5LP6B

Crystal structure of tubulin-stathmin-ttl-thiocolchicine complex
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tools for the rational design of bivalent microtubule-targeting drugs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 154
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5lp6B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5lp6B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5lp6B01
4ZI7B 5LYJB 4X1YA 3JAWA 4WBNA 5EYPA 4U39A 4EI9A 5EZYB 3HKCB 2VAMA 4DXDA 4LNUB 4TV8A 5ITZB 5JVDA 4LNUA 4IIJA 4X1KA 3HKBA 4FFBB 4O2AA 5IJ0B 4M8IA 3JATA 3RYFB 5BMVB 2XKAA 3UT5B 3E22A 4TUYB 3R4VA 5IYZB 5CB4A 3C8LA 3ZBQA 5J2TA 1TUBB 4F6RB 3VPAA 3RYHA 1TVKA 4ZHQA 4F6RA 4EI8A 3HKEA 2VXYA 1JFFA 5CA1A 2RHHA 4O4HA 4IIJB 4X1KB 2RHJA 5KX5A 2Q1YA 4E6EA 5LXTB 3WGMA 5JH7A 5BMVA 2R751 3HKBB 4O2BA 5EIBC 5CA0B 4TV9A 4YJ3A 4O2BB 4TUYA 4I4TB 4TV9B 4DRXB 5GONA 4I50B 4EB6B 5IYZA 5LP6A 3VOAA 4EB6A 5CB4B 4I55A 4O4JA 1Z5WA 1W5FA 1TUBA 4IHJA 3ZIDA 3VO8A 3RYHB 4ZHQB 5LYJA 1W5EA 5EYPB 3N2GB 3WGKA 3HKEB 3N2KA 5C8YA 1OFUA 5C8YB 5EZYA 4O4HB 5JH7B 4XCQA 3JAKA 5KX5B 5MN6A 1W59A 3WGNA 3HKDB 3ZBPA 4X1IB 3RYFA 2VAWA 1FSZA 4O4LA 3M8KA 4YJ3B 4WBNB 5JQGA 3UT5A 5KMGB 2R6R1 3V3TA 5GONB 5LP6B 3RYIB 2BTQB 5IJ9B 5J2UA 2BTQA 5MN5A 4EI7A 5JCOC 5EIBD 1SA0B 1RQ2A 4ZOLA 3VO9A 1JFFB 4ZOLB 3JAKB 5M7EA 5FNVB 4B45A 3RYCB 5JVDB 3WGLA 5LP6C 4O4LB 1W5AA 5CA0A 2BTOA 5KMGA 4O4IB 4HNAB 3HKDA 4YJ2A 2RHOA 4B46A 5LA6A 1RQ7A 5LA6B 3E22B 4I55B 4O4JB 4U3JA 4ZI7A 4IHJB 4X1YB 4U3JB 1W5BA 5J2TB 1TVKB 3JARA 3N2GA 1RLUA 3VOBA 2XKBA 1Z5VA 3N2KB 4X20A 3HKCA 1SA0A 4X20B 3RYCA 5CA1B 4KWEA 3M89A 4TV8B 5ITZA 2Q1XA 3JASA 1FFXB 4FFBA 4O2AB 3JASB 4YJ2B 5FNVA 5LOVB 1FFXA 5LOVA 5LXTA 3WGJA 5MN4A 4X1IA 1W581 2VAPA 5IJ0A 4I4TA 4HNAA 4O4IA 4DRXA 4I50A 5JQGB 3JATB 3JALB 2RHLA 2GVIA 3RYIA 3JALA 5J2UB 5IJ9A 3JARB 3RB8A 5JCOA 3CB2A 3JAWB
chains in the Genus database with same CATH superfamily
3P27A 2HSEA 1S8NA 4Z0NA 1L1FA 1XQ8A 2ZCUA 1OROA 1WO8A 3TW0A 4UQOA 3MTBA 2Q3JA 1ZD8A 3TGUH 2XEXA 5K0JA 1Q3EA 1V54C 2EW1A 3RWRD 3GNLA 3L79A 2CFRA 2TRSB 2V7TA 4IIJA 1DG9A 1OI7A 2QLFA 4N9QA 2LJ2A 4URUR 3RF6A 5HOQA 2WSSG 4AS3A 3KE8A 2Q6AA 3B85A 3PCXA 3OBIA 1R3UA 4LF7O 4EB3A 3K9NA 3MJSA 2BEWB 3HU2A 3PWZA 4BT6A 1J8VA 3O93A 1YRYE 3ECSA 5E1AC 1UI9A 2ZR2A 1EFLA 2DYSC 1SUIA 1JT2A 3OPVA 2R9RB 1AS2A 4H7IA 3R3UA 3G1WA 4PX2A 4HI0E 4DR4B 1W2BF 3BJMA 3WBKA 5LQMA 4F4HA 4XWYA 5G0SA 1VA5A 2P78A 1PTJC 1Y98A 1DIGA 1JXAA 1QZZA 3WG9A 2J33A 2Y71A 4NYMQ 3AIMA 5L9AA 1RJEA 4D8VA 4YIPA 4HLUA 3E8SA 5KYGA 2I9KA 3AZOA 4KO1S 3A7DA 2DBZA 4HPJB 4LYAA 1G291 3Q5EA 1R16A 2REBA 3T4DA 5JQWA 2PUTA 1XREA 3OFKA 5G0TA 5AW3A 2LZ0A 1RC0A 3VZQA 3T7TA 1H3EA 1FSGA 2X6CA 4LRTB 4MDYA 2V7PA 1EDZA 1KFJB 4JLVA 3USZA 1IYZA 2QVCA 4EBFA 1AV7A 5TJ9A 2C54A 1ZL0A 2YS8A 4MMYB 4DEVA 2ZG6A 2FKXA 5DN6G 3QE9Y 3B82A 5TY0A 5I7HA 2IS6A 1Z4JA 3TD9A 1KI6B 3A1WA 4UXHA 2O2CA 4E15A 4M2LA 5KTMA 3HXTA 3SDZA 1T0HB 5DJ5A 5B36A 3LQ1A 5I6DA 1AM4D 3I3FA 3R7LA 3CCQV 2Y9PB 1IU9A 3V3TA 1E2KA 2FLWA 1HTTA 2HDWA 4MWZA 4NJMB 3L0YA 4PZ0A 2W6QA 4BN5A 2ZSUA 1QTIA 3JX9A 3LHKA 1GKUB 2Q07A 2YASA 3F67A 1O6CA 3AJRA 4NYJR 5KJEA 4DZZA 5AJZA 4URXR 2VFAA 3U9SA 1R0SA 2JGIA 2O7QA 3GDOA 1MCZA 2ZKLA 2RE8A 2HJGA 4OVKA 4Z5XA 1VDMA 4DADA 4ARZA 3BWVA 4JI7B 3A2FA 5LL6Y 3VC2A 2X3FA 1R00A 4MVQA 4MQMA 2MINA 4G84A 5FPHA 4BX9A 2ZU6A 4GSYA 1T9CA 3D6NB 2P69A 4OPHA 3W2IA 1OX5A 3VYVA 1ADCA 1F23A 3DEFA 5E95A 2H2WA 2ODAA 1HOTA 2WEKA 1Z7GA 3E22B 3LLSA 5JO0A 2AXTZ 5DMHA 1OXXK 5FIUA 4EHHA 1T3TA 1JZQA 1KXZA 1FYDA 1K75A 2K4MA 2P2SA 2RJOA 2YJZA 4OM8A 4PG4A 5K0SA 4DQVA 3M1XA 4KLAA 4D9JA 2PX3A 2CGEA 3D0RA 5FBZA 4IZIA 4HR7A 1VQ5V 4CIYA 3FZQA 3M89A 3HB1A 1QG2A 4YS6A 4BMNA 3SBXA 1SZQA 1F5NA 2Q50A 2PT7A 4I4IA 3QU5A 3HUUA 3LWBA 3VGPA 1KXJA 1LLQA 1MTZA 4UUJC 3DGFC 2J41A 1YTFD 3OX1A 5IC5A 3RRZA 3S7ZA 3WL3A 5HK9A 2N1MA 5IJ0A 4YN3A 4MV6A 4YXWG 1GTJ1 3CNLA 4UVHA 2IYRA 5DYGA 1GQ2A 5JAIA 1YZ3A 4H35A 3S55A 2ZKOA 2CBGA 3FSGD 1QCZA 2BGLA 2I6TA 1Q3KA 3GFPA 4LXYA 4LRQA 2YIBA 2QMUA 4BO3A 2H4YA 2ZF8A 2MSEB 2FQXA 1FDUA 5CNIA 4EUSA 5A9SB 3GVIA 1EN6A 1DXQA 1AXEA 3I0ZA 2YXDA 4TMVA 2H18A 2ACKA 2ZWAA 3OF3A 3VI4B 1W0KD 3NWPA 2FE4A 4LRWA 3VU0A 4AHCA 1SRQA 1TUEB 4RVGA 2Z2ZA 3VR5A 4WE3A 3URKA 3NNSA 2ZXFA 2G08A 1V0JA 3D7KA 1ZLXA 1G8JA 2IE8A 3EIQA 1LI4A 4UBNA 4C2BA 3SC2B 4PY2A 4BJHB 1C1HA 3THYA 1EVYA 1S01A 3FVQA 4GQBA 3RVQA 1OAPA 4WY8A 3T1NA 3K7EA 2DKNA 3ELUA 3K5HA 2XB4A 2WT4A 3GLHA 4ZQEA 3JQ8A 2WABA 3AF1A 1GYRA 1Q92A 1RAHA 4QXRA 5ICGA 1VKJA 4KGVA 1YAHA 1MFPA 3NETA 1CG6A 1Q82H 2VRZA 4OB8A 4V38A 5FA6A 1C2YA 2V6FA 1HQDA 1JTEA 2KX7A 2ONYA 2YWGA 4TTIA 5HCUA 4OI2A 2AIZP 1EFHA 1HORA 1ZI6A 2WBLC 3KOUA 3V4ZA 3WS7A 5M5BA 3AF3A 3VMMA 4E3WA 5LU9A 4FONA 4IIHA 4Z4HA 3ISTA 5THXA 3M7MX 2C4TA 5TGZA 4BV3A 1NYRA 1XMIA 4DIMA 2W7TA 1PE0A 1UMBB 2Y4OA 4QBIA 5C18A 4X3CA 3ZXYA 1P7GA 4OREX 3FFBA 3QEMB 2IOQA 5E4FA 4BU0A 4BFVA 4EB8A 3FYUB 4MARA 2VKTA 3GLQA 2NV0A 3MGGA 4ZWNA 1RP1A 4TRNA 3GD7A 4FBMA 1EFPA 2SICE 4RVHA 5FF9A 1AGPA 4DDVA 1AKVA 1P3Y1 5ICCA 4RSRA 3F2IA 1GKIA 1CRZA 1J0EA 2O0HA 3HDYA 3D2CA 1IPHA 2JJ1D 3FA2A 3I8XA 1O08A 3DULA 4F5ZA 4YCLA 3SBDA 4ZQFA 2YVLA 2XD4A 4EHJA 2C9ZA 2JS3A 3LYAA 2NSLA 1WDLA 3BK1A 3PUVA 4TTTS 1CU1A 1H1DA 3ZRSA 1NYTA 2GVNA 1E2PA 1KQGA 3WJQA 3W9BA 5KNBH 1O95D 1OC4A 2AT1A 3CSSA 4JJ8A 1KO8A 3E15A 4Z9AA 1U9CA 1DVRA 1WL8A 3HNOA 2Y8EA 5IC4A 1JFFB 1Y3CE 3ND7A 3OY7A 1PR9A 4MROA 3JAKB 1NXWA 1LBTA 1AROP 1WMBA 2DH6A 1VLQA 4L07A 5CH3A 2W6OA 2F00A 4YRRA 5ENVA 5LZ2A 3ZDBA 4O1IA 1HT2E 1D2RA 3S8MA 4BT4A 5KC8A 2H5JA 4I6EA 4J41A 1M0TA 5IMSA 5LM3A 2PD3A 3KBOA 4JZKA 4ZO8A 3A0BZ 5B3JA 3ZI4A 2YYYA 4JC0A 1QVWA 5JCJA 5LQDA 4R1NA 1UBSB 1HDYA 3WIDA 3GD5A 2XOKG 4U3JB 2NADA 4K9OA 4WNCA 5EERA 5IJWA 2Z5UA 1STOA 4BWGA 5H6QA 3TD3A 5F5XA 3MNFA 4G41A 3O4GA 1AQJA 2CHUA 2P5OA 1SCKA 3O3NB 3Q12A 4URWR 1JI3A 2AQKA 2FF5A 2OO5A 2ANBA 5GVSA 3WIUA 2IS2A 2PDAA 4F2GA 2Z2XA 4V0MA 3CH6A 3WBFA 4EAQA 1J2TA 3OCWA 3WDMA 1VH8A 3ADCA 1AI6A 1R0WA 3TRFA 1T3SA 4P3OA 4HVCA 1QR8A 8MHTA 2GZMA 3INTA 4CH3A 1TTTA 2A84A 2H7XA 2ZYDA 4Q16A 1Y7PA 4LJAA 5EWLA 3ZLBA 1CUVA 5DM0A 4QOEA 3WICA 1L7AA 1HY3A 1QG0A 1ONPA 4TKMA 5HA5A 1ZD2P 1V41E 2Q62A 3AXTA 4TKUB 3GWOA 1I94B 4BT3A 4FLMA 1GZUA 3KFVA 3B2NA 1I14A 2F17A 5BQFA 1LV8A 1IV2A 3RUDA 1U9ZA 3ITEA 1SQQH 1QD9A 5L6LB 3IAM1 2H1VA 2BFBB 2YL2A 4ITVA 2FN9A 2HX1A 2OHHA 3L5KA 3WB2A 2QDXA 1ZQ1A 2F43B 2C96A 3SHTA 2YRFA 4PIVA 1NM5C 3COWA 5BMVB 3BFJA 5ES4B 2JIDA 5TNXA 4GS5A 2A8YA 3OO1A 1QIGA 5F7XA 5JXHA 2Y2VA 3WQHA 2C2XA 1AQLA 3FFXA 3K03A 2HNBA 3BIJA 1KU9A 2ZBRA 3ZDRA 3CSUA 2BRUC 3EORA 3NKLA 2ZVPX 3FMFA 3M4SA 2IXAA 1IZ3A 2CXQA 4IIBA 2VXYA 3U9LA 3VXKA 2WLIB 3EUWA 4N0EA 5AM5A 3IMGA 4QPJA 2PKQP 3NUZA 1ODSA 5JYBA 3HA7A 2O8CB 1Z2GA 1ZS9A 4ZAZA 1ISGA 1VQ8F 1CF4A 1URFA 4C3ZA 1GA1A 2A9OA 2VR1A 3VH2A 5LP6A 5LWHA 1VF5B 3ZCVA 4IDBA 3ZGZA 1XSEA 1W5FA 4KFRA 3W5IA 4FJCC 1Z08A 4W5WA 2WQ6A 4RFVA 2HI0A 5CB6A 4Q4HA 1L4MA 1OUMA 1LF5A 1TYDE 4XEHA 1KE1A 2Y2UA 4TQDA 4RORA 2XQJA 2H4ZA 4G9BA 1NATA 4K9NA 1JEQA 3Q87B 2PLFA 4B4DA 1C7QA 4CMCA 1ZX3A 4WFIA 5AT1A 1KECA 1OLXB 5J4KA 4LF8O 1KKUA 1YCFA 1YK0A 3OEEG 3V4VB 3NH6A 3ZBPA 3ZX4A 1T8TA 5TVGA 3VU9B 4B3HA 4M9CA 4CG3A 1SU6A 1VYVA 2ZJOA 3FD8A 4GPZA 4FWIB 2HFKA 1J90A 2QQGA 3AHCA 3JSAA 4IXTA 2LD4A 1BG6A 4K3UA 2QN2A 1CQJA 5C4IA 4Q7MB 5I45A 4B09A 2TMYA 2V6GA 2FY8A 2WVGA 5I9IA 3T7CA 5LMNO 4CMIB 1EFCA 4IHQA 1RCUA 1V55B 2GJ4A 5TDHA 3RIYA 5JUWA 1FTGA 4FHDA 4MUNA 3ADDA 1J0DA 3VAAA 1I6WA 3F5SA 1DP4A 1GOTA 2XUZA 3SBEA 1EK1A 5JVDB 1W2HA 4DV0O 2DJVA 2ES4A 4MYSA 5JNLA 3JD1A 1DPFA 4G37A 1NJ5A 2FP4B 2BTOA 1HNWO 2OBNA 4UOEA 2J3QA 1RI5A 1SXGA 4MRVA 1OFGA 1M6YA 4L72A 1B41A 3T7IA 2EV9A 2WA2A 2ZPUA 4B3MB 3MTQA 3FYHA 5F3DA 1Q0ZA 3SICE 4II2A 3UW3A 4JDPA 2Q69A 2UYGA 4XQCA 4R7TA 2O05A 4C0QC 1HDZA 1XN1A 1HYHA 4TT8A 2IEAA 2GV9A 2R7KA 2NU6B 1IE3A 5CNJA 1QQAA 1M90W 1N2JA 3S3WA 1YK1A 3G7NA 4OFZA 2ONKA 3DOJA 2P6NA 4P84A 2PZLA 1GU0A 3ZN0A 4UCUA 2B9ZA 3QVNA 3BGDA 3KDAA 1HT3A 1MUUA 2Y0CA 3H0CA 1GA6A 2VHEA 3L82B 2KG4A 3TRKA 5K3EA 5KNBA 3TDMA 4M0MA 1N2HA 2Y1OA 3UV7A 3ZXSA 4I7EA 5BSKA 2LDXA 3TAUA 5AVYA 1IC6A 5JBQA 4HBGA 4OHCA 1YE5A 1Z0ZA 1Y81A 2NVUA 3I73A 4GXNA 3X43A 1VYTA 1OASA 3D6FA 5HMLA 5BV2P 3OQNA 4DV3B 3BMXA 3VR5D 4JV5O 2EFYA 4F91B 5IC6A 4PGAA 1Q22A 3IR7A 2H94A 1HDRA 1VZ3A 1OCZB 1X7HA 3PQEA 4O29A 4TZZA 1DTSA 1SK8A 1UP6A 1J8DA 3KC2A 4FFBB 4PSKA 2BFDB 4BBZA 4KB5A 4XB1A 2UVDA 1M90H 1SCIA 5AXCA 2JIZA 2C5EA 3DAYA 3V46A 3GT3A 2YICA 4LOIA 3KD2A 1GUAA 2JIPA 3UUFA 3I62A 4KBFA 2R47A 4TM8A 5BW5A 2AEFA 1BHBA 2V5UA 4Q6BA 5KSWB 1O0CA 3ZDEA 1DAEA 1Y7HA 2CMHA 2JI8A 3I1IA 1GDDA 4NL4H 1JIXA 1DGSA 4TT3A 5DHQA 3ELYA 4QSMA 1RI1A 1QO0A 4H0LB 2FR8C 1HEUA 1TM1E 3ZOZA 1ZR2A 2BMFA 1JIUA 1IEXA 3I53A 3JV7A 3ORQA 1GN6A 2P27A 2QM7A 1BQEA 2C99A 2HLNA 1P4RA 2XA9A 4KX3A 5DW3A 2V45A 4XGNA 1ST2A 3M7IA 2YEVA 1A9PA 2RAVA 4TV9B 1CSEE 3LPCA 3JQQA 4G24A 3RI3A 3UKJA 5CCBA 4V0OA 2I0FA 4MGIR 4DJDC 1U1DA 2F3QA 1SC5B 1ORVA 1AQ6A 1SBIA 4RCYA 4NXNO 2BUAA 4N6OA 4MVJE 5KTOA 3WGKA 4MP6A 1E4YA 3ZGNA 3AP3A 4BOYA 1KWKA 3F98A 4QVKA 4MVWA 4B33A 4DJJA 4G2KA 1MV8A 5KYXB 2WKPA 1Y8CA 5KTPA 1DUIA 2WWTA 2XRYA 1KEUA 1M2OA 2FWRA 3GWGA 4FX2A 3U3RA 2QW8A 3CW9A 2INGX 4L15A 2Q6IA 1A95A 1ISSA 2A0XA 2W2MA 1YJWF 4G1BA 1GJRA 2RGNC 5KYVA 5A3QA 3IMKA 3OECA 2Z57A 1B1AA 4FTWA 3CRVA 3FKSA 3VA7A 3ZHRA 2WLHA 4K6FA 3FNQA 2FPPA 3NEJA 1KZ6A 4N5LA 4QYSA 2AG1A 2E2WA 4BVAA 2C57A 3JRWA 1E5QA 1NOKA 1FS5A 4PR0A 3I61A 2PGIA 3MFQA 5I4CA 3ABMB 5KC9A 2AW9A 1W19A 3NT4A 4YIKA 4DLSA 3S1AB 1M54A 3IOEA 3MJ4A 5AFSA 1P2TA 3RVZA 3H5OA 4C4TA 4Q15A 2IS4A 2DBYA 2ORED 1D4OA 3V1KA 4BQIA 1Y3FE 4J9VA 3CVXA 1MIHA 2H9AA 3UGTA 3LUKA 2Q4TA 3OKAA 4GWGA 4MI6A 3H2JA 1USVA 2FB5A 4O02B 2H17A 1JHRA 2QAGA 4I46A 1AGYA 3RDPA 2AW3A 3PIIA 4A4DA 1NL3A 2DOSA 3CUVA 3WLJA 3ZH2A 3TKLA 4EYEA 1YZUA 3RIMA 3NK6A 5GPBA 4B4OA 1QPBA 3J80N 3JARA 1NYQA 3D5TA 3G2QA 1Q0TA 2GD6A 2Y1FA 3ZNOA 1WXQA 4CNQA 3F6RA 1E3TA 4GMDA 5IS2A 3FGNA 2YZMA 1RJ9B 4RHXA 1HFEL 5J4LA 1E1RA 1OW3B 3OW2F 3AR6A 4G5HA 3UC5A 4KXMA 5KUTA 2C97A 2Q5CA 5D86A 3AETB 2CFCA 3KALA 5JSHA 4LJRA 5FNVA 4X6XA 5E7IA 3VDRA 4AX8A 1LS1A 3AJAA 4IO0A 5G0WA 5A4KA 3FDFA 2J9FA 3DOFA 1GQFA 3DTNA 1I01A 1CZRA 4FNMA 4Y6OA 4EPTA 4YJFB 1NNEA 3BD8A 2W2OA 1Q90D 4PZYA 1DEAA 1TDJA 1A98A 2J9ZB 4TL6A 4KQJA 4HLUC 5AKGA 2JVJA 3U7QA 3L40A 3OF5A 3CCJF 5EYPA 4RTNA 1Q82W 2WU1A 3I2GA 2JAUA 2XWJI 1YOVB 2C03A 3OLYA 4JEHA 1L5KA 5DWDA 3IP6A 1RWKA 2XNKA 4BTLA 1UQUA 1PPJH 1NVGA 4PLHA 3TSZA 1VLJA 1X1BA 1FMFA 1TF2A 1QVAA 1Y34E 1C7EA 1KIFA 4O2BF 4UMEA 4EY5A 2XVYA 4MAMA 3BJEA 4EKNB 4CN8A 3VAYA 4JYYA 2GEJA 5FEMA 5HQ3B 2Z2JA 3M6AA 1SFRA 2HU7A 1ZWIC 1ECJA 1PZEA 2IXFA 2ZQYA 5H70A 3RK0A 3SIVA 3APOA 3UCSC 1FKAO 1YZGA 4AJKA 2DW4A 2C2BA 3FWHA 4MVJD 1IK6A 1W94A 2NV6A 2BFNA 1HFWA 3BE4A 1PX0A 3FYCA 1X59A 4JOSA 4FYHA 1DG1G 3QFSA 4JYAO 4IWYA 4R2JA 4CYMA 4IF6A 3EC1A 3SMVA 3I12A 2JJ2A 3E27A 3MCAA 3KXKA 4RTPA 1KHHA 2KE5A 4KSYA 5ESDA 3UW1A 3BC1A 4R1UA 3EPHA 2JD0A 2R8PA 1YVRA 4R2IA 2OCCB 1F2TA 2YHIA 1NHWA 3K94A 3O31A 3UB4A 3EC7A 4KXVA 2VQEB 5AI0A 2EX1A 3DEHA 2P6RA 3LQYA 5IY5B 4MICA 3JYQA 3CLUC 3WJ2A 5IM4A 3G8CA 1BEZA 3I2YX 4QNRA 4V3CA 3U17A 2QRUA 1JDPA 5EJEA 1WUJS 4Y6LA 3VTKA 1SKMA 4RZ3A 3CCLF 3ZIAD 2H1FA 2OGZA 1O0SA 4BT5A 2I1LA 4JB8A 1A2QA 1NKDA 2WIJA 3BRCA 1H8HG 4CS3A 1IEWA 1J49A 3Q6NA 3VR5H 2JHCA 1MP0A 3DUFB 3IV9A 4BNGA 2CVQA 2DU8A 3O4RA 1G8KA 3OCVA 2W4MA 4F8EA 5CA0F 4LQCA 5LQAA 1GL9B 1OYOA 2WD9A 4C5AA 1QDEA 1B3BA 4GEGA 3ZQ4A 3E2MA 3VC7A 4ICIA 1ZJWA 1T24A 2PN1A 2VLIA 4GI1A 4IY1A 3RNOA 3GGDA 5FLKA 3NVDA 1EXMA 1O9BA 5BR8O 4LHZA 4YNBA 5GGXA 5HFAA 2A58A 3FGZA 2BHLA 4V1CA 2QAGC 3S99A 4EPWA 4FVMA 4D3YA 1SELA 3H8JA 3LYLA 1QZUA 2I66A 3G9ZA 3FCOA 4CRWB 4A26A 2C5SA 1W46A 5JH7F 1RZRA 4ZOLB 3NBXX 4N8DA 2ZJ3A 4B85A 3AK3A 1FPMA 1NVAA 2EERA 5CEJA 1XLVA 4LVCA 4GWKA 2FCAA 4RCZA 1Z63A 3FX7A 2G36A 2G28A 3CJRA 1NJ1A 4BB9A 3MBOA 5DYWA 3GWKC 1BCCH 1KD1H 2XNSA 5CHYA 1QYCA 5D00A 1T4CA 4F2WA 2GHTA 1F4LA 1RJFA 4X71A 4H7DA 2OXFA 3OAAG 3RSOA 3K5WA 3BFKA 5C8VA 5IULC 3AH8A 2F62A 1L3CA 3FAZA 4BFLA 2FSUA 3QKRA 3W1EA 2MK3A 3ZGLA 3ZWPA 3NIFB 3HFSA 5A6SB 1S9HA 4OFBA 2P67A 3B6KA 3SQMA 2FW7A 2J45A 3ABIA 2PWYA 1QP0A 4OL9A 1NDUA 5LXTA 2NAFA 4RVDA 1EM8B 5JD3A 3IULA 1EB8A 5B1BC 2NZUG 4RF2A 5AJYA 2V4ZA 4OAOA 3WOHA 1G3UA 2WPDA 1I7DA 2Z83A 1LF0A 3CUKA 4I1UA 4KP4A 2FOIA 1KGDA 3ITNA 1T5EA 1JHDA 2D2IA 4ZI7F 3AY0A 4EUNA 3GF4A 4NP6A 1GNPA 1T2FA 4YB8A 5JC8A 1T0JB 2A9PA 8ABPA 4HYEA 1XJ0A 4QYIA 1AKYA 2QZ9A 4BIOA 3N1UA 4UAVA 4HNRA 2VF7A 3IXQA 3QX8A 4QPNA 5HW0A 1J33A 3N74A 4BNWA 4MDEA 1EDDA 2PTMA 1U8AA 1MAVA 1VHTA 2CWDA 5ITWA 4TWBA 4DV6B 5LQCA 2JANA 2O2IA 2R7NA 3X0DA 4OHVA 3RSGA 3WWEA 3A11A 5AH0A 3FZNA 3L04A 4FOLA 4TTQA 3SFTA 2A5FA 1TCAA 3ZRXA 2JBAA 2O7NA 4RV5A 4D4GA 2PRZA 4IT5A 2PZMA 3PU6A 4FB5A 5FRDA 2QLLA 1BHSA 4AXXA 2A3NA 1GILA 4EL0A 1REQA 1V6SA 1LC0A 2HF8A 2VP3A 3PA6A 4LZLA 4XJTA 1ONNA 4UPVA 4DGQA 3WKEA 2DH5A 3CFYA 3KEQA 4QFMA 1PLLA 1YJWV 1YDWA 2PM8A 3WY9A 4RD4A 2BE7A 5JWRA 1RWBA 1RXVA 3PNMA 2XJ4A 2PL3A 4FPPA 4M7RA 4WT7A 5FI1B 5IE9A 2XUOA 3OCZA 2R4QA 3OCXA 3PWKA 1YRLA 4B46A 1RPTA 3DDHA 3GXOA 3ZPXA 2CEKA 2UYYA 2WT8A 3WG7B 2WLTA 3E18A 1KO4A 4N18A 4JY7A 1FYWA 2IY8A 4XDZA 2QZJA 4IS2A 5CLFA 2W58A 2Q6LA 4PSCA 1O6GA 2NXCA 4RV4A 4NCHA 2V1UA 2JZCA 5LQSA 1W93A 4CT5A 3CLUD 4PYLA 3T7SA 4U2BA 1XZEA 3T5GA 2JK5C 2XSZD 1RU3A 4TS4A 2ZIMA 1PVVA 3HY6A 4JXKA 4DLTA 4C30A 1I3CA 2NOAA 2ZRIA 4BQOA 1YZYA 4YDRA 2YV4A 3IAAA 1A4UA 2P1ZA 3FCAA 1UOPA 4KXFB 1R6BX 5KYWA 3QRWA 3TG8A 1H8EG 3L74H 5DFAA 3T99A 5IU6A 4YMVA 2GZHA 2PMBA 4MW1A 1IZ8A 1U90A 4ZGWA 3ZCUA 5FOSA 5JSFA 2F1MA 1Z3IX 4M99A 2ZIEA 1ZPDA 2PY6A 5IM4F 2P6UA 4U2DA 1CHNA 2C9BA 3I28A 5CRIA 2RCVA 1UBOS 4DDKA 5KDLA 2AZ2A 1G8HA 1PZFA 4WKCA 3V80A 3CUEF 3S2SA 5T4HA 4ZV7A 2BUCA 2EFCB 4BMXA 5ED4A 1IOZA 1ZK0A 4NQ3A 5K1ZA 1NA5A 3TVDA 1RIIA 1QFZA 3RS3A 1PV1A 5L3VA 2BGTA 3GPBA 5JPCA 1FVOA 1JR6A 1BT8A 2PU7A 1FTSA 5KLVH 3H2IA 1Q3HA 4CCYB 4B3MO 4Q7LA 1C14A 3DLAA 1JNYA 4U6NA 4UOQA 3VVMA 3RBZA 3U4GA 5I4KA 5ITVA 3JSNA 5AJHA 4P0PB 5CDGA 1NLMA 1SJ9A 2H0QA 1DTEA 4ZTUB 2PX6A 3ROFA 2H08A 3ND9A 3QQPA 4B3GA 3N2KB 2NSHA 1VYHA 3B3QA 1ZSVA 3GJ6A 3M1AA 2D7JA 3A6KA 4HAXA 4Q12A 5ALQA 3RRBA 3T4UA 3ZWCA 1M1UA 4YCSA 2PT5A 2PUSA 2GUZB 1OXSC 2OCAA 4WEQA 4HGNA 1USGA 3ZP7A 3L3BA 3FOBA 1YMVA 2EFHB 1P8AA 2OO3A 1NQVA 2QJRA 3ENWA 3K6KA 3NHSA 2XUGA 4OXKA 2ZRBA 1J1UA 1P0MA 3FYEB 1EJ2A 1WJGA 5KWIA 1WXEA 3E7FA 4CIAA 1AH2A 3QPAA 1DRUA 2LKDA 1JYSA 5K03A 2NZYA 2OTMA 1JJAA 4B5LA 3NCHA 4D41A 5FEUA 3RHFA 4XGKA 5JSZA 3WAGA 2RIPA 5CVJA 3EODA 3ZRWA 2CZQA 3K9AA 3GRPA 3Q0EA 1N6NA 1N3LA 3OZGA 2Q99A 4DCUA 2PUEA 3DMPA 3P0FA 5CMUA 1JECA 3OW2U 1ISIA 2VH2A 4BB0A 4CI0B 2AFIE 3SC4A 4K6OA 2RDCA 4S04A 1OZ0A 1QX4A 3G67A 5EP1A 1W25A 4FHCA 3CS5A 1D2EA 2GAIA 2PLAA 3TNFA 5KHLB 1YCIA 1K8AW 4RA9B 2B4KA 5JXWA 3K57A 1Z5GA 1QLWA 2QM0A 3L7YA 4LFAO 4OXSA 2AI1A 5FYQA 3PRHA 3WV4A 1GKYA 1K3FA 3A4TA 2IH3C 1Z6QA 2XYQA 2B4YA 4MKHA 1UBNA 1ZH8A 4REQB 3S2UA 4CQMB 2P22C 1RMYA 1UP4A 2H5EA 1Y5LA 3TD2A 4ZV4A 4MK4A 2XA1A 3K9BA 2ZYWX 4AD8A 1AKUA 3H9UA 4O4JF 1NY5A 1G20A 1PJTA 1DX4A 1DIOB 1H8HD 1QS0B 3NX4A 3OJCA 1UJNA 2AH5A 4HOYA 3JQBC 2YFYA 4JAVC 4O08A 5AHWA 3O9OA 1Z68A 1TUBA 1XVAA 1I36A 2G1UA 2QRKA 4JJGA 5AVXA 3TWOA 4IOKA 4RFSA 4XQ9A 3L0BA 2EJBA 3R3XA 5HY4A 2BOCC 2VPXA 5HDBB 4DY4A 1UC5B 1LWNA 1CUUA 4IUYA 4GZLA 1KK1A 4MPTA 4OBEA 4U6SA 3N2LA 4AW9A 2GEFA 4L2IA 2X8JA 3SYMA 4PDMA 1I08A 3HR8A 4D6YA 3ABSB 1D1QA 3QWAA 2Z09A 1VQOF 4R69A 3G82C 2O4CA 3PNVA 2I2AA 4G4SP 4MUEA 1D2NA 1M74A 1OGYA 1TGYA 3O92A 5EJMA 2IXGA 4XCXA 1T6ZA 3TO5A 3UUEA 4KR0A 2CXUA 4A23A 2NV2B 3O74A 1CUJA 4JC4A 4EM6A 4E3ZA 2H2GA 2PJZA 3BPZA 3GOQA 1H6CA 1IK4A 1MN6A 2VA8A 3KPWA 5GIPE 1VKHA 1LV7A 3Q41A 3Q85A 1E2GA 1R0YA 3DMTC 2JCYA 1CK2A 1V4BA 3AVXA 2OCXA 2FGKA 2VXCA 3ZZ0A 1X38A 3CA8A 1UM9B 3AEZA 3L9DA 1JJIA 3PICA 4Y2GA 5D6OA 5J4HA 1VPEA 4TS9A 1HOXA 5IDYA 4A92A 1Q1GA 3W2FA 3D00A 1H2KA 4FSDA 1NJIH 1TM5E 4HFJA 4PTLA 5CTAA 2CGOA 2JHPA 5IT9A 4FYVA 2QN9A 1E7KA 3Q7QA 5DMXA 3OMLA 1NLUA 2G40A 3S06A 3CH5A 3WWCA 1M5UA 1WMAA 2IYFA 2VCHA 4DHWA 2C3YA 3ZP4A 3SXUB 5TQ0B 1VQPF 2BY4A 3OPYA 1US8B 2VHUA 4NV1A 4IHJF 3PFIA 3N7TA 5MFZA 3AUUA 2BL4A 3FHLA 3IDZA 1L4LA 1ZW6A 2B5OA 3GR6A 1ORIA 4TWJA 2DG2A 1M6NA 1WM1A 3DVAA 1F7VA 3X2QC 4EUFA 2VGMA 1M5RA 1FVFA 3LK6A 1JQAA 1D1SA 3QKUA 4OOEA 4KH1A 4PZPA 1JFLA 1KI2A 5ADVA 1NPDA 1FFXB 1KJ8A 1M0SA 5FUVA 4LJ4A 4Z8XA 1J1IA 2ZI5A 3R0VA 2DPHA 3HLYA 4YBRA 5AK5A 4K81B 4J1TC 1XZHA 2N46A 4YMIA 1GG9A 1ZCAA 2CXTA 3CNHA 3NIBA 4GPD1 4MVMA 1XA0A 4NENB 3TRJA 2RHLA 1GZ3A 3P30A 3PDHA 3WSVA 5BPHA 3O8OA 3PDIB 5EIOA 3ZN2A 1QHHB 3O82A 1J0BA 2R48A 3GRYA 3KQKA 3KQLA 2B5WA 1QGYA 3B6JA 1NDQA 4OLJA 3T4XA 4Z9FA 5DW0A 5AM0A 2W2XA 1J07A 2BKVA 4AJ1A 3BBPA 2KI5A 4DCVA 2GDSA 1Z8FA 4OK6A 4ZXFA 3RTDA 3ZHXA 5JE8A 4OOFA 2Q68A 4O2LA 3BZWA 3GDGA 2D00A 3P0JA 3QZUA 4A8HA 1V71A 3R75A 2WAXA 3W4JA 2I3GA 4UATA 4UC0A 1G8MA 2GVZC 3JU3A 3IGAC 4QX6A 1EVZA 1QYRA 2O5RA 1YMUA 3RKRA 1AMOA 3E9ZA 2ZSEA 3DYVA 5AW4A 2BHTA 5EJ2A 3CGWA 4LXGA 3UMCA 4B5KA 2PBLA 3BL8A 2GZ1A 3ZMVA 6Q21A 4FGSA 3CXUA 3GOHA 1PJRA 2QUBA 3TL3A 2WRZA 4XVHA 4W5TA 3ZBQA 4F6EA 4MOWA 3CMAF 2JW5A 2D3OW 1JDUA 3GAFA 4RIFA 5KTTA 5MGBA 1O5IA 2IHNA 3ASNB 4I6GA 2I33A 4XYMA 4PA3A 1Y4DE 2CCKA 1CRQA 1OLOA 5GJWC 4UTRA 4JI0B 2EFGA 3U5TA 4JI5O 1XDDA 2BEVB 3QVSA 3IUQA 4G9GA 2H4FA 4Z2YA 5CDUA 2JFFA 1W4LA 5AVOA 4BE7B 1DWQA 4G5YA 2PA0A 4JYCA 1GDHA 3A36A 2L0XA 3WRXA 3B78A 2EJ7A 4F5WA 3RA6A 1DT9A 1WU7A 1MZFA 2D06A 1GGJA 4N7MA 3RU9A 1OCRB 3TRIA 1HLDA 5J4VA 1X39A 1FX0A 3H13A 1JDVA 3B1VA 4OQYA 1U4OA 1DI0A 1EE1A 3FWZA 3OSUA 4HDOB 3QFRA 4US0R 5GJCA 4K6MA 4GP6A 4D4MA 1EXDA 2OE2A 4DA0A 5EEHA 3Q7SA 5LYJA 4I9QA 2AB0A 1YTLA 3I8OA 4H6PA 5HCNA 1ZHFA 5K45A 2IG8A 1HMPA 4GL2A 4YRCA 4PN7A 4DR1O 1GKKA 4MI1A 2L2QA 1AUPA 1CJVC 1LZKA 3MT9A 4V03A 2WAYA 1ABFA 5B3LA 2QD4A 3CTPA 4CMAA 2P0EA 1XTPA 4K2HA 2QT9A 5DEIA 1NQXA 2VAWA 5JZMA 5E3HA 4MCHA 4L02A 1BZYA 3GZNA 4Z1OA 6ABPA 2BHSA 3VAZA 4CG2A 3C3SA 1I13A 3I01M 3SHFA 2QQ5A 1YB6A 2VXBA 2W98A 4RDXA 4FFSA 2G6BA 2ZRQA 1M1YB 4RO2A 5JADA 5EB1B 2YMQA 3PUKA 4CQNA 1TO6A 3G02A 2E76B 1PYDA 3N05A 1KOFA 1EFAA 4CR6A 1VP7A 2HHCA 1U6JA 2PKQO 4XOIA 4MULA 5CAEA 2IOYA 5FO1A 1XOUA 3NTXA 2VPWA 4OQMA 3ZY2A 1FFTB 4DLPA 1QP7A 4EGJA 5KYUA 1DHTA 2BDEA 2FZEA 3JZDA 3KOWA 5AIAA 3LPLA 5HM8A 1J7KA 2F1KA 2O14A 3L8GA 1JR9A 1Y4UA 3QG1A 4JU8A 2BT4A 1G5IA 2C95A 2JFHA 1PO7A 2PX0A 1ESDA 3QGMA 4OGWA 2J0UB 4PYJA 4BY9E 4UFPA 1P9RA 1VQ6V 1L7VC 5AWFC 1DRJA 4JEMA 1LW7A 1KFEB 1VPDA 3EPKA 4ZCSA 1WIWA 3ZE2B 3MTIA 1SA0A 1DC5A 2IDKA 2YHUA 4UXIA 4DV4O 5E7QA 5C1IA 3UCFA 2BF7A 4UBIA 2Q1XA 4MV3A 4O2AB 5ECWA 2C84A 2A5DA 4QDXA 4MEAA 1QRRA 3L4BC 5AI5A 1UKYA 2OR3A 4TS3A 5IYZF 3ULKA 3HK2A 4ISBA 3M70A 3VYRB 5LZ9A 1Q0RA 4FMTA 5DNWA 1R0RE 2PCLA 5K8CA 1VSQA 4JBNA 3MVEA 4FZ5A 4D4KA 1SCAA 3AW8A 5AVUA 3RYIA 4D9HA 1BEEA 1NGSA 1GL7A 4CT0A 1WB5A 1Z8HA 2GDZA 3BG5A 1WS6A 5HKKD 4P32A 3DF7A 5JJIA 3AUTA 3UKMA 1IMOA 1VXRA 2C9DA 2C5GA 1GPWB 4MCAA 3T1OA 1JWAB 1C3JA 3OKPA 3VHLB 5J43A 1L5HA 4I5GA 3SZLA 1N2OA 1G21A 1T9KA 2I1VB 4AWAA 2F67A 1RSZA 1DKLA 1P2GA 3E3LA 2OHFA 4I0XA 3HABA 2W6JG 3P0IA 4X1OA 1EX6A 3DXXA 1IXRC 4OLBA 1QXSA 3C9TA 2D2XA 3NP7A 2YC0A 2N04A 1R5JA 3CG0A 4FFOA 4FYWA 3N59A 4YC7A 1NAIA 1OVMA 4MTGA 1IDN1 4D8XA 4DV7O 3QEJA 1A2KC 3KQQA 1R4MB 1Q17A 2WF6A 2HT1A 5FBWB 3T1YO 1DBFA 1Q50A 3H3FA 4IDGA 1RHQA 2OP0A 3EDCA 4R9UC 5K8IA 3K9FC 3OMNB 2AX3A 4XPIA 3M34A 2PBRA 4XUDA 1NTZH 1E6KA 1M8GA 1XZDA 2XE6A 1SM4A 3I0NA 3ZNQA 2VDJA 4OQQA 1X1SA 1EHIA 1PGPA 5LHIA 2QPTA 4KE9A 4W7HA 1I7QB 1GN2A 3EEBA 1GTSA 2D3WA 3NC4A 3CM0A 4LGMA 1CUDA 3P9QA 4MS1B 5B7NA 1Q1AA 2I8AA 2G38A 5ELLA 1KZ7B 1YXBA 2WU0A 2FL4A 3M5DA 5HY1A 1VJ0A 4XAQA 4JGIA 1U6IA 4JJIA 4C0JA 4M1MA 4DABA 1VIYA 1H2NA 1CC1S 2C78A 3T0FA 2BZSA 4OHPA 1WCV1 1MZEA 2O48X 2BHRA 4KIWA 3I6QA 3FHCB 2YQZA 4DV3O 1ITZA 1MPTA 4PC3A 5E6RA 1A4XA 3W7VA 5LD2B 2WAOA 2XOEA 5C8YB 2X5OA 1H2BA 2OFPA 1GKLA 4L5AA 1TJYA 5L7TA 2YC2C 1OLSA 1OAKA 4L73A 3HUEA 4QEZA 3BM5A 2C04A 5LGTA 3KZ1E 3X1ZA 1U2SA 6CHYA 1H0HA 4CXMA 2X77A 4RFLA 4X1IB 2GBLA 3J80M 2VUIB 1XHEA 1FSZA 2B98A 2W90A 2Q46A 3M8KA 2G09A 4HRVA 4ZK7A 1QC5A 1UDCA 4XUEA 3PGMA 4OUDB 2D59A 5DE3A 2PUCA 4UUMA 4Z4CA 3L18A 5F4ZA 3B9RA 2PNFA 4Q3OA 3TE7A 2Q4BA 3STVA 3ZX5A 3CC2V 4YT4A 1TLTA 1S1MA 1IN7A 4IOMA 2VQ3A 4R7GA 3B8HA 1WBJB 4BBJA 2WICA 1K7EB 1JSZA 3HVKA 3BE5A 4CM4B 4UZFA 4IVNA 2GTPA 3CINA 3E8GA 2ASVA 3BWDD 3WKBA 4BGEA 2VT3A 1RWNA 4GKAA 5K8LA 3BFRA 2O8FB 2J6HA 2OG1A 3LOQA 3F1KA 3L2OB 3JQBA 4CF3A 4YRNA 4J91A 4OQZA 4P35A 4A8TA 4NCIA 2YW2A 3CO0S 3WV5A 1QG4A 1WR8A 3AW9A 3VO1A 1GAXA 1JEJA 2FW8A 2HJRA 2XUDA 3LT5A 3ONWA 4KNWA 3PFFA 1LTHR 5FQNA 4AJ4A 1VMDA 3LKDA 4ANFA 1JTVA 1W29A 4ENTA 1CHDA 1E7RA 1M93A 1XJWA 1EN5A 1UAYA 1L7QA 3EE6A 3OG9A 1LGYA 4GHWA 4LEIA 4OCZA 3FFQA 2XAHA 5EO3A 1EEXB 4UMFA 4W1SA 3HAXD 4HSEA 1ANKA 3W5VA 4CM9D 1TF7A 3AVYA 1ZUNB 3DP7A 1FYVA 4Z2WA 2CXHA 3GUYA 3SR2C 1E7YA 1GQQA 3DHVA 3NDJA 4KXXA 5LOVB 3UGQA 3QO8A 2SECE 2CZWA 1UBRS 2PZEA 3INRA 1SQSA 2I34A 3GFTA 4PYQA 1AZLA 2HTEA 5IVPA 2LBTA 4DRXA 3RJMA 3MDSA 3RT3C 3ZCCA 4HB3A 4ZU1X 5K09A 1YZQA 2IUEA 2WVJA 3Q3EA 3JCUZ 2GX6A 4AP5A 2FDRA 2P8JA 1TVKA 3AB3A 4A9AA 4JMPA 4ZI7B 1J0XO 3BH7A 4JQOA 1TA8A 1BQ4A 1K6MA 4GMGA 4X5OA 3ROEA 3U7GA 5B53A 1KP3A 1BRTA 1N5IA 3WLLA 3NDIA 5C7OO 3D3KA 3FBTA 3GIDA 4ZDIA 1ODTC 2VTBB 2J3MA 4OQXA 3DT8A 3PJDA 4R0VA 5FBHA 1QNFA 4Q3BA 1XMPA 2I9PA 3PLAC 4P7FA 2XYVA 5K4HA 4TRJA 2YZ2A 3TZCA 3AX6A 1AHIA 3FKJA 5CX1B 3T54A 4NR0A 3NH9A 2E4UA 4WF9V 1NMSA 2XVMA 3I04A 4E88A 1M6VB 4UHFA 4YRGA 3DBVO 1PJBA 1XHXA 1DC7A 1COWD 4M1YA 1D1PA 3ABLB 4BVRA 4JXZA 1NMUB 3L8ZA 3DCIA 4P7JA 2VJOA 4R1QA 5CB4A 4RPCA 1G38A 4D7TA 2PS9A 4E70A 3B9BA 2PSHA 1B73A 2WYHA 5HTKA 3DZGA 4EA9A 2WILA 2LIVA 2XWSA 3IP3A 4G0YA 2QM3A 3QTLA 4KXLA 1ZUHA 2I6SA 1Y37A 3UMFA 3K0EA 2QRNA 3U60B 3H1LH 3ORYA 5CBPA 3LC1O 1QBZA 2YN0A 4KWHA 2QZZA 2IYVA 3GUHA 2H8KA 4FOSA 4UUNA 2Q4PA 1H7MA 1JDBC 1MJGA 2GBFA 2QYHA 3MBIA 3A3KA 3EG5A 4QGFA 1LBSA 3ZWAA 1VIAA 4IDFA 3KUXA 1FFYA 4FS3A 4ZRDA 1SMKA 4AZ0A 4B7CA 2F8TA 1XNJA 1NVFA 2FFBA 2WSIA 3G71F 3T7JA 1Q7TA 2IPAB 3Q7TA 2ITDC 1XTVA 1RPAA 3LP8A 1DE0A 1WXHA 2RHRA 3C3BA 3RCBA 2N42A 3A4YA 2QMQA 1YCDA 5DYIA 1E5LA 2HQ1A 4FWBA 4B3RO 4G8CA 4TTAA 3KLPX 3U7IA 1J39A 1LVUA 4NHEA 4WZAE 4GL4A 1LRKA 1XTBA 1RM3A 2JHAA 3KYDA 3PNBA 3CX5F 5E1BA 5G02A 3ORSA 3SOPA 3T34A 4BNJA 1QIEA 1E92A 2CVHA 1QR2A 1X80B 2W6PA 1IOWA 1MO3A 2IY9A 4TZTA 4UEKA 1S7CA 3LUAA 3B6ZA 3PFNA 4IOLA 1KC8H 3G9UA 3T4ZA 1TT5A 1Y6RA 1C8KA 2VP6A 4DMMA 4EJSC 5KYNA 1MORA 4GZ6A 2KG7A 3B5IA 4BLUA 2GF0A 2DOKA 4WJLA 1G1XB 5G0VA 4YLYA 2RHGB 3HSYA 4I1YA 1IY9A 4Z7JA 5HZKA 5LMNB 4RZQA 1ZOSA 2XCIA 4JT4A 4XZ3A 4AJPA 4C6TB 4UTVA 3PNKA 4F6LA 2XAFA 1SD1A 1Y48E 5COAA 3ADBA 4ZVNA 2HQSC 1DKRA 3LTNC 4YDQA 2UUCO 1UOQA 1VLHA 2IEBA 1ZP6A 3NIGB 3ZW8A 4DILA 4FM1A 1NH2D 1BS9A 1CB0A 2JIZD 4C0WA 2BO1A 3T3MB 4MVSA 1XNRB 4LMPA 2GCOA 1Y4MA 2F9FA 2R6DA 3NRCA 1GSOA 1O6BA 4UUBA 3RW9A 1JL3A 1D2CA 2ZM6B 4D45A 3B7WA 2X7RB 3HTNA 1II9A 3RVNA 2P90A 5HQTA 1KZ1A 3IELA 4B3TO 4GR4A 5KHAA 4HO1X 1GXSA 3G85A 3Q7RA 4JI4O 3HKCA 1MX9A 3CR3C 3W5JA 3OEHA 4P58A 4C14A 2HHLA 1G4YB 5B3SC 4L3OA 2DYRC 1GK9A 4IJ6A 3ZGOA 2Y0PA 4GWLA 1IX9A 2AFVA 3JVIA 4X95A 1H3FA 1GG5A 3M2PA 5K0BA 3PJRA 5KEIA 2GM3A 4BECA 1ULHA 3G0GA 3KYBA 1JTFA 4KIFA 4N0PA 2KB1A 1NQAO 4M7WA 1NQTA 3U5ZB 3U4MA 4F93B 4W5QA 5EEGA 2C1ZA 1HRKA 4QGHA 4JUFA 2E18A 4GP7A 2X86A 4AZTA 4D6PA 1TAUA 2P2DA 2O2EA 2XE8A 4C6HA 2YH2A 2O8EB 1EBOA 3IUMA 3A06A 3KSUA 5LB2A 5HIKA 3EZLA 1RLTA 1WZCA 3COZA 3IHWA 4MUBA 4YH1A 4D79A 2NYRA 2HK6A 2LVBA 1ZVMA 1PK8A 3G80A 1W3EX 4JGSA 3ZJVA 1FDSA 3KUUA 3RABA 3V6LA 1II8B 1Y3HA 1U99A 1P1CA 1AHPA 4BFYA 1P4SA 4DR7B 3GLVA 4MCJA 1NBMG 3SJUA 3W5SA 3WLKX 4PI2A 3M84A 3BHMA 2WWWA 1BDBA 2CT8A 4Q1AA 4LQLA 2UV8A 4ZHVA 4RBNA 3WADA 2WUFA 4MWGA 4BV8A 2GYUA 4Y9TA 5B6IA 4X3PA 1MIOA 1AR1B 3SYPA 1VL6A 1Z4LA 1XHZA 4B76A 1Y6QA 2PJDA 1XRQA 4F71A 1ZN9A 4KN9S 5FJJA 3A9VA 2ENUA 3EZ9A 1BJTA 2AK3A 1XXHA 4MTXA 2A1TS 1FTYA 2WK1A 1W4CA 3JQDA 4COKA 3G1TA 1UFYA 1QFSA 3D2LA 3TSYA 1U7UA 5ENDA 5LBQA 1A9QA 4J76A 4QAQA 1ZUD1 1GSIA 3EFOB 4PF1A 2LCAA 4O2BA 1EWTA 1JIVA 4AY4A 3PENA 3OQOA 4GP9A 3PGVA 4DR6O 3HCNA 4KUHA 3N2IA 2NTEA 5IN4A 2QMOA 3ELCA 1KYZA 1X2BA 5I8ZA 2OTLF 2QU7A 4XX0B 5LMUB 2C92A 1TZKA 3HJNA 1UFQA 2IQ5A 1UWVA 4ND5A 1JQLB 2YR0A 3H1BA 2FEWB 3GUVA 1YI2V 3ORRA 4OQEA 1GR1A 2IOFK 3WISA 5TLSA 1LDMA 2QAJA 4LXUA 1UBTS 1TTPB 2Y1LA 3UPDA 2FTKE 1D2MA 2ACEA 1OZGA 2HSZA 2QK4A 2VZ8A 1VJTA 1XROA 4GKJO 1JU4A 4QWWA 3W34A 5CCEA 1CDEA 1OLUB 1L8XA 1CW2B 4IGEA 1N2CE 3WLPA 4H1WA 2Z8YM 3O3CA 3M6VA 4TVOA 3KEMA 4RVCA 2QUHA 5JQGA 3EGDB 1OCCC 4MVJI 1F7UA 3S0JA 2XRFA 2ZT5A 3E48A 4HNSA 4KSCA 4YK7A 2REOA 3MWJA 3MW8A 3RLFA 3CLSD 1T6YA 2J59A 5KJCA 4LJYA 4EZIA 1SQ6A 2C20A 3F90A 1KA9H 1U1FA 1OY1A 3OR7C 1C1YA 1XNQB 4JIGA 3VNUA 2BGNA 5FDFA 2M98A 3V8VA 1MB4A 4FFNA 2M6LA 1S2OA 4FNAA 2ID9A 4ZQGA 3KE9A 3COPA 3EWAA 1U94A 2FSGA 2PBZA 4QICA 1WSBA 3UTCA 1W85B 5AW0A 1J97A 4FE4A 1I10A 4FQ5A 5EAIA 5L3QB 5AKYA 3GC6A 4NAVA 1N4DA 4DM7A 4O4JB 5CBKA 4KH0A 1J09A 3WGQA 2OCLA 3D0OA 3ETDA 3W79A 3CF2A 4DV1B 2ZFUA 2NNUA 3L5OA 3NAQA 3O8NA 4BIMA 3CC4V 2J4DA 2VRNA 3RN4A 1E8NA 4LMBA 4MRNA 4WW0A 4XDYA 5F35A 1KMQA 1XD2A 1IQPA 2R6ZA 1EJ6A 2KWIA 3ZRVA 5ERXA 3JTMA 3UOAB 4RTLA 3SP1A 1GN3A 2ZK7A 3NWBA 3E1KA 3FOEC 4YAJA 3KQMA 4RKRA 7MDHA 3KZXA 2H65A 2OGSA 1DRWA 1SKYE 4NESA 1RZVA 2A30A 3D7LA 5BOSA 4NXMB 2IIBA 3VC3A 4MVXA 4ZC1A 3BEDA 2QSJA 4LHEA 2PPVA 3SZRA 4AJHA 1Z8DA 1J20A 1J1ZA 4W1RA 3RK4A 2IH5A 1XU4A 3OICA 3RB8A 2YV5A 4NTYA 2ALEA 2BI7A 3NBAA 3UAXA 1IJFA 1W42A 1WAMA 5BV7A 2GJAA 2ZAMA 2PT9A 1NYLA 4FYPA 4UHBA 5K0FA 1ZA1A 3NHPA 4KV7A 1H8EA 2QTHA 2HAEA 5KAMA 2VOEA 3GJ7A 4WTOA 4BNXA 2EW2A 5C8DA 3V2GA 1E0JA 3VQTA 3WXBA 4EI2A 5BSEA 1FC0A 4EYSA 4WMLA 1NTOA 4RJIA 5EE1A 3RNLA 1DKMA 1X7WB 3GLIB 5JJ5A 3IAFA 3BMOB 1GSAA 2IUFA 4YQEA 1EESA 5B1OA 5JV5A 1HDJA 1E4OA 2AF4C 2IDJA 2ILTA 1B8OA 3I9MA 2ERCA 4FSXA 5EUQB 3UKOA 4ALLA 5BPFA 5BSVA 4EJSA 5I01A 2CDAA 3CZPA 4E1AA 5WRFA 1D9XA 1RLIA 2XDYA 4RHTA 3G49A 4DR5B 1B3QA 1CCWA 2HA0A 1PR0A 2R4UA 3K16A 1MJFA 3E03A 2IYSA 3FUUA 3PE4A 1U0BB 4KL1A 5C0OE 4PX5A 1KP9A 4ZVMA 1H42A 1PJQA 3T7DA 1DUSA 1J5EB 2Q1YA 2H4XA 2J1LA 4BQFA 4FZ0A 4WZ6A 5BMVA 1LW6E 1Y8RA 4HUQB 4Q7KA 5AKEA 1T3HA 3Q7PA 4EUKA 3NW9A 1XKXA 2GQ0A 1EX1A 1WZIA 3BMCA 5FI3A 4BCDA 4F3CA 2CLCX 5AW7A 2X8WA 2QR5A 3ABZA 3HR4A 4KV9A 4RHUA 3PX3A 5C4GB 2K2QB 1GAEO 1PFVA 3FNHA 3L1JA 3R44A 4JWTA 3R7FA 4AJNA 1KZYC 1X13A 1IRIA 3PQ4A 4PSAA 1MDFA 4XSHA 3WBBA 2XTAA 2NW6A 1XEXB 1KTVA 2JFQA 3KVYA 4M54A 1LRJA 1Z4KA 1FW6A 1S5PA 1X52A 3ZV4A 4AKHA 4K28A 4WLEA 2Y66A 3HWRA 1Z4PX 2VDLB 1KQSU 4LF8B 3ZMZA 4FVTA 4OH1A 3SZ3A 3THXB 1T8WA 1RDFA 3FCEA 3LWPC 2HF9A 4JBXA 3AK2A 4JPRA 1AUOA 2H2AA 2JIZG 5KS2A 1YR1A 1UPBA 4IKOA 3PPYA 4MI9A 4Y2PA 4KQHA 2DPXA 3MWFA 3X1WA 4TWKA 5L3GA 3PYLA 4LV6A 2C4VA 2HRCA 4I3GA 4ZCLA 1M34B 1H5QA 1WQ4A 2AJDA 2W2QA 1FYXA 3P19A 1YKSA 2EIXA 1G9TA 3AG2B 1GGNA 1JU3A 3DKVA 3X2SA 2X19A 4YUXA 1OHHG 1M1KW 3JVDA 3O26A 3V7UA 4FDVA 1RTKA 2WB4A 1MU0A 1XD9A 1QQ6A 1NVKA 2YXBA 1UJWB 4FOTA 4HGYA 4HNAB 2QA4V 4CH5A 2YYSA 3GMDA 3RVMA 4NVPA 4KVGA 5IXSA 4IHAA 3GJ4A 1GIAA 1KY2A 3IMCA 4YJHA 1VPWA 1IHXA 3IAXA 2GCEA 5LDHA 2GCPA 2V7XA 6GPBA 1UZUA 2GTIA 2IP4A 2QZPA 3T9EA 4PNZA 3D1LA 3HCWA 4LCBA 4OK3A 4PXYA 1NFFA 2JFGA 2A35A 4K3VA 1SN7A 4DOMA 2WWYA 4Q5IA 3U49A 2PLNA 4ISCA 2FPKA 4MX8A 4AY2A 1ZW1A 2ECKA 4KQ6A 3TLAA 1PGQA 1V6CA 3F49S 3DFFA 3K2BA 4BW5A 2RI6A 2ZAIA 4HDMA 3A6ZA 4FDMA 2HLPA 2XASA 3FB8C 3VJLA 5DGCA 3P4EA 1M2VB 4NJEB 2GA9A 2ZRKA 5HFJA 1ND6A 1I4WA 4Y2VA 1JHZA 1JZSA 4F8JA 1GTG1 1GITA 4HWRA 4ARIA 3LVRE 4TWIA 3BYZA 4KMRA 5DHPA 3OTIA 1JEOA 1UWLA 2XH8A 3HCRA 4IGKA 1J6UA 2K87A 2M6SA 4MIOA 4NPHA 4OMCA 4TSFD 5K9ZA 2JFPA 3B8NA 3LGXA 2ZUFA 2V1XA 3AP1A 4ND3A 1F3LA 3LSSA 5CM9C 4F1JA 1NRWA 1CY0A 3W7TA 4P92A 4K9SA 5FB3A 3NR2A 1Z4MA 1YQXA 3HFRA 1LLUA 4FU0A 4NNPA 1JLSA 1RM1C 2FRDA 4OYRA 4QE3A 4U7HA 2C3PA 4B2LA 4CV2A 2VHCA 3PUWA 3ZDXB 4E2FA 3S8EA 2D1FA 1VP3A 1YE8A 5L51A 4JC5A 4MWSA 1NULA 4R6WA 1M72A 7YASA 5JXJA 4CBCA 2GZAA 2BZ0A 4EK9A 3GEIA 2IWRA 3I4FA 2CHFA 2GJSA 3L6OO 2BGUA 2AC2A 4P9NA 5CYPA 4EL5A 4ZIRB 3ICQB 2QTNA 5EVCA 2CZCA 3OVMA 2JJ2D 4CLXA 5DCWA 1EK6A 1IZ7A 2CL0X 2GYVA 1X8XA 4URZR 1YQUA 1Y1PA 2MIIA 1NWCA 4MW8A 3VNAA 4H37A 4B3RB 4DCGA 5A5FA 3DWIA 5K0CA 1BAPA 4Q3DA 4JLDA 2P5YA 3TGLA 4YRKA 1NVPB 1NXTA 2ZKIA 2W2LA 2J9GA 2BMWA 5AG2A 3U26A 3O0DA 1YIJV 3E58A 2Y67A 3TZLA 1V1RA 1P9LA 4M0EA 1FBTA 1NJ8A 1OJLA 2LFRA 3ZJ4A 5BXQC 1I5RA 2EIJB 2P91A 5A2QN 1U5BA 1VPLA 1JJ2U 1JMVA 1UMCA 1DOZA 1E69A 3CCEF 2N0SA 3FG9A 3MWEB 3OX2A 2BHNA 4GKVA 5DSTA 4DNXA 4K88A 1H38A 3U56A 1ZGAA 1Y5MA 2GEBA 2PZBA 2XYGA 4G2TA 1L5GB 2HU8A 1JHOA 1RXWA 3T9BA 2J6IA 5ABPA 1VTKA 1ZH0A 2BMAA 3IV7A 1TVMA 3BDIA 4A2QA 3PDWA 3EOAI 1WCYA 2A88A 2HA2A 4ZOQI 2VUSA 2XMBA 3JTEA 3SQNA 4KLRA 2REXB 4QOFA 4EH1A 1I80A 3ZWXA 1XQ6A 5EAZA 4TSFA 5EESA 5E9JA 4KFMA 2XRZA 4MWEA 2IEDA 2ZM6O 1KBHA 1JN1A 1HE1C 4BX2A 2EBFX 1K4MA 2EIMC 1X25A 5EIBD 4AKTA 2HVJC 3VYUB 4LKRA 4UU0A 2OHVA 3CUTA 1B6QA 3CJHA 1YIDA 2JNWA 3ABOB 4JH0A 2FE1A 2RKOA 1SF9A 4H08A 1XYGA 2IELA 3R41A 3ZHOA 1PJ2A 3DP9A 4ZQHA 4DV0B 2DUWA 1MOZA 4ERNA 3KQWA 4JLNA 2ZDIA 1XBIA 1NN3A 3L75H 1N7GA 2BBSA 2OO5C 2IOFA 1MAHA 2X9VA 2V7VA 3H9VA 4FC6A 4JJZA 1CJMA 3IJPA 4ZK2A 4DAEA 3CCUF 5HXAA 3WLTA 1YVPA 1DXHA 2CCJA 3KKKA 3PVSA 2X58A 3UQZA 3VOBA 2Q0OC 2BH9A 4Q39A 4YUZA 1Z6PA 1W8DA 5CXQA 5JY1A 3AEIA 1UPAA 4LX8A 1D0VA 5LBTA 1WP4A 3EAFA 3LSQA 3GJZA 3LG2A 4G56A 2WWFA 2W2LD 4J0CA 5ALYA 3ZX6A 5JMTA 4UV8A 5JD6A 1ETHA 5D3MA 1LNSA 1YB2A 3EEIA 5H81A 1Y7IA 2DMRA 4J7AA 3TQIA 2VAPA 2PGOA 4LCKA 1LTKA 2ZVZA 1XWFA 3KHSA 3MF4A 1Z36A 3D6TB 2W71A 2Z9BA 1FD9A 4L8GA 4BQPA 2B8JA 4HB0A 5KQSA 3UJBA 2PX5A 1R1MA 1WJZA 3HB0A 3QELA 4N40A 4PLWA 3KQHA 1RJ9A 3LBNA 4ZU3A 2ARHA 1P9NA 3HJUA 1OKKD 3HUDA 5FOUA 2QX8A 4U00A 4Y6GB 1DEHA 4KPYA 2CSUA 2DZDA 4LDNA 4IFTA 4RETA 1IUPA 4Y6RA 1K33A 5EIXA 2CVFA 4DREA 2JGAA 1IXKA 3CRQA 2XWQA 2EFDB 3HI6A 2XUMA 1B43A 3L0ZA 3T2MA 2XY4A 3N6XA 2VTDA 1K6XA 4M0LA 2XCQA 3OTFA 4BO8A 1ZINA 5IFLA 3K32A 3GPLA 2FKNA 4PX3A 3HCBA 4R51A 1Q95A 3E20B 1E2UA 1V8ZA 1Y7TA 3QNUA 1JQ5A 1U3VA 4EY8A 3B1ZA 4EHNA 4ILKA 4Z9BA 4DCJA 1MJ5A 2G1KA 3GUCA 1GFZA 4F9FA 2WLLB 2O8DB 2G0NA 4E4YA 3TLJA 5B1NA 3H2GA 1W1WA 2BR5A 2JLAA 4IRXA 4CM5A 1PJLA 1TMGE 1WHSB 4NOLA 2O3UA 3ZY6A 5DI3A 3RH0A 3MCTA 2XHBA 3RFVA 3DBIA 1PK7A 4TTPA 4HNGA 3H11B 4CEHA 3FKQA 121PA 4MLCA 4C1NA 4RYLA 4FFLA 1NMYA 4KQEA 3I64A 1YJCA 1A9ZA 2F66C 1M8KA 1KAEA 2HHAA 2ZB2A 3GGCA 4CKCB 2XNDA 2H63A 4KIJA 1G6UA 1BNCA 1USIA 3DZKA 5C4MA 3GP8A 1AURA 1UXOA 4DIUA 1HUQA 1AC5A 3ENZA 3RU2A 2VUUA 1PUXA 1SHLA 3C39A 4RK0A 4L50A 5AIBA 9ABPA 1KERA 3D54D 3WL5A 1PQYA 4AILC 1GMGA 4INOA 4HDNB 1CPYA 4RPJA 5A0TA 3UK6A 2CE7A 3PX7A 4EPVA 5J2TF 2I7CA 5KX5B 2AMTA 1PT8A 3IP1A 1AGRA 1XMOO 1BQZA 4GC5A 2Y27A 1TJ4A 3C9UA 2SCUA 4NBUA 4MSWC 4NICA 3ZKWB 4CW7A 4Z53A 3IE1A 4JT2A 1E5TA 1FUKA 2KQUA 1SAYA 2JG3A 4IJKA 4MV4A 3DXRA 4R05A 3B1FA 3K1AB 3LUFA 2Q29A 2GZSA 4J0DA 3RVSA 3KT0A 3L7BA 5LNK6 2KLHA 2QRPA 1D5NA 2AJCA 2ESRA 2RGAA 5KB3A 2QKCA 1X92A 2WWRA 3GT7A 2MOKA 3V8RA 4YCNA 1MDBA 1FJGB 3PUHA 4V0ME 1XQVA 5EIWA 4WVLA 3DEKA 3O9ZA 4IBOA 4UJ5A 5BSTA 4CEIA 4I1RA 1G20E 4ARUA 3PP8A 3V9AA 2LO1A 4YI3A 3T61A 3R8XA 1D5WA 3WK5A 5FWDA 1A32A 2J9YB 4CKZA 2V7QD 2FUEA 1SXJE 2R8YA 1XEWX 2AE2A 4X64O 4NXMO 5DGHA 3VJKA 4BKQA 1QZTA 2E0IA 5BY2A 2QTPA 4UB6Z 5C46F 5FJIA 5F33A 2EILC 2ACWA 3I5DA 1LUVA 4MT8A 2PX4A 3L71H 1CWUA 2X42A 3R5KA 1IXMA 5DTMA 5IBPA 3DLPX 2CXRA 2G17A 3RAFC 3DLBA 2NR5A 3L7CA 1ULBA 2DUNA 3V4SA 4EY4A 4FJ0A 1HE8B 4DR3O 1HZZC 2X0KA 3UJ9A 6YASA 3M9XA 3DV0B 4WFBV 2ZDQA 4HWKA 4CM3A 3BHPA 1VIMA 2QBYB 3COSA 4H1TA 5LJIA 3B5EA 2H4WA 1Z0UA 3H6HA 4TSFG 4N41A 2Z5VA 4YJ2B 2ZUSA 3PNSA 4LS3A 4GRIA 1UPFA 1DBPA 1TQ8A 4RIGA 1DJMA 3J81M 4RTOA 4R8SA 5A3SA 4CVNA 2AQIA 4IJQA 4UNIA 4D9GA 3PRJA 1K08A 3JALA 3OM1A 2IKSA 4XI9A 3TQQA 1V5IA 1AD2A 2Q6OA 2R1VA 1KDYA 2Y69B 4CM6A 1A77A 4DLNA 1QH0A 1V4VA 2UZ4A 2IU0A 1IPFA 4B6PA 1SRYA 4TXJA 2HLDG 1OZAA 5HM6A 5IZ4A 3EIXA 3QV2A 3SIXA 2X2FA 2FWAA 4BE9A 4IF4A 1YRBA 3ADKA 3DAOA 5JPDA 4UW9A 3J7AC 3DDNA 4ZJYA 3ZU5A 1KJ9A 2R7LA 1VOTA 3A0RA 4RD1A 2VSYA 1N6PA 3OE4A 4V2UA 3RYFB 4FGKA 4M1SA 2BOBC 1SHKA 3E8BA 3CPQA 3Q0IA 4MZDA 4QC2A 1X6VA 3ZHZA 1OI4A 2ZRAA 5HOEA 2HWYA 1G8AA 1L5RA 3A9RA 2EWWA 2FUKA 2ZRLA 4EMBA 1OA0A 3SIWA 3E05A 1BCRB 4P2BA 4AJEA 3QBJA 5FPOA 5JJNB 4I2NA 4OD0A 1J8MF 3N2YA 4ZHQA 4V2IA 4C0AC 6REQB 5JS8A 2ODBA 2Q7XA 4H4DA 3AHIA 1B26A 3QF4B 3HYNA 3I9V1 2QX7A 4DR1B 3INNA 1I6LA 4GYJA 4FLUA 4CG1A 1QPZA 1FFSA 1Z7YA 1ZGHA 4JQZA 1DQZA 3E9QA 3K59A 4DK0A 2X0RA 4LV5B 4U5QA 4Y2UA 5F2EA 3UV6A 3GQBA 5FOQA 3THWA 2WLKA 2O5EA 3E9RA 4PO3X 2IXBA 4AJLA 1O6FA 4DZRA 3H97A 5IABA 3CCJV 3KKQA 3T5TA 1ZUIA 3FUTA 3H8VA 1O6ZA 1OPXA 4LJLA 2FZCA 2EIKB 2ZUWA 3NTOA 3IMPA 3E2PA 2QE7G 2GTHA 5DECA 1UM8A 5JH7B 3CKYA 4HZUA 1ZHOA 2B78A 1WW2A 2ID4A 3TXYA 3REQA 4K8XA 3I9LA 4PLZA 2LW1A 4C7BA 1TMKA 2FX2A 1ZMTA 4J3FA 4Q9IA 3I6ZA 1FU4A 2VZEA 1J22A 4P36A 2Z8YA 5BR8B 2H0AA 4UOZA 2YBDA 3D01A 4BEBA 2RNBA 4R2LA 3K0CA 1DQSA 4RHFA 2PHNA 3OT5A 5MN5A 1TCCA 4QASA 2XCOA 4IQFA 5AR1A 3TOXA 3VV2A 5LKAA 1JILA 1QFYA 1NNI1 1Z15A 2WHQA 2CSXA 4IILA 1JJ2F 1LNQA 1DFGA 3PEUA 4TMFA 5SV2A 1MO6A 4M3NA 4BVFA 5H02A 1M2JA 1PT7A 3LPDA 1AB6A 2KBFA 2YV2A 1H3NA 1C4XA 1T9BA 1ESCA 2QRQA 2YQ4A 4Q82A 4XYGA 4WNAB 3FFWA 3GEGA 1ABBA 3K6SB 2AWOA 1M2EA 5HJ7A 1S2IA 4DDUA 4B79A 5JCXA 3U6KA 4ZEOA 4X3OA 3O4VA 3SPHA 3IMEA 2Q0AA 2Q9LA 5IVIA 3E9CA 1BOOA 1ATIA 3JYPA 2CWJA 4IDHA 1DX6A 4G4ZA 4XEUA 4KR7A 3RKSA 4BUJA 2JDIG 2P0YA 4LJ8A 3RJ9A 3I1FA 1LC3A 1XD8A 1Y42X 4PLTA 5SZJA 4UVIA 2BFOA 3SC3A 2WJIA 3WYDA 3RHTA 3K0TA 4QGBA 3U11A 3L92A 1Z07A 3D2BA 2QJFA 3WNBA 2XECA 3ZYCA 5KTNA 3LECA 3MS7A 2DGDA 5J47A 3FTDA 3HDJA 1E3MA 4DG9A 4NU6A 1OCEA 3ASYA 2VNKA 4WI1A 1PW5A 3CUWA 3RS9A 2GKSA 1N5LA 5DTQA 1LJUA 1F4PA 2UUOA 3I32A 3DOCA 1LY1A 3N2GB 1ZMBA 3DMTA 1B2RA 3F46A 1NM5A 3MILA 2NG1A 4TYPA 4CMEA 1G2PA 1GTOA 4M7PA 3RWMB 1HDIA 4AAYA 3CXHF 4JK3A 1BE0A 1Y9DA 4GICA 5D1NA 1GP2A 5ALRA 1R88A 3F47A 2NM0A 1H1TA 3KYJB 2C4HA 2A86A 4IIJF 2BMJA 2W8BA 3RROA 2WIKA 4RIEA 4Z1VA 3RFUA 3H2BA 1S4MA 4MW2A 1IHYA 1QCEA 1P4GA 3BGWA 2HA7A 1L8LA 3IRUA 3M6MD 3R3SA 4QPJC 3ABMC 2IYAA 3SLGA 3ETLA 1N6LA 3ZU3A 3K70C 1UPGA 5KAPA 3RS4A 4F3YA 3ZV7A 3PPIA 3J81A 1LTQA 3CZQA 2YYZA 3IFSA 4NH4A 5B8FA 5J2TA 1G21E 2C00A 4JAUA 2IHTA 1RS0A 4LGCA 4EY3A 1OH7A 4R8LA 3MTEA 1Z4QA 2CNLA 3P96A 4CZ2A 3G1UA 1S5HC 2HNKA 3QMPA 4JUIA 4NCNA 4RE6A 5HK8A 4L08A 1XRLA 1I2AA 2NUAA 4GRAA 4NU0A 4OK5A 5AVKA 4GGMX 2VI5A 3IDAA 2K2WA 2X8LA 3ROXA 4LY3A 3KYIB 1EBBA 3AHGA 3EA4A 5NLLA 4OSOA 3NQ41 4KBGA 3HUFA 1KTIA 5JFTA 3BVOA 1VRVA 4YAFA 1Z28A 2G4LA 1A9OA 4YCDA 4A0QA 3AEQB 1IXZA 1W44A 4N0QA 4NONA 3BXPA 1N36O 4W8HA 3RRMA 3SU8A 3OJOA 3TTSA 2X2OA 4UEJA 4P83A 4JHLA 3UCEA 1Y74B 2ZJ4A 5KHJA 1DQRA 2NU7A 3QW4B 5DM70 4Z1MA 1H2SB 1WDTA 3BBLA 3JZAA 2BI4A 2FUG1 2QVBA 3AOEA 4C81A 3N8NA 4MINA 3ZTWA 5DM60 2H11A 1O1YA 2WIFA 1RHRA 3IEKA 3ZHYA 1I2ZA 3EQ7A 3JQ7A 4L76A 5JNRA 2IPMA 2I7XA 2CHEA 4CUZA 2OUKA 4P0TA 1AK1A 1QH1A 3L8YA 2RGDA 5HZGA 2BKLA 5CIWA 1SZXA 4U2CA 4DXWA 3TQSA 3MWDA 1Y8QB 4ARVA 1JHUA 4TM7A 1B6TA 4YFVA 1E3QA 4L75A 5B66Z 4JR1A 3LX8A 2WIAA 3O38A 1QU3A 1SCJA 4WY5A 1O95A 4BVHA 1N36B 1ULAA 3ITDA 4M37A 3NXSA 5E0OA 4DMUB 3HYRA 5D5PA 4S2UA 2WB2A 1ORRA 2WE7A 2YV3A 2A79B 1QV9A 4W5RA 4B6RA 2ETNA 1QAMA 5J1SB 4EMUA 3C2QA 2NYUA 2ZOSA 4WKNA 1M5TA 4FOPA 1XZKA 3A6LA 3WB1A 1DUVG 2XIJA 4MTCA 2PYZA 4HSGA 1MAWA 1RCFA 1YSCA 2YMPA 5JSUA 1P80A 3WLQA 3CHXA 1SG9A 3LHIA 1NW4A 3TSAA 5G4KB 5TGDA 5JS6A 2AMFA 3O4HA 1BYIA 4ZYYA 2JFYA 2IIVA 1E1MA 1ZC3A 2V6IA 2QORA 4JL6A 2Q45A 2X76A 5DNYB 3MUFA 3PLNA 4XR9A 3C5VA 3U6BA 2Y05A 1OBOA 5L3EA 3OBYA 2YV1A 3AM3A 1AILA 1BVRA 1FZQA 4Q03A 1U7DA 2NN3C 2ZJ6A 3DNPA 3P0EA 3APQA 4MRMB 1YB1A 4BLSA 4UQLA 2DE0X 2YRXA 2FQ1A 5EHNA 3JASA 1R6KA 2J6BA 3BA1A 4BMCA 3KZVA 2FQQA 1BHJA 2Q3LA 4L16A 2P4QA 2ZBGA 1HK7A 1AJNA 4MW5A 5HKKA 1H9CA 3B6IA 4HGPA 1TEZA 1PNMA 4YY3B 3IR6A 4BVJA 2WV7A 3Q4HB 1LBHA 4KNYA 2QI2A 3IIJA 5CT8A 2C83A 4C21A 3UM7A 4F4CA 3MBKA 4DA9A 3F5FA 2XX3A 4KFCA 4F3TA 4G8DA 4RUFA 2FEPA 3OTOO 2R68A 2W6JD 3SHQA 3WNCA 3FPSA 1K7DA 1QUFA 3ANNA 1UFVA 3RFTA 2FPXA 4DO2A 2WYUA 3L1HA 3M5WA 3OT7A 2WTXA 1NXXA 4KKXB 5CT9A 5DWVA 2NMUA 1GRRA 4X1KA 1NSFA 1SHZA 3JWPA 4QEKA 1FXVA 5IJ0B 3WMWA 2I3DA 2O1EA 3L49A 2P1DA 3NDRA 3MGAA 4K9QA 4CCWA 1QHHA 3ASZA 3SKVA 1H0KA 2ZRHA 2Y93A 3V4RA 3ANYB 5AVJA 3UENA 3TDNA 2O3JA 3WGZA 1CT9A 3D3WB 3I39X 1JY8A 5C52B 1Y3IA 3C1TA 4GGPA 3SS8A 1K7XB 1NKSA 1YR7A 3ML1A 3RTEA 1Z2CA 2J5RA 2F3PA 1DAPA 1XZIA 4PAOA 1EZZA 1G4HA 3CJQA 4J8PA 4N6GA 4RTSA 3B8EA 2WVHA 3FMOB 1RC1A 4N12A 4EP1A 4O4HA 3LOUA 3CLSC 3LKZA 3NBKA 4RANA 4U8HA 3WA7A 1KQ3A 1EUDA 3K5PA 3I8SA 1YL5A 2J6CA 5C1OA 1WUYA 1H5UA 5DBGA 2CYBA 5FL7A 2QN1A 3THSA 1UZAA 4BQNA 5U9CA 1VIBA 3QNEA 2VF8A 4JN6B 2IK8A 4EOGA 5AW1A 1OXKB 2V6BA 4DEXA 4WFKA 2YDXA 4K6GA 4EA6A 1SQVH 2VAVA 4HXEB 3PR3A 1AQUA 2DB3A 3W5BA 1V8BA 1Q1QA 1HG0A 4TLBA 1Q6ZA 1LBQA 4B1FA 1DJLA 2YXHA 1F0YA 3U0OA 1QVRA 1I1OA 1J2RA 4NATA 4L0CA 2GHRA 4AKSA 1YUNA 4QLBA 1CUEA 2FETA 2ZIAA 2LXNA 3WGNA 2Z8XA 1IY1A 2QQ0A 5ETJA 2Z01A 3LO8A 4G89A 5KOHB 1QO9A 2CFSA 4NULA 4WCFB 1PG5A 4QLOA 1VQ6F 4BP3A 3RV3A 3SM9A 4B3IA 4EYQA 4JTCB 1UMBA 1R27A 1JV2B 4CMJA 2PGLA 3KSBC 3K3PA 2EWCA 1OBHA 4PO1A 3W04A 4BGIA 4C3VA 4F85A 4S1TA 4G5QA 3HBLA 4YRQA 1H2FA 3GWZA 5LUAA 1KH2A 1JRLA 1HQYE 4DV2B 2ZREA 3BSSA 5CA3A 1RXEA 1VPVA 3V6MA 4JFAA 3GL9A 3R09A 5LP6C 4KITB 1U5AA 2HCBA 2QL9A 3HBNA 4L5BA 3BAFA 4OIFA 1CS0A 1RACA 1YBFA 3HS3A 4TQFA 5DX0A 4B6OA 4WBNF 5LYJF 4DKXA 1MW8X 3HZOA 5CT6A 3AGQA 1N7IA 3L4JA 3G0HA 4PC1A 1JR4A 1U4NA 5HFLA 5A2QA 1WHTA 2H1LA 4X1YB 1JG3A 1XCMA 2YJ6A 2DHDA 3JQGB 1N8KA 3DEJA 2A3QA 2Y48A 1BCSB 1K88A 3JYHA 5DX8A 4M76B 2XYPA 5HF6A 2DPMA 5IT4A 1KVTA 2FMFA 4DF3A 1NTMH 1NBIA 4HQ6A 2C98A 3U0VA 4Q1BA 4DNOA 3D6JA 1U7TA 4NTXA 5CA1B 3QLUC 5CG1A 1DJNA 3P9PA 2NP6A 4D6XA 3H5TA 4WOCA 3LQ4A 4COOA 2ZJ1A 5FL7D 1ZJ4A 3GCGA 3P4YA 4E7PA 3PFHA 4MW4A 1JHPA 2XQFA 4ETWA 4P93A 3EMBA 4K03A 2Q4EA 4M89A 1ZDMA 1WN7A 4GXTA 4M53A 3V34A 2C9YA 4EYGA 2P8SA 1E7WA 3EGXA 3P2JA 1ZGGA 4MA5A 1KVQA 2R3SA 3F3SA 1CQPA 4W99A 2E1RA 4ZCTA 1V37A 3JSXA 3PR1A 7REQA 2V0GA 4PLGA 4NOJA 3BL6A 1GVHA 3IAS6 3K09C 1FP6A 3TMYA 4UVBA 1GWNA 3LVBA 4QBKA 5GJBA 3EF3A 2VEDA 1XALA 4GSKA 2QD2A 2DSTA 2NSDA 2P9JA 3HY4A 4WKBA 2XBLA 3I9FA 5CGQB 4B4KA 4PHFA 4IFEA 2ZAUA 1COWA 3QE3A 3HRKA 1OV9A 4V02A 3GJ8A 1ORTA 1Q5PA 3Q98A 3GLFB 4LUCA 2XKAA 3WZMA 3DC7A 2R4TA 4ERHA 3R7AA 1PTJA 3C24A 3NDBB 1ZL8B 1JGTA 1K2VN 1ZAKA 3ESDA 3TN7A 3B36A 1SBQA 5KYYA 3AJ9A 3G0DA 3DBHA 2ROQA 2GNAA 2XAAA 4A5UB 2V7EA 3H87A 3K4QA 5EWRA 2DAPA 3CKKA 3MOIA 4I4CA 2JGFA 2IV2X 2VDUE 1C30A 4RMHA 2IV3A 4DDWA 1C3OA 2CHGA 5HBGA 2L35A 2FH5B 4DV6O 3N9IA 4ZODA 4OHRA 1RZUA 1XZNA 2AJTA 1G4AE 4FHGA 4Z0HO 2BYTA 5A5GA 5JYCA 1NG1A 2I76A 3OZVA 3G88A 1X9GA 4TUYA 5DNCA 2BFMA 3TRHA 4QTUB 3PUJA 4JTDB 3IO3A 4IDPA 1Z9BA 4E30A 4G28B 1K7SN 5FFMA 3M3DA 1FYJA 5AUOB 3KB2A 3FPEA 4WVFA 3RAEC 5K8TA 1JQDA 2RI1A 1H2XA 1VJCA 4PG5A 3QJ5A 5FHQA 5EC2C 1L7MA 4O4HF 1N1GA 4OXNA 4MRSA 3D8CA 2ZJ8A 3UFBA 1NFRA 5CVDA 4QELA 1IWPB 4KQ2A 3J81k 3SYCA 3VVLA 3NLLA 3DYBA 1Y89A 3HKDB 1XJ5A 2OMEA 1NJ2A 2FMUA 2ZJ5A 3OKFA 4NJOA 4O0MA 2EATA 2WD7A 3KXDA 1MG5A 5M34A 2HP0A 4D9BA 3HYLA 1IZYA 3CXCF 3LDFA 2XXBA 3A9TA 4K9RA 3QBDA 1QLEC 1HNXO 3HXQA 5DNEA 4IYJA 3CCLV 4MTLA 2FLVA 1OSNA 4IINA 2QTCA 2H3HA 1SIWA 2H85A 3AR2A 3TX2A 1A9SA 3A3OA 3Q3VA 2DN9A 1N2CA 3NM6B 1MRNA 1JYEA 1QMPA 4RQUA 2WLSA 3TZBA 4OHUA 4PQGA 5FNVB 2UUPA 1I2DA 4LYGA 4MQFA 1VPTA 1KRHA 4OO3A 1ML4A 5CLJA 4LFCB 3CCMF 1NOJA 1ZOIA 2WNIA 2XDAA 4ZAYA 5A9RA 1EHYA 2WG1A 1PUJA 2A5YB 2FZ4A 3A1DA 5KOIA 2F93B 1NQ5A 5LA6A 2B3DA 4GPIB 2NSYA 3OFNA 4NDNE 3QVUA 1SDSA 2Q27A 1SCUB 3PIRA 2HMWA 3QFFA 3E9EA 4HRXA 3AB8A 4JLMA 1YQNA 4CMIA 2B3TA 1OXUA 1ATZA 1Q1NA 1NVXQ 3A26A 3S8YA 2NSJA 3ZK7A 4QUJA 5D84A 2Q0XA 4RM3A 3N0WA 1V7CA 2XCLA 2F8SA 3H2HA 4RQAA 1DAHA 1PEAA 2JEUA 4DUZB 4LFCO 1FY2A 4XBFA 1ISJA 1GZSA 4GUDA 4KDRA 1Y6ZA 1CUHA 5SZKB 2J3IA 2WNSA 3PHBE 3FB5C 3B8MA 2XOKA 3BUSA 2PH3A 1PWEA 3IAS1 1RXIA 4A2WA 1U3FA 2C2WA 5KTYA 1GM5A 2D0IA 2PYLA 4RACA 3V7EA 1FJ2A 2B8NA 2GD0A 3CEJA 3LVFO 4B0OA 4WBNB 1SUFA 2VRWA 2WF8A 3A28A 4HC4A 2PXHA 3EUEA 4MYUA 3OZXA 5EXXA 4CGYA 1P73A 1X7ZA 5H9VA 1K4CC 2AOTB 1GM9A 2IHBA 3KTAA 5CCDA 1ETUA 1D8TA 5KHIA 1ZUNA 2IU4A 3ZWBA 3DBOB 4U2KA 3AU8A 4YQZA 3GDFA 1NUTA 421PA 4B6GA 3RKUA 2GEDA 4JFRA 2Q8NA 4U2FA 5F2VO 2MSKA 1EZJA 4X6YA 3WGUA 4I66A 5FT9A 4R6ZA 1BW9A 3MJTA 2VDOB 3F78A 2JLCA 3ZBTA 1N5RA 2QB5A 2EKBA 4YV2A 4Z4GA 3OOEA 4MV8A 3K15A 5HDQA 3FJOA 4DRZA 1BL8A 1B0AA 1YDFA 3P9IA 3CF4A 4JGGA 1FDIA 3QE0A 1QHGA 2HRRA 3CEAA 2ERYA 2YWCA 4AWBA