHXA 3IFRA 4LH4A 3HP9A 4B62A 4EB6B 5HRRA 1VQKF 2RQVA 4LDWA 3JCMd 1Y97A 3NH1A 4M7DF 4ERHA 4OMOA 1Z26A 3HSBA 1HR0K 1OU8A 2DMOA 3N5BB 5JH7B 2YDLA 1QKWA 2E5QA 1YHQT 1GL5A 3WXKA 1UDLA 4WYBA 3SWNC 4DV1K 2K4YA 2D0CA 3KIZA 5GAOr 4TSXA 1TVRA 2RN2A 1VQNA 4KO0A 5AZIB 1W2BA 5JVGL 4X1IA 3S03A 4X3MA 3IKFA 2QASA 4C1NK 2CH4W 1VQ9A 5CZ1A 4ZN3A 1XNIA 2DEUA 1KCFA 3T80A 1BO5O 3A2FA 1VHAA 1NGEA 4PJOA 2KEAA 3BEXA 3SJHA 2CZ1B 3G1JA 1W2BM 1WPYA 4DQSA 1IBLK 3CCMF 3RYHA 4LFAK 1Y0MA 3HRUA 4BDPA 2BE9B 1HYZA 2CH5A 1NK9A 3K0TA 1IV3A 2ASMA 1EIFA 1OPLA 3M6GA 1BA1A 4DF4A 2JLEA 3RYCB 3CCUF 1D1CA 2J4RA 1U3OA 2W41A 3V1QA 2RM4A 5JICA 3WPXA 2FVUA 2HL5C 1VQOA 3HSCA 1L5UA 2E41A 2QQBA 4CIGA 5KQ8A 3TU5A 4B8CA 3TAGA 4IKFA 1JD1A 4DUZK 4EI9A 3JB9J 3NCIA 4BRGA 3KHNA 1RAHB 1B34B 3NBPA 2UUAK 1R59O 4XK8E 4FJ5A 3IG1A 5LL6S 3P4EA 4CHZA 4E3SA 2FRYA 5JCOC 2RHKA 3JCMJ 1M3CA 4GV3A 2FL7A 4J2AA 3WXMB 2ZQBA 2GBZA 4CECA 4CHQA 1VYTA 1LAVA 3LWLA 4XTUA 4BRFA 5H1SQ 3JCMe 3PIPA 3KIOA 3FZFA 1QW1A 4CE9A 1ESVA 3CETA 3AVLA 2DTHA 3GL1A 4IO9L 4BRIA 3BE3A 2QGGA 4FU6A 1VQKA 2OTJT 3K9KA 4V19S 1JU5C 4GKJK 3B6OA 1W2BS 2ZD1A 2CH4A 4OB3B 3KZBA 4YTLA 4XAXB 3HTNA 4FM0A 2HMIA 4BD3A 4J9GA 4DSLA 3SMPA 4LD6A 2V1QA 3P8BB 1XI1A 2COYA 1UA1A 2O8CA 3IR9A 1BCOA 4JLGA 1I39A 5LP6A 4BWMA 1ZX6A 1QU9A 3BZKA 2KE9A 1DTTA 1RBSA 4BT7A 3MO8A 1QVGF 5FRNA 2QEXA 2QA4F 3A5NC 2E12A 2OTLQ 2X6NA 4M7YA 2VAPA 1TV6A 1TAQA 4CFBA 4J2BA 3EGXA 3AVCA 4O2BB 5IT9E 4DR5K 4O4JB 4HXJA 4H0XB 4AH9A 4U3JA 3RMBA 5AR0A 2KRSA 2KW4A 4PHTX 3D54A 2RF2A 2EQKA 2K2VA 3O4QA 3RR8A 4F2SA 5EO3A 3F70A 4E6RA 1Z5WA 1FSZA 3IEWA 3HRTA 5LJ5g 2H3JA 3UKRA 3HPGA 1X2QA 2CUBA 3EN9A 4B3MK 2OTLT 4L8RB 1CLQA 5C42A 4KGZB 4HCZA 1D1BA 4PKIA 2Q0RA 3VEVA 5BRHA 3VS0A 5GIOA 2WSCE 1VSHA 1VQ8A 3QBWA 1KD1U 4Z89A 3CMEN 4J6WA 4ELYC 4C0DC 1Y64A 2O01E 1JJ2A 2LMJA 1RLPC 5AQOA 2XDBA 2H8CA 1N8RR 3O8VA 4CW7B 5LJWA 4YFUA 3CCVT 1VK0A 3E9PA 4BY6C 1I0CA 2JT4A 5A2QO 2UYNA 4IUVA 1FMWA 2E4LA 2PZ1A 4OPJA 2UUCK 4B3SK 3F0FA 4DS5A 1U2VB 4DOVA 3CPWS 5TKYA 4E7KA 2GBQA 1QWEA 3CC2Q 3TCJA 4KH0B 3O8MA 1R0BG 5J26A 1RTDA 4B9TA 5AQTA 4KRTA 1ASWA 1B9FA 4JYAK 4ZHVA 4ORZA 4XH1A 2FBYA 1GCQC 2P5GA 3OW2F 2ZJQL 3AAQA 4DV0K 3CM5A 3SUOA 4CFDA 3N2KA 3T7ZA 5I2MA 2OTLN 1PF5A 2JWLA 4ISGA 4F7UF 4IJAA 3DLMA 4JD2A 4A53A 2OTJA 2XI9A 4JKFA 3PX0A 4DV6K 1K6YA 4CK2A 3CCRA 4LF5K 2OPRA 1KAYA 4BY9D 3HKDA 3LH0A 3NF6A 4WQ5C 4E19A 3CB2A 4F7UE 5DMRA 1GX1A 4LDYA 2FF6A 3DWLA 4YY3K 2RQWA 2P9PB 1YITN 3G6EA 2QI2A 2DNUA 4JJDA 3A5LC 5AQVA 3QFUA 4DU4A 1Q9YA 4Z4EA 3J7YP 1M9SA 1XHOA 3QETA 2QYZA 3CJ9A 1QVGA 4E89A 4C8QG 1VSIA 5BRFA 3PX6A 4ID5A 1N8RU 8AT1B 2K5LA 1BA0A 3TARA 3L4QA 5GANg 4E7HA 5LMNK 2YNFA 2FO0A 3VOBA 3CJAA 3EGDA 1NMDA 3G71T 2W10A 4XTVA 3JAMM 4M7AE 3HBTA 5KX5B 4J9HA 4X1VA 3UPUA 5LMUK 4CD3A 4FYVB 4M75G 4L59A 3EAEA 3QWYA 1Q8RA 3V9SA 5EY4A 3C9RA 1T3VA 5LJ3g 2F9ZC 5KMGB 2DD5A 3LWPC 4FLTA 1VQ5F 1G2BA 2XDDA 2W40A 3URGA 1CZBA 2JNGA 4DTPA 5GIPA 3SI6A 3QLHA 4KAZA 3OYNA 4JLIA 1J54A 3QINA 4ILJA 3RUXA 3V1OA 4DF8A 2E70A 4JKAA 3OY9A 3N4ZA 4IOCL 1MWMA 3O3HA 4C92E 3HRSA 3A0IX 1NEGA 1BI2A 3RVCA 1NMNA 5HY0A 1NG2A 4XU3A 1RNHA 5ECAA 2JN0A 3J80E 3OYYA 1LNXA 3L3VA 3VF2A 1T3SA 4CJRA 2EQUA 3CCLA 4FK4A 4E1MA 3D2FA 3SPYA 3MEVA 2IAJA 2HP0B 1QP3A 2QG9B 1RLGA 2O8CB 4N4GA 4CGGA 2KFNA 1D1AA 1XV2A 2V1RA 3LDLA 1YI2F 2AKLA 4RCHA 2QEXN 4FT2A 2OYQA 4NLBA 3HI0A 4FJJA 1N8RC 4I6MA 4KKOA 3H0HA 4ZTJA 2YUOA 5GONB 4J9FA 4WBNA 1ZLMA 1YJ9A 2RJFA 4J7IA 4X1KA 5JQGB 2FGYA 2EQMA 3L2QA 3G7ZA 3U8XA 1UGQB 4LDVA 1NJIO 4E0DA 2FSKA 2CGLA 5C25A 1I4K1 4JUVA 2ZPBB 1QE1A 2FBTA 1YI2A 2G8KA 1YJNQ 3HVRA 3PSIA 2P9KA 2EWCA 2JVVA 2RH2A 3M56A 2EWNA 2KT1A 3LH5A 4NLCA 2H6LA 4C92C 3WGLA 2MQEA 2G8UA 4LE9A 3QXEB 4B3OA 1JLBA 3C9UA 3DXKB 1ZBXA 4BRNA 4LUEA 2YJFA 3SZ2A 4BR0A 1RQ2A 3MJXA 4M7AD 2ROLA 3MXIA 3CG6A 2LZ6B 4HTLA 1HLUA 2E1YA 1MHNA 2IQQA 2BTOA 5J39A 3INZA 3DI6A 2QTVA 3HKCB 1YHQN 5LA6B 5CA0A 3CC4F 1JLQA 4O8KA 1EP4A 3JRZA 1W5EA 3VEWA 3CCUN 5M1NA 2Q97A 4KH4A 2YHAA 1SRLA 3CC4Q 1KVBA 2NRTA 3WQUA 1B07A 1BU6O 3CC7N 3MDQA 5HL7L 3CCSN 4FWOA 2ZAUA 3CCRT 4CZMA 3P39A 1FXXA 1KHCA 3KBGA 1OX9A 3EHQA 3T1AA 2ALEA 3NPFA 4RMOA 2BZXA 2Z1JA 4CHYA 3JVHA 4C82A 2RK2A 5GAN5 3TABA 1TUYA 4A5AA 4BR2A 3DLBA 2ITMA 4M41A 1BL3A 3SNNA 2YT6A 3NAEA 4DQ2A 2NUBA 2VASA 3QZ9B 2ABLA 2J06A 1W2BP 3JSCA 4JD2B 3CD6N 4MO5A 1FFXB 1E7KA 4N4HA 2LJ0A 3TANA 4FJLA 4Q5VA 2AT1B 5LJ5e 4E7JA 1Q81C 3FD6A 5GMKh 5LYJA 5JS2A 4M7DB 4B9UA 3VQBA 1W1FA 1BI4B 4N56A 1VQLN 1YCSB 4A54A 3TU4K 4JNEA 4MO4A 2A1RA 4Y91A 4B9XA 4E7SA 2LJ3A 2F9WA 3WNEA 2QQ9A 2X3XD 3OYGA 3CCLT 1A5WA 2YCHA 4B1ZA 3EG2A 1O75A 4WE1A 4CJEA 1QLYA 1VQKQ 1HJRA 4IDKA 5AQHA 4AHSA 4AFQC 3GOIA 4B08A 1KC8C 1TUCA 5A2QE 3HZ6A 1KVAA 3MN6A 2DZ9A 2HEQA 2NUTA 3CFRA 3ALYA 4FWNA 4HHTA 3NMUA 4WQ5A 3MEDA 2KRMA 3VQCA 2M0YA 1R0AA 3EHRA 4LF4K 5C0YA 2IVWA 4A5BA 5ITZA 2L3QA 3NF9A 1H8KA 1JB0E 1NYGA 4WFAL 1LCUA 3GPLA 5A0GA 3JCMX 2HBLA 5KMGA 1RACB 2F2WA 5ADXA 4RKUE 1K73R 2HHWA 4HNAB 3WGJA 4C5GA 1YITF 1U8RA 4CZIA 4MDXA 3DM2A 2ZPFB 3SAGA 3NVKA 3BP8A 2DF6A 2HHTA 2KVQG 2ZF5O 2VGNA 3VRZA 3CC4T 3G25A 3JCMP 1H3ZA 1F1BB 1VQMT 1CN7A 1CKAA 3QEWA 4NWOB 1WFWA 3ER0A 3I35A 1W42A 4C81A 1VQ9F 4FL6A 1QQMA 4JKHA 4JKBA 4DBRA 2HNYA 3H0FA 3M58A 2XRIA 2CKKA 3C6TA 4YNQA 3I55T 1NEBA 1UGPB 4Q0BA 3AVGA 5CY4A 5AT1B 1N33K 3H1QA 1KXPA 1X27A 2L3RA 4JI3K 4RTYA 2RHUA 4IOXA 3SUPA 4C92G 3PTAA 2I2LA 1VQ5T 3VS6A 1Q86R 1DEJA 1TKXA 1T0JA 1X43A 2EAYA 1UGRB 3GNFB 4F14A 2D0BA 2QTDA 2RPNA 3IAYA 2YKMA 1M90O 3AHUA 4CGHA 5GAGP 3H8ZA 5GAOp 5CA0B 2XIDA 1GO0A 1WSFA 5E41A 5CA1A 2DBMA 2DO3A 5GAMg 4KGXB 2V52B 3C9SA 2EBPA 5GAOn 4CBUA 3F0EA 2QDLA 2FLOA 5HRPA 1DBFA 3VYHB 3CQXA 4DCHA 2YXZA 1ZBIA 4B5CA 4JV5K 5KI6A 4J9CA 3OYAA 3I56Q 5J2TB 3CBPA 4HUEA 5M9OA 4JK8A 1YP5A 4M3ZA 1FMKA 3S0HA 5K14A 2PMPA 3QKJA 2K57A 3ZSZA 3D01A 4PK4A 2E6LA 3VEOA 1PWTA 1ZSZB 4DEYA 5A0LA 1LCKA 3JCMg 4XTZA 2V8KA 4N0AC 2O9VA 3DXKA 3RR6A 3E9LA 2LCLA 4OMQA 4ANJA 1M5Q1 2ZAEA 5HRNA 1TKDA 2HS4A 3F0DA 2X51A 2E2NA 4DLEA 1WSEA 3CM6A 3NHGA 1S72N 1GOCA 1VQ6T 2FXUA 4IZ9A 4CRIA 2QTXA 2ZWHA 5HOOA 1NJIH 3M0SA 3JS6A 3C12A 3WJQA 4PJNA 4BR9A 2P5OA 2O4GA 4MFBA 3KJKA 3VRYA 1FNKA 3NH2A 2EQIA 3JB9D 2F2VA 1M1KC 2XD0A 1XC9A 3SUNA 3PLAA 1OU9A 4V2SA 1VQMN 1K8AU 3C0CA 5IH2A 4RW7A 2V8JA 1BIUA 3FZLA 1IKWA 2GQIA 1H1VA 2X74A 4EI7A 1X6GA 3DXMA 1XTDA 3AVNA 1ZBFA 3K57A 4W5NA 4OMMA 1VQ6Q 4PJLA 3HL8A 3KFVA 2CWJA 2ZPIB 3DB3A 3RERA 4CJWA 5CYQA 2NUPB 1GLFO 2QKBA 3UA6A 3VQQA 1K76A 2PQWA 1J5EK 2HHUA 3J7ZO 3CXCM 1KLNA 1VQNT 4EZ9A 1NGIA 3GOXA 4BACA 1RL2A 4I4TB 2VGMA 2D0QB 4PJOG 2ZF8A 3QERA 4FSXA 1TYQB 3ZP4A 2COZA 2DL3A 5GAN2 5IWAK 3BFMA 4C8OA 1U6ZA 2H3EB 4M7AA 1M3BA 1WJSA 3VGLA 3QUWA 2KQWA 4EHUA 4FM1A 1U06A 3PNWC 4DV4K 1QS4A 4ZOLB 4KFBA 2LSNA 1SEMA 5J3BA 1VQ6A 1NLOC 2CREA 5G4UC 5I11A 1YAGA 5FPEA 4X9DA 2PVGB 5ITZB 4QQGA 3KLIA 2KLAA 1K8AR 1EFNA 1XUPO 4OMFB 3CJBA 5GJWB 1VQLF 3NVKE 2C0IA 5SZTA 1Q95G 4O4IB 4C8NA 5GAHP 3QDKA 2YHYA 2O8FA 2OZMA 4FLYA 2RHLA 3MQWA 4JKCA 3J7AR 1VQNN 3HKSA 3QIIA 3O1BA 2PUKB 2M51A 4BR4A 4CJQA 3M4SA 4M78E 4DTSA 2M9UA 4KH1B 2QA4Q 5I42A 5LP6C 4H0TB 3OYFA 2DXTA 1WI7A 2DFFA 3J80M 3NFCA 3O3GA 3X20B 3OS2A 1TUBB 3AO4A 5GAOq 1OVQA 3VMFB 2QK9A 2E3HA 2GZLA 3CPQA 4RHAA 1QMCA 3B8AX 3LWOC 1VQ9Q 5KYYA 4DTUA 3D7SB 1EKEA 4CZJA 1ZHIA 3K5LA 4LNUA 4PUOA 3JATB 2DFUA 2LTOA 3G4ST 2D0AA 3VQ9A 3EH2A 4LNPA 4AILC 2HHVA 2EGCA 3EH1A 3ID8A 1QAHA 2MYSA 5JMVA 3JSMA 3JB9F 3R6MA 1RAAB 3ZEHA 2L5QA 5AQJA 2RMOA 4KHWA 1WNLA 4QQ6A 1VQPA 1Q7YU 4YOYA 4E7IA 2NYSA 3LM9A 1QCFA 3LW5E 3QPHA 2VG7A 5AFUH 1E6HA 1HRHA 3F73A 2XY7A 3FBAA 3VYUC 5IJ0B 1MDUB 1YJWN 4CGJA 1PRMC 5M1OA 2VWKA 2Z1GA 4AF1A 3OB9A 4H5WA 2CP5A 1HJDA 5FLXO 4CGIA 4CC7A 1Y57A 3DLKA 4IURA 3CYPB 2CSIA 3OQ5A 1V4SA 3T9NA 2RHYA 5FLXM 4CEAA 1CLIA 2VYTA 1IO6A 1WX6A 2K3YA 2O4XB 2RI3A 3KKSA 4OJRA 2QQRA 4A4HA 3CMAQ 4FJHA 2IG0A 3BYQA 1T6CA 1JLEA 4KPYA 3AGRA 4CFCA 2RQRA 3LDOA 4JLHA 4MLEA 2E6ZA 2I7PA 1VQPQ 3CJCA 8ATCB 2CT3A 1IV1A 2Q1XA 3VYSC 3I55N 4W5QA 4IUUA 1N9SA 2EJGA 2HQSC 4EB6A 1RAEB 2DE0X 2BGGA 2P6YA 1VQ5N 1VSFA 5HP8A 3PE0A 1XHXA 4GBQA 5GAN3 5ADXH 4L6V5 2RB9A 1QQOA 1QHTA 3ZEUA 3AO2A 2RE2A 3S9HA 5I3UA 2KROA 4LD0A 3C7NA 4CJ7A 3WVDB 4ZK7A 1U3PA 3DYAA 1ZBSA 4KTWA 2PVDB 3BF3A 2QDYB 1KQSA 1QCNA 3A8HB 1MWKA 3MBMA 3ZX0A 1M2OA 2FZGB 3S6WA 3QO3A 5CQYA 4W5TA 2R58A 1JL1A 2ATCB 3LWVC 5CKHA 1YJNF 1R1MA 1JLAA 3CCVQ 3ZBDA 2RJEA 3DLLA 1VQ5A 1GBRA 2FC0A 3D2FB 2NZTA 1EZZB 2DD4A 3MEWA 3FFMA 4H5NA 3NTKA 1W5AA 3A5ZB 1KAZA 5D6WA 3V6DA 4AMCA 4BDZA 5AQPA 3U9ZA 4WF2A 1S1TA 2ATQA 1VQON 3UT1A 3H3NO 1N8RO 4O2BA 4M3YA 2QWRA 3LP3A 1R8OB 3T1HK 4RTVA 3GP8A 5GMKe 5BPMA 2V9YA 2GFAA 4LCKA 5GONA 1P92A 2J6OA 5FLXE 3G71A 3L3UA 9ATCB 3OSSC 2HNZA 1YJ9N 5J2UB 4TVRA 4Z88A 1W9HA 1C0GA 2ZPGB 4TUYB 3MDOA 1T8EA 1VQLT 4KH5A 4DRXA 4GW6A 1TUUA 3M8PA 3VTHA 1I07A 2DJQA 4AT1B 3VN5A 4DXDA 3IS9A 1AEYA 4HVJA 3VGMA 4OPHA 3LWHA 3M8QA 4JI4K 3LWMA 3ZO8A 3C6HA 1KSWA 5AQRA 2E1HA 2XY8A 3U0OA 4J9DA 1IKXA 3B6NA 4FVMA 1W4SA 3G71N 3V9ZA 4D8KA 3THYB 1XQHA 4RTFD 1UHFA 2A7YA 1JRIA 1NK8A 3TD3A 3E1YA 1QQJA 3LWRC 3QEXA 3LZJA 4ILHA 1V1CA 1H47A 2F4VK 4ISFA 2BTFA 4PJMA 1K8AO 2Z01A 3P10A 3TAFA 4AG2C 4W5RA 2DK3A 3EGXB 4HA8A 3AAPA 1DT9A 3CCJN 3LL3A 5KQDA 1VYVA 2YLCA 1GCPA 1YN8A 2KYBA 3EEQA 1VQ7F 2QWOA 4C0DB 3AVIA 5EZYB 4K42A 3ZOPA 2WOMA 3Q7BA 3QIPA 2P9SA 1L3VA 4K0KK 5IJ9B 4M7AC 1UWBA 3FGUA 4AM6A 2FRWA 1NJZA 4BVPA 1IBMK 4U67L 3C9TA 5I9EB 3THXB 4N76A 1YJNT 5AQXA 4O4HB 1KQ1A 4WFNL 4DTMA 3G6EF 3CXCA 1IXDA 4O5VA 3HSTB 4PY5A 4KRFA 2W8BC 4I9QA 3OJSA 3QDFA 3CIPA 5C2FA 3LLRA 3ZCMA 4CEFA 5EYPB 3VIUA 5CA1B 1RCHA 2PAVA 2FF3B 1OH8A 1SZQA 4JS4A 1JEGA 5AVMA 4Y92A 1U47A 3PIOL 5M1KA 4JZ4A 3LDNA 3EORA 4C8KA 4FCYA 2UU9K 3LPUA 2F69A 4PJOC 2E2QA 3VERA 1KC8O 2UYKA 2R5MA 3VPZA 1RDUA 1KC8R 4K25A 2L3SA 1OOTA 4FOIA 4H8KA 3WUHA 4HWIA 3I7TA 1BQNA 4OMNA 1ZXOA 3TAEA 2ENMA 3HTVA 3VEYA 4GLMA 4JI2K 3CCMN 3AVAA 3SWNB 3CCJA 2LX9A 2NRHA 3META 4EIKA 1Z5VA 3U23A 5M1PA 4UQGA 1B3QA 3E9OA 3CYMA 2JJ9A 4JKGA 3BY7A 4G4YA 3DC2A 1M3AA 4B9MA 1JLFA 3FEOA 3AO5A 1HNWK 2VAMA 2DTUA 1KQSP 4A2BA 7AT1B 4C4WC 4PLIA 1R0CB 1GLAG 3JCMV 4FK0A 3AY9A 3O9QA 4DR7K 2OTJN 4OB0B 3CCST 3L2VA 4EMHA 2O31A 4H0VB 1Q8IA 3QEPA 4M3WA 1QVFA 1Z05A 5GAMj 1K0XA 2RHOA 5FNVA 5GMKm 5BREA 5HXZA 3UT5A 2DVJA 4IUTA 1YIJN 1YVNA 1JXEA 2WUSA 2QTPA 3EG1A 3ZT0A 5HXUA 4A63B 1KC8U 4KV8A 2B33A 1QVFM 4FYXB 5B8HA 4I4TA 2KSSA 1VQMA 3CD6F 1WSHA 1Z9ZA 1H92A 3QG1A 2E2OA 4PJOF 1HJOA 2OA8A 1VQ4Q 3M0UA 4BRKA 3PO5A 2KDSA 3KLGA 1PM3A 3M8RA 2DL4A 3JAWA 1AZEA 4DFJA 3HP6A 1OH5A 1ASVA 3NK6A 3SB2A 3P8HA 3PVLA 3VQAA 4YDUC 3TREA 4D8DA 1UJ0A 3LX7A 1X1PA 3AT1B 3CCUA 2P9NB 2JS0A 4G4XA 1OI1A 3PIPL 1RT7A 3TQ7P 3QBYA 4Z0UA 4OLBA 3CJ1A 4NYNA 2LQKA 4M75B 3SLCA 3EG3A 2P1JA 3THYA 3ZSRA 1YJ9T 2V7YA 4Z4IA 4E1NA 3PT9A 2V26A 4FOEA 4ZNXA 5E26A 1M90R 1YJNA 1S72A 2KXCA 5G4VC 3QEVA 1VQ8Q 3QICA 3HKBA 2DEQA 1NGDA 1U5SA 5L23A 2HSTA 4H5TA 3ZSWA 3LANA 3ZSVA 3RDVA 3OVNA 4LXCA 4A61A 1WJRA 2A0FB 3FIFA 3CMEA 1EETA 4DU1A 1K8AC 1YUWA 4G4ZA 2HKNA 4TV9A 5HY1A 4FJ7A 1HNXK 4GNIA 3VA0A 3CC2T 4MQ3A 2MMPA 3EY1A 1NGCA 2KK4A 4IIOA 4FJGA 1W40A 4J9EA 4OKEA 2HVYD 2XK0A 3FPIA 2G8HA 1X69A 5M1QA 5GANe 5CZ2A 2FG0A 3EZ5A 1D0XA 3C95A 3KJJA 4O4IA 4YOTA 4MZPA 2CZWA 4EP5A 4BQLA 4FL9A 2V51B 2WALA 4CEZA 1HKGA 1KC8H 4GV9A 2FEIA 3ASMA 1ATNA 1NKBA 1P8ZA 1WOQA 4F6RA 2MWPA 4J9BA 2DYBA 3L6QA 1ZSZC 4WQ4A 3VA3A 1VQ7N 4JI7K 4C0ZA 1C0TA 4DRXB 4Z94A 1E4GT 1QQCA 1BQMA 4K11A 2H3GX 4DG1A 4Y1CA 4OPAA 3RA6A 2A37A 1B9DA 3VEZA 3T69A 3CHWA 4X1IB 2YUPA 2M02A 1VQ4N 3V8JA 4RQOA 4XU0A 5MN6A 1NJYA 3EG9B 1YF5L 2WONA 2LX7A 5AQFA 1U40A 1XHZA 5HP7A 3KK2A 3SJJA 2EVRA 4I2PA 3V7EA 1JCFA 3DRPA 2QWLA 1OVYA 1KIKA 1MMAA 3A8MB 4FWSA 4J8FA 1PXWA 2KTVA 2CZ6B 4TV9B 4X1KB 1HMVA 2KMTA 3RIRA 1YVUA 4FWMA 4WCEL 2X4JA 4M78G 3CCRQ 2NRWA 2Y1JA 1NM7A 1Q18A 1NOYA 3J7AP 2E88A 2VWJA 1O1WA 3JASA 3TWHA 1SHGA 3QB0A 4C8QC 1VSJA 3IKMA 2OANA 1YITT 2EKOA 1K9MH 4DQ8A 2DXBA 1BK2A 3VYTC 3D6RA 2PY5A 2L2PA 4JN4A 1W6XA 5HROA 1JXMA 1X3MA 3ZSXA 4CHOA 1FK9A 3UATA 3P4IA 1D5AA 3L8BA 2M1HA 4CCHA 1NE8A 1XWLA 4ZI7A 2ECZA 4NCBA 1XNQK 2Y4XA 4J8OA 5AYFA 5J2PA 4O55A 3RR7A 3MX5A 1Q9XA 2F8SA 3I55F 4FSVA 2OTJF 1QHAA 1DJ7B 4M3TA 1J5OA 3F9MA 2CT4A 4B1VA 3G4SF 4M7AG 2OTLA 1OYXA 5J2MA 4CJ5A 2EYXA 2AIFA 1BUPA 3CG7A 2YSQA 1REVA 4BT3A 1NJIU 5BMVB 3RSEB 2WACA 2D6FA 4PJOE 4FWPA 1Q7YC 3IDHA 4JHDB 1E6GA 1SHFA 4J2EA 5A2QM 2R751 2ASPA 4KWEA 2DL7A 1RLQC 3O80A 3F0GA 2YRVA 3PMIA 3CCVA 1TS9A 4D6WA 2QA4A 2D8JA 4QVDA 5JVHL 2JUFA 1WB9A 2JM8A 4J6XA 2D4WA 3JXUA 3VQ4A 1LW2A 4CESA 4CK3A 3CPWP 2GFUA 4P5NA 3CCQQ 2P9PA 2XU8A 5JH7A 5DM7L 2WTUA 3KHYA 4JK9A 3OSVA 3WEEA 4M3XA 1TVKB 2KFZA 1PG5B 1N34K 5AQQA 4N41A 2P4TA 4Y0WA 3BDPA 3BY5A 4KHSA 4HUGA 2XMFA 4A4KA 1OEBA 3VQ5A 4O2AA 1KHIA 4GY5A 3V7RA 3VEXA 3CJ7A 4MDWA 3UWNA 1RDAA 2AP1A 1N36K 5EZYA 4CEOA 2KTUA 3KD1E 1E4FT 2F7TA 1D0YA 5GANj 1SSHA 1N8RH 5CK9A 5GMKj 2PVOB 1M8VA 1W97L 1SRMA 2EHGA 4XH4A 4U7BA 3LMEA 3F9KA 2FZKB 3QSUA 1GOBA 3G71Q 1Q81H 1J3TA 3IUCA 1M90C 3VU3C 2DPNA 3QYGB 5LJ3j 1JJ2S 3V4DA 1S6QA 4PWTA 1KVCA 2VQFK 1U2VA 3CFOA 4B46A 3CC2F 2O8EA 4CBXA 1N6AA 4I50A 2J7IA 4WCIA 5IHKA 2YWWA 1O9SA 1PD0A 1J9AA 4H0PA 5I22A 3PY8A 2BTTA 2ZGYA 1HYOA 2EGEA 3RMSA 2AZSA 3L2RA 2G8WA 2GWKA 1QCOA 2RK1A 4B9WA 2YRDA 2YJEA 3OYBA 1DLOA 5FWBA 4DSKA 2JTEA 1VQ7T 1O13A 2PYJA 4E1JA 4FWLA 4WF9L 2HF4A 2Z1IA 4DS4A 1GLEG 1T05A 3OYKA 3H6ZA 2GGRA 2P4RA 4CC2A 5JLHA 3QESA 4KUIA 5DY9A 1AT1B 2PU9B 4FJ8A 4LFBK 1TTHB 1W7AA 5DM6L 4BVSA 2D1KA 2IGIA 5AQZA 3C8LA 3E22B 1LAWA 5FPMA 1WIEA 2MF2A 4RTWA 3REBB 2E6MA 4BT4A 3SDZA 1IRXA 4BRCA 3M1XA 5LJ3f 1T6DA 3CI5A 3VETA 4CZLA 3A8GB 2NUZA 2DLPA 2EX3A 2A28A 5GMKl 3P38A 3D00A 5GAPK 2A42A 4B3RK 3OBYA 1ZSZA 2BE2A 5GANf 2GCXA 3SIVA 2OPSA 4PJJA 1S9EA 4KH6A 3PAFA 4KULA 3FZHA 2PZSA 5IJ9A 4CVNE 3UT5B 2OZBA 1RAGB 2EGAA 1GZ0A 4FPAA 4OVLA 4KREA 1VH8A 2HBKA 3KUFA 1VQVA 4AM7A 1VIFA 3OMCA 1TYQA 1KD1H 1AVZC 2KNBB 1AHJB 2OJ2A 5EOYA 3V9UA 4DLGA 1PKTA 1Q81O 1U3LA 1R77A 5HRSA 1X9SA 2KTQA 5DCVA 3NHNA 3CQ8A 2DKGA 1RTHA 4O8UA 3OS5A 1IGUA 4OF1A 5C24A 3CD6A 3ASKA 1NK7A 2YRCA 3K9JA 4CI0C 1IH7A 4OMLA 3DXMB 1K9MR 2PUOB 2OPPA 1X6BA 4RTZA 4EMKA 2P9KB 1T0KB 4K8ZA 3VYGA 5KYUA 4OVAA 1YJWQ 3JB9H 3OONA 5FPDA 4BR7A 2YNIA 3V1RA 1M8MA 1I5OB 2F1LA 1WHLA 2DJZA 2MWOA 4GLKA 3EE8A 1NGJA 4LSNA 3LZIA 3ZSQA 3HOSA 4Z4GA 5LYJB 3BW1A 1ZA2B 4FT4A 3PMTA 3SWNA 3OYEA 4ZHYB 3V8KA 1IHWA 1KFDA 1D3BA 3CCRN 4K41A 1PC0A 1C0UA 2L89A 3QFPA 4NO7A 4C5EA 4C5HA 4LSLA 2C06A 4OLAA 3M55A 2Q2RA 1OAPA 1YITA 2O8DB 1KK7A 2A40A 1BGXT 2DILA 3WNHA 3K58A 4CF9A 2HHQA 1SZ2A 4ZGEB 3EG0A 2B4JA 1VK3A 4F9OA 1D9FA 3BGRA 4M77E 2E3IA 3CCJF 3OA9A 4HKEA 1KSPA 4F7UG 5GAMd 3Q7CA 4PKHA 3GYQA 1VOMA 3JCMb 2ZVZA 1UECA 4AFUC 1P90A 3PVQA 4FZXC 4OP0A 3GF5A 3E01A 2NLUA 1QP2A 4FIBA 4B1XB 1B34A 4B9VA 4BT5A 2RD1A 4KBOA 1SV5A 1HKBA 1C1AA 4CEEA 4BRHA 2EJFA 1K9MU 1RT6A 3NVMA 3HHTB 2ASOA 3VQEA 2P0QA 4LF6K 2X4YA 1OQKA 4CEDA 2LT1A 3PSFA 1W41A 3CBOA 3AA5X 4PL7A 2ZGWA 3LYBA 5CE3A 4TUYA 2CYZB 1BU1A 2L3PA 3MP8A 3L2ZA 5D6XA 4F16A 1FKOA 2HB5A 5GINC 1WGSA 1NGBA 3B6PA 1WQWA 3H6EA 5KPTA 1K73O 4M77A 5CKBA 3JAME 3CXCF 1EWQA 1RAIB 5KYUB 4CEQA 4AQYK 4IFYA 3RYFB 4XU1A 1JCGA 4IBNA 1ZYQA 1Q81U 3DAWA 3CCLN 1LVKA 3ULEA 3THWB 1A5XA 2A6AA 3F5TA 3I5SA 1UE9A 4X62K 2W6LA 1AWJA 4XEIA 4DFPA 4B9SA 3WGKA 3NFAA 3CMEF 3OHRA 1SL2A 1X52A 1G3YA 2VC8A 4Z4FA 2X9HA 3MECA 1VQ7A 4BVQA 1Q86H 2F9TA 4BRQA 4EDUA 1DTQA 3LDSA 2JTFA 1CXUA 3CF5L 1SS6A 1ZBLA 1M1KO 3G6EQ 2QWMA 5EXWA 3N4YA 3C7NB 5HY2A 2RN8A 3A8LB 4FLWA 5AQKA 4JI5K 1W59A 5L8RE 2CP0A 4RCCA 1X2KA 1NNEA 4OB2B 4HCKA 3NF8A 3RTVA 1V4TA 1CKBA 4OGCA 2PHNA 2Z1HA 3JARA 4YJ3A 4XU2A 3LM2A 1B92A 1JLCA 2IVNA 4XTXA 3S0YA 4FXDA 1WXUA 3K5NA 4ELZC 1QTMA 3MCPA 2X78A 3LDTA 4DBFA 3FR0A 3MEGA 5GAMe 2ED1A 2Y4YA 2ZM6K 1ZUUA 1M1GA 1UJYA 3VOVA 3DOKA 3S06A 2YHWA 4M78D 3V9XA 3E20B 1ITGA 4IFEA 4LC9B 2EJ9A 4IJNA 1WSIA 4R79A 3VS3A 2F2XA 1S72Q 1Q81R 1YJWF 1KLMA 3KK1A 1Z25A 1YQNA 3QDRB 1A5VA 2D5RA 2YYEA 5J2UA 3VS2A 1D4XA 4QVZA 3AVHA 3CCUT 3JAKB 3TAQA 3MP6A 5IAYA 4BVTA 2D0PA 1UA0A 1K9AA 3HPHA 3W3DA 2Q1YA 3SAFA 2VQEK 1FX7A 2P0PA 1JKHA 3CC7T 1NJXA 1W5FA 3RSEA 3MHXA 5IT9O 4ZGDB 3THWA 1ZC6A 4M77C 1RT4A 3I56N 4JKEA 1YIJQ 5J2QA 4NCAA 2K9GA 4JRKA 3U6FA 4M63C 3MXJA 1C0MA 3WPWA 2DIGA 2RI2A 3O9UA 4DMNA 3SQ4A 1KQSF 1X9WA 4HVUA 1NK5A 3ON1A 2AKKA 4EMKC 1W2BF 2Y1IA 5CKFA 5KYNA 1TK5A 1AWOA 3K5OA 4I6MB 5GIOC 4FYWB 5A0DA 5JQGA 3FDRA 3JCMc 5GAOl 2HL3A 4JRPA 2QQSA 2RQUA 4YOWA 1KRPA 4B1UB 4QOZB 1NKEA 4BT6A 2A5XA 3JCMf 4B9NA 4JPBW 5LL6Z 3AA4A 1G3SA 1IV2A 2VUBA 4A4EA 4BI3A 3TSZA 1C1BA 4NL3A 3AARA 1A0NB 4JJBA 1LOTB 4MLHA 4O4GA 4CZEA 4PL6A 5EIBC 5HY4A 3I0RA 2IIMA 3JASB 2E1ZA 4B8AB 1Q86O 3ZYYX 3QO9A 1ARKA 3MWPA 1VQ4A 2O8BB 5LJ5j 2NRXA 4Z02A 1QSLA 5GAMf 3KWGA 2HSEB 1WXTA 1IJJA 2OPQA 3VQ7A 5C2DA 1YI2N 5HKCA 1VQ6F 4FSSA 1RI9A 4CJLA 3OYJA 3OYDA 1NYFA 1LWCA 1N32K 4AG1C 4CBWA 4M7DG 2Z1FA 3LFOA 4IIMA 2MAMA 1WQ7A 1RT3A 2K5IA 2YNGA 3AA3A 1H641 1YI2Q 1K73H 1ABOA 3X26B 1RBTA 1TH7A 2BE7D 3OYCA 4C5IA 1ATSA 1W0HA 2HHHK 1I8FA 3UKUB 1HSQA 3M84A 2DL8A 4BE2A 1VYUA 1T0AA 1M2VA 3MCAB 2AK5A 3M54A 3NMZC 4C8QD 1WDXA 4F04B 1NGFA 5AQYA 3WNFA 3RE3A 2AIZP 1JJ2F 5CAIA 2HD0A 2K3XA 5D6YA 2A36A 2LC4A 2BO1A 4DFKA 1Y07A 4RW6A 4DQRA 1TG0A 2DPPB 2RHJA 3JB9G 1KNJA 3SK3A 5KYWA 1SKRA 4E2FB 4A57A 3R3LA 2HW3A 3CPWF 3VUZA 1NGHA 1VQLQ 4PJOB 2ZJPL 4EPCA 3I5RA 3IKEA 4DTRA 3U4LA 4EHTA 5IXFA 5LOVB 3WVEB 3ATUA 3D0PA 2RA2A 2ESWA 4BG9A 4YJ2B 4YDUA 1QZ5A 1L3UA 3HFNA 4FLXA 2KI7A 2BANA 2V7ZA 4IEEA 1IHVA 3DLGA 4G88A 4DOWA 2EFIA 2VYPA 3X25B 3C6AA 1IZ6A 3P1GA 1MUZA 4IWVA 1KD1R 4QAGA 5BN9A 1TU0B 2HS3A 1QKXA 5LJ5d 3JAKA 3S02A 1JLGA 3HYFA 4DV3K 5CB4A 2Y90A 2QEXF 4C92F 2QWPA 5DK5A 1VQLA 1UGVA 3CC7Q 4YOXA 3CC4A 2UXBK 4LUDA 2WBNA 4B9LA 2GV9A 1G3TA 1WHMA 2XICA 2LQNA 4QVCA 3NGPA 2E10A 3CCUQ 4QCLA 2EW3A 4DFMA 4M77D 4M7XA 3FFKB 3E1SA 4HCBA 2YHBA 1D8YA 2DX1A 4CC3A 2WFBA 4DV2K 3M4GA 1RT5A 2DERA 2P9LA 4I2QA 3ZX3A 4MZTA 1RA4A 4FJ9A 1VQOT 2KGTA 3N4QA 4CIFA 3E22A 3HKCA 2PBDA 1VQ4T 3BF1A 2RPIA 3C4SA 4X1YA 1UB4A 4M77G 1I1JA 2KRNA 3GBQA 2ED0A 3KVGA 3S3NA 3H45C 4CF8A 4N47A 4RW4A 1AWXA 1FKPA 2W6KA 2CS7A 1GFDA 2GX9A 3T3FA 2CVLA 3CQYA 1BIAA 4DKWA 2HZYA 3RMDA 1YJNN 4PFPA 1T44A 3EGUA 4G4WA 1YWPA 1MU2A 3GE1A 3M0TA 2DAQA 3OMGA 3A5OC 1BI0A 4JI1K 1W3EX 2G8VA 3KE1A 1U04A 3G6EN 5EIBD 1BBZA 2KAFA 1NZ9A 3O9TA 5KTQA 1VQPF 4XIUA 2O4IA 4HT9A 3RA5A 4IIJA 1ABQA 2JM9A 4IXCA 2YI1A 5JVDA 1QVFF 5KYXA 3QHSA 3VV0A 1M1FA 1SG5A 6AT1B 1RTJA 2FPFA 2NRVA 4DTNA 1COMA 1SKUB 4M75C 3VI6A 1S3XA 3GNGA 3R8EA 4BQZA 3CCRF 5LJ3h 3H0IA 4RTUA 3QMLA 2GNCA 3SBGA 1IGQA 1LJOA 1Q86C 3TSUA 1YWOA 3CCLQ 2DFHA 1VQ5Q 1D09B 2EYQA 3UKUA 3ZEUB 4CZGA 1VQ8N 1ILYA 3O9SA 3E66A 3SQ2A 2UZHA 3GTZA 3N4PA 3L7QA 4BT2A 5J2TA 4LFCK 2JTMA 3I55Q 4OGEA 3F6MA 2DFEA 3RMCA 1G5VA 3K12A 3HM9A 3K0SA 2PYLA 3R1XA 1ONIA 5FU6B 3D2EA 1YIJA 3HKEA 1C6VA 3LYIA 1GFCA 3ESJA 2HBMA 3SQ0A 1RILA 2F96A 4H4MA 2CZ7B 4HTUA 4DSFA 1BWFO 4DHYA 4ZTFA 2FBVA 1ZBUA 1ZUKA 2ZVYA 1GLDG 2GLZA 3CCQF 1ACMB 3MN9A 1RTIA 3MEUA 1JXBA 1QSSA 4M3RA 3HKDB 2P9UB 5AZJB 3SPZA 3R6OA 4FW2A 1UGSB 2HQEA 3ZSOA 2F8TA 1TSFA 5HK0A 1TK0A 3VS7A 1YXQA 2HQHA 3DLRA 4LDUA 5IYZA 1K73U 5C10A 3L0QA 1RBUA 2BH1A 2HX0A 5CB4B 5IT9M 1WNSA 2XHCA 3ITHA 2YUNA 1RBRA 1YITQ 3RMAA 4LF7K 2CHTA 3QTYA 1NOZA 3RWUA 5AJ3K 3CC2A 1LPLA 3SCXA 2EWSA 1RABB 4DV5K 1VQ9N 2HQXA 4FO0A 2UXCK 2VXYA 1F21A 2XG8D 2OTJQ 1TL1A 4ZGJB 1HXDA 2YLBA 3E9GA 2DETA 1KTQA 4OB1B 1WSGA 4BVOA 4BC2A 3RYHB 3TTFA 3LP2A 3ZT4A 2J6FA 4KTZA 1S1XA 3QIOA 2BUPA 1V76A 4FK2A 2Q31A 2B86A 2RO0A 4WFBL 1Q86U 5LY3A 4NXNK 1CK2A 3CCSA 2LJ1A 2WSEE 3S3OA 1VQNQ 4MDAA 2IAFA 3HJWC 5HWEA 2F5KA 1VQKT 3I9QA 5HK3A 1M1KH 1MNDA 4BRAA 1L3TA 3ENBA 5KGWA 2BTQB 4BG8A 4DQPA 1BI1A 1D9DA 1OX8A 2B8AA 2DRKA 2JOYA 3LGLA 3CPFA 5KX5A 3VQ6A 4C8QA 4K8XA 4BR5A 2HNIA 5GAMh 5CO7A 5GJVB 2EYYA 3CMAA 3ZSYA 3WGNA 2RNAA 4AHTA 4EP4A 1VSEA 4ZI7B 3ZT1A 1NK6A 5AQNA 1K9MO 3AVJA 4CZKA 1SAZA 3OW2S 5EWRA 1NJWA 1HK9A 1YJWT 2K5FA 2AIRB 2RHIA 4HUFA 2LVMA 4M75E 4EZ6A 2HP3A 1MA9B 1VAZA 2GF7A 1N6QA 3JCMh 4M78B 1TUBA 1EQYA 1T0HA 2MK5A 3OW2P 1HX1A 4FLVA 3G6ET 2KY9A 2ZPEB 4J9IA 2HP0A 1N9RA 4PLLA 3JB9I 3MWTA 3TD4A 4VUBA 2VB6A 4J7FA 1LV5A 3Q8HA 3I8BA 3LGFA 2HNDA 1DGKN 3DRSA 3KLFA 3ZP7A 2CP2A 1NG9A 1IBKK 2O8FB 4I9LA 3RKXA 2HMPA 3VJPA 3ENHA 5KYXB 3OW2M 4X20B 1EO1A 1IPAA 2AHJB 4MMLA 3ZETB 3VENA 4FJKA 3S0WA 3AVBA 3L4IA 4BY9C 1S1VA 1VSLA 3LWIA 3DLHA 2I6RA 5JCOA 2QWNA 3GDQA 3LDPA 1VQMQ 1S72F 5C8YB 1Y7XA 1VHXA 1NPRA 2NUTB 4BRDA 4A62A 2OI3A 3JV3A 5LJ5f 3ULDA 2SEMA 1LW0A 2RQTA 3MEEA 5KRTA 4FM4B 1IV0A 1Y96A 1YHQA 4LNUB 1C6VX 2CP7A 3BZCA 2KHOA 4O44A 3UDCA 4M75A 5GAN4 4X64K 4OPKA 4DSEA 3V8LA 1NK4A 1Q7YH 2OTLF 1X01A 1GLJO 2E5LK 4H03B 5BPLA 1S1UA 2W0ZA 1EWRA 3U3YA 1W581 5F0XA 3HPOA 4E47A 4M42A 3I8DA 1ZQ1A 3S41A 3N2GB 3A1PA 3FJPA 1L3SA 4DQIA 4Y1DA 4DBQA 5J2NA 2DXCA 4B1WB 2ZCFB 1S6PA 3A8OB 3F2KA 5GAOm 1CZAN 1VRTA 3KK7A 3NE6A 3O5BA 2LBXA 1RQ7A 3U3GA 5I2SA 3QHDA 3EE9A 1WYXA 2P51A 2JNBA 4H5VA 5FU7B 4X65K 3KK3A 1HKCA 1IV4A 4AHUA 4ELTA 4BI8B 1VQOQ 1N5YA 1YFNA 1XNRK 2O4XA 4QQDA 3TAMA 1YJ9F 1K9MC 4BGBA 1BDGA 4WQ4C 4E6EA 2ZZDA 4RTTA 5FNVB 1SUQA 4B9QA 1LWFA 3L1AA 3LPTA 3EFOB 2A1SA 4F3OA 3X24B 3VTIA 3JCMM 3I56A 1ZSGA 3VOAA 1GLBG 1FWZA 3M0RA 3CCQN 4PNOA 3WJPA 1QD9A 1VQMF 4C8QB 3ISNC 3AVFA 2BZYA 1OH7A 4M77F 4ME7A 2C0OA 4DR2K 3ATVA 4JRIA 2FB7A 4Q5WA 3OYLA 4FVUA 4O0IA 4R55A 4QKUA 3GIBA 3CC7F 4EI8A 2E65A 1IREB 3I33A 2GEMA 3DJCA 3MAQA 1IB8A 3M8SA 4KT0E 4DSJA 4PJOD 1JJ2M 3QYHB 2ROTA 5AQMA 2DM1A 5C15A 1WXBA 1NMUB 4ATOA 3KKRA 3REAB 4E7LA 1WAJA 1NPPA 1K1ZA 1ZBHA 4C8IA 1N5ZA 3M1FA 3HVTA 3QNNA 1SA0A 4U3JB 4NQ3A 4CJPA 1WA7A 3FJ5A 3J81E 5AQIA 1J7HA 3JALA 5FDLA 1KQSS 4RTXA 3HK2A 2LCCA 3RESA 1RDWX 3M57A 1WN7A 1XQSC 2E6NA 2BIVA 2MPXC 1WZOA 2ZJRL 3NTHA 4R0KA 3Q1JA 4BE0A 2D9TA 5CR4A 4FWRA 1QQNA 2CDTA 1RDDA 3J81O 3VUBA 2GUPA 3OYMA 2HS0A 3V9WA 5HBMA 1JJ2P 3MN5A 4G1QA 2IS3A 2WSFE 3AV9A 3KD5E 1ODEA 4M77B 3OW2A 2KGWA 3OBWA 2CP3A 3S3MA 1BISA 2OHWA 3TVTA 2UYNB 2V8IA 2I0NA 4HVVA 4J5YA 3CPWA 1GO1A 3C0BA 3MCQA 3RYFA 2JGUA 1U43A 1VQ4F 1M2VB 3EO3A 2E5KA 1AD5A 2WC9A 3HO1A 1HPMA 1C0FA 3EGDB 3MPUB 2DT4A 5LXTA 5KE2A 5KCOA 2VXEA 3T19A 1NGAA 1VQPT 3VCZA 4KI6A 3CCEA 4G9ZA 4CI6A 3AVKA 1W5BA 3IEQA 2FYKA 3N2KB 1D3BB 4TV8A 4BB7A 4M45A 4B6MA 1S72T 4C8EA 1CXQA 3NH0A 5LOVA 2HMAA 4F6RB 4C92A 3JYTA 1G8XA 4ELUA 1W57A 4IG3A 1XC3A 3TTDA 4BC4A 1VSMA 2BDPA 2L26A 4FPBA 2HVIA 2NLXA 3K14A 3QBXA 5EC7A 2VG5A 5LJ3e 3ENOA 3PO4A 2ZPHB 5IXBA 1M1KU 1HPZA 2I6DA 4ZHRA 4M7DE 4CF2A 4BRPA 3DLEA 4C92D 4JS5A 2YV0X 4WTOB 4M78F 1UFFA 5GAEP 1WBDA 3UIQA 3ZX2A 4PWDA 1TGOA 2GTOA 1VQ7Q 2RI5A 4F3TA 3FC3A 4RG8A 1DKGD 2K2MA 2KKZA 3KLEA 4BVRA 4DR3K 2Q36A 4MZMA 1YTUA 1X75C 2N48A 2CGHA 5IHIA 4CHNA 1SL0A 3KWIA 3CXCS 4O5BA 1VSKA 1WHJA 3CMET 1GLLO 3BDLA 5GAN6 1JO8A 2DXUA 3M5RA 5AQUA 3FRNA 5F2RA 1IKVA 4JI0K 2NRZA 2OX7A 2LNHB 4DSIA 4FLUA 1Q7YO 2GUIA 5KYYB 4RW9A 1S5JA 1OH6A 1Q7YR 2VV5A 5KE3A 1M4ZA 3O08A 1WLJA 3OS1A 4KHNA 4Z4HA 1XJWB 2D0NA 1Q82C 2QW9A 5FPNA 1XMOK 4O4JA 1M1KR 2GWJA 1PHTA 4UY8O 4IHJA 3I55A 5BR9A 2F5TX 3TSWA 3PGGA 4Z4CA 2VVKA 4NS5A 3TEEA 4X66K 4YHHK 1RT1A 1SF9A 1VQ6N 3NMUC 2RHZA 2JXBA 4JDSA 4O0JA 2DVEA 5LJ5h 3P0ZA 3HT3A 1BIBA 1HQUA 2CUDA 5AZJA 1OV3A 3ZLJA 4O6JA 2QA4T 1VSDA 4CD1A 3QEIA 2YXYA 5EYPA 4ICLA 4PL8A 4BDYA 3UKRB 3GLXA 1RBVA 2W42A 4KBMB 3CD6T 2G9IA 4M7DD 4IOAL 2GELA 3ZT3A 4GV6A 1EXQA 1WSJA 3EYZA 4FJMA 3VKIA 4X34A 1QWFA 2R5AA 1FFXA 1YGYA 1NJIC 1PCXA 5B8FA 3M5AA 3EZWA 4HCCA 2LRQA 1BYMA 1HNZK 1S9GA 2AMTA 4RG2A 1Q82R 5MN4A 3DRRA 2HF3A 3H46O 4IEIA 3OJUA 1RLUA 1KQSM 3A98A 1YTAA 4F17A 1XMQK 1AZGB 4JKGB 4YOVA 1TVKA 1TWBA 3O1WA 1U48A 4FJXA 1M27C 3SV3A 4FWQA 3K5MA 4CF0A 2HHXA 1TAUA 5FROA 3SIUA 3X28B 3CCMA 2VWBA 2NMUA 3RYCA 5AQLA 1UG1A 5CCAA 1E3MA 2D8HA 1X7OA 1NM1A 4MMKA 2CSLA 5CVIA 1PSFA 1RUWA 1XOVA 2DRMA 3FB9A 4DBHA 4OKKA 3TPQA 4CHPA 1T03A 2JWKA 4K43A 2O2OA 1YNZA 4EIAA 2E20A 1D0ZA 2KQ2A 1BOTO 2ETJA 1BB9A 1IKYA 3DMJA 3LP0A 2NWMA 4NYFA 1M30A 3O5ZA 3HRGA 2ZE2A 2OCEA 4CJ3A 3DDNA 3OYHA 4ZHQA 3CC2N 2EPDA 2QXLA 1X25A 1QVPA 5DLQE 4FLZA 2VWFA 2QKKA 3LAMA 3CMAT 4NUTA 5IJ0A 1CZ9A 3CCMQ 2B5JA 4DB3A 2RHHA 1UI9A 3GHZA 3BUZB 3U9DA 5CKDA 4CZFA 2XDPA 1U45A 1JCEA 1NKCA 1YCYA 2O8EB 3ERNA 5JS1A 3M3ZA 4ZHWA 2LBWA 4IDHA 2XY6A 4KI4A 1JQQA 3HPWA 2K1SA 3RMQA 3VS5A 3E2UA 4EMKB 1Q82U 1GCQA 1GOAA 3AO1A 2O88A 4KGVB 1TL3A 5ELZA 3SBTA 2Z1UA 1SSFA 1S1NA 3M0PA 3V4IA 1HYSA 4Y28E 4DR4K 5I21A 2O8BA 2FBXA 3MP1A 4LF8K 5J1EA 3J8AA 4DTJA 4FYYB 5GADP 3CQTA 2UYJA 5CKEA 3P31A 1WHHA 2IOCA 1CSKA 4FWKA 3MN7A 1T3LA 3WQTA 2YUQA 3SV4A 1J6ZA 2EYZA 4XTYA 2QM1A 2Z1TA 3SHWA 4AHRA 3FD5A 1MMNA 2QK0A 1OZ2A 1TUDA 4TZZA 4F2RA 5BRDA 4FJNA 4KB1A 3SUQA 3RRHA 4BREA 3ZT2A 2DTIA 2VG6A 5KH6A 3EKSA 1X9MA 4PKCC 4A4FA 1H7MA 3AA2A 1OFUA 4JAXA 1PRLC 4BRLA 3HTRA 1OZ3A 3CEYA 1VIEA 3C65A 3UE5A 3VQ8A 1EX4A 1GBQA 1M90U 1PNJA 4BY6B 1X9JA 3AGKA 3I0SA 3CCJQ 4W5OA 3FFIA 1WBBA 4J2DA 2A3ZA 5KYWB 1IO2A 5MLCQ 2VCPA 2RF0A 3DLLL 4O4LA 2GVIA 3EFOA 4JK7A 4ZHQB 2QWQA 4FZYA 4N0AA 1VQNF 4CGDA 3JCMW 4WBNB 3O3FA 3J7AF 3FLGA 5TKWA 1YBYA 4MDBA 5F1XA 4BC3A 1K0SA 1G3WA 1TKTA 2R6R1 2UYPA 2KXDA 3CCEQ 4LF9K 4PFOA 1LOJA 3ELCA 2G8FA 4C0GA 4M4ZA 2I5JA 1X3NA 4JEPA 2FPDA 3VTIC 3FLCO 2G8IA 2P9IB 1YIJF 3CC7A 4KHQA 2VKNA 2Z0WA 3PFSA 2KYMA 4A59A 3E9FA 4HT8A 2CW4A 1VQ8T 4M7AF 3D7EO 1KFZA 2ZOVA 3VO8A 4JHDA 5GANd 1QVGS 1ATRA 1NGGA 5EAZA 1G83A 4RWTA 1B7TA 1YJ9Q 4LH5A 3CCLF 2JZ2A 2P9SB 1VQOF 4R56A 3NK7A 2QAZA 1K8AH 5AQWA 2FSJA 4FFBB 3PLAC 3CFPA 4BWJA 5LJ3d 1SDSA 5GAN7 3TSQA 1MMGA 1SKSA 3OA6A 1WJQA 2IVPA 4B3TK 1I81A 2H8HA 3CCET 3VQDA 1JXOA 4XQ3A 4H0YB 3WNGA 4YJ2A 1W70A 1NU0A 3CCVN 3W0LA 3ZFJA 5FU6C 1N27A 2QEXT 4PKGA 1PD1A 1TOVA 4NCGA 3RRGA 1ZWZA 3CYQA 4A2AA 4C8LA 2M16A 1ASUA 3TSPA 4BW0B 2MI6A 3WJRA 4C8GA 3CMAF 1HNIA 2QEXQ 5CR2A 3O6WA 2C0TA 3V81A 1YI2T 4O2AB 4QS8A 2AZVA 3PIOA 2LNVA 2QQAA 4M3UA 3D45A 3G71F 4IUPA 3C6UA 3OS0A 2LDMA 1QZ6A 2DL5A 2Q1NA 1LWEA 2GTDA 1I94K 4AFSC 3BDUA 5EG2A 3SEMA 4AHCA 4II1A 1UFYA 2DTOA 3AVMA 4M7DA 5EB0A 5EB1B 1Q82H 1TKZA 2DBKA 3UB5A 5D7UA 4BI4A 4OKJA 4BRMA 3CCSF 4KHYA 3HWUA 1VQPN 3CCEF 4OO1J 4UC4A 4F7UB 3FZMA 3OTOK 1FW6A 3P8DA 3CMAN 4AFZC 4X1YB 1U1SA 3NGYA 3VS4A 4CJTA 2D1XA 1IG9A 4CGFA 5D3GA 3O9RA 2P9NA 5LJVA 3L42A 4GVMA 3I3FA 2A3LA 1VUBA 3E19A 3P83D
chains in the Genus database with same CATH topology
5AZIA 1YIJT 3D2EB 3FZKA 2EQJA 4BC5A 2E8AA 5CHIA 3CCEN 4XTWA 4DA4A 3H1VX 4C92B 3CPEA 5JLFA 3QJYA 2YX6A 4ISEA 1KAXA 1BKBA 3M4YA 3VGKA 5BN8A 3NTIA 3I56T 2GQVA 1QVGM 4H5RA 3ME9A 2IVOA 5GIPC 5KPRA 4ILGB 5FJ4C 5E84A 2PFUA 3MEAA 2FSNA 3QUIA 2CZ0B 4N4IA 3SAHA 2L8DA 3EFSA 2UYTA 1Y71A 4EAHD 1HUXA 2QA4N 2QXFA 1JBMA 2VXFA 3SFMA 5HY6A 4H0OA 1GXIE 4XH5A 4M78C 4JJNK 5GAN8 1PSEA 3H3OB 3ID6A 4NL2A 3R9PA 2I7NA 1Q82O 5CQXA 1VQ8F 3CCVF 3I56F 1OKJA 2M0OA 2P9UA 2E64A 5GMKi 3GBTA 4EFHA 1RI0A 3L2WA 2A41A 4IUQA 2CGJA 3CERA 3MMVA 3V7QA 3RKWA 1UEBA 2OAUA 4J83A 2NNWA 2D0OA 2EIFA 3DB4A 3M9QA 3V7CA 4YOUA 2X4XA 2YHTA 2FC3A 4YORA 1G99A 3JCMQ 4BROA 4L5GA 4GY2B 1K73C 4C1NI 3VESA 5FRMA 3WT0A 4C8QE 5KPZA 4BE1A 2CGKA 1NLVA 4F7UA 5KCHA 4M78A 1U1TA 1BI3A 1KD1O 3CBMA 5EVZA 1Z6RA 2XKOC 1VQ9T 4QW2A 2KG4A 3HM8A 3IMXA 2Q0UA 1SQKA 1KG1A 5EX5A 2RHXA 5FU7C 4NB4A 3OYIA 3CCJT 4J6YA 3ZETA 4CZHA 4IO8A 3HOTA 5C6SA 4JRQA 1GLCG 1IG8A 1MGQA 5BPNA 3O85A 4A4GA 2LQ8A 2NRRA 5DM7R 3L2UA 2X4WA 4C23A 5AQGA 3GG4A 4QS9A 4ZN1A 5C0MA 2HAXA 4EMGA 5AQSA 2HBJA 3HAXD 3WEEB 1K8KB 1WUAA 2DIQA 3EL2A 3V3TA 4O5FA 4C8QF 2RB6A 5GANK 3M53A 4LDXA 4M7DC 3EFRA 3CCMT 3QZ5B 1RGIA 3DKMA 3SD4A 2R57A 3MK6A 3C94A 3SMSA 4RCBA 1Y96B 2P0KA 4XCQA 4BGAA 4L3QA 5IN1A 3TTCA 4BUGA 2P9LB 1X7PA 3RKYA 1YHQF 5M1FA 4QS7A 1S22A 2RJCA 3FE1A 3CCQT 2E2PA 3MX2A 2BKDN 2FHDA 3V7SA 3NVIB 1X6OA 2HBPA 2LT4A 2P9IA 3EKUA 1KD1C 3HFOA 1VQKN 1QVFS 2CH6A 3J81M 3ULEB 5GINA 2ZGZA 3WXJA 4X3LA 5AFUA 5CIUA 1K8KA 3G4SN 2X35A 3KXTA 3QJ6A 4X9CA 1BG3A 3WXIA 2G3RA 4M75F 3O4WA 2IIRA 4C0FA 4M75D 3VF4A 3CPWM 4JKDA 1NWKA 5DLOA 3LDQA 3M59A 4M7AB 2HOEA 5C12A 3A5MC 1XBIA 3VF6A 2RJDA 4KUDK 3CC4N 3LWQC 3G4SA 1YJWA 4NOYA 3A8YA 4B1YB 1V29B 3CCQA 5GANh 1I5LA 1KQ2A 2AA4A 2BUDA 4LD9K 4GVEA 1RFQA 1NBWA 2YHXA 2DZCA 3IFRA 3HP9A 1VQKF 4LDWA 3JCMd 4M7DF 3HSBA 3N5BB 2E5QA 1YHQT 3WXKA 4WYBA 3SWNC 2K4YA 5GAOr 5AZIB 5JVGL 1VQNA 1W2BA 4X3MA 4C1NK 1VQ9A 4ZN3A 1XNIA 1BO5O 1NGEA 4PJOA 3BEXA 3SJHA 2CZ1B 1W2BM 1WPYA 3CCMF 3HRUA 2CH5A 2ASMA 1EIFA 3M6GA 1BA1A 3CCUF 2J4RA 2W41A 2RM4A 5JICA 2FVUA 1VQOA 3HSCA 2E41A 2QQBA 5KQ8A 3TU5A 4IKFA 4EI9A 3JB9J 4BRGA 1B34B 1R59O 4XK8E 5LL6S 2RHKA 3JCMJ 4GV3A 2FL7A 3WXMB 4XTUA 4BRFA 5H1SQ 3JCMe 3PIPA 3FZFA 1QW1A 1ESVA 3CETA 2DTHA 3GL1A 4IO9L 4BRIA 4FU6A 1VQKA 2OTJT 3K9KA 1W2BS 4OB3B 3KZBA 4YTLA 4XAXB 4BD3A 3SMPA 4LD6A 3P8BB 3IR9A 4JLGA 3MO8A 1QVGF 5FRNA 2QEXA 2QA4F 3A5NC 2E12A 4M7YA 5IT9E 4H0XB 5AR0A 4PHTX 5EO3A 2EQKA 2K2VA 3LWRC 3F70A 3HRTA 5LJ5g 2H3JA 3UKRA 3EN9A 2OTLT 4HCZA 4PKIA 2Q0RA 3VEVA 5GIOA 2WSCE 3QBWA 1VQ8A 1KD1U 3CMEN 4J6WA 4ELYC 4C0DC 1Y64A 2O01E 1JJ2A 5AQOA 2XDBA 5LJWA 3O8VA 3CCVT 3E9PA 4BY6C 4IUVA 1U2VB 4DOVA 3CPWS 5TKYA 4E7KA 3TCJA 3O8MA 5J26A 5AQTA 4XH1A 3OW2F 2ZJQL 3AAQA 3T7ZA 5I2MA 2OTLN 2JWLA 4ISGA 4F7UF 4IJAA 3DLMA 4JD2A 4A53A 2OTJA 2XI9A 4JKFA 3CCRA 4BY9D 1KAYA 3LH0A 4WQ5C 4F7UE 4LDYA 2FF6A 3DWLA 2P9PB 1YITN 3G6EA 2QI2A 5AQVA 3A5LC 3QFUA 1M9SA 3CJ9A 1QVGA 4C8QG 5BRFA 1N8RU 2K5LA 1BA0A 3L4QA 5GANg 4E7HA 3CJAA 1NMDA 3G71T 3JAMM 4XTVA 4M7AE 3HBTA 3UPUA 4CD3A 4M75G 4L59A 3EAEA 5EY4A 1T3VA 5LJ3g 2F9ZC 2DD5A 3LWPC 1VQ5F 2XDDA 2W40A 3URGA 2JNGA 5GIPA 3OYNA 4JLIA 4ILJA 3RUXA 2E70A 4JKAA 3OY9A 3N4ZA 4IOCL 1MWMA 4C92E 3HRSA 3A0IX 1BI2A 3RVCA 5HY0A 4XU3A 2JN0A 3J80E 3OYYA 1LNXA 3VF2A 2EQUA 3CCLA 3D2FA 3MEVA 1QP3A 1RLGA 4N4GA 1YI2F 3LDLA 4RCHA 2QEXN 4FT2A 4NLBA 3HI0A 1N8RC 4I6MA 4ZTJA 1YJ9A 2RJFA 4J7IA 2FGYA 2EQMA 3L2QA 3G7ZA 3U8XA 1UGQB 4LDVA 1NJIO 2FSKA 2CGLA 1I4K1 4JUVA 2ZPBB 1YI2A 2P9KA 2JVVA 2RH2A 3M56A 2EWNA 4NLCA 4C92C 3QXEB 3DXKB 1ZBXA 4BRNA 2YJFA 4BR0A 4M7AD 3CG6A 4HTLA 1HLUA 2E1YA 1MHNA 5J39A 3INZA 3CC4F 1YHQN 4O8KA 3JRZA 3VEWA 3CCUN 5M1NA 2Q97A 4KH4A 2NRTA 3WQUA 1BU6O 3CC7N 3MDQA 5HL7L 3CCSN 4FWOA 3CCRT 4CZMA 3P39A 1FXXA 1KHCA 3KBGA 2ALEA 4RMOA 2RK2A 5GAN5 1TUYA 4A5AA 4BR2A 2ITMA 4DQ2A 3QZ9B 3JSCA 4JD2B 3CD6N 4MO5A 1E7KA 4N4HA 5LJ5e 4E7JA 1Q81C 5GMKh 4M7DB 1VQLN 4A54A 3TU4K 4JNEA 4MO4A 4Y91A 4B9XA 2F9WA 2QQ9A 3OYGA 3CCLT 4B1ZA 2YCHA 1O75A 5AQHA 3GOIA 1KC8C 5A2QE 3HZ6A 3MN6A 2DZ9A 3NMUA 4FWNA 4WQ5A 5C0YA 2IVWA 4A5BA 1JB0E 4WFAL 1LCUA 3GPLA 5A0GA 3JCMX 2HBLA 5ADXA 4RKUE 4C5GA 1YITF 1U8RA 4CZIA 4MDXA 2ZPFB 3SAGA 3NVKA 3BP8A 2KVQG 2ZF5O 2VGNA 3CC4T 3G25A 1CN7A 3JCMP 1H3ZA 1VQMT 3ER0A 1VQ9F 1W42A 4FL6A 1QQMA 4JKHA 4JKBA 3M58A 2CKKA 3I55T 1UGPB 3H1QA 1KXPA 2L3RA 2RHUA 4IOXA 4C92G 3PTAA 2I2LA 1VQ5T 1DEJA 2EAYA 3GNFB 1UGRB 2QTDA 1M90O 3AHUA 5GAGP 3H8ZA 5GAOp 2XIDA 1GO0A 2DO3A 2V52B 5GAMg 5GAOn 4CBUA 2FLOA 3VYHB 3CQXA 4DCHA 3OYAA 3CBPA 5M9OA 4JK8A 3QKJA 2K57A 3VEOA 5A0LA 3JCMg 4XTZA 2V8KA 4N0AC 3DXKA 3E9LA 2LCLA 1M5Q1 2E2NA 1S72N 4IZ9A 1VQ6T 2FXUA 5HOOA 4CRIA 2QTXA 2ZWHA 1NJIH 3JS6A 3C12A 4BR9A 3JB9D 1M1KC 2XD0A 3PLAA 4V2SA 1VQMN 1K8AU 2V8JA 3FZLA 1H1VA 4EI7A 3DXMA 1XTDA 3HL8A 2ZPIB 3DB3A 3RERA 1GLFO 2PQWA 3J7ZO 3CXCM 1VQNT 1NGIA 3GOXA 4BACA 1RL2A 2VGMA 2D0QB 4PJOG 4FSXA 1TYQB 5GAN2 3BFMA 1U6ZA 4M7AA 1WJSA 3VGLA 2KQWA 4EHUA 3PNWC 5J3BA 1VQ6A 5G4UC 1YAGA 5FPEA 4X9DA 2PVGB 4QQGA 2KLAA 1XUPO 4OMFB 3CJBA 1VQLF 3NVKE 5GAHP 3QDKA 2YHYA 3J7AR 4JKCA 1VQNN 3HKSA 3QIIA 3O1BA 2PUKB 4BR4A 4M78E 2M9UA 4H0TB 3OYFA 2DXTA 3J80M 3NFCA 3X20B 3OS2A 5GAOq 3VMFB 3CPQA 3LWOC 3B8AX 4CZJA 1ZHIA 2LTOA 3G4ST 3ID8A 5JMVA 3JB9F 3R6MA 3ZEHA 2L5QA 5AQJA 1WNLA 4QQ6A 1VQPA 1Q7YU 4YOYA 4E7IA 3LM9A 3LW5E 3QPHA 5AFUH 1MDUB 1YJWN 5M1OA 4AF1A 3OB9A 4H5WA 4IURA 1V4SA 3OQ5A 5FLXM 3T9NA 2RHYA 2VYTA 2RI3A 2O4XB 2K3YA 2QQRA 4A4HA 2IG0A 1T6CA 3AGRA 3LDOA 4MLEA 2E6ZA 2I7PA 3CJCA 3I55N 4IUUA 1N9SA 2EJGA 1VQ5N 5GAN3 5ADXH 4L6V5 1QQOA 3ZEUA 2RE2A 4CJ7A 3C7NA 3WVDB 1ZBSA 2PVDB 3BF3A 2QDYB 1KQSA 1MWKA 3A8HB 3ZX0A 3S6WA 3QO3A 5CQYA 3LWVC 2R58A 1YJNF 5CKHA 3ZBDA 2RJEA 3DLLA 1VQ5A 3D2FB 2NZTA 3MEWA 2DD4A 3FFMA 4H5NA 3NTKA 1KAZA 3A5ZB 5D6WA 3U9ZA 4BDZA 5AQPA 1VQON 4WF2A 1N8RO 3UT1A 3H3NO 2QWRA 1R8OB 5BPMA 3GP8A 5GMKe 4LCKA 2GFAA 1P92A 5FLXE 3G71A 1YJ9N 3OSSC 4TVRA 1C0GA 2ZPGB 1VQLT 4KH5A 1TUUA 3VTHA 3VGMA 4OPHA 3LWHA 3C6HA 5AQRA 2E1HA 1W4SA 3G71N 1XQHA 4RTFD 2A7YA 1JRIA 3E1YA 4ILHA 4ISFA 2BTFA 1K8AO 2DK3A 4HA8A 3AAPA 1DT9A 3CCJN 3LL3A 5KQDA 2YLCA 1VQ7F 2QWOA 4C0DB 4K42A 3Q7BA 2P9SA 4M7AC 4AM6A 3FGUA 4BVPA 4U67L 5I9EB 1YJNT 5AQXA 1KQ1A 4WFNL 3G6EF 3CXCA 4O5VA 3CIPA 5C2FA 3LLRA 2PAVA 2FF3B 4JS4A 3PIOL 5M1KA 3LDNA 1KC8O 4PJOC 2E2QA 2F69A 3VERA 2R5MA 3VPZA 1RDUA 4K25A 4FOIA 3WUHA 4HWIA 1ZXOA 3HTVA 3VEYA 3CCMN 3SWNB 3CCJA 2LX9A 2NRHA 3META 5M1PA 3E9OA 4JKGA 3BY7A 3FEOA 4A2BA 4C4WC 4PLIA 1GLAG 3JCMV 3AY9A 3O9QA 2OTJN 4OB0B 3CCST 3L2VA 4EMHA 4H0VB 1QVFA 1Z05A 5GAMj 5GMKm 5BREA 5HXZA 1YIJN 4IUTA 1YVNA 2WUSA 5HXUA 1KC8U 1QVFM 5B8HA 2KSSA 1VQMA 3CD6F 3QG1A 2E2OA 4PJOF 1HJOA 4BRKA 2KDSA 3NK6A 3SB2A 3P8HA 4YDUC 3TREA 3LX7A 3CCUA 2P9NB 1OI1A 3PIPL 3QBYA 3CJ1A 2LQKA 4M75B 3SLCA 1YJ9T 2V7YA 3PT9A 4FOEA 5E26A 1YJNA 1S72A 5G4VC 3QICA 2DEQA 1NGDA 2HSTA 4H5TA 4A61A 1WJRA 3FIFA 3CMEA 1K8AC 1YUWA 5HY1A 4GNIA 3CC2T 2MMPA 1NGCA 2KK4A 1W40A 2HVYD 2XK0A 5M1QA 5GANe 3C95A 4YOTA 4MZPA 2CZWA 4BQLA 4FL9A 2V51B 2WALA 1HKGA 1KC8H 4GV9A 1ATNA 1P8ZA 1WOQA 2MWPA 3L6QA 4WQ4A 1VQ7N 4C0ZA 4Z94A 1E4GT 2H3GX 4OPAA 3RA6A 3VEZA 3T69A 3CHWA 1VQ4N 3V8JA 4XU0A 1YF5L 5AQFA 3V7EA 1JCFA 2QWLA 1OVYA 3A8MB 4FWSA 4J8FA 1PXWA 2KTVA 2CZ6B 2KMTA 3RIRA 4WCEL 4FWMA 2X4JA 4M78G 2NRWA 1Q18A 2E88A 3QB0A 4C8QC 3IKMA 2OANA 1YITT 2EKOA 1K9MH 4DQ8A 2DXBA 3D6RA 4JN4A 1X3MA 3P4IA 2M1HA 1NE8A 2Y4XA 4J8OA 5AYFA 3MX5A 3I55F 4FSVA 2OTJF 1QHAA 1DJ7B 3F9MA 4B1VA 3G4SF 4M7AG 2OTLA 1OYXA 2AIFA 1BUPA 1NJIU 3RSEB 2WACA 2D6FA 4PJOE 4FWPA 1Q7YC 3IDHA 4JHDB 5A2QM 2ASPA 3O80A 2YRVA 3PMIA 3CCVA 2QA4A 4D6WA 4QVDA 5JVHL 2JUFA 4J6XA 2D4WA 3JXUA 2GFUA 4P5NA 2P9PA 2XU8A 5DM7L 3KHYA 4JK9A 3OSVA 3WEEA 5AQQA 2P4TA 4Y0WA 4A4KA 1KHIA 4GY5A 3V7RA 3VEXA 3CJ7A 4MDWA 3UWNA 2AP1A 2KTUA 1E4FT 2F7TA 5GANj 1N8RH 5CK9A 5GMKj 2PVOB 1M8VA 1W97L 4XH4A 4U7BA 3QSUA 3IUCA 1M90C 3VU3C 2DPNA 3QYGB 5LJ3j 1JJ2S 1U2VA 3CC2F 4CBXA 1N6AA 1O9SA 4H0PA 2ZGYA 3RMSA 3L2RA 2GWKA 2RK1A 4B9WA 2YJEA 3OYBA 1VQ7T 1O13A 4E1JA 4FWLA 4WF9L 2HF4A 1GLEG 3OYKA 3H6ZA 5JLHA 4KUIA 5DY9A 2PU9B 5DM6L 4BVSA 2D1KA 5AQZA 5FPMA 2MF2A 3SDZA 4BRCA 5LJ3f 1T6DA 3CI5A 3VETA 4CZLA 3A8GB 5GMKl 3P38A 3D00A 5GAPK 2A42A 3OBYA 5GANf 2GCXA 3SIVA 4KH6A 3PAFA 4KULA 3FZHA 2OZBA 1GZ0A 4FPAA 2HBKA 3KUFA 4AM7A 1VIFA 3OMCA 1TYQA 1KD1H 1AHJB 5EOYA 1Q81O 5DCVA 2DKGA 4O8UA 3OS5A 4OF1A 3CD6A 3ASKA 3K9JA 4CI0C 3DXMB 2PUOB 1T0KB 4EMKA 2P9KB 3VYGA 4OVAA 3JB9H 5FPDA 4BR7A 2DJZA 2MWOA 4GLKA 3EE8A 1NGJA 3HOSA 3BW1A 4FT4A 3SWNA 3PMTA 3OYEA 3V8KA 1D3BA 3CCRN 4K41A 2L89A 3QFPA 4NO7A 4C5EA 4C5HA 2C06A 3M55A 2Q2RA 1YITA 2A40A 1SZ2A 4ZGEB 4F9OA 4M77E 3CCJF 3OA9A 4HKEA 4F7UG 5GAMd 3Q7CA 4PKHA 3GYQA 3JCMb 1P90A 4OP0A 3GF5A 4B1XB 2NLUA 1QP2A 4FIBA 1B34A 2RD1A 4KBOA 1HKBA 4BRHA 2EJFA 1K9MU 3NVMA 3HHTB 2ASOA 2P0QA 2X4YA 2LT1A 1W41A