5LP6B

Crystal structure of tubulin-stathmin-ttl-thiocolchicine complex
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
428
structure length
422
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
molecule tags Structural protein
source organism Rattus norvegicus
publication title Tools for the rational design of bivalent microtubule-targeting drugs.
pubmed doi rcsb
total genus 154
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5lp6B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5lp6B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5lp6B01
5IJ0A 3VO8A 4EB6B 4I4TA 5EIBC 4DXDA 3N2KA 4X1IA 4B45A 3N2KB 5MN6A 1TVKB 4X1KB 4EI9A 3ZBQA 5LP6A 5JH7B 3RYHA 2VAWA 4O4IA 5GONB 4E6EA 5GONA 2XKAA 4I55B 5LA6A 4FFBB 1RQ2A 5LA6B 5IJ9A 4F6RB 1RLUA 4I50A 1Z5WA 1SA0A 1SA0B 2XKBA 3M89A 4X1IB 3RYIB 2RHOA 5ITZA 4ZOLB 5LOVB 4M8IA 4ZI7B 5CA1A 5KMGB 5CB4A 3M8KA 4TUYA 4X20A 3UT5B 5LXTA 3VOBA 1W5EA 2RHLA 3VO9A 4B46A 4U39A 4IHJA 5IYZA 4HNAA 5IYZB 1JFFA 1W59A 3JAWA 4X1YA 3WGKA 1W581 4O4HA 3JAWB 4O4LA 5J2TA 3WGNA 3C8LA 4IIJB 5FNVB 3RYFA 4DRXA 3WGMA 4YJ3B 5CA0A 4YJ2A 3R4VA 3RB8A 3RYFB 4EI8A 4I50B 3UT5A 3VPAA 4TV8B 4TV8A 4ZHQB 4WBNB 5JQGB 4WBNA 5JQGA 3ZIDA 5JVDB 5JH7A 4ZI7A 5CA1B 5KMGA 3N2GA 4EI7A 4O4IB 3JAKA 5EZYA 3WGJA 5J2UA 4I55A 5MN5A 4YJ3A 4YJ2B 5CA0B 2Q1XA 3HKBB 5LP6C 3HKBA 5C8YB 4HNAB 2VXYA 4IHJB 3HKCA 4F6RA 3HKCB 4KWEA 2RHHA 3RYCA 3RYCB 1RQ7A 4O2AB 5LYJB 4LNUA 5JVDA 4LNUB 5LOVA 2VAPA 3JASA 4ZOLA 3HKEB 3JATA 3N2GB 5LXTB 3JASB 4O2BA 4O2BB 1W5BA 4I4TB 1FFXA 2BTQA 1Z5VA 5IJ0B 2R6R1 3WGLA 3ZBPA 1FFXB 2BTQB 1TVKA 4O4JB 4U3JB 4X1KA 5LP6B 4O4JA 3HKDA 4XCQA 3V3TA 1OFUA 5JCOC 3RYHB 5FNVA 2R751 4IIJA 3E22A 5C8YA 3JATB 3HKEA 5KX5A 2VAMA 4TV9B 5JCOA 1FSZA 4ZHQA 3JARB 3VOAA 5BMVB 3JARA 2BTOA 5EYPB 3HKDB 2Q1YA 4TUYB 5J2UB 3JAKB 5EZYB 3JALA 5EIBD 3JALB 5IJ9B 4FFBA 4U3JA 4X1YB 1JFFB 1TUBB 2GVIA 1TUBA 4O4LB 5J2TB 2RHJA 4O4HB 5LYJA 5BMVA 4DRXB 4O2AA 5ITZB 3RYIA 3CB2A 5M7EA 5EYPA 3E22B 1W5FA 4X20B 5CB4B 5MN4A 4TV9A 5KX5B 4EB6A 1W5AA
chains in the Genus database with same CATH superfamily
5KAMA 2VNHA 3GRUA 3CVOA 5DGHA 4JDUA 3OZAA 1P5JA 1YNOA 2F8MA 3FGOA 1Z3CA 4OFXA 3P3NA 2VYFA 4KSYA 5HMLA 1G1AA 1XAJA 2QUIA 4CS2A 1AKYA 3NKVA 1KVSA 2CTQA 3NHYA 1V0JA 2AUTA 3V33A 2ERCA 4UU8A 3C45A 1Z12A 4D6XA 2HBYA 1LX6A 2YCLA 3OHPA 3JQDA 1QH9A 1XZDA 2W2NA 2PI4A 5DISB 2CXOA 3GLFE 2Q29A 4OAOA 4YTEA 5DW0A 4TM7A 4J2TA 1POWA 2J0UA 3FH0A 1LPSA 3GWKC 4JI8O 2OBYA 3FIJA 4BP3A 5JZVA 1MUUA 3M7IA 4XWAA 1IHUA 1Y8QB 2VT2A 5LOVB 2YW2A 2W2VA 4JJKA 4YMGA 1UZUA 4ESHA 2JJ1G 1RJGA 3LVBA 4ZO4A 5IUNC 5K03A 3DDCA 3MOGA 4EKYA 1K8RA 3CVVA 4UZFA 4M55A 4IIHA 5EP3A 2ATKC 2ZKOA 1FXWA 4OGWA 5FPTA 4IIJB 2RBEA 2XA2A 4R8LA 4TROA 4BVRA 2B5UA 4MINA 2ONJA 5AVYA 1G4UR 2O5CA 1AJPA 3T15A 5IZCA 4R1OA 1RBYA 3AY3A 4W8OA 4BLQA 1AP5A 3J7AR 2YI9A 1NSTA 2IC5A 1T5DX 1ORQC 2EFYA 3ANNA 4Q3BA 3WP1B 4DCCA 5ISMA 1AKQA 5L6MB 5ECYA 2AR7A 1BQZA 1L7EA 4JI2B 2E4VA 2GX6A 4EFDA 2Y4UA 2RJNA 1G63A 2OG2A 3LHDA 4NBVA 2OHXA 4UMFA 3SEAA 2PZJA 3NLLA 5EKSA 3QKSA 4PWZA 4J9YB 2NU9B 2AVDA 3GH3A 5KSYA 4GNRA 3TLMA 4UBOA 2REXB 1K2VN 2JLRA 5CDFA 3AILA 1KY5A 4MUAA 4FSHA 4X3MA 2ETXA 3HKBB 1E69A 4IIUA 8MHTA 3AJRA 1KC3A 3AHJA 2B82A 2N9UA 2VKQA 2ZOVA 5JO0A 3AIKA 5MGNA 1AKWA 1GV1A 1I3CA 4G0VA 3EFOB 1RC8A 1PV4A 3WWCA 5JS7A 2ZD9A 5HP8A 3L01A 1ESCA 1UZAA 1P80A 3HL4A 2SCUB 4G8BA 4QBKA 1EVJA 5IG2A 2VZLA 4UUPA 2VXCA 2AGVA 5LXTF 2ZQMA 1KNXA 4X0EA 2BL4A 3HWRA 2N0SA 3S1AB 2EBWA 3DWEX 4Y7DA 4LHXA 4DV3O 5IJAA 4LYFA 3WLLA 4GKJB 4GMDA 1UKVY 2C4NA 2PBRA 2VG8A 1RS0A 1VF5B 1G8KA 1XJ5A 3F6RA 3N05A 3EOBI 1I6LA 4BAYA 1R8XA 4NQZA 2P5OA 4X84A 3SNHA 7MHTA 3Q5EA 4CM9D 5I9TA 2K7ZA 3HV2A 3L7BA 3OCYA 3L5OA 2ZBEA 2J6IA 5DHFA 2PIAA 4MEAA 5EQFA 2QN1A 2QTOA 1I3OA 3CX4A 4IIXA 4OQMA 1IOLA 2AQHA 1IB0A 3L18A 5AHOA 5JAHA 5BMVB 2ZIZA 4L3OA 3RV3A 5A4FS 3MLAA 2BTOA 2OTLF 3O47A 4C78A 2QLLA 1M2FA 1VQKV 1J7KA 1QYCA 2BFFB 3O4IA 5CJJA 3VGJA 4AJJA 4F45A 1VECA 1T1GA 5K0LA 4CC6A 3OCJA 4YT8A 3MA0A 2XNCA 1Y3HA 1AA9A 1Y76A 3HFJA 3L8EA 4LBEC 2VH2A 1XU7A 4RWZA 4YV2A 1QTNA 3HVRA 1PUIA 1DHRA 1EDZA 3K71B 2V97A 3RYIA 4QTUB 1P1RA 1NMXA 3F9RA 3E22B 3LXRA 2PX6A 3N86A 3BREA 3I04A 2PHNA 3L8ZA 4HR7A 1THZA 5FADA 3WLNA 2V9YA 1ONPA 5ELLA 2BRUA 4US2R 1OCOC 2LO1A 2QI9C 1WVMA 4HP8A 2YZMA 4DXDA 1N2SA 4RWUA 4DR5O 3J80M 4TWBA 3N58A 4HJXA 4IJQA 2DHQA 2C2YA 5AH0A 2A5JA 2EGHA 4EEZA 1C30A 5B1BC 2YHSA 4OAPA 2Q4RA 3FZEA 1VMGA 3GBVA 1DIBA 1DBFA 1SURA 5F2OA 2GS9A 3EMBA 2LDBA 3C97A 4YFVA 4NBTA 4DWJA 3J7AU 2Q3FA 1VKOA 1E3TA 4X3PA 3A9TA 4FXPA 1SKAA 3EIEA 3PGKA 3LBFA 3M81A 3QQ5A 5IAJA 3M7MX 3EF0A 5AD1A 2CH7A 1V11B 5JNTA 2ZAIA 4AT1A 1GXSB 1W57A 2Y9PB 1USIA 3BSSA 3TD5A 5CA1A 1CB7A 2DHRA 1MX5A 1QYIA 3ABRB 4MUBA 4PR0A 4ZYXA 1NE2A 3MQWA 2XZTA 1T2VA 5JEEA 3EPHA 3K9HA 3WGOA 1HDZA 3T1YO 1UWKA 3AFHA 3K8QA 1EM8B 1C0KA 4FFDA 4LY9A 4RJKA 4KH1A 1WUYA 4HX5A 5LQSA 4Q3KA 1U7DA 4RELA 4JLDA 5JO9A 4B43A 2FYUH 4E08A 2I33A 2P22C 2YI8A 2XYGA 2CFRA 3N4YA 4GZRB 2B8TA 4FLZA 1HL3A 2X86A 1MSWD 1I7NA 3GZNB 2MJLA 3GLHB 3NWEA 4WZAB 5KTSA 3SYQA 2C7QA 3E82A 4DV1O 4WUVA 2ZRDA 3FOZA 4PPNA 1FL9A 1H5UA 3O4JA 4RPLA 2AMFA 5IDXA 1M2EA 4RVOA 1PQYA 1FU4A 4IX1A 4FM9A 3GFRA 3RBVA 2ZSJA 5IDWA 1KMHA 3ETEA 1L4EA 3NWJA 5JJKA 3NBYC 1KO7A 4B3RB 4NJMA 4DIKA 1Z22A 1XRLA 1G4HA 4HNQA 4I2VA 4KKXB 4WF9V 4WVLA 1TLFA 2F9ZC 2AJBA 2RK4A 4ER3A 1WBJB 1F2TB 1W47A 1Y3FE 1Y5RA 2IIVA 4XGNA 1RI4A 4EFLA 1BS1A 2VP9A 1NFRA 3G49A 3U80A 4EJSB 3VR1A 3E2IA 2DQ0A 1YR3A 2QYHA 2Y71A 3CR3C 4BKPA 1WY7A 4GWKA 5CVEA 3SDLA 1ZK2A 4D4JA 1M2HA 1CY6A 4W5RA 4XIYA 5EPEA 1VQMF 3PNOA 2Q4PA 4NDAA 2XTMA 3S5UA 4MW5A 1T5BA 1EM1A 1F4MA 1UZNA 3DBRB 1P0IA 4BO1A 1OX4A 4LJ8A 4K0KB 1Q15A 4J29A 3JD3A 3MOSA 5AKHA 2Q21A 2VYNA 4FMBB 2HXSA 2VPZA 3T4XA 3OETA 3T9AA 4F84A 5KVVA 2WSIA 4JAAA 1UJ6A 2UXDO 1W96A 2C2BA 3MWDA 2XT9A 2PFSA 3CY6A 3EAGA 4JR1A 1N77A 3WLPA 1W7AA 4MS4A 4MEJA 2ZRMA 4C20A 5ES3A 2DWDC 2FDRA 2R8XA 4D42A 5BMOA 3HO1A 5JDIC 4YB8A 4JYZA 2VPXA 1DIAA 1KYZA 1KMQA 1PJZA 3E7PA 2YVQA 2ZQZA 3X2QC 1PF5A 1SKVA 3H4VA 1FYWA 5T4FA 5J2UF 1JKFA 2CMFA 5LZ9A 3DC5A 4AMVA 2AN5A 4MVJH 4CDRA 5DYNA 1VCMA 1CUVA 3ER9A 2WNSA 1T4CB 2YV4A 3MZ0A 4I9HA 2CJYA 3IVRA 4U5QA 4WOPA 4HWTA 4ON9A 3ZGNA 3HN6A 5JNVA 4RIHA 1CE8A 3V55A 2IP1A 2W11A 1JEOA 1TQ2A 4GL4A 1JSRA 3JQ9C 1QXSA 1M54A 2GCGA 2QJOA 4L8FA 5EEHA 4EHBA 3WJQA 1U94A 2AYYA 4PE5B 4A8JB 4S3MA 3RSCA 2XUFA 2R6HA 4S2UA 2CZQA 1I4OA 2AG6A 4WERA 4PA9A 3V4OA 3LMEA 1NN1A 2O8DB 1JQJC 2R62A 4QOEA 5FTKA 2CT8A 4LC1A 4HLCA 4NUTA 1G21A 3AG2C 1QFXA 3WLOA 5CFLA 3AF0A 4W5QA 2RJ3A 4A8PA 3VPBA 3AEQB 1N4DA 3HI4A 1PGOA 4FIDA 5F1OA 1N8KA 3IOCA 3LC7O 3ICQB 4EVIA 2BKEA 3NOXA 4XOUA 1KP9A 3GT0A 1JQ0A 4J8PA 5F2EA 5FUWA 1G8FA 2CTPA 3TGWA 3TUJC 3UJHA 4ABTA 1S0UA 1ZL0A 3K5LA 1I30A 4ZCTA 4XWWA 4E0BA 1YZNA 2HF7A 3U7FB 1AR5A 3NXSA 2DYRC 1QS0A 3CS5A 4RLFA 4EA7A 1U2RA 1RACA 1TMYA 5A7FA 2BY4A 3OOSA 4KN9S 5C3UA 3RWRD 4PELA 5EC1C 1FP1D 5DBFA 3E5NA 2R8BA 2DWOA 4WKOA 2YV2A 4ZRNA 5TPZD 2WOOA 3H9CA 1GTL1 2G9IA 4Z0PA 3ZW7A 2C78A 3CCQF 1FSPA 4CR8A 1KJNA 3MCQA 4MR9B 3PN1A 1KKLA 1UXJA 1I3LA 3IGAC 4FNAA 4NAUA 4OQLA 4Q01A 4M38A 2ACEA 1R66A 5EP4A 4I50B 3L40A 3NAGA 3C6ZA 4R1NA 2IEDA 2QLJA 3UW1A 3W34A 3OP1A 1WKBA 4G0WA 3KQTA 2ATEA 4WBNB 1EMDA 1H3NA 4DG5A 3TQHA 5AJYA 1WZNA 3LE8A 1IN6A 2W4QA 1FQOA 2Q1TA 2ZIXA 4PO8A 4MP6A 1SXJB 3N5KA 2W6ZA 3PQDA 4M0EA 5EHZA 4JBYA 1H47A 1TJ3A 1KZ6A 1N0WA 3G2IA 4Q82A 5I3ZA 4JLPA 3GNLA 3KJNA 5GJVC 1TQ4A 2VDPB 1QK3A 3DE6X 3P9CA 2R72A 2DAPA 3BAAA 3KSZO 3N6VA 2BHTA 4ATNA 4YMUA 1V54C 1EIZA 1UBNA 4WKGA 3C6BA 2G7ZA 4HVLA 4RTQA 3FB8C 3T4DA 4OBBA 3K30A 1Z88A 3OCUA 3SHOA 1XZQA 3A3OA 3FOAA 3ULKA 1CR1A 4K1LA 2QBYB 3YASA 5ALNA 3AP2A 4LVNA 1U3TA 2BHRA 1P2VA 2BCGY 5IWAO 3C3CA 3PVCA 4Y2PA 1DF5A 1O57A 4QICA 3TJRA 5EBMC 4JNKA 4ZDKA 4L4ZA 4BIMA 2R4TA 3LDAA 1D2CA 1PS0A 2YWCA 1NVBA 1PSDA 3H5LA 1Q7YH 3B2EA 3E9QA 3LSSA 3IMCA 1KB9F 4OI4A 4OHOA 3GLHA 3WSVA 3ZV6A 4L0DA 2Z1FA 1VB3A 5JR3A 1OJHA 3IT1A 4BNLA 4DRYA 3W7UA 3LYLA 3BRQA 3G13A 3RS9A 2EXXA 1CS0A 4JI1B 1VJCA 2XVYA 3WMRA 3QNWA 3V7EA 1GTMA 2PT9A 4ZD6A 4DA7A 2Q4EA 1ZOIA 1OHHA 2QTTA 4RPCA 3G88A 1NT4A 2VXBA 4JI6B 3GCXA 4G5SA 3W8FA 2CJWA 4AWXA 1WMFA 2JAXA 1KMHB 3OIFA 3OU6A 4U6SA 3UV3A 4D0SA 2J30A 2VWKA 3ABLC 4H44B 3O75A 4EELA 3UUWA 1WY5A 5JE8A 3AVTA 5FL7A 5C93A 3L2OB 2PZLA 5K0EA 3UJ6A 5CCEA 4Y6RA 4JYPA 5FI1B 1UBKS 3L4SO 1IUPA 3WB0A 1CJVC 2H7CA 3LCUA 3Q12A 2R1TA 3AUKA 3VAZA 5LLDA 4RCYA 3DMGA 3JWPA 3ZX5A 1OB2A 5BY2A 3HB5X 3KZXA 1E1RA 5EE5B 2VBGA 2O3QA 4DV7B 1HLFA 2NV2B 3MJCA 3OQPA 4JBHA 4P93A 4JI5O 1WKVA 3LNCA 5IE9A 2NO4A 3QH4A 2YWJA 1FUKA 3FPFA 1AXEA 3KQWA 2D62A 2P75A 3LC0A 3HDYA 3HSYA 4JPRA 1TIKA 3CUSA 4Z7OB 4KMRA 4F4UA 5I7FA 2W6OA 3ZUGA 4FK5C 4B32A 1Y6ZA 5EJ4A 5L9AA 2IUFA 2HPAA 4RO2A 1PZGA 1RMYA 2WAMA 3DGEC 3GB9A 3KZ1E 4D8UA 1F8XA 2XZOA 7YASA 1QR9A 2EJRA 2ATCA 4R8MA 4UHEA 1WA8B 3HCPA 1YJAA 2FFAA 4EA8A 2ACKA 1QMGA 5IY5C 2NM0A 2WVHA 2GM5A 3FWPA 2JLQA 4ENUA 4MPRA 1D1SA 5DLDA 4F6EA 1Z6XA 4MMYB 2W8BB 5TISZ 3QEKA 4OPAA 1UMBA 3INTA 3EA0A 1ZL8A 2E82A 3LHSA 3QA9A 3UPDA 3BH7A 2XLCA 3JQGB 1IMJA 5EHGA 1NXTA 5E7IA 5FBZA 2QN2A 1Q0HA 1TM5E 2J9XB 1LU9A 1LJLA 3DGEA 9LDBA 2AOTA 2JGKA 1IN1A 4NX2A 3O9OA 1XO1A 3LRXA 3IO3A 4P98A 1FQWA 1WHSA 1XLTC 1RBQA 2AHOA 4PINA 4YHHO 2ZGVA 3ZNNA 4RHEA 3OT7A 2C59A 4CKEA 3C1OA 4DR2B 2Z8YM 1SD2A 2H3EA 3TW8A 5L51A 1P9LA 1TEXA 4MQLA 4D0GA 1PZXA 1JXQA 2CYBA 4DLNA 1XK6A 2ZM6B 3VTIC 4DJEC 1DAEA 4I4IA 1IRIA 2HRZA 3FY4A 2PKCA 1GZ4A 1GVNB 3ILYA 4NJEB 3BE6A 1JA0A 1RIIA 3V6LA 4V03A 3ACCA 4JL6A 1OBCA 1QOPB 1RJ9B 3SX2A 4DMGA 2JD1A 4DV2O 4ZEMA 3RSFA 2GPBA 3FHOA 1LWOA 3AK3A 1LX7A 1RMTA 1VP9A 1W1WA 4M1YA 4M9RA 4ND7A 4LSWA 4CI0B 3RYCB 1RQ7A 4GX1A 1E1DA 4OPHA 4I4CA 1FVHA 1G6UA 4M9QA 5IARA 1JG1A 2IYFA 4KU4A 5H9WA 3ZLJA 1ISMA 4QOFA 2VP2A 2ZXWC 4GU5A 4YCDA 5G3ZA 4AN4A 3AKDA 3CIOA 3ONWA 2HQSC 2FEWB 1EUCB 3IB6A 3O8OA 4MJLA 3PR2B 3BF7A 1XNHA 4B40A 4CG0A 2JI4A 3QVLA 4C0HA 4I5DA 2WAOA 4W7SA 5D87A 2CL7X 2O52A 2ZSFA 3AK2A 3HR0A 2WWRA 3M8AA 3VDRA 5JADA 4B4UA 3AEUB 1CUWA 4KQIA 4FD3A 2NQTA 3OKFA 3DD1A 4MVYA 2BHLA 1UPGA 1COZA 1N2ZA 4FQ7A 3QKRA 1M1YB 4HNRA 3IQHX 2QVBA 3TW4A 3LIIA 4LVUA 4WLEA 2F95B 1SXJA 2Z5VA 4TS9A 3E5RA 4MV4A 1DRVA 1FDSA 1XEWY 2GA8A 2GLZA 3E8SA 3OE7D 4GZMA 2X7RB 3KLOA 1SCUA 2GYYA 4FEGA 5D3KA 5JV5A 3HM9A 3IPLA 1BX1A 1U3VA 3A1EA 1R5OA 4DCGA 1S9HA 4YASA 3CCVF 2KE5A 4GECA 1CJTC 5CJ2A 2PJDA 4Y2HA 3W6NA 2MYNA 3OZDA 1HYBA 4R1PA 4LE0A 2OBLA 1IPHA 4EG8A 4EB6A 2J6HA 3PT9A 3SPCA 2GCNA 2RB9A 4AMZA 1Q86H 1OD6A 1SU8A 2DWQA 2X9VA 2QTWB 1E99A 3O8NA 3QUSA 2WHPA 2VRNA 1H6AA 3GZTB 4W5JA 5HFJA 4CW7A 4EJ2A 4NMWA 1ADCA 1SXPA 4U7FA 4LRQA 1OOEA 4OGGA 4TQ9A 3GP8A 5EC2C 3A2LA 3QEMB 1NMYA 2J46A 3OFJA 3LZDA 1JAYA 5ESXA 1D4ZA 1FVOA 2RHRA 1LEHA 2GHYA 1FS4A 1V3UA 1DWUA 3IEKA 1KO4A 3TPFA 1Q7YW 5LD2C 3LA8A 4AJIA 1OT5A 4CWAA 3LI2A 2KI5A 1SY7A 3ACBA 3D81A 3DEZA 4R7ZA 4LV8B 4YP6A 1JJIA 2J5XA 4GUNA 1YH3A 4Y6PA 1QZUA 1P4GA 2X9LA 1PYDA 2YIJA 1ILWA 3QUAA 3JQGA 3LKBA 3M4ZA 4J9UE 1Y63A 4YPVA 4LJ5A 4RDHA 3WQQA 5AQEA 4X1YA 5IKMA 1U3PA 2WLJA 2FKXA 1YZTA 4H35A 4DM7A 1K9MW 4E3ZA 4FFSA 1ZN9A 4MQMA 5F7JA 1X1QA 3CUVA 3KOMA 2GZSA 1V9PA 2NZJA 3CGWA 3JWGA 4DMLA 1CQZA 2I7TA 1HF3A 2LDXA 3HCOA 2FJUA 3ZY4A 3RT1A 1SZTA 1Q0PA 5B55A 2ENUA 4S05A 5ER6A 3LPCA 4K1XA 4BBJA 1B0AA 2WJ4A 3DDSA 2JZNA 1VL6A 5LB4A 3S27A 4B48A 2YW9A 1ORDA 5K0GA 4LXQA 4HCJA 2ECOA 3LQFA 5P21A 5F7OA 5LQMA 1OAPA 3TLKA 1PFVA 1VJ0A 4BNTA 1M1NA 4BPRA 4N18A 4DEXA 1R0LA 2O8NA 1M56B 1JG6A 1XHZA 1PUXA 1Q20A 1ZITA 4QBTA 5IMBA 2L82A 1R4NB 4ZVSA 4ANFA 3D31A 2F1KA 3JAMN 1VQNF 4ZVQA 4K8RB 3TO5A 2AMYA 2Y05A 1X25A 2Z1TA 5K3FB 3KKNA 5EJ2A 2V3WA 1VLVA 4WQMA 4NYMQ 3H75A 4G4YA 5LBUA 4MQ5A 5TQJA 4CIVA 2DLCX 2JAUA 3ASVA 3DDZX 1XFDA 4Z2YA 3L46A 4YAEA 1ZI9A 3AP3A 4O2BB 1Z6PA 2IPMA 4NR0A 1CK2A 2BH2A 1FFXB 1L3IA 4DEVA 1RRKA 3MHSC 1XXLA 4RJJA 3U62A 3UT0A 4N12A 3PXEA 4C5BA 3HADA 3P0FA 4RGYA 2RHGB 4MKIA 3FG9A 3LK7A 1HFJA 3IV9A 1E9EA 4TM8A 2VS0A 1RMQA 1ORVA 2X15A 4DJ5X 4M22A 3STZC 4MW1A 1CS4C 4PIPA 1WBBA 1GYRA 4B4WA 1KPGA 1GKKA 3MJ4A 1E2UA 4Q5IA 5AJZA 5FOWA 2XCOA 5BSRA 4B3DA 4BUJA 4YQZA 5A4MS 4UOZA 3LT4A 5E2AA 3VR4H 5CDTA 1Q5OA 4GEKA 2IU4A 3OZXA 2ZROA 4BFYA 3EFFK 3PHCA 1N8SA 1M8GA 1EFVB 4LCBA 1ECLA 1SGWA 1K73W 4WKPA 3ZR4B 2OZPA 4CN8A 1ODTC 1G3MA 2NYRA 3P20A 1WCYA 1C9EA 2P9CA 4BGVA 1XXHB 1FFDA 2IELA 3K70D 2YYEA 4QLBA 2JFFA 5L3EA 2ZR8A 3DV2A 2Y4OA 4HEA6 1E4YA 1K9MH 1MOPA 1JWLA 4NSNA 1DXYA 2F1MA 1ZMXA 1K89A 5KNBH 1RLIA 3BFKA 3BK2A 4EVSA 2H65A 5EYPA 3OQIA 3UATA 4F21A 4PDVA 2ZRNA 3NPAA 4IH1A 1RLUA 3N0XA 3O1IC 4IOLA 5DM60 5HXUA 3QVGA 2AZXA 1JDTA 2I3AA 3T1HB 3T7KA 3VYTB 1P4AA 2JVKA 5KA5A 2KPOA 4YRAA 4BVEA 3OZTA 5A02A 4EI9A 1VPDA 1DIGA 1JTVA 2A7XA 2CBXA 2CK3D 3G2MA 4R2MA 3RS2A 4CLHA 5HP7A 1Q17A 3TBFA 5BXYA 4MVRA 3IEMA 2B99A 5GONF 4EHHA 1LLDA 2RJZA 1X70A 2OAEA 4B82A 4KBGA 3AVUA 1QNMA 1RM3A 5D01A 3CR8A 4BLPA 1MZPA 3FYIB 2EWCA 5CM8B 2QMZA 5C80A 3C87A 4X1IB 1Q19A 4NMXB 4WESA 1V43A 4OGLA 1HZJA 3RSSA 3BA8A 1B8OA 5KMGB 2GXSA 1NS1A 3DEAA 2ZUDA 3P2YA 1OBHA 5F5XA 1N1DA 1NV9A 4XRRA 4P86A 3S40A 4E2YA 5HJEA 5AW1A 3S8EA 1A04A 2VBIA 4NNOA 2OZLB 3KVRA 4MYHA 1ZLZA 1QZXA 3PDJA 5FX2A 5L95A 4YAWA 1U7TA 4K26A 4OQ4A 5EG5A 1KOLA 9GPBA 4C06A 2X5JO 1DMRA 4D3DA 2I99A 1VIMA 1MU0A 1ISPA 1I6MA 1NQ3A 2XMZA 1UPBA 2ZTUA 2NO0A 1CRLA 4YCMA 3U3MA 3FYTA 4NI5A 4XD7D 1TCUA 4J0DA 2IYVA 3HB0A 2YYYA 4PQRA 5F64A 5JDCA 3ZCTA 4Z8YA 3O7WA 1EDOA 2GN4A 3TXYA 1ACMA 3HEMA 3UJNA 1DIRA 3RFVA 5JQGF 2ZB3A 1N6IA 1QVWA 5L3QA 4Q7KA 2FOIA 3U17A 3PNPA 1BXRA 2F1JA 1UK8A 2PGOA 2OV3A 2PZSA 2C04A 3ZN2A 3U0ZA 2NZYA 1UXHA 1ZWLA 3SD7A 4FGUA 2B20A 4D98A 5BR4A 4DIBA 1X1RA 4RVFA 1A27A 5T64A 4TYQA 2RI6A 1Q3EA 2I1QA 4LJ7A 3CU5A 1SCJA 1ZYUA 3KR2A 4MAFA 5EIHA 3EFBA 2M6KA 3C1UA 3DF7A 3VR6H 1ICIA 1MIOB 2BTQA 1M3SA 2NTYC 2Q9AA 3KWLA 1G2OA 5HE8A 1ISJA 3U31A 1R1DA 2OCCC 4H9GA 2G9RA 4B08A 3TUIC 2INGX 4RIIA 2BR3A 4ZGBA 1H2AS 3SZLA 1X0XA 2JVDA 4YJFB 1E61A 1N9GB 3BMCA 2PSEA 1Y9AA 2GD1O 2HJWA 1SKYE 1Z5OA 5ENVA 3I9MA 4HPWA 2XSZA 4V39A 4BVFA 2W8ZA 3HM2A 3ESXA 3UYLA 3WB9A 1GTRA 4G1VA 3KDPA 1RXCA 4CQNA 3KVVA 2C7VA 4HTFB 3MBKA 4NBLA 1BU5A 1F60A 6YASA 1GZ5A 1XTZA 2C94A 3QJGA 2W70A 2VK2A 3U4CA 1GU1A 5BR8B 4G4XA 3OPNA 5BYJA 3WYCA 5KWVA 2FLWA 4MQ4A 2ZB2A 5F12A 1YFJA 3IYLW 3PJFA 1ZVVA 3F0EA 3L9XA 3H6KA 4OP3A 4KOAA 1UC8A 4JT2A 4LV6A 1SM4A 1I2BA 1KTVA 2ZJOA 3TZEA 2PUGA 2CSLA 1UEXC 3AO0B 3HJFA 1K4MA 4XD7A 5I48A 1GN3A 1JCHA 3TTVA 3DWIA 5A6SA 1ZNWA 4B3HA 4K9RA 4N47A 1SQGA 1FFGA 1E5VA 3CG0A 4FX2A 4PBSA 1GUAA 4RNCA 3TMAA 1RP7A 2WSMA 3HXMA 5AW4A 1E2JA 4L51A 4FHCA 1JDSA 2FWNA 3V3KA 4BAGA 2GXUA 4MCIA 1C0LA 3PUIA 2KTVA 1Q77A 1X2BA 1R4MA 2H7XA 4D4MA 3Q11A 1VG9B 4FMDB 2IXGA 5JFGA 3C8UA 3T61A 4NBUA 4R16A 4LVOA 4YAIA 2H2DA 4PZ9A 3VI6A 3OZCA 4P81A 2B1GA 4QYTA 1GGEA 3DCJA 3TRJA 3DMFA 4Q7EA 3MAJA 4OXIA 4WZAA 3JV7A 2IYNA 4D43A 1KI8A 2BSKA 5DCVA 1KJYA 3BTOA 4MUXA 3K53A 2FEPA 5GADl 2VJOA 1E58A 2PGAA 1GVHA 2MMCA 1NE7A 3NBQA 2HDNB 4OHUA 4RW0A 3NHKA 5JC8A 3FPGA 4BAZA 4V0OA 4NNPA 2I71A 4C04A 3ZWXA 5ESRA 5EHQA 3FF4A 3KB8A 1VF6A 4UARA 1U5BA 4ZAYA 4NE2A 5KLVH 5B4UA 4KXLA 3F6YA 3OKCA 4FGLA 4NBRA 3RIHA 4ENVA 4CIWA 4NFHA 3LJKA 4KUEA 1LPMA 3LYAA 1MAVA 2PUFA 1FSFA 2I4RA 4MVJD 1AKUA 2ZZKA 1DSSG 5LHIA 1VE1A 3EMKA 3IUEA 3BN3A 1C3LA 1N7GA 2ADOA 4UM5A 3UTDA 3VZQA 3APOA 4OVKA 1UT6A 3RIMA 4EKIA 2Z8XA 1HLDA 4Y1FA 3AB3A 1KBZA 4NOLA 5JPCA 1D6NA 2F1RA 1CHDA 3NUGA 3KE8A 1CRPA 1MA0A 3KZOA 2VHWA 3RTCA 3KQHA 5KBYA 3PUXA 3GGPA 3UOGA 4NULA 1M7BA 3OE4A 3DO8A 1ZCBA 1YVWA 4A8JC 1B3QA 3O3CA 1L4FA 1E94E 3IA2A 4ZO7A 2A57A 2PUTA 3H2SA 4Z9AA 4BRZA 2POCA 2OBBA 4G0PA 1SZCA 2QRUA 1Y74A 3FM9A 3VOSA 4OV6B 1W35A 3WMWA 1E2MA 1KHHA 1Q95A 3BXOA 3Q9SA 2BGGA 2GBOA 3RYCA 5DWDA 1EGHA 4QVGA 3STWA 2QIPA 3CZCA 3DXXA 3SKYA 5ES4B 3T3HA 3GVCA 4CM7A 5C1DA 4FJ1A 5E79Z 2VPWA 2JVJA 3MQ2A 4O0MA 4NLLA 2IGTA 1ONIA 1W4ZA 1MORA 2JHGA 1PG5A 3I01A 3MWKA 4L0MA 4EEQA 1QB7A 3RA5A 2YL2A 3FPEA 5I4KA 2AD1A 3L7IA 1CZRA 4J2OA 1SDSA 5C7YA 3RYHB 1JFRA 1N8NA 2L2QA 3EBOA 5JTTA 5EZ6B 1Y37A 4WXRA 5I7WA 4CEJB 1ZH8A 2AOVA 4HGOA 1DKPA 2WTUA 5KX5F 2WNIA 2XAHA 2UAGA 2I3GA 4B44A 1H8EA 2FMTA 1PZNA 1MSDA 2B2CA 2XGMA 4Z4EA 1JDNA 3X2FA 4JT8A 3AJAA 2VF7A 2VDMB 1BWSA 1I4EB 3EGXB 2CLKB 2DCMA 1QU7A 4NOKA 1M93A 3LDDA 3DZ8A 4G1EB 1G291 3GGSA 4OHBA 2DUMA 5L3QB 5EWJB 2WI8A 2XD4A 1Q7CA 3TD4A 5ALJA 3S1AA 5JPDA 3BPSA 1WU8A 5CDGA 4PR3A 1SC4A 2WFLB 5E1BA 4F71A 1O03A 1ZVKA 2FJPA 2PLRA 5FWXB 5LC1A 3UMCA 3EFOA 3KTAB 3WPXA 1QCCA 1ZRNA 2G5PA 3EARA 3PIRA 3QPUA 3DC2A 5EIFA 2OBNA 4RPKA 3LQYA 1KQ3A 3VSBA 1DFHA 1KFCB 1NI8A 5HY1A 4FZVA 4G67A 4UE6A 1C7FA 4JDPA 4UCRA 2IWRA 4M0LA 4XPIB 2BFBB 4D8VA 3EJWA 3RTGA 1B0ZA 3X1ZA 2X6AA 4KX3A 4LX0A 3DXFA 4EVRA 2DFLA 3AUSA 2V3VA 5E9JA 2V6IA 5AK4A 1EJ0A 3UT6A 4AKTA 3PXCX 5TQ2B 2Y92A 1Y1LA 1NQWA 2QPAA 3MUFA 4BP9A 4URUR 4URWR 2HWUA 2C61A 4BNMA 4GHWA 3C9SA 4AO6A 4XVHA 4EHDA 3CCQV 4G37A 3ZNQA 1B6SA 3CKKA 1ETHA 3NYQA 3JD2A 1W85B 3GYBA 4QC2A 2XQKA 1QR8A 5E1DA 2VGNA 3WRXC 5IULC 4KFCA 1IPFA 1KY4A 1QQ5A 1RI5A 4FMCB 3V42A 3GDFA 4MUJA 2XDQB 5BOVA 4JI7B 5ALLA 2DUNA 3TTTA 1Y1KE 1XROA 3VZBA 4YUYA 4U7DA 2GSWA 2GKGA 3MPUA 1KYXA 4U7TB 3TIVA 5A62A 5F98A 2HL6A 3FUCA 4UD2A 5IYZA 4FILA 4QFBA 5A7HA 5DN9A 3HMQA 3G2LA 3VR3A 2E9SA 1YOVB 1JG7A 2E1RA 3GLIA 1RRFA 3L7OA 5HWSA 1E0SA 2H5JA 3I6BA 3V4SA 1Y6XA 3QE0A 3SQDA 1B2RA 3FR7A 4FYVA 4X60A 1I1QB 3KKKA 1O6FA 1YVRA 4N5NA 3ZY5A 4TL8A 5IM5A 4TV8F 2I55A 1HNXB 4ALIA 5AG2A 5BWNA 2WWHA 3E89A 2A1IA 1W0KA 1Q1QA 5D6NA 2BFEB 1R4MB 4K6OA 3ELDA 3ZDAA 2R1ZA 2C97A 3IEVA 2AH5A 1YF3A 2E7ZA 5H80A 4F3TA 4UCTA 1GTSA 3GEMA 3GL9A 3WU2Z 3OD4A 4ZIRB 1DBSA 1JEAA 1GN9A 4HTAA 1EM8A 2QL5A 2WICA 3EYAA 3P96A 3PJGA 1COWA 2G72A 1GM9A 4TXJA 5LYYA 1FDTA 2XUQA 3KCQA 4R68A 1R3DA 2RHHA 2JJYA 3HUEA 1ZUIA 4MQFA 4D79A 3SQMA 2A78A 4Y18A 1AUXA 1N9KA 1RFGE 3C7TA 4EQZA 2JFXA 3WXBA 4ENQA 5I5GA 4PPFA 3DWFA 4Q66C 5L3RA 2PMBA 5DEDA 4JOCA 4KREA 1RWMA 2QWRB 3DL7A 3LKDA 5CK5A 3ZJVA 3A9CA 4P0QB 1EGMB 1JIVA 1U3GA 1KY3A 2LP4Y 2DYRB 4YJGB 4OP1A 4RTMA 3R7SA 2C54A 1V35A 2IS1A 1XZHA 1PWZA 2YWGA 3G7NA 2BEUB 1BJTA 2Q3DA 2RH5A 4M54A 3DZBA 3ICOA 4HDNB 4NV3A 4XR9A 5KUTA 1G16A 2HX0A 2G0NA 3I9NA 4JKIA 4IWXA 1CP2A 4M1ZA 3VUEA 2IYQA 3M5PA 3DKPA 1SC1A 4OXQA 4PZZA 4RANA 2YVAA 3KSDO 4TTIA 2Y1DA 5AVOA 3PJRA 4DJDC 2YXEA 1R8QA 2ODTX 5KVQA 1NW6A 3BDAA 4RESA 4YALA 5ALZA 2G40A 2VSXA 4NDNE 1QVAA 5IANA 4CKEB 1GILA 4PZEA 4BBPA 1SCIA 3QYFA 4FDVA 2Z1MA 3OEHD 4WFQA 4MOWA 3WLQA 4ZHWA 1G7CA 1ZVQA 2BSKB 2I8LA 3CJQA 4B6PA 1ZUD1 2CXXA 3ABIA 4H0FA 3SIXA 1LUWA 4TLEA 3K58A 3PUZA 5B3AA 4TQGA 2M32A 4BQPA 2JARA 3DE5X 4U9HS 4ERHA 1LC3A 1OYYA 4LTDA 3ETDA 1OCZB 1Z4LA 3LCVB 1KWKA 1IQRA 1KU0A 2EBFX 4Z1VA 1JH8A 3NHMA 4KXVA 4PIVA 3VPXA 1K3FA 4AYWA 1U0OC 4ZPJA 3SYKA 4EY6A 3OW2F 2JBAA 3UMMA 1TAHA 5F51A 1BA3A 1R4AA 5ALIA 2OWOA 4M8LA 3K9QO 2E37A 1RJEA 2FVXA 1MVLA 2FUEA 5IFKA 1ODEA 1M66A 3CMCO 5HSGA 5EE1A 5L3ZA 4RWEA 3N7TA 3ZS8A 1VQ8F 1J07A 1O4WA 1WV1A 3LLMA 4CPDA 3SYMA 5GY7A 2Q2OA 3IMFA 3SEQA 1QC5B 1P2TA 2G09A 3BZBA 3GVIA 5T41A 1ZMOA 3KS9A 2HRCA 4OFWA 3S8MA 3MTAA 3GNTA 3AG1B 4IWYA 4AP6A 1C9KA 2V4MA 4YRFA 1CSEE 2W93A 1KI4A 5REQB 4BMOB 1RQXA 5EINA 2J09A 3G23A 1Y8RB 5E3IA 4YO8A 4F11A 3MT7A 3JRXA 2Q3CA 1O8CA 2HG5C 1CLIA 3C8LA 1Q1EA 3VIUA 2Z2KA 2YIAA 4PA3A 2HBQA 1U0BB 1VQLV 5IAOA 4KL8S 4KQMA 1ES9A 1VQ1A 1N4AA 3JPWA 4WCFA 4BVLA 4LJ6A 2V8OA 1VJ1A 5JRJA 2PFGA 2WAAA 3H1IH 4XASA 4QJIA 3WYBA 4ZVRA 1Z15A 1A88A 4UUQA 2VI5A 3LWRC 3LY5A 4J4TA 4YMSA 2QTSA 5JH7A 5KMGA 4J7ZA 1MD9A 2NZUG 1T13A 3PYLA 1M0TA 5LSAA 2O8EA 1K4YA 1SEPA 1YL7A 3NGLA 3CJTA 1E64A 5CYFA 4BYMA 2ZVZA 3E9DA 3E2EA 4YJ3A 2B1JA 3IURA 1S8NA 4NAHA 1PR4A 3FSJX 1QZTA 3M3PA 3K35A 3THXA 3SXUA 3K1ZA 1QIDA 4CH6A 3WZMA 4A1OA 2FWMX 1H94A 2G8LA 2WU0A 3RWOA 3T7DA 4YUXA 4KN8A 4LNUB 1I10A 2XZDA 3QNUA 2QPTA 3OZGA 3W5HA 5TPWA 4EQ6A 4TXHA 3HTNA 1R6KA 1J0BA 1ENZA 1JHUA 5JIBA 3HG7A 1ULSA 1D8TA 4E3WA 1YCGA 4P9PA 1C2TA 2NT3A 2E4AA 4LY0A 3SXPA 1L7AA 3O3NB 5D85A 1IB6A 3G5UA 4GPD1 4LC0A 1UP7A 1KAQA 3MSCA 2A4MA 2PUEA 5A3JA 2SNIE 2VJBA 2O8VA 1HE4A 3LWOC 3CCVV 3F5MA 5FYQA 1SAYA 4Z1MA 3VR6A 3RGWS 4BNVA 2C29D 2XD9A 1S3IA 1RKBA 2VJQA 2XCQA 3BTSA 4QG7A 4C7JA 4Z2AA 5AXAA 2HV8A 3NHZA 3CHYA 4RMHA 1QRUA 1Y3DE 3URMA 3O2SB 4ZK7A 4KXNA 3N0VA 1IIRA 3QBDA 4UULA 2TMYA 3VHRA 2HHAA 1AN9A 1Q7TA 3ZK9A 4GBGA 3B8NA 1HYHA 1OFVA 1Z73A 2O7NA 3OU7A 3R9IA 4DADA 4DE5A 3U61B 2N75A 2PS3A 4Z2WA 1Q81H 4B6RA 3CNHA 5AM3A 3PQ5A 3WNZA 1E2BA 2HU8A 1RPOA 3JVHA 1YU9A 1GUZA 3O8DA 1R9JA 1YXMA 2NPFA 1KAOA 3PKIA 4GAEA 1EVKA 2CMHA 4CLOA 3PWTA 3ZVMA 1SC3A 4CKWA 5ETJA 4WFGA 1T29A 4JU9A 4ARZA 4BCDA 5CITA 5KJ6A 2GERA 4X24A 1NUUA 4DA9A 4XWYA 3VO8A 4KFRA 2PTMA 1KMMA 2JAWA 1JQBA 4PPYA 2H0AA 4ZXFA 3MLEA 3IDFA 4YRLA 1G2QA 2XGSA 2PSFA 3AI7A 3EZNA 3NR7A 1KZGB 3LF2A 3ZBQA 4EHNA 4GI3A 3T1OA 2R2GA 5CXQA 3CH5A 3GJ6A 1H85A 3MELA 3AESB 4TS3A 5DLEA 4R9SA 3T4UA 3VR5D 4ZYUA 2D5BA 2DZDA 2B4AA 5EJEA 4RQEA 1NI3A 2GTSA 2C4WA 1JVBA 1DWOA 4DV5B 2Y2VA 3FHJA 4MB6A 1A9PA 4GLBA 5K1PA 1FOEB 3FZNA 3FYUA 2PF4E 1E3IA 3QEJA 3L1VA 4HWGA 4OEHA 3IEWA 4WPGA 5KTPA 1GGNA 1WS6A 4O2RA 1DC3A 4O1HA 1KXJA 1RI3A 1SR8A 1JR3A 1SHLA 4GMXA 1I5YA 1XZEA 4FI3C 4CKBB 2JA1A 2OYSA 1R5BA 4C87A 1B8UA 3OHMA 1H8HD 4Y2JA 5TMDA 3P4EA 2VSQA 3HBLA 4QRIA 3RS5A 1DBQA 4E5MA 1JFFA 3JAWA 3IFSA 4Q9HA 4A1FA 3DKVA 4DB2A 1RT9A 1WPRA 1XVIA 3ID6C 3A4MA 3ZLVA 4WKNA 1VGQA 4UHKA 1S7GA 1UJCA 3ESBA 3OSUA 3E70C 1B74A 3C6MA 5SYAA 4HK4A 3GJ4A 1R3JC 4TV8A 1V1RA 1KETA 3E8BA 1UPTA 1Z35A 2GYUA 3O3OB 3L02A 2VQDA 4DC0A 2R66A 2FU5C 4QXOA 1VQMV 3U3XA 1P2GA 3W2FA 3EMVA 1YKFA 5JCZA 2PUCA 1EDDA 1JN0A 2NSHA 3QHAA 4KE6A 3JAKA 3SJBA 3UO2A 3JSXA 1XOIA 5DTQA 5JBIA 3C8DA 4DUZB 3L6RA 3LFHA 4LY3A 1XX6A 1ZUHA 1ZXBA 3KB1A 4WRRA 3USES 2QM8A 3OBBA 2FC3A 1MO4A 3V6MA 3W1VA 2GEBA 5FKJA 1DEOA 1XMSA 3MINB 4QGHA 1LVHA 4IDOA 3FCEA 3NUQA 2ESRA 4R8VA 1AXRA 3OFNA 5DXJA 2AXQA 3EVCA 2PKRA 2FFHA 2MK3A 3Q7EA 3KOYA 2D4HA 1RQPA 4LPKA 3OG9A 1UBLS 4KPGA 2WJJA 2IOHA 3I76A 4DCPA 3VBEA 4A4DA 2BMVA 2GBFA 2PT6A 2VAXA 2IJJA 4IP0A 3ZN1A 2ZJ5A 3ETLA 5HFNA 1TQHA 5KHHA 2HLDD 2HMYB 1F7UA 3K70B 1C1XA 2BZ1A 1ZCJA 3HBNA 4B8YA 4D9IA 5BQFA 2WFAA 4F92B 5KQRA 3BULA 4Q3DA 3ZKWB 5BYBA 3O73A 4U2CA 1D0IA 4X63A 5LFAA 3B20A 1OFIA 3GNQA 3QELA 1I2ZA 3HXQA 3GHHA 2IIPA 1X8JA 2PHZA 3IAAA 2HWYA 2QMHA 3AUAA 4LYEA 4BV9A 4DMFA 2P7TC 4UV9A 5ALWA 4OBWA 4RPGA 4NRDA 1I36A 3O8RA 2QT1A 2HPHA 5KWJA 5KJCA 4OX9B 3EGIA 1Y6FA 1PAUA 2IHYA 2KWIA 4MROA 5G0WA 2ODWA 1YULA 3ISVA 3JQBC 3RW9A 4HNTA 2IP2A 3QK7A 4MVJE 3HJNA 1H2SB 4H6PA 4IDCA 3T1YB 4MGZR 5CXSA 2XB4A 4FCTA 1Z2DA 2GAOA 4UPDA 4ZT4A 1L1RA 2NGRA 5BWLA 1N5KA 4Q4HB 4V0NA 3HU2A 4YUVA 3GDGA 3E1KA 4RY9A 2PBZA 4KO4S 4FWTA 2V6BA 2BEKA 2XMQA 5PGMA 4CV1A 5CB4B 3EVEA 4DT1B 2WP8J 4JI8B 4FJCC 1TF7A 3L4BC 3L7LA 4WASA 3I9LA 1M6YA 2ZPUA 3NC0C 4HJRA 5KNBA 1NPDA 4MLZA 3JAMA 1KGSA 4IYRA 1LS6A 2HA0A 1CDEA 2QTPA 3F47A 3FWNA 3Q3EA 1SBQA 1GFSA 5AM2A 2PAAA 4H18A 1XKTA 2CXHA 4YC7A 1ACJA 4HLUA 1HMPA 1U2DA 1IN7A 3QG1A 4FGSA 5JY1A 2EJ7A 4J76A 4I9FA 1XQYA 3FTPA 1B15A 1BXGB 2E5LO 1T24A 3GRPA 4Q3CA 3UJAA 1A9XA 3VH2A 4UNQA 3AB8A 2CF6A 3M6AA 2OTCA 1OV4A 2PX2A 1U0LA 5B66Z 4Q16A 1O9GA 4QPZA 3RVSA 3UMSA 1I2CA 1IULA 2C9DA 1I01A 3K0AA 2BGJA 3PR3A 3QJ5A 4XD2A 5B7QA 2Q27A 4COOA 2MQEA 2HO5A 4U3FH 3KAKA 1GCGA 1ZW1A 2AEJA 1NBAA 4YDSA 5JNLA 4LH6A 1ISGA 5DO9A 3VJMA 1O97C 3TE6A 2PQ0A 4LHSA 2QYTA 3DHYA 3MRVA 2OP1A 3JVDA 2J4FA 2RHTA 5CNJA 2UYNA 4Z6KA 2NVUA 4Y1GA 2WC1A 2LR0A 4O4LA 2WJZB 3SFTA 2QWPB 4B6EA 1D5NA 1C0PA 2ZF8A 1JZTA 4Q4CA 4QPKA 5JU6A 3GUCA 2OYCA 3CYQA 1O08A 3IBGA 2I78A 1ZHOA 1NM5C 1FNCA 2YN4A 3MIIA 3CLVA 4LFAB 4NAVA 4LFAO 3FD8A 3S2IA 1LR1A 2XWPA 4RZXA 3QW2A 4K9LA 4GMHA 4BZQA 2YHIB 1QLNA 2TMGA 1DKRA 1M90H 1E5TA 1KP3A 5B6JA 4EHAA 3R3YA 3I2FA 4N0QA 3IPRA 5EXXA 1XWWA 4J0JA 1M8JA 3IOMA 4Y1EA 3M1IA 4BS9A 3HLTA 4ZQBA 4EAAA 5HUJA 2OHFA 4BVAA 1S77D 2GDSA 5DNAA 2YHUA 4Y0VA 2H4HA 4FM2A 4DAEA 2R7NA 2PZGA 4A73A 3G59A 4ZQEA 3PD7A 3MPOA 3IKMB 3C3TA 1SXJE 1T9CA 4X88A 1DUVG 4IGEA 4IXDA 4R1TA 2LBXA 3R77A 1CQWA 3FCXA 4HQNA 3NBXX 4XTCS 3R74A 3H1JH 5CFMA 3CC8A 2RGXA 4OJYA 1UEJA 3TIXB 3SJUA 3T6KA 4OH1A 3QRWA 1LXCA 1EINA 5EY5B 4DR6B 4R40A 4JGSA 1T1SA 4DR6O 3MC1A 5CT5A 5A4JA 2I1LA 3BQ9A 3O26A 4MIYA 4Y6GB 5ALMA 3Q8KA 1L8QA 1YRHA 3EOAI 1DRWA 2B34A 1IJBA 1G9SA 4DXAA 3D8NA 3H9QA 3E9ZA 4IOJA 3GMIA 4FZ3A 4ETNA 4FGZA 4BFWA 1Z3IX 5DBIA 1YZYA 2PH1A 1YBAA 3JYNA 4KLCA 5IS2A 4L27A 3BERA 5EJ9A 1U9YA 3RU7A 2HK7A 2DH6A 1JVMA 1GWNA 1NP3A 2H92A 2PJUA 4NJMB 2NMUA 3WAJA 1BXZA 2X8LA 3B1ZA 1THGA 1O6ZA 5JS2A 3UW3A 2OZLA 2WYIA 3H8VA 1RWOA 1AUOA 3Q9NA 3A3YA 1J0DA 2E3JA 1MX3A 2Y1KA 1V16A 1JOYA 1GNQA 1ZEMA 2JJ2A 3HXTA 4EG7A 3BXFA 4TT3D 1NTMH 4WE3A 5J9FA 2ZU6A 1E63A 2AHYA 1MQ8B 4DKXA 3ZWAA 1LNQA 5JYEA 5J1SB 3DNFA 4X6UA 4XM1A 3A1FA 3KYBA 1NVGA 1XT6A 4BCCA 1TC1A 4JYAO 2XDAA 4L8JA 2L26A 1K0FA 1ULUA 2G88A 4CF6A 1WB9A 2XGOA 1FTGA 1SQVH 3KT3A 4EYOA 3DXYA 1D3AA 2A67A 4AUKA 4TWAA 4CKZA 1KK2A 3N28A 1EWKA 1ZQ9A 4UDXX 4ZQFA 1LBSA 3JZAA 5E6SA 4QM6A 2JJMA 3FI9A 3I0MA 4W1QA 1GPYA 2R25B 1ZM9A 3B6ZA 4ZVOA 3SMVA 3B7PA 3U3KA 2DYSB 2CWWA 3IODA 1CUCA 1U8XX 3PENA 1M8PA 2IH3C 4KI0A 3RJ9A 4J3NA 3AT1A 3QVVA 1FLAA 1E2PA 5AM0A 4TYNA 2Q99A 3UCSC 1KAHA 4IDNA 4YRMA 4GKJO 1Q11A 1XN4A 5GPBA 4CQMA 3ZDZB 2JGMA 1XXHA 4PFKA 5IKXA 2HHJA 1N8RW 2FGJA 3KTDA 4EFNA 1NQ5A 2BPOA 3AY6A 1JVSA 1T4BA 3OM1A 4TLDA 4TSRA 2J0SA 1OZHA 1NR1A 1XHLA 2J5QA 2HH9A 2ZRHA 3KIZA 3AR8A 2E5LB 2NT4A 3QWIA 2QP3A 1NQAO 1X52A 5F4BA 3P0RA 1I13A 5DWVA 1D2AA 3MWEB 4RA6A 1DE0A 4B6FA 3U19A 3DYIA 2FQYA 2JL1A 4I8XA 4NYKA 3QYJA 4OQZA 3BEDA 4R98A 4DQ0A 3VNVA 3E2MA 4RZSA 3W2HA 2AIRA 3RSQA 3BMQB 3HYCA 3Q7SA 1JIQA 5CT4A 3GFBA 3WYNA 3ZHZA 3ZY2A 4BLVA 3PC4A 2CE4A 4JX9A 5H83A 4QTZA 1DTWA 5KYXB 1FNMA 2XWSA 2P30A 3JVVA 1T1JA 4C1NA 1E2FA 5B8FA 3DJYA 2EDAA 1COWG 5CA0B 2H0QA 2Q1XA 2CK3G 4ZCSA 1U40A 4C0BA 1QQCA 1P17A 1RYNA 2OWDA 4ZP1A 5K09A 4GMKA 5JBNA 1RC1A 3HZRA 3TZBA 1VJ5A 1GK9A 1RE0A 3ECSA 1LFDB 1HDGO 3HMKA 4ISCA 4EHIA 4UTVA 5JVDA 1X4TA 4JLUA 3JATA 3T52A 5JHHB 2B7BA 3EGOA 3DL0A 3W8NA 1AR4A 2A0UA 1PQ4A 4Q93A 2J3MA 5BQOA 1NP6A 1WPXA 1PYGA 1FP2A 1SU7A 1T91A 2V5VA 2B2NA 2BGNA 4KCGA 1MZVA 1UOPA 2BR4A 3GK3A 3N70A 3NIGB 1Y1QA 4ZZ1A 1Z06A 4BECA 3K9GA 3KQVA 4YXWD 5AVZA 1H2LA 1U1GA 1ZN8A 1G3UA 3CRZA 2P65A 4IDGA 2VHVA 4YR9A 1IVYA 4K9MA 3U7GA 1C41A 1FBTA 4C5AA 3S3XA 2WSSA 1DG1G 1VMKA 2XQFA 2IZ1A 3BMNB 1MPXA 2BFBA 1VKJA 4UMEA 5CEFA 2W6NA 3R76A 1COWD 4QRHA 4RJLA 5AK6A 2OM6A 3AG7A 2DH5A 3FTDA 4H6VA 2OY0A 3RODA 4B7KA 1SB9A 2EKQA 4J1NA 3NBKA 1G55A 1XNGA 3D6VA 1GQFA 2HI0A 4M46A 4AY5A 3M49A 3K5IA 4IQ4A 1N32O 4U2EA 2H7YA 4PDMA 1A8QA 1RM5A 4PPQA 3E3OA 1B16A 4CFZA 3MMZA 4JTAB 2ZSHA 5LU9A 2ZE7A 1IG3A 2QZ4A 1LLUA 3BL8A 1SZDA 1UDCA 1IWBB 1X13A 2FZ4A 2I2AA 2YWRA 2Z5GA 2RB5A 4IXWA 4UVIA 4B0PA 1Z16A 1M1YE 2A5FA 2B5OA 2BE9A 2C2XA 1NYLA 1A8SA 3CLSC 3L8HA 3PNVA 4YHHB 4F1JA 4RC9A 1GAWA 2QG4A 1UT8A 3G4SF 2RH4A 4IVPA 4TKVB 3QVMA 4Y2RA 4F8JA 1Y3BE 1UFOA 2Q7DA 3P45A 2HCFA 2VJLA 5KVAA 4JCOA 4ITUA 4K2HA 3B89A 3NJ4A 2RI1A 1FDUA 2CJPA 4ITVA 4KNWA 3VR4D 3WWOA 2AEMA 3DAPA 3W9SA 2CV1A 1TRHA 4E14A 1UXKA 2X1VA 3MMSA 5FNVF 3X1YA 4FZ1A 3IOEA 3SG0A 5C37A 4ZQCB 3QF4B 4WZBE 2Y0IA 3UV7A 2JNWA 5JMOA 4V0SA 2AX4A 4I1RA 3OUTA 4HLNA 1LPNA 3WLTA 5JQWA 3STXA 2HJHA 1U02A 2HSZA 4PVCA 1W49A 4DVGA 1YZVA 4UBNA 4UHJA 1DB3A 1Z45A 3WAKA 1KS2A 1E66A 4PC7A 5DLQC 1RYYA 4YGXB 1FTSA 5TT1A 1IAQA 2JRCA 1U0JA 1MPTA 2X9GA 1M6VA 3LCMA 3LNTA 4WACA 1YJCA 1SETA 2YMLA 5AHKA 4UFZA 4GLLA 3B48A 3U44A 2XQJA 1DEXA 4UMDA 3RUPA 1FW6A 2I4TA 4TYPA 5AHWA 3LCJA 1ADFA 2PU5A 2XWQA 4BB6A 2VT7A 3HJGA 3NYIA 4GR5A 5BQ3A 1EFCA 2X5XA 3ZW9A 5DB4A 1MT0A 2H5LA 5HCIA 1XVLA 3C70A 4J10A 2IXEA 3S02A 3KK0A 1WUTA 3OF3A 4H1WA 1RP1A 3OPQA 5FFMA 1W44A 2EIMC 4CZZA 1I5XA 1C3JA 3FLMA 1YRWA 5E2BA 2WHRA 4KQXA 1TUEA 4AZ3B 3C1TA 3O65A 3I42A 4D0NA 4Q20A 1NVDA 2P27A 3FFAA 1ZUNB 5J3JA 3FOCA 3OICA 3HB1A 1I7FA 3FTQA 5G2OA 1IUKA 2PXCA 2WD7A 1BJRE 2WTEA 3IQZA 1RTTA 5DZSA 1Z26A 4B3IA 3W2GA 2C5LA 4QGBA 4G4WA 5ICSA 3N2NA 1IHPA 2QGZA 1HGXA 1H2XA 1YA6A 2HSDA 1CUEA 3DOIA 4B5KA 3OZSA 1Y5LA 3RJZA 2GVDC 1WUKS 5TMBA 1RAAA 2OCCB 3BFJA 5A0FA 3ZS9A 4NJEA 2WFZA 2QL9A 1IUOA 1OYWA 1Z18A 4QSMA 4KDRA 1RJ9A 3S2UA 5KYVA 4DLAA 4RTPA 3RBZA 1WSWA 4LY6A 1TE2A 4FHFA 5EKTA 2JB9A 3CX7A 4R31A 2Q0SA 5ILOA 2Q1SA 3TRIA 3FLAA 2DJIA 1D04A 2NO1A 4RD0A 1WBDA 2FCAA 3ZOPA 4XWTA 4BNJA 1WM1A 3GARA 3PS9A 4K88A 5CGQB 3GUUA 2HWWA 3ZV4A 1RAFA 2NXEA 2PUSA 3AVQA 3LC2O 1XCMA 4UZEA 5AW3A 5KJ1A 1PNMA 1MNQA 4CF5A 3JRWA 1XTPA 4LE2A 4Z0TA 3H5VA 3R7BA 2O8CA 2I2DA 4GPIB 2I1WA 4R2XA 4EG0A 2B5WA 1JIKA 2OV1A 1IJEA 2W6IA 1IK4A 2E4YA 3ESDA 3K5MA 3PNLA 2H3HA 2OHVA 1IOZA 1JXAA 2ZRBA 3CNEA 4QFDA 2VDQB 5B1OA 3A11A 4X6YA 4JAVA 2G8NA 2G04A 2HDOA 2IJGX 1HE3A 1WP4A 1V3TA 1YCFA 3B12A 4HVCA 5JAOA 3CUWA 4OP2A 4Q9DA 3QVJA 4B3CA 1K8AW 1FMJA 1JBEA 1THTA 1NZ6A 1SD1A 2XH8A 4QQRA 4WZBB 7GPBA 1E77A 1ESEA 2HHLA 5H5NA 4UJ5A 3WHPA 4X20B 3WKDA 3RLFA 3VR2A 3SFVA 1UBRS 4R9VA 2ZT9B 1AS0A 3AL3A 4FLWA 3QF7A 4MVJA 4Y8VA 4CMAA 2PKWA 4M7RA 5UKDA 5JZ9A 1WF3A 2A2ZA 4FYPA 4DSAA 2IPLA 2Q73A 3I28A 3OCWA 1P3JA 4IHKA 1T2NA 2AZ4A 1K3TA 5H4HA 5EL0A 4C0XA 1PJSA 4J16A 1QRRA 4QRDA 3UB3A 1PFYA 1F4NA 1SC5B 3E35A 4GOOD 4LVCA 2ZEJA 2CV0A 3CV3A 4JI4B 4POAA 4EEXA 2GXAA 3R7NA 1Y6QA 1L4GA 1P49A 4MVJP 1E9VA 4MGYR 1Y3AA 1NHGA 1KMIY 3M89A 1M9NA 2ACVA 2I66A 2WD8A 4L2IA 3USCS 1JFTA 1AX9A 3LWZA 5DN6D 4RTSA 2EINB 3BC1A 3KXPA 1VQPV 3AZOA 3AM3A 2EYQA 3CE9A 3HJRA 3PX2A 621PA 3KU1A 2NVBA 4HAUA 2IEGA 5AI8A 3LT1A 1UBGA 4ETWA 5KTOA 4Z4QA 2OCHA 1U0HC 5TQVA 5BT8A 2Y6VA 4HXFB 4QE9A 3H5AA 2ACWA 2J45A 3Q1LA 1EZ4A 5EMNA 2Q2WA 4UATA 4CKXA 1GUFA 3HE3A 2QRGA 1USWA 3TR0A 2IP4A 1GQYA 1CVIA 1IXSB 2C5EA 2FWPA 1T1EA 1CLUA 3GA5A 3SYNA 5HKKD 2Z6UA 3T5GA 1X9HA 1CUSA 4BYGA 2CFCA 1N6HA 1JJVA 1MVOA 3R5HA 1OROA 1J9GA 1ML4A 4L5YA 2UYCA 1C9DB 3HCDA 5KSPA 4AS2A 4C01A 1QGAA 2BEWB 1UDAA 1G8JA 1DPFA 1P0PA 2G25A 2JIPA 3F98A 3KPUA 2LJ2A 1K06A 4C82A 1OIWA 2R96A 5ALDA 5IZ4A 3DZIA 1N6PA 1M0EA 4WECA 1O87A 3KLBA 2D3WA 1C50A 3SQLA 1OLXA 3TF5A 1S3SA 1DK1A 2I7XA 1YZHA 2Y1FA 2WBLC 4UU0A 4CCYA 3VO2A 2QLMA 2XUOA 2MU1A 5KTTA 5M04A 1ZD8A 3IEIA 4ZV9A 4QVIA 1EJBA 4XWKA 3RTAA 4G2NA 3KFVA 1TTQB 4FXOA 4XB6B 3DLTA 4BU0A 4AAYA 3L04A 4OU4A 3FDZA 5HKOA 4I5GA 4BMNA 1V8OA 2I8AA 4FEAA 2X4LA 4AULA 4KR7A 1DX4A 5CLGA 3T9EA 5HOQA 5I8ZA 4IJ6A 3QPBA 1QCDA 5KZMB 2R86A 3QNEA 3T1HO 4H17A 2VJKA 4F3RA 2QRNA 3MTGA 3CN7A 4BNZA 1XL6A 4CLRA 4MVCA 3HK2A 2DEUA 5TARA 4PHZA 2AZDA 3BS4A 5AIAA 2CEKA 1J0XO 3AOEC 4TKUA 3QPDA 1ZVJA 3LP6A 2E4UA 4HDOB 4LK3A 3O85A 2OILA 3DMPA 1RWVA 1NATA 1QLEC 3BFPA 2BP7A 1J33A 1NLUA 1S72F 3IAEA 3TRFA 1X7PA 3FFMA 3KHTA 2CNDA 3LC1O 4KBFA 4N21A 3LFOA 3FNFA 4M76B 3MUEA 3NH9A 3B5EA 4PYQA 5DXFA 5EA2A 3AIMA 1VBKA 5B1SA 1KQFA 3E83A 1UK9A 1U5BB 3T9BA 1UWLA 5HQTA 2RSLA 4EF4A 4J1TA 3RS3A 4A10A 4BC0A 2BGWA 1K0UA 2P3QA 2YS7A 3W3AD 3WSWA 4RL6A 3TECE 1IOVA 1SESA 1QAMA 2FMLA 3FCSB 4JZKA 3NTQA 4H0CA 5T3UA 3H1BA 1UMCB 2NSYA 2Q2QA 3ZHVA 1WCIB 4EFBA 4KR3A 1L7RA 3OUFA 4P3OA 3BHMA 5HUQA 3I5YA 1OCCC 3O4VA 1R6NA 2NSDA 2OQIA 3TEMA 1QYVA 3DNMA 1GV0A 1NN3A 1ECPA 2JIRA 4BUZA 3OCCA 4X1KB 2A1UB 1AOXA 3C7KA 1PJTA 1II9A 4FI3F 2NZ8A 5J4VA 5HFMA 1FEZA 5AICA 3FWKA 3MTBA 4O1MA 3UHOA 2J07A 4MTGA 3ADOA 2VWHA 3HFGA 2NO5A 3NRJA 2CBZA 4HFNA 3SS9X 4B6QA 3IXMA 4WLNA 5C4MA 1IY8A 1OLUB 5LA6B 2XYVA 2C84A 1L5MA 3C5WP 3MJRA 1Q0ZA 2AR0A 3FBAA 3O8BA 3JYCA 4FIZA 1BGYH 3SPGA 1M0SA 3ZRWA 1K88A 5FT9A 1JY8A 1WZUA 1JAIA 3COJA 4K9DA 2MIIA 4IJKA 1NTOA 3ZPXA 3IP8A 1WUIS 4DVJA 3HAXD 3WI7A 5CW2A 2G38A 5ILGA 1EHYA 2YQ4A 1NMUB 1W2BF 4XVCA 1SZQA 1BROA 2WOJA 3PJSK 2CHEA 5KHIA 3NVIB 2WJHA 2ZRPA 1S4MA 4C2BA 1TA8A 2VDKB 4ZHSA 2AQIA 3NQ41 4PLWA 1NTKH 1AE1A 2WUDA 3CGGA 4JP1A 2NVUB 3EORA 1QKJA 2PNJA 4GS5A 2QX6A 5H5JA 1K2WA 5B1DA 3FB6C 1XNRO 2V74B 4DRXA 2XUHA 1VLJA 1MABB 1OLOA 3ZWKA 4EGAA 4W99A 1ZN7A 4P7JA 1SRYA 1Z37A 4Y2UA 3PX7A 4ENSA 4GE3A 2VJMB 4BVKA 1E1QA 2MSCB 3AY0A 4D96A 4JUDX 3NBFA 1DOHA 1L8XA 3WJAA 5FLEX 3DHWC 4R1MA 1U6JA 4JZ2A 4WBSA 3ZK8A 3ZVNA 3MGKA 3T34A 3KEQA 5MGBA 5CG2A 2VXYA 4KO3S 3ZP4A 3OT4A 3VV3A 3WG7B 1C9JA 4KWEA 3LLCA 3QKRB 5EWMA 4FSXA 1WJZA 1AA6A 3AKYA 3WFZA 1KC8H 4HPJB 3D7SA 4DA6A 4CF7A 4A6PA 2P06A 4PA6A 4EGSA 1XI1A 3L1HA 4L4RA 1PR5A 3DCIA 3GD5A 3NKFA 3PUYA 4XIFA 4H4EA 3RC2A 3UXEA 4WJKB 3B2EE 2GK6A 2J3QA 3PBKA 2EFJA 3QM1A 5BN5B 2QVGA 3P0JA 1KDOA 2BHNA 3BHIA 1KZ9A 4GO1A 5KVSA 2CJFA 1U0GA 5AW5A 3RJMA 5KYXA 3HSKA 3T3OA 4WFBV 2Q6AA 4F0JA 2O05A 2QHXA 4JUBA 1XKQA 2O4UX 2F43G 4QA9A 1HDOA 3BEOA 2QTVB 1YACA 2ZVDA 5D5QA 1UH5A 1K9SA 4AQYB 1UKZA 5DOVA 3TR5A 4DMKA 4ZCRA 4ZK6A 2BP7B 2QLTA 5KDOA 3PGLA 2Z3VA 3IMEA 4BFUA 3JYQA 4C7MA 3PF9A 2PG3A 1KH1A 1UDBA 2P5SA 1YC2A 2SICE 2X6TA 5G02A 1LK5A 3E5MA 1AGYA 3I1IA 4EO4A 4FHEA 1SCUB 2W98A 2XRZA 2GF9A 3W9UA 3R7LA 3T1CA 1FJGB 1PTKA 1ZH2A 3PJEA 4XQ9A 5SZKB 1RHUA 3HP7A 3UB4A 4AUNA 1PP9H 4URZR 2Y9MB 3TB6A 1MO2A 3PZBA 1SQSA 1YTFB 4KPFC 1OAOC 1V11A 2OKGA 2EKPA 4KXXA 3ES9A 3HY3A 2DG2A 2EP7A 4NP6A 5CCDA 1PU2A 2YXHA 1V4VA 1WXXA 2JZCA 4BE9A 5TIIA 1Y6JA 2VNIA 3CF4G 4G5YA 4TYMA 1NMEA 4AKSA 3F5QA 3RW0A 2QM3A 2O2XA 1K1EA 1OWNA 2X8JB 1D5CA 3FPSA 4IJMA 1JHVA 1BS9A 1H2WA 2IS2A 1AUVA 2VHJA 3ABSB 3O83A 4QDTA 1WUHS 1ZNZA 4H3SA 5K0TA 4JP3A 3C7DB 3M6WA 3U9TA 4AG6A 6ADHA 4YJFA 3W5AA 2EAUA 1C8KA 2FF5A 3P3PA 4JASB 4LWZA 4PANA 3OQ6A 4YV1A 4DKJA 2FX5A 5DM2A 2CYAA 4E7PA 3IT3A 4UCWA 4UCFA 5G0SA 1OREA 4P7GA 3RUHA 3CCMF 1VQ7F 1HRKA 3JQRA 2OAQ1 1YJBA 2LD4A 4Q05A 3SJAC 2JAQA 3NVKI 4NTXA 3MINA 4W4KA 3DM5A 3LKVA 1J8YF 5CYPA 4M1TA 3RARA 3W9BA 3LSUA 2AD5A 1P1BA 2MR6A 5KDLA 3H6GA 4RUEA 1L6IA 3F6SA 5CIQA 1K08A 3QI2A 3ZYZA 1CZHA 3I2IA 3CC7V 1KYYA 1VFNA 1GKYA 4FHGA 4N5LA 4KUMA 4RGBA 1OE0A 1CUZA 2GRAA 2W6MA 3H84A 3M70A 4MPDA 4EGCB 5KNDH 1VQ9V 1KQOA 3PRHA 4YK7A 3B40A 5D5HA 1GPKA 2AXTZ 4RKRA 4CNQA 1J4AA 3ENZA 1FNJA 3R6DA 4ZTBA 1RRCA 3ZDBA 1OCOB 1AVMA 5CBHA 2CFSA 3P5BA 4RV4A 5F4ZA 3H16A 3OLVA 3VPFA 5JARA 3EEOA 1GM7A 2M7WA 3OGIB 13PKA 5ALGA 2K1SA 2JS3A 3WICA 4DR4O 4RSRA 4TV8B 4OG2A 3MFYA 4OL0A 3DMNA 2LNDA 1F4PA 3WNQA 1B42A 3QBTA 1TYDE 3ZY3A 4ZJYA 4IEEA 1R74A 4Q4JB 2ZBPA 1FUIA 3DAYA 1T43A 4E4TA 3TW6A 5LMZA 4XM0A 4ZTUB 3NDRA 2BTEA 3E9NA 1JEDA 2RDCA 3P94A 4LF4B 1QHTA 2JAOA 3H3XA 2HS0A 1T4DA 4IFTA 2HIGA 3FBTA 1C2YA 2QUAA 4YO7A 5EFOA 4ABYA 3P2JA 4EO7A 3BWXA 4JNCA 2A8YA 1U5CA 2QUKA 2ZB7A 5FIUA 1TO1E 3VYSC 3WB1A 1YQ9A 2D00A 1JV2B 4YAOA 3VZRA 2CYCA 4QDOA 1E1RD 4G8JA 1Z4PX 2WT9A 3QV2A 4CM9A 4KITB 2OT5A 1NVXQ 1RZ3A 1TZ2A 3PJDA 4B4KA 4OM7A 3CLKA 1PNOA 1Z36A 2NTNA 3AR4A 5EWLB 4ZDJA 4X65B 3OT1B 4CT5A 3CCRF 2VP6A 3GQBB 3VOTA 4EHKA 3IVMA 2M6LA 4XCQA 4LCUC 4ZVNA 1HNNA 5GMOA 4A7PA 4A9AA 2BFFA 3L82B 4LMAA 3DD5A 4PFQA 3E9MA 4GYKA 4KFMA 1QIMA 2KGWA 2OPBA 2YC2C 1BSMA 2KB0A 2OZBA 4MQEB 1KXZA 3TN7A 4QODA 4MUYA 4QAJA 3FN4A 1DLBA 3MN1A 5K5EA 5JCOA 2CXSA 3NTUA 5KIAA 5KKNB 1E5DA 2IYOA 1U2EA 2JJ2D 3H9VA 1GZVA 1ZI6A 2CLSA 5K3CA 1EWQA 3FB1A 2PM8A 3HA2A 5TJ9A 2C96A 4A0SA 2PA3A 4LOHA 4P33A 4FB5A 4RAIA 4AKIA 2AI3A 2AVNA 1CN7A 2CNWA 3GJTA 4KRXA 1BOOA 1QLWA 1VBMA 2HWKA 4ZI5A 2EKBA 4RHCA 1NXQA 3OX1A 1FRZA 3NIFB 4G0MA 1JW9B 5BXQC 1T0IA 4YIHA 5LPNA 4W9MC 1NG9A 3HRHA 4DABA 3I64A 1DT3A 1CKEA 6REQB 4U9UA 1DAOA 1KYQA 1L5SA 1J2RA 4M98A 4NS4A 2P90A 5E1MA 2ZI7A 2VPQA 1MGOA 3TI9A 3WJ1A 2VDLB 4E1BA 4Z7JA 3I30X 3V2UA 1W5AA 4MSWC 3ZWQA 4BV3A 2Q9UA 4REMA 1XA3A 4JQYA 4AZ0B 2D8MA 1SZPA 3SF0A 3EVGA 4FDLA 4GUDA 3BRSA 4GT1A 2HP3A 4N03A 3G1UA 3MRXA 5JCXA 1RRMA 2R4UA 4JJZA 2G4VA 1XCBA 2WTMA 4C4WC 1Q6HA 2GBCA 3MERA 4BQIA 5KB3A 2A06H 1YBFA 4U2BA 2ZVJA 5SZJA 3V2HA 4HAZA 4MUFA 1K33A 3B7WA 4KE7A 1DJQA 3DE7X 4QATA 4EFKA 2D2IA 4Q4HA 3ZXIA 1T0KB 1NY5A 3JYLA 3P7MA 3DV0B 1TAEA 1YS4A 1T2DA 3VC1A 3WLSA 5FLKA 4MW3A 5L3SB 5DASA 2WLLB 2OCDA 5A3QA 1NW9B 4UFNA 3KSBC 3G82C 4O5OA 4WK2B 4X45A 5GIPC 1E1NA 5A3SA 4MPTA 3PYMA 1C7JA 1RKQA 2ONCA 4DJAA 3UAOA 1YFZA 3K09C 3Q3JB 4IUCS 1YS6A 2WABA 2EV9A 3SS7X 2BM1A 5AUQA 4U0JA 3BJIC 2JLSA 3OE7G 1UFRA 2XOKG 1NKTA 3GH1A 3NBAA 4J1SA 2VQ6A 4JC0A 2XUAA 3KT0A 3CC2V 2VZ9A 4HRXA 5FO1A 2IGBA 3IEQA 1R9GA 4FYWA 2PGDA 4B71A 4B4DA 4B83A 2H3OA 4DR5B 4BKRA 3VHXB 1X1BA 2VHCA 2RGNC 4QASA 2MCFA 1OZ0A 1QBGA 2H4YA 3TJMA 1SCAA 5ALEA 4WBNF 4YHBA 3QFCA 5E95A 1JQDA 4E5KA 2YMQA 3P9IA 4HVAA 2P9GA 4BE7B 1URFA 4G0UA 2PYDA 5JJJB 1UFYA 2WTAA 1Q83A 3E7DA 1PS9A 2O7SA 4JLBA 4JL5A 4F6RA 3UK7A 1DQSA 5HY0A 5I7RA 1AKRA 1X80B 1X8LA 1FSSA 1XZIA 1WHTA 2Q7EA 1Q0LA 4LF7O 3DHEA 1CR4A 2FK7A 4UHCA 2AZMA 4IAOA 5IYBO 4RNDB 1PGJA 5HIKA 4AKGA 4CL0A 3GOHA 4X8HA 2QRJA 1KQNA 2CW4A 1NBME 1GN2A 3ZZTA 2EWWA 4RF2A 4EUKA 4D02A 1OHHG 1X7HA 2ZI9A 4P80A 3KCYA 1H2RS 3VSAA 3NVMB 2P0YA 2IW1A 2ZIAA 2ISQA 3KLMX 3TZLA 3WAGA 1HMYA 4G9GA 4HRVA 1UM9B 3DBIA 2G36A 1ODJA 1TYBE 1J1UA 2RAUA 2I22A 1WB6A 2OQRA 4TKVA 2V59A 4GP9A 3JCUZ 1NZJA 1JEYA 3LPDA 1W3EX 4BGEA 4URXR 4WMLA 3ZDDA 3ASOC 1J8DA 3KEOA 5AJWA 1CE8B 2G9QA 2V7TA 3PSHA 2JEUA 2GMWA 1ZKMA 4TUYB 3HJWC 1TFRA 2XUGA 3KR0A 2FTKA 3TNDA 4MVXA 5FF9A 3F3MA 1RJWA 4Q7QA 4MRRA 5F7ZA 1QK5A 2X6QA 2C8KA 5F3RA 5TR9A 5LGNA 1P5HA 4RFVA 1N75A 3SJCA 2FW9A 2OGSA 1JHPA 4LQLA 2QAIA 3CRW1 2WT8A 4H3HB 3VPCA 1UADA 2R48A 1DHTA 4MTLA 3V1UA 1XZNA 5WRFA 2ZRQA 1AJEA 4PLFA 4BLTA 3CW8X 1KJJA 4C2TA 3RVJA 1KD1H 4DYLA 1NUPA 3OR7C 1T9ZA 1E0JA 1YVEI 1D09A 4QQNA 5EMHA 1VFPA 2EQAA 2ZI6A 3AEIA 3MQFA 1IXKA 2FUKA 5HOEA 3LLUA 4JOBA 3W1EA 1AB5A 1FNKA 2H9AA 2WPNA 1F8FA 1ZG3A 4R6WA 3M6IA 4AJHA 1OASA 1XYVA 2WIGA 1GCIA 3LHKA 1E2QA 2C5GA 1BJKA 2HLDA 1S5PA 1IM5A 1C0EA 1PG2A 2VHYA 2GEUA 3JYHA 3KRTA 2ZUVA 4LF9O 3HCEA 3IIIA 1WSDA 3KJEA 4WLFA 4GZLA 3TLXA 3RQSA 5AP9A 5B53A 1CU1A 4CIYA 2DE0X 3W2TA 2A9PA 1DKUA 4QOHA 1X77A 5AK0A 4GSKA 3NR2A 4QUDA 1A8HA 3OEED 1QGOA 2H1IA 3TIIA 3UAGA 2P3OA 3SSOA 2GLTA 3H05A 3F7VC 3FA2A 5F7XA 3DZKA 4GOLD 3R0IA 1O9BA 4KIFA 5A3RA 3U4HA 3MOIA 4X91A 2NSJA 3PEEA 3KJFA 4GBJA 3RG2A 4DB4A 1PWHA 2CSUA 1AMOA 1N1MA 1JDBB 1GADO 1W30A 1UC4B 5A9TA 3K0KA 3PPIA 4Q3AA 4OQDA 3WDSA 5FOUA 1TCCA 1W2WB 3UGQA 3WLIA 2A9RA 2GCEA 1YT5A 2CDNA 3OMIB 3SE7A 1DV1A 1T0HB 1R0KA 4NOJA 1L5KA 1V8PA 4WVFA 4YQEA 2RHCA 2Z6QA 1PL6A 5DRYA 2XNDG 2CDBA 2QEQA 3CIFA 1TADA 1KIMA 2REQA 3A9RA 3AG5A 4FC6A 4D6TH 3K3PA 4G0XA 4G86A 1UBHS 4AMBA 4C14A 3K0BA 5EZYA 4NONA 3LQRA 1H2YA 3ZCXA 1VL0A 3CUEF 2EJVA 3FWHA 1JYFA 4PHGA 4KJXA 4ZVPA 3CNBA 3HPLC 2ES4A 2D5IA 3PNQA 4AJKA 3V4DA 1ULBA 1GPUA 1AS3A 3HJCA 3QLUA 5LYJF 3E8GA 4JV5B 2ZJ8A 1QO0A 4PZDA 4WFEA 1X42A 1S8OA 2ZYRA 2QQ5A 2ST1A 2OCLA 1SHTX 2D1YA 3N8IA 1AHNA 2PMEA 3UJ3X 5GZ1A 1B7GO 2XAAA 1X8KA 4Q24A 4CM4A 3X1WA 2C7GA 4BJ5A 1F6BA 1KFEB 2QX7A 3CA8A 4URFA 4AKHA 3RQIA 5TQ2A 4ZAWA 4B9AA 1HSOA 2BT4A 3V3TA 3OESA 3PITA 3PE3A 4QL3A 5HZMA 4QVKA 5KTNA 4U6NA 2QUZA 3P9QA 1I08A 1MG5A 1UQRA 3C3DA 3NRCA 5FNVA 4LOAA 2DHCA 4J4BA 1H1LA 4Z9BA 2OWEA 1QCYA 4ZU1X 5PNTA 5BN4A 4FZJA 3IPYA 1SBTA 4OYYA 5B3KA 2BUAA 2PTGA 3AR3A 3DEYX 1XDGA 3V7YA 3CUUA 2GCIA 2JGFA 3NPMA 1NFQA 4LTMA 2NU8B 3SLGA 2HNBA 1P62B 4S1VA 3IP1A 4ZU6X 3U9SA 4BO2A 4E1VA 4Q34A 2CZGA 2CCGA 4DY4A 4JP8A 4CMCA 2GPAA 2VXOA 2ASEA 1EWVA 3IXQA 4PO1A 5G1PA 3SZ3A 1JEEA 2NTJA 3BY6A 3IC5A 4QJ3A 2WA3A 2FW1A 3OOHA 4H27A 4MVJI 3I2GA 1Z68A 5EXPA 3BAZA 3DEHA 2Y93A 1A2BA 3KNZA 4YJKA 5BOSA 1G0NA 4EKGA 5KAPA 2VDRB 4BTVA 3TK1A 1RRGA 3MYRA 1GSIA 1TCVA 5BMVA 3MBIA 4QELA 2OSBA 2AUNA 3MDOA 1PR0A 2Q4OA 2ZTSA 3HYLA 3K92A 1GD1O 3L8YA 5FA6A 5F35A 5TS2A 1UZLA 2BM9A 2VDWA 2A0XA 2FV8A 3LQKA 3Q8WA 4KN5A 4LEIA 4D74A 1W4LA 1BE8A 1KVUA 5ALHA 3BHJA 1PWEA 3CZ4A 4HDQB 4HMPA 5HUHA 4C6TA 2DVMA 1KO5A 3I3OA 4G85A 2J1LA 1MNAA 2JFQA 4MO2A 1FDRA 4WZZA 2QRVB 2O7RA 5EJ6A 1FZTA 2VEOA 4FZ0A 1HV8A 1QFJA 1Q82W 2VK1A 2OUIA 3I01M 4HDRB 2JI9A 1S2NA 2QTFA 1D6SA 2EBHX 4Q4AB 1OBOA 3AW9A 2O0MA 3H7IA 1VLHA 3I8OA 1QSGA 3FRIA 3Q2KA 1NXOA 4L9SA 1FS0G 1KK1A 4LZWA 4C2AA 3K6SA 1QAHA 2V8BA 3ZDCA 3I56F 4N49A 3PDWA 1VARA 1HDEA 2ZIMA 1DOZA 4NMLA 5KSZA 4O59O 5B3LA 1OH6A 1UBOS 3GEPA 4MR7B 1DFGA 4UU7A 4IS2A 5K45A 1WQ4A 1VXOA 2WLSA 4AU1A 4OKNA 3GLTA 1NQTA 1W0CA 2XDYA 1NH2D 1NF3A 2WZCA 3FROA 3LVRE 5M3BA 3CCUV 1EVEA 5BZBA 3ND5A 2I54A 1P77A 3X2SA 1RYZA 3Q3HA 1T9HA 3ABKB 3TLGA 3H1EA 3HNPA 3NP9A 2R1TB 3ANXA 4UVDA 2CFTA 4QJ5A 2XF8A 1XZ8A 1RWNA 3OTHA 1NW4A 3H8WA 3FKSA 4HGZA 1CP3A 3GLQA 3K9LA 4HDNA 4HI0E 3ZY6A 3L7NA 3I6MA 3N8NA 4M0PA 1MDBA 1SVLA 1WE2A 1TZCA 3E23A 1T2AA 3I55V 2EIHA 3OUSA 2UUOA 3EUEA 4P4TA 2UZIR 1KDZA 4EM6A 1OCCB 2VQEO 1JYSA 1VZ2A 2JS7A 3KPVA 5A9SA 1ZK3A 4NCKA 2LBWA 2D59A 1N36B 2C31A 2PSJA 2ZAMA 1N36O 3MGBA 3ND8A 4OX9O 2NZ2A 2WJ6A 2X42A 3DOEA 4B87A 5LD2B 1WMAA 4RY8A 5CVUA 4L5JA 1QVFF 1Z6ZA 1R3KC 1OYOA 2DX7A 2NUTB 1MFPA 3ZMZA 2ECKA 2OD9A 3NEAA 4S1WA 1HYEA 1TJ5A 1IZ3A 4FHDA 3OR6C 2B1IA 2JGIA 3L0BA 4IJWA 2XOXA 4XUCA 1K6MA 1VKNA 1JHXA 3WTCA 1T3TA 3B3FA 4FU0A 3VKGA 2PWYA 5T67A 2HYDA 3CW9A 4AMUA 1XMXA 4GOND 4F5EA 5KAFZ 3IRVA 2YXLA 4J11A 2F9LA 2UVPB 4PN7A 4KTTE 3BCCH 4R1SA 4PSKA 4FFWA 4HB2A 3B38A 3TG2A 1RA4A 1CUIA 3JQAD 4KFUA 3ZH2A 4JUAA 4BLWA 4EMSA 4O3MA 3FKSD 3UJPA 3AF4A 5FA5A 3H1GA 5CT9A 2IOQA 1L5LA 5HIMA<