5LP6B

Crystal structure of tubulin-stathmin-ttl-thiocolchicine complex
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tools for the rational design of bivalent microtubule-targeting drugs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 154
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5lp6B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5lp6B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5lp6B01
3ZBQA 4TV8B 4O4IA 3ZIDA 5C8YA 4U39A 3JALB 1SA0A 2VXYA 5LYJA 3JAKA 3WGKA 4ZOLA 5EIBD 4O2BA 5JVDA 5IJ0B 4O4JA 4XCQA 4X1YB 4U3JB 5IYZA 3JAKB 4ZOLB 5JVDB 3N2KA 4X1YA 2BTOA 4TV8A 4TUYA 4O2AB 5LXTA 1SA0B 3HKCB 2RHOA 5LYJB 1W59A 5J2UB 5JCOA 5JQGA 5IJ9A 4YJ3A 2RHJA 1Z5WA 4X1KA 5IYZB 2Q1YA 2RHLA 3HKDA 4FFBB 4I55A 3N2GB 3N2KB 4B46A 4YJ3B 3JARA 4IHJA 2R6R1 3CB2A 4ZI7B 4TUYB 3HKEA 3HKDB 4FFBA 4O2AA 5KMGA 5LXTB 2XKAA 2VAPA 1TUBB 3HKCA 2BTQB 4X20A 3JARB 4IHJB 4ZHQA 3JASA 5JQGB 5J2UA 3M8KA 5IJ9B 4I4TB 5JCOC 3HKEB 3VO9A 5EZYA 4X1KB 3VPAA 5CA1B 1TUBA 3HKBB 5MN4A 2BTQA 4X20B 4ZHQB 5EYPB 3RYCB 4I55B 3N2GA 4EI7A 4I4TA 2GVIA 4TV9B 5EIBC 4ZI7A 4M8IA 5CA1A 3C8LA 5MN6A 3HKBA 4LNUB 3RYCA 2VAMA 5KMGB 4EB6B 3WGNA 1Z5VA 2Q1XA 4I50A 3R4VA 3JASB 5JH7A 3RYFB 5ITZA 3V3TA 4LNUA 5EZYB 3WGLA 4O4LA 1FSZA 5LOVA 4WBNA 3E22A 5BMVA 5EYPA 3RYFA 5ITZB 4E6EA 4EI9A 4HNAA 4TV9A 4WBNB 5CB4B 3E22B 5BMVB 5J2TB 1RLUA 5MN5A 3RYIB 3UT5A 1RQ7A 2R751 4EB6A 3VOAA 5LA6B 4IIJA 4I50B 1JFFA 5JH7B 5CA0B 3ZBPA 5CB4A 4X1IB 4F6RB 4KWEA 1FFXA 3RYHA 4O4LB 5LOVB 5LA6A 5LP6B 1W5EA 3VO8A 1JFFB 4B45A 5CA0A 4X1IA 4F6RA 3WGMA 1TVKB 4HNAB 5KX5A 1W5AA 3M89A 3JAWB 5FNVA 5GONA 4YJ2A 1W5FA 5J2TA 3WGJA 3RYIA 3UT5B 4O4HB 3VOBA 1RQ2A 4EI8A 4O4IB 2VAWA 4IIJB 5C8YB 5KX5B 4DXDA 3JAWA 5FNVB 3JALA 5GONB 1FFXB 3RYHB 1W581 1OFUA 2XKBA 3JATA 4O4HA 4DRXA 5IJ0A 5LP6A 4O4JB 4U3JA 3RB8A 1TVKA 5M7EA 3JATB 4DRXB 4YJ2B 1W5BA 2RHHA 5LP6C 4O2BB
chains in the Genus database with same CATH superfamily
2AFHA 4EJSB 2Q41A 2JHPA 3AG7A 3Q40A 4KOEC 1KI2A 4UCQA 3CURA 1ZJWA 3SC3A 4F5ZA 5EIXA 5AW2A 2HFJA 4EJ0A 1XNQO 2W8BC 3VZBA 1I4DD 5E95A 1RWVA 2JAPA 2E3JA 3ILXA 3E1GA 3DDNA 1T4DA 1FBTA 1USVA 3KQSA 5DGHA 4HL6A 4H3HB 5HBGA 5T4EA 3QENA 2Q6VA 3RVQA 1CR2A 2E4YA 3P4UA 3ZK7A 1GGKA 2I03A 1XVLA 3FAKA 4U7NA 3NKVA 1W88A 4PVCA 3ZX5A 3QO7A 1M1NA 1P8JA 1YXMA 2F1KA 3F5DA 3T7KA 1VARA 1EIZA 1VSVA 2HA3A 3BX1A 3FCXA 5EXDA 2NU9B 1FP7A 2WG1A 2WF6A 3R7LA 1E1MA 3IO3A 2Q6LA 2F9LA 3SGIA 4BGIA 1O08A 1NLYA 1BS1A 3J80A 2YVLA 1GPBA 4EENA 3U0BA 3HVIA 3ZY2A 3WLNA 1ZZGA 2QSYA 5F12A 4EITA 1NVWQ 3HCNA 3UHPA 2XMSA 3ZZNA 1PG2A 2YC2C 4P84A 3WRXC 5AVKA 4KN6A 3ABUA 2QJTA 3K1AA 3U39A 4H33A 3KT3A 1Y1QA 3GPCA 3DOOA 4U4AA 1IBKO 3IV9A 2GD0A 4WK2B 5G0UA 4CR8A 5IJZA 1XP8A 4JC4A 4JBHA 1J56A 3PXXA 3THRA 3VKVA 2GTSA 1R8XA 4BMOB 1Y3AA 2YC4C 3C7AA 1K7FB 1EUZA 1KMQA 3BA9A 1XROA 3DV9A 3P2JA 3K9AA 4KXMA 1JSZA 3ASOB 2GD1O 3W1WA 2LZ0A 1UKCA 4DYDA 4P9OA 1I14A 4XQCA 2X14A 4GKBA 1BU5A 3I2HA 1UFQA 4PX3A 2D6FA 4EJSC 2VTKA 1WA8B 4F38A 2XDAA 1LSOA 3AIIA 4L5JA 5IDWA 2ORED 2ES4A 3A9VA 3GMDA 5C8XA 5CD9A 4CIAA 1BKDR 2LP7A 5JW6A 2OV1A 4CZZA 2X3UA 3B8HA 1G2QA 1O5OA 1OMOA 4OKIA 5CCXA 1O2DA 3TE7A 5KAFZ 4TN5A 2R2GA 2FMHA 3RS7A 3UICA 5ISMA 3ET5A 4J75A 4RFSB 3K79A 1H2EA 1RJWA 1YQGA 4RKEA 2P0EA 1UPXA 4BN4A 3MJEA 3BD7A 2GAOA 4QQKA 3KIPA 4JB0A 1OY1A 2CCJA 5C81A 1QJCA 4V39A 4EYSA 2IJKA 1G8SA 4BT5A 3JWHA 3ZLJA 5J9FA 3LOQA 2LBXA 2LGWA 2FSVA 3H6GA 2J32A 3IJPA 3MINB 3GDHA 4NCJA 5FBQB 3T3DA 2PUVA 3ZS8A 4I5EA 3HDQA 5LOVB 1A27A 1T5OA 4FKZA 4N23A 4IZ6A 4KOAA 4AJHA 6Q21A 2R60A 4L27A 2ZPTX 5CVDA 1AI4A 5K8IA 1BXRA 3VPXA 1G291 1D2DA 2FMLA 4Y1FA 2V6IA 3LCJA 2WF9A 3TRDA 5C5EA 3UT5B 4L5BA 4YI5A 3LT1A 2VJAA 2XBLA 3K73O 3D00A 3JCZA 7AT1A 4CETA 5CT6A 1TC1A 3PNYA 2XA9A 3EH2A 5HY2A 2CN1A 1RI1A 2D7DA 4UHBA 2ONYA 2XGMA 3IMGA 2ADPA 3LCVB 4DRXA 3DHYA 5DYNA 5B7NA 4E31A 1AGPA 1Y1TA 1KZ4A 3NHRA 2BMVA 4WWHA 2KBFA 3QMMA 1HE4A 2BGIA 1KC8W 1KNKA 2EU8A 3S0WA 2W00A 5L40A 3UCXA 2JVJA 3VKWA 4DV3O 1FRQA 2GK4A 3L9WA 3BYZA 1GVHA 1NZ6A 1JHOA 3P10A 1P17A 2CHGA 4XWWA 3W7TA 2ZJ5A 3SYOA 4G84A 1BVYF 2OZVA 2VHTA 2NM0A 3N58A 4MVQA 3AVVA 4PLVA 1E8NA 4LI0A 4YCDA 2MYTA 1E58A 3GFRA 3I76A 5CVTA 2JAHA 3I56V 3F0DA 2FR8A 4DLPA 4UC0A 4ZAGA 1J0XO 1K34A 1TB4A 4IBOA 1JKFA 3DE4X 4Q4JA 5A5EA 1UPAA 3ZMVA 3MXTA 1XL0A 3OIWA 2FF5A 3UJ8A 4JDPA 2D3OW 1Q95A 2L35A 1QRTA 1Y8QB 2RAUA 5A05A 2WY2D 1VIVA 4XYMA 4KE6A 3IQIX 2C7BA 3B3FA 4FFRA 3PU6A 3MWDA 3PTAA 1CJKC 1TI7A 5DJ5A 3RIXA 1QOZA 2ZSUA 4GFDA 4CLDA 5A6SA 2IS2A 1P81A 2ZB7A 1D8AA 3ITDA 3NQ41 4HFJA 5IWAO 1D8TA 5JFTA 1FD9A 1QQ5A 1TYAE 1F2TB 5EK0A 5BSKA 1QHHA 4TUYB 3P7MA 2YXPX 2QA5A 2RGNA 2WLTA 1M7BA 4X62B 1PQUA 3IBSA 4M0MA 5CAEB 2KQUA 3IEIA 4RHFA 4ACBA 5GZ1A 2TMKA 4ZEVA 2QYSA 4P9PA 4RL6A 4B3GA 3HKEB 4DR5O 1DJLA 3JRWA 1UBEA 4QQRA 5E2AA 3WWEA 3H11A 4A6EA 4IQ4A 3OR6C 3K0FB 2EWWA 2PYIA 4MHSA 5LBUA 4FKBA 3FMPB 3NONA 5EY5B 2ZF8A 4EG8A 4D25A 3SBOA 5EIBC 1ZXLA 1IZ7A 4G0PA 1MRZA 4YJGB 5LGNA 1E59A 4QDUA 1R4NA 1QIEA 3EGWA 1HORA 4ZVNA 4RKYA 5JCPA 3ABZA 3IGFA 3N39C 5B30A 2Q3JA 3HA2A 4OHOA 4CQJA 1ODIA 4QO7A 2E55A 1OBFO 5EERA 5B2EA 1JE1A 1JR3E 4FFMA 3SYNA 5DECA 3RF7A 2P4VA 4QREA 3DMNA 3FNBA 3K09A 1JDSA 3OT5A 2CBXA 1I6MA 4R8CA 4G3XA 1OVGA 5K99A 3LUKA 3TW8A 4KWIA 4N3GA 3LHDA 1QHXA 3O94A 5H70A 1RQ7A 5BOVA 3K0AB 3V1MA 1QU7A 5CFRA 5K0TA 5HE9A 1RRVA 3F1LA 3SDZA 1NL3A 4D98A 1P2GA 1XEQA 3S5UA 4B3TO 4XAQA 2YMQA 3MTBA 3B6KA 4X1IB 3TK1A 2EP8A 3WP1B 5IT0A 1ZVJA 3PQ7A 1W25A 3CR3C 2W22A 2NN3C 4NRDA 1N8KA 5JNLA 2HM7A 5BORA 5JSHA 3I04A 3W6NA 2QJWA 3OH8A 2QMOA 4QIWF 1UOQA 2AG1A 4WA7A 4A0HA 4BFZA 2Z1UA 2C61A 5C1BA 2NXJA 2CL0X 2W90A 3JRNA 5GADl 3RYIA 1A8HA 1A9XB 1PL0A 1VJ5A 1GZ7A 1NP6A 1E3EA 1ZOPA 2FPRA 2Y0BA 3AGPA 4JCCA 4NATA 4U7FA 4R0MA 1DTWB 3SXPA 3TBFA 2J09A 4G86A 4MS4A 1L1FA 2EFGA 4M1QA 3P27A 2VF7A 4M60A 1E18A 2C9DA 1FXSA 3C85A 1HT2E 2P6RA 1XV5A 5E1AC 3CNBA 3V1KA 4RZQA 5A06A 2F1OA 2EBHX 3VKUA 3M6IA 2RMKB 4HRVA 3BERA 4D0LB 4RVGA 3S2GA 4HDAA 2I8CA 2F95B 3E0QA 1HYEA 1YI2F 3DE0X 4KLCA 3W5IA 3NWEA 5CEJA 1C7EA 1TQHA 1WD5A 2X5XA 4Q4AA 4LE1A 4BDTA 3L8ZA 2C5LA 4I36A 3BRSA 2RJZA 2ZE7A 1QYXA 4I1OA 2FDRA 5TSDA 4X1YB 1PVOA 3F6YA 1OLUA 2O20A 5DTRA 3WE7A 3BRWA 3GLUA 2JRIA 4TMTA 1RE0A 9MHTA 5FAKA 4ZT5A 5JSYA 4TZZA 1NASA 3DMPA 3U4CA 3WBKA 2E4AA 1OZFA 3AILA 2EKDA 4UEWA 3MJFA 1I7LA 3R65A 2CVLA 2PS3A 2WPDG 2D3WA 2Z56A 3QGMA 1U0SY 4LYFA 3EQ7A 1X9IA 1T9GR 2DY1A 4TTRA 1UJ2A 3ZO8A 5LHGA 2AX3A 3NBYC 4MGHA 3KUUA 4LBVA 5TGTA 2XZPA 1IPFA 3RTGA 2OLEA 1XTPA 4M86A 4NK5A 1RDFA 4D46A 1ABFA 2AFHE 4BIIA 2AOWA 2Q49A 4S1OA 3RT3C 3EF0A 3IMEA 2QRLA 1EFHA 3DOFA 1S5PA 4Q34A 2Q9AA 3NH6A 3NFRA 1KYTA 5BYKA 1ZP6A 5CBHA 3OTWA 3MRTA 3QKRA 3V2IA 2YKGA 1DMRA 2OOSA 2PD3A 2ZRPA 2H3HA 3HYRA 1OGYA 3KKNA 5AKHA 5F7OA 5CA1F 4B6GA 5B8FA 2P5UA 4MITA 1TECE 4FSHA 1IZZA 1VE3A 1Z7YA 2DEUA 4L9WA 4EP1A 3NJ4A 5F5XA 1JKMA 2PEYA 2FZCA 1CULC 4PBRA 4REQB 4G4WA 1JT9A 2Q6TA 3RU2A 4B6PA 4EIWA 4CLRA 3QELA 3ZMUA 5D6OA 3R9XA 2IYYA 4LNUB 2AI2A 1AD2A 3C3EA 4L6AA 1V5IA 3AJAA 4O2AF 5A6VA 1W52X 3QF4A 1J06A 4N5DA 1MOFA 4QT4A 4QEDA 3B3GA 3OM1A 3P0FA 3QK7A 4EUNA 2OBNA 2BFAA 1UQUA 2NWQA 3V9AA 4N9QA 3LC0A 2I65A 4UUBA 1DWQA 4ZVQA 3T7EA 5J4KA 4HC4A 2Q4OA 1N6OA 3AC0A 3PKJA 1D2MA 4DG5A 1OX4A 5IG2A 4BAZA 1P75A 5ADHA 1PLKA 3LP8A 1VBKA 1P4HA 1JTVA 2OSBA 3STUA 5KYXA 1I51A 4K9DA 4JL5A 1IQRA 2BW0A 1GUBA 2VG8A 3LUTB 1WPGA 3OZDA 2LDBA 2GPNA 1OYYA 1EE9A 5CB4A 3CW2A 2MCFA 1VJTA 1R5BA 2RI1A 3OCYA 5DBHX 5DBFA 3L8HA 3B12A 1TCVA 1SH7A 1TQ8A 4JP8A 1WOYA 4AFNA 521PA 3ER9A 5LIRA 5K3AA 1I6WA 2XMRA 2CVZA 2AOTB 4G01B 3OBBA 2GSWA 2PL1A 4JOQA 2TS1A 3EX7C 4C05A 2O2GA 4BGDA 4X24A 5CHEA 1UFRA 1XZGA 4TXLA 2FP4A 4RMJA 1C0LA 4DPKA 3NI2A 4FVMA 4OREX 5CVJA 5LZ4A 1DT3A 1N8TA 3SJAA 3W7AA 4GGMX 2LFRA 3NT5A 4BFVA 2C31A 1O95C 1NI5A 3A58B 3JYLA 1AIPA 3O4HA 4JC0A 4JLPA 4RQAA 1Y81A 1DV2A 1JX6A 2EGHA 2Y05A 1G66A 2Z2IA 4W99A 2Z1NA 1SZPA 2J45A 3N7AA 3OG9A 3PQDA 1CUCA 4FSXA 4LVNA 3A1WA 2FKAA 3V4SA 5ANRB 1DQZA 2BKUA 3E05A 1KAQA 2RB4A 3KC2A 4N01A 2AE2A 2Q2VA 3FETA 1FMFA 4YFVA 1HTTA 2ZB8A 2VVTA 3MCAA 5FHQA 5D3MB 3IEQA 5JPCA 3DBLA 5CM2Z 1T3LA 5A3SA 1IH8A 2DTEA 2EF1A 1RWXA 3F7NA 3K5WA 3BM5A 3QX8A 2GN8A 4A03A 4I8XA 5BXYA 1G4UR 2PTHA 1SRRA 5AI0A 1W29A 4RSMA 4PHZA 4RD3A 3RUFA 5A1JA 2JS3A 1COZA 1OLXA 2GBFA 3A27A 2X23A 2D2IA 2DHEA 1TMKA 3R20A 2WDZA 3L06A 4MJ3A 3I92A 3FUUA 1C4XA 3F6EX 1XHLA 1KDRA 1HETA 2HJWA 1KR2A 4TX1A 1NFRA 4ZOQI 1JG3A 1EQUA 3DTYA 4MWOA 5ILQA 1KOLA 1RRMA 3LPLA 3QUWA 2DPMA 3RVKA 2WLSA 5B12A 3EQ6A 2UU9B 2QD5A 1XYYA 3EXFB 2XD9A 1DOZA 1E9FA 1WDLA 3A6HA 3FH0A 3H8VA 1MVNA 2IUFA 4B3TB 4FW9A 2OTLF 1I5OA 3EGVA 1TA0A 4OJQA 5SZIA 1TTTA 4IKEA 1FQOA 3LDCA 2ONKA 4QU0A 3TJRA 4DJAA 4YJDA 3RR2A 3T9CA 1VL2A 1J2UA 4FLYA 1VRCA 2BKEA 4X7BA 2I4MA 4LH6A 5HK8A 4P3YA 2RB5A 3WR5A 3OCVA 3GDOA 1K5HA 4E6PA 2ZSJA 3NOXA 5AKJA 4EFDA 2FKNA 4DM3A 2BFDB 1I32A 2G6TA 1AZLA 4K6FA 2QIOA 1XX6A 1SQPH 1A4UA 1D0VA 3BL6A 4QGSA 1RZVA 2ZXUA 3O47A 1PR5A 1CP2A 2PXCA 3T9EA 3A0RB 1HNXB 1GKYA 2M1ZA 3O4IA 3ZLBA 1N7HA 4PI0A 3MAQA 3FYUA 2YFQA 2Z4RA 1HI9A 3M70A 3PWZA 4M1SA 3TFWA 4NPHA 1DX4A 3EVCA 4TKUA 3UENA 3PB3A 2Y76A 1ZLZA 2Z57A 3TLMA 3L8MA 2WJYA 4ND1A 5JFOA 3GN1A 2Q68A 1EUQA 3BH0A 5CG2A 4LA4A 4HDRB 1NJGA 1GDDA 1XVTA 1HNWO 3V6LA 3FLAA 1QGOA 1ZM9A 3QTBA 1U9JA 2ZBDA 3JQFC 1IEQA 4N03A 4IKPA 5L51A 1M74A 3KEGA 3KV3O 4Q18A 4QG7A 4AZ3B 1Y5LA 1I3KA 1SXJC 5EC2C 4ZQHA 4BV9A 4HVLA 4NY1A 4F3RA 5FDFA 4K3AA 1KEWA 4N49A 4ZJZA 1AB6A 1E2DA 1LK0A 4WBNB 1Q83A 3ZVNA 3GWGA 1GPWB 1W75A 1Z7GA 4RLFA 4HDMB 1CXZA 2HXSA 4KBYA 4MUHA 1CUWA 4RY9A 3J80M 1W57A 5F9FA 3GNLA 4RELA 3HWX1 4KHZA 5CURA 5JT1A 3KTDA 1EI9A 4B0OA 3GFTA 2AW5A 3SJBA 1UKEA 5LU9A 1M6NA 2HPHA 2XJ9A 2ZTVA 3E81A 2RGNC 4JVNA 5CN0A 3CUKA 3O4JA 3RKUA 3PJFA 2R1TA 4N8SA 3F96A 4WFHA 3HCPA 4QXPA 4HNAB 4Q9LA 2ACEA 5DT2A 3U5TA 4G0MA 1Q3HA 2AFIB 2W2KA 4LZPA 1B74A 2WYWA 1AY0A 3AR2A 3LMEA 4X8OA 5TY0A 5JS8A 5JRZA 1AB3A 1P77A 1MQ8B 3EZGA 4EGQA 1OROA 2I0FA 4MV3A 1DLIA 3CZQA 1EK1A 2FQXA 3U49A 3OGIB 3FWNA 1HFJA 1EINA 2NNWB 2QU8A 1K6JA 5IF3A 2YY6A 3D8NA 1K3FA 1V5GA 3F6MA 2IK8A 2FMUA 3S03A 3F6CA 1AUXA 1S2IA 1T8YA 2JEOA 4IHAA 1ZAUA 5F2KA 1GD1O 5M7EA 2W6CX 4MQ5A 1XWWA 1UBRS 3ESQA 3FKJA 4JBGA 4WZBB 3R7BA 4DBLC 1QH8B 1MJGA 1FQKA 3J7AU 2JK5C 1M8GA 2YFHA 4NBUA 4OK5A 3EA5A 4Z1MA 1JLRA 4EF4A 4HYQA 4V0OA 3AHHA 4CL0A 4RORA 3VI6A 1C7ZA 2G4LA 5E1BA 3TKLA 2CXNA 3U81A 2FSFA 2G70A 1NC3A 2ZEJA 4KO8A 3VOTA 1X7PA 1PD1A 1M5TA 2OZKA 3QPWA 4L2IA 4XCQA 1AKYA 4Q7JB 4Z9XA 5GPBA 2WWWA 4PANA 1US6A 2D4HA 2REOA 4TKLA 3ZXUB 4EX6A 1Y6GA 5LB2A 4QXOA 1ZIXA 4GOLD 4ZO4A 1QTQA 1NC1A 1OASA 5C0OE 4RH1A 5ALZA 4TSFA 4AXBA 2XVAA 1QV7A 3HHEA 2IS6A 3NXSA 4RS4A 3BMNB 5HUQA 3EXIA 1E9SA 1YXBA 1Y34E 1HLGA 3AY0A 3HSYA 3ENVA 5A4MS 3BGSA 2CXHA 2RC5A 3CHXA 2OM6A 3COZA 3DKKA 4R2HA 4JENA 1LLQA 1LZKA 1H2YA 1QTRA 2P2CA 3DMTC 4B4WA 5KTTA 2PH5A 1L5KA 1A2OA 1IEWA 1JA0A 3TL6A 1BCCH 1EFCA 2DVMA 3KNZA 4OLAA 2EIMC 5CYFA 1T2VA 2YVQA 3LYAA 2AHZA 1U2GC 1Y3BE 1H3NA 1W73A 3JY6A 3LFTA 3PKZA 4MV5A 4PFJA 5H4HA 3UHOA 4EW6A 1KY4A 4EQ6A 3AEIA 3HKCA 3MERA 2XI4A 3R77A 4B82A 2RGUA 5K7SA 3F7YC 1CE8B 3P2OA 1XZEA 2CGEA 2CHTA 2R1ZA 1OAOA 2X2FA 2Z30A 3GVXA 4C0LA 5MN4A 4LF4O 4A0FA 3HU1A 4FGWA 3JX9A 4H7KA 4ZO8A 4AKGA 5DP2A 1T0UA 2QA4F 4QTYA 3A1CA 1G8FA 2FW1A 4H77A 5HFNA 4X45A 2XT9A 4UBJA 4ZYWA 3OJLA 1RP3B 2V4UA 5C3UA 4XA8A 1EFPA 2ZSKA 4IJKA 4EDHA 3RGBA 1XNRB 3TTVA 2KWIA 1AQNA 1IXKA 4OHCA 4RKFA 5C8DA 4ZYUA 4IWNA 3WBJA 2PX0A 4MQUA 5E6SA 2Y3IA 3Q2OA 3JAMN 5B4VA 1L7MA 1M76A 4DJ5X 3BT7A 1DRKA 5BWNA 4RNDB 2ZPAA 3GLHE 3N5KA 3VZSA 5CITA 3EPLA 4J4HA 4YCCA 2YSUB 1H6BA 1XTSA 7ADHA 5JMPA 3A6KA 3GLIB 4ASUG 4JJ4A 2A33A 1IXSB 1V2GA 4M49A 3FM9A 2I4IA 4HEA1 1R3IC 1G42A 3KKLA 2KGWA 3H4VA 4RPLA 3L7QA 3TLBA 3UV6A 2FKXA 3Q3CA 5TIIA 4X8AA 3SS7X 3T0FA 2P4QA 2FUG6 4QBFA 1CR0A 3MMZA 3REGA 1NQUA 3JYQA 3EZFA 2H5LA 1BCRB 1V9SA 4IKOA 4R2IA 2OB2A 5EP2A 3VZCA 2RGXA 4XVHA 3OD5A 5F73A 1FC0A 3CLSD 2CY0A 4X8HA 1SVUA 3RNLA 2OGZA 1K6EA 1Y8RB 3GXOA 4TTTS 1M67A 2N75A 4O08A 3IEKA 1IDOA 4PE5B 5BNWA 4FPXA 3KEOA 5B57C 1PBTA 3FLMA 3TLGA 2UYNA 3AYXB 2GPWA 1K9MH 4L07A 1NVTA 5KJFA 1TVKA 5GV7A 5JC1A 3EPJA 4CCAA 3W3AD 2Y6UA 1VC2A 3PUJA 4RQOA 2VP6A 3I1FA 4LVCA 4RBNA 1E2PA 1BZYA 1S72V 3EULA 2G25A 3KJGA 3NYIA 5FPKA 4NCAA 1XZMA 1ZA1A 1BYUA 1D2NA 1AO3A 3E70C 1YDEA 2W8BB 4MTCA 1KZ7B 2II6A 2QTVB 3EQ9A 1IPEA 4FHGA 4TMYA 4EARA 1MHPA 3T3PB 4BVLA 3GFFA 4GZRB 4FX2A 1XL6A 2FGKA 2HJGA 2QX4A 1V3UA 4OLBA 1TCBA 3CYQA 1XQ9A 3OFSA 2WWRA 4D2IA 1V7PC 4PPNA 5LZ9A 5FYQA 1YC5A 3CWQA 3P97A 5DTMA 1DAMA 2GMWA 2GZHA 4A6DA 3IFSA 2GZ2A 1ZCZA 3DZKA 3N2LA 3MC1A 3DHWC 3NHFA 2WSYB 1QZZA 3TZKA 4B3BA 2VDQB 1XDCA 1J99A 2O5RA 1SA0B 1IOVA 4IDBA 2DJ5A 2QSUA 4MAFA 1W35A 4GYCB 4M1YA 2GCPA 2RCVA 2IZZA 2V7GA 1O94D 3C87A 4DJJA 1U7ZA 3WGHA 2CHFA 2FPUA 4X1KA 1DCKA 2J41A 2BCCH 2JFNA 3S2IA 3WOVA 2GBGA 4TL7A 3CINA 2QWRB 2B25A 2JFXA 2XKKA 1XCLA 1KMHA 1W6RA 2QR5A 1FTYA 3UBTA 2ZR8A 4ZALA 2HAEA 2NMVA 2EINB 2ID9A 2X15A 1ISIA 2AK3A 4Q5IA 3VU1A 1XEXA 4O2AA 5LLSA 5F3WB 1H2FA 1CW2B 2QG6A 1KAGA 2R00A 3GC6A 3JQAD 4J1TC 4RKQA 5D87A 4CBVA 2VDRB 4ZO7A 3O8CA 4C20A 1E1QA 4JX8A 1YASA 4G89A 5JCOC 2ZCVA 5EZYA 1QZTA 3MPOA 5DLPA 2PMKA 5K8LA 3USCS 4PPGA 1TUBA 3RARA 3A7DA 2JJ2G 1SIBE 3KSMA 3NLLA 3UMFA 5IBCA 5DHSA 1L3BA 4YK7A 2BEUB 4YUYA 1ROPA 2O59A 4UUAA 1WMSA 2IDMA 4UMDA 3D6NB 1RXSA 2QTNA 2QQ0A 4F7WA 2ZVZA 1U94A 1HLFA 1PQYA 1ZI9A 4EMUA 5ALUA 1XEAA 3DBHB 2HK6A 4JQYA 5HKBA 3C9RA 2IEAA 2N47A 2Y8EA 4BCDA 4Z51A 1B26A 3CZRA 1YS6A 2VYQA 1VPWA 1G41A 3DAGA 3VAAA 3MS7A 3AFGA 4IEFB 2CLSA 2ZIUB 3IT0A 2HSDA 3EZ7A 3PV0A 4L8LA 4MUIA 4OSOA 4URUR 4J41A 5E9QA 5I7FA 2WJGA 3TGLA 5EAIA 3D4OA 4XWOA 1MIOA 4DDMA 3HB5X 3UK0A 4V03A 3V8BA 2B9ZA 2HRDA 3DC7A 1QHTA 4G85A 3C6BA 4YIKA 1R9MA 5DIFA 3ZQJA 4BO4A 1QFZA 1Q7EA 2BCJQ 2J1LA 2WFZA 4BNVA 4F3TA 3DVSX 4S1WA 5DHRA 4GO1A 1BAPA 1P3DA 4HWPA 3D8UA 1NR5A 4F6RA 3TLEA 4RF5A 2CUNA 3WL7A 3IKMB 3M89A 4RW0A 1N77A 1ZICA 1HO3A 4JLSA 2VHCA 3BGDA 2BYTA 2NXEA 5ESDA 3RLFA 4REMA 1OIXA 3LSTA 3NBKA 4CYMA 1N2CB 1LY1A 1JLSA 3DO6A 4RX1A 4QKQA 4Y7CA 1ZTEA 4Y0VA 5KX5F 3CNOA 3K9NA 2PVCA 1P4GA 3NHWA 1ZWIC 1R6XA 4KLNA 1S5LZ 1XCPA 4RK5A 5ALPA 5DTQA 2N48A 3GUVA 3R9KA 3B5IA 3OQVA 2GCNA 1U96A 1VB5A 1YOVB 1H5NA 1XSEA 1BIFA 3HK2A 3AEYA 2FPIA 3OQIA 3SJUA 4CF6A 1D2RA 3TYXA 3KFLA 4O4IA 1MG5A 3BXEA 3K0EA 2IV2X 3OY2A 1NWHA 1M4UA 3RJ9A 4M37A 4LF8O 1HSOA 1QG4A 4U2CA 3KAJA 5KUMA 2A0UA 3QEBZ 1HQKA 4X0EA 3LK6A 1R0LA 3GLRA 1E63A 3RUHA 1A8PA 1QMPA 3WHLA 3TSAA 1MO5A 4LMBA 3WIEA 4MA0A 1G7RA 3FUTA 4J7KA 3KR2A 3SS8A 3L4JA 2XYRA 2JGFA 3LRTA 1K4DC 3CSSA 3E9DA 5G4LA 5P21A 4KDCA 4Z2YA 5REQB 1JHVA 1QIJA 2B94A 4NE2A 4UCUA 1EFKA 3D7SA 4IDEA 1QHGA 4LSGA 3VTZA 4TROA 1A2BA 4UUJC 3PD0A 4HDSB 4EPYA 3DGEA 3R3YA 1FW8A 1C0KA 2ORIA 1BQ4A 2YBDA 3WFIA 1RM5A 1QOQB 2G1KA 4ROTA 1JQDA 3CVYA 2A1TR 1JHYA 1OJLA 1ECCA 1DKPA 1Z4LA 2R7NA 5DN6A 1A9PA 1KNXA 1RTKA 4YREA 3VR6D 1XDBA 3VX3A 1WU8A 1TM1E 4U2EA 5IH3A 4CPDA 4ZTUB 3Q7RA 3WKAA 3CCMF 4WADA 3SYMA 5DXAA 3OC0A 5H02A 1YEWA 3O92A 3I1IA 3CA8A 4DV2B 3ND9A 3BIJA 4YN3A 1XK7A 4B81A 4YJHA 3ZE8A 3ML0A 4C9BA 4FFVA 3GEEA 4Z9FA 1G18A 2WJIA 1UEJA 2B0CA 3C8UA 3V2UA 3GOQA 3UFXA 4E22A 4RZHA 4Z8XA 1WXWA 1RMTA 3FFWA 3R8FA 1I2ZA 4GX2A 1ENZA 2Q1WA 2NZXA 1JV2B 2VJLA 2WHEA 5FTWA 4P7BA 3ED5A 1VHLA 2FOIA 3T99A 4UFOA 4PQYA 1HDRA 1BA2A 2F4NA 3MOSA 1JU3A 1RFLA 2FZWA 3KDAA 1IVNA 5A9TA 3W9SA 2ESRA 1ONOA 3SQNA 2Y66A 3WAGA 1ZH4A 5FFNA 2FJPA 1MX1A 1T8TA 3TH5A 1NTMH 2AEEA 4C03A 1CETA 1KIMA 3CZAA 3PXEA 4WRRA 3RK0A 3ZWVA 5EPEA 2I6TA 4K3VA 1PJCA 1P9LA 3LS2A 3M6FA 3PUXA 4UCRA 5LR6A 1PR4A 4ZMSA 4XIGS 3I3FA 1YTFB 1P0CA 3VTIC 3NUZA 4YR7A 1BH6A 4QM7A 2AJBA 1E0JA 4FLEA 3VQVA 3F9CA 4RA9B 4E2XA 2Z43A 1SU7A 4LXHA 1J70A 4NK4A 4XIJA 4FWIB 4ZVVA 3WVNA 4DCUA 4XWYA 1DKOA 3QU9A 3GRAA 1OZHA 1Q0PA 4J7JA 3L8YA 1K7SN 2LO1A 3DW3X 4G8JA 1RYFA 4NULA 3A11A 1UC5B 3QFSA 3FB4A 3WLQA 3D3QA 4EGAA 4RULA 3U5ZB 1VMKA 4W4KA 3KT0A 2FWBA 4R1UA 3PC3A 3PL5A 3DXXA 3RVDA 3FX2A 3SVLA 3OZFA 1OCCC 2I6QA 3W4KA 2JKZA 3FOWA 4FS8A 3L01A 4KRYA 1IAQA 4FIZA 1C81A 4PQEA 4TQAA 4C6TB 2QWOB 1W3EX 1LS6A 4GOND 5DOVA 3PCXA 3I61A 1XZLA 3ZCTA 4QJIA 3I6MA 1R8SA 3TXAA 4U3JA 3UTCA 3ZGLA 3AFMA 1N5DA 3MDOA 5F51A 4UKDA 5FA5A 3DKIA 4FZJA 4Y9RA 5CXXA 1XRPA 5FWXA 3LWDA 1ZD5A 2JJ8A 3PEUA 5IBPA 4KBGA 4HLQB 2YRWA 1RZRA 2OT3B 4J3FA 5CIYA 2OBXA 3A2MA 3AB7A 2I55A 3C3AA 1IHOA 1SXIA 2EYUA 5CH8A 1KIFA 1PBNA 5JJLA 2D8AA 1ZH6A 2CB9A 2O0JA 3AR3A 4DWVA 5C32A 3GFOA 2O2HA 3GV0A 5IT9N 5JZOA 1EDBA 2CDBA 2CNOA 1I3NA 1X13A 2EIHA 3C7CB 2XUIA 4H15A 4HB3A 1HTBA 4RY2A 1R88A 3LLUA 3QFFA 4OM7A 3CGGA 3G1UA 5IAGA 1CVIA 1CSEE 2PDAA 5F1OA 5CD1A 4GCZA 4PR3A 5IUNC 1AB5A 3IPAA 4QFMA 3WGZA 2PUJA 3LCCA 4MVJF 1HYBA 3U4HA 3CX5F 1UF9A 2JI6A 3RIMA 3QWHA 2XMPA 3JQ9C 4OMDA 4WOJA 3ND8A 3HN7A 2C7GA 3Q7SA 1BS9A 3KR0A 4PV1B 4F8JA 1U7WA 3DE5X 4EHJA 1DKQA 4G5XA 3PXUA 4KL8S 3BXGA 1NX9A 3WWPA 1DBQA 1VQKF 3AESA 1XKLA 3T95A 2OY0A 4C0BA 1DLJA 1KRHA 1PFWA 2XZLA 4PC6A 4G63A 4DG8A 4ZJPA 1SBZA 1BS2A 4QPDA 1VYVA 3ET4A 2C2OA 1I6LA 1XF1A 1Z7BA 2HO4A 1ACJA 2VH2A 1JQKA 2Z2ZA 3DLTA 4MYRA 4B3DA 1BMTA 3NK7A 2IPXA 2WINI 2YOFA 1WP4A 2P3LA 2PMEA 1A82A 1Q7GA 2GKGA 2VWPA 3ROKA 3QVKA 3W7BA 3WZMA 4UTXA 4BHTA 1SRQA 3ZXYA 5AK3A 4EPXA 1FXWA 3AHJA 1J22A 3GG9A 2AG8A 4QOGA 3WGNA 1Q81H 3SJ7A 1W47A 2EIKB 4DDVA 4GAEA 1EM1A 1LLUA 1RIFA 3E9QA 4GRAA 5LZ5A 4CE6A 4DLKA 2ZWVA 4IF4A 4QUHA 5DP1A 1VKJA 1YB4A 2R65A 5BSHA 5FUMA 4K28A 1L5VA 1QH1B 2HOQA 3C5VA 4UE2A 4UPDA 1AUVA 3DEAA 3OPYB 3ORQA 3T1CA 1ZG3A 1DJMA 2FPGB 3OBIA 4EI9A 1Z2DA 5JISA 1Y76A 4KE7A 2XV1A 4L4YA 5DI9A 4DVJA 3I04M 3QEOA 2JIBA 3B48A 3ZHTA 1M6YA 2ZIGA 3R6DA 1AHIA 2QV0A 4LZNA 3CLRD 3KE1A 4RH3A 1PTKA 3UUWA 2CKMA 4E07A 2VYFA 1A5BB 4FS3A 1FXVA 2FK8A 1TW3A 4YT8A 1RTTA 1GZ0A 4IJ6A 2QN8A 3B70A 4B73A 1MO3A 2AIFA 1YDFA 5BQPA 2VP2A 2F67A 1T5SA 2RN9A 3E3LA 2Q1TA 4QYMA 4P0QB 1WB6A 3O93A 5JWHA 3GLVA 3U3OA 4ALIA 1JJ7A 2HJRA 3TXQA 1KP9A 3DF9A 1HW7A 3IBGA 3RS9A 2YXLA 2HMUA 3T5TA 1SUIA 1O96A 5D5PA 4JV5B 3G2OA 1E61A 4EJ2A 2YY7A 3EAFA 5BV2P 3A26A 4N0QA 1RQ2A 1PHRA 2R8YA 4BO0A 1UWLA 1FXHA 2AI1A 3HCWA 2FEPA 4QQFA 2PQ2A 4P4GA 3DTVB 1TIKA 5K1ZA 1TO1E 3WP0A 4BUZA 3ROFA 2O5CA 1BFDA 3PNVA 3ORHA 4WKCA 2DCMA 1T36B 4B3FX 2GWRA 4G2NA 4MEAA 2YZNA 1SQ5A 4O0MA 4NBTA 3DXYA 5EQFA 3CWZA 3VKGA 2BBWA 4QTXA 3KD3A 4EBFA 3RHZA 5KYNA 2EZPA 4KL1A 2Q5FA 3KZVA 4OK6A 4Q7KA 3O21A 4UASA 3T7JA 4FD2A 1IEVA 3N8GA 2CYBA 5FL7A 1P0MA 3ZU2A 4ZKEA 3UJPA 4QHSA 1AR4A 3C2QA 1W36C 4KNVA 2IU0A 2H8KA 3PA8A 5ICMA 4DABA 3H2HA 4I3GA 2Q8PA 2X8WA 1MAUA 1M6WA 2PL9A 5D7NA 3SIVA 1G17A 2XYGA 5JAZA 4DB4A 4DCGA 2HY7A 1T5BA 3HWWA 1YZFA 3E61A 4UBOA 5B7GA 2PBFA 1AP6A 4JY7A 3TGWA 3PZBA 4UEQA 3M49A 1YB7A 2H5IA 3WRXA 1X1QA 3M1IA 2WIAA 1GRVA 3ONDA 3O9OA 1ATIA 1G64A 1VJDA 1EZ4A 2NU6A 4IINA 3EJWA 4EKDA 4B2YA 2W6OA 5L8VA 1VE6A 3HWRA 1YZYA 2DBZA 3S28A 1YE5A 4FHDA 3JCUZ 3TW0A 4IIBA 2QE7G 2X1MA 3H05A 2RBGA 5KLVH 2VBGA 3EUWA 5AG2A 2FW8A 3HE3A 3MOIA 4MWZA 3W04A 3OMNB 5HM6A 1K2VN 3MT8A 3MTAA 3W6PA 3DCJA 3GP3A 3AYZB 1SCUA 2F23A 4A91A 4ONEA 4BNNA 2RI0A 4QLAA 2D62A 1K89A 3RVPA 3JVHA 5CFOA 1MN6A 4LP8A 2UXCO 3H2ZA 1FB5A 4KLRA 3OUUA 4C30A 3TMYA 5K09A 4A36A 3AVTA 4ENWA 1U1CA 1VIMA 3BY6A 3R3HA 2FGYA 4O0LA 5K0BA 5LQSA 1Q21A 3TJZA 5KKNB 4AY2A 2WUVA 5GIPC 1V8PA 3ABTA 1NJFA 2QTZA 3I4CA 5CNIA 2G4VA 1F8GA 4XPIB 3KTFA 1VIBA 1X19A 4EJMA 1GUAA 4ZHYB 1MOQA 2ZZNA 2DOSA 4UZSA 2ZVPX 3KOWA 4L95C 3S2SA 5JJBA 2WTUA 2BT4A 4EFNA 1JTFA 3QLJA 4AN1A 1NN5A 2CW5A 4KTVE 2HHHO 3FD8A 1W0KD 5KSYA 4DKJA 4F97A 4V0QA 4ZOBA 1FLVA 1N34B 2FFBA 5BR7A 4J9YB 4IUDS 4IVQA 4YP5A 2Y69B 1ZKDA 3WTCA 3C4VA 2QTOA 2O8EA 1JIVA 1F8YA 1QLWA 4JYAB 1H1DA 3E89A 2I6FA 2XMCA 3AY7A 3PXGA 4AUKA 2F8SA 5A71A 3WGGA 3O3OB 1QIDA 4L87A 2D74A 3NALA 2BELA 3PHLA 5BPHA 4WOPA 2OCGA 2IL1A 3H6HA 1TW2A 4KO2S 3KQPA 3L7IA 5E2BA 3CW9A 1AGXA 4AICA 1UJCA 3G2MA 4DA9A 1X80A 5KTSA 1JSXA 2JCSA 3FTDA 4YQZA 5JWPA 4JVMA 1OJ7A 1R0YA 1TMYA 3I9V1 3T3NA 3L1JA 3PNOA 3TCXB 1UJBA 1RHRA 1ZUHA 3CKYA 4PZPA 3PDCA 3O9VA 1FDVA 5EMJA 3GUZA 1WCWA 1KOGA 1GZVA 2AFRA 2IDJA 3LUHA 3FHOA 5FBRB 4LDRA 4Q12A 1ZD4A 5ALVA 1UP4A 1V25A 1XXHE 3G5UA 1JJ2F 3KCQA 3DEJA 3EEFA 4RK4A 2UYJA 1P2BA 1N7JA 1CFZA 1M57C 2CLEB 2OK8A 4R3UC 4ARBA 1JIIA 4Q1FA 1YFZA 2IOFA 4CGYA 4C6RA 1QS0A 1U5BA 3ZBTA 1E1KA 4R1TA 4RTNA 1QP0A 5FL7D 4UOEA 3C24A 2C0PA 2YICA 1ZM7A 1UADA 5ALOA 4BIOA 1S2DA 4N8EA 4M8SA 1MVLA 3KJJA 1V7ZA 2IXDA 3BVPA 3U4DA 4ZPJA 1H2AS 5BUZA 5CCEA 1JOYA 7REQA 1E2QA 2OHVA 2XCOA 2ETVA 3FMFA 1OBVA 2DECA 2P22C 1J0EA 1XU4A 2E87A 3LNCA 2BTEA 1AJNA 1E2NA 1JMYA 1V95A 1JNXX 2KMLA 3LBIA 2CNWD 5HIAA 1DUVG 4AU1A 1M1YA 1DC4A 1F12A 1FW6A 3PIDA 1FTQA 2ROQA 3DE3X 3OLVA 3VTAA 4LNHA 1RZRD 4OXYA 1HE5A 3ZJZA 3DEYX 2Y0EA 3QTLA 2EJTA 3MK31 2DWDC 4EWLA 5IABA 4UMEA 5ECWA 5B3AA 1U8EA 1ZPDA 3LXXA 3DWGA 3U7EB 5K8UA 3ZMTA 3UPTA 4Y9DA 4F86A 1YS9A 1P9NA 4AZVA 3KQHA 1X2EA 5A1TA 5EQTA 2ZAIA 3O0DA 1I7NA 1GTMA 5HEKA 5K8TA 1O94C 3ZOPA 4GZ3A 3X2EA 1PW7A 4NG4A 2W2PA 2QTMA 3A28A 2AHOA 4GQBA 5JQGF 2ZBVA 1P4SA 3TNJA 3L4KA 4PU0A 2X4LA 2GO1A 4H6WA 2VPZA 4YY3O 1Z2EA 1Q0LA 3JTEA 3KZKA 5EKXA 3KDSE 3L7KA 2F3TA 2GN1A 5A4JA 4PYIA 1PZFA 1HE3A 4FFBA 3TQCA 1CJSA 3UMYA 1RM3A 2ORYA 3D2BA 3EXHC 2IIBA 2LCQA 3DHNA 1NH2B 2YDYA 4M1ZA 2PBZA 2B8WA 3QXJA 2Q0SA 5B6JA 3A9WA 1DHRA 5CBPA 5JVDF 3Q0TA 4WDRA 3EARA 4CMHA 4L76A 4LFBB 1E4VA 4ZHQB 1K6IA 2RIPA 3HDYA 4A5SA 3U9SA 2ODBA 2KB1A 3LWVC 1VF6C 2VSQA 2BOVA 3I56F 3H42B 2KHZA 3PFIA 1ONNA 3G82C 3H8SA 4JL6A 5IZCA 3EWIA 4G4SO 1KH2A 3BFRA 4NENB 3E9MA 4NQZA 2VHWA 4MJ7A 2W58A 3KTAA 4D4LA 2FDCA 3DTUB 1IXZA 1J9ZA 3AK1A 5DWVA 4IX1A 5LL6P 2BSQA 2C99A 3IIMA 1NHWA 1ZC3A 3WJAA 1LEHA 4AJPA 1EVQA 3ZJTA 3QOFA 1C5KA 1UK8A 4NQ3A 2YOGA 3P52A 4GX0A 3FZQA 4KXNA 5IW8A 4YQYA 1VJCA 4GEGA 2OCLA 5DNAA 1ND6A 2NO1A 1E5QA 2XE7A 2FZEA 4MW1A 1NIJA 1RFYA 4BQQA 3QPBA 5FT9A 3J7AC 1AMOA 2OHGA 1SK8A 4Y30A 3ZK8A 3R5JA 4ABTA 3NCHA 4PO3X 3EDRA 2UUBO 1KD1H 3ONVA 2XGGA 4Y6SA 3V4VB 1KTIA 5KWJA 1ULAA 3MM4A 4QECA 4XJVA 4NJEB 1N2IA 5HCIA 4MXDA 2G1AA 4FNGA 4GWKA 5ICFA 1PEAA 4ZICA 2FLKA 2H6EA 3CX6A 3ZE2B 1K0UA 2DETA 5CM8B 2HP0B 5K3FA 1XVVA 4BV3A 3BB3A 3IQEA 1RXWA 3M9LA 3JZMA 4HN9A 2W42A 2JHAA 3LIIA 1SKAA 1XQXA 2PFKA 3PNLA 4N6GA 3S29A 2HP8A 3HY4A 1Q6YA 4ZQFA 1DFIA 1LK5A 2JH8A 1S9HA 3ZDYB 2H1VA 1OWLA 4LJ8A 1UDXA 1WZUA 4WEQA 3FPJA 4QVKA 3HDJA 4E5VA 5FNVF 2XTJA 2EC5A 4X71A 4M55A 5IMBA 3KRTA 3BWMA 1CCWA 1XDGA 3QNUA 4DQUA 3RYHB 3ZCSA 4D42A 5ITVA 2PQ6A 3I42A 3E8GA 1VSQA 3PUKA 2FSUA 3WBBA 4NCKA 5FO1A 3UQ8A 1ARZA 1Z13A 4HTFA 2J33A 1WHTB 4CG0A 4ESOA 1JFSA 2VDVE 2XYHA 5LQRA 4KYVA 4KHPB 3ABIA 3BQ9A 1XNJA 4F9EA 1GITA 1QGUA 3CBQA 2QQEA 3M99B 3AEXA 4IICA 5ALKA 2VDWA 3V7YA 3CUVA 3LYLA 3VPHA 3WJ1A 2HC9A 3ZK9A 3LCMA 1S2NA 4TTSA 4Y9SA 3V8PA 4TV8B 4Z7QB 3IEMA 1VXRA 3GB9A 5GZ6A 1BKYA 5B58C 1RVDA 4G8CA 4IFBA 2HXGA 3IIKA 3KBBA 4P36A 4TVOA 1X9GA 5ELXA 3KSRA 4NP6A 5GANK 3FD5A 5K03A 1DNPA 4JYZA 2J3JA 2YBEA 3O8NA 4LXYA 2AB0A 3HBMA 1RWWA 1JNYA 2AQIA 2Z3YA 1PJRA 2Z2JA 5KJCA 2B8TA 1OGIA 1IX9A 1S4QA 3U13A 2Q73A 3K0SA 1WV0A 4DMUB 1M2EA 1E6WA 4HT3B 4P6VF 2WU4A 2EDCA 2Q2WA 4NU5A 4K03A 4AXXA 1UMCB 3SSOA 2GPJA 3BJMA 3KYJB 1JQEA 1V5EA 4O2RA 5G3ZA 4OIMA 1W4AA 3AK3A 1TJNA 1KZ9A 1MMFB 2JAXA 4JI1O 2IW3A 1AROP 4Q6WA 4RIGA 2FMXA 4XUEA 3UGTA 2W6NA 1CY1A 5BY2A 1B42A 3EGXB 3ZDXB 2VRBA 1X7ZA 3PKIA 1M1ZA 1XZ8A 4YJ3B 2G36A 1E32A 4U6NA 1CFJA 1EXWA 5K1PA 2F3QA 4H17A 4XD2A 2F43A 3QJGA 2VRCD 1GG8A 1RLOA 3O7MA 3VSBA 1FXUA 1K97A 2DOKA 5B1BB 4UU1A 4MVJH 3RSQA 3ZW9A 3JWGA 3LBHA 3JARB 3N4YA 1T4BA 3AL3A 1XZDA 4L3WA 4PYOA 1DRVA 4F0JA 4OU5A 4G1UC 5BR8O 2FZVA 3I45A 4U2BA 5ICSA 3DBRB 5FJ4C 3OTFA 3EQZA 4L4RA 2YEVB 1WO8A 1JA9A 4G4SP 3VYRB 4BQNA 1R0XA 2I6DA 1HY3A 2OGSA 4JASB 5H3CA 1T2AA 2RQ6A 4EEZA 4OF4A 3WJ7A 5CA1A 2Q4BA 1T4CA 1Y6JA 2Q4TA 4UCTA 5B1NA 1WWKA 3OHPA 2VAMA 1QVZA 2O0MA 4OX9Y 4PZCA 3KZNA 2G0AA 4FM0A 4YV1A 4PFQA 4IUYA 3JASB 3DMRA 5ITZA 3IKTA 5DXFA 2RHTA 2ZRBA 1J4AA 1IJEA 1E96A 1DHTA 4Q20A 2C82A 2EWVA 5D1HA 4JLBA 3SYRA 2CLLB 4XVCA 4BFTA 3AI1A 1WDWB 2ZYDA 3AUAA 4XI9A 4EA6A 1A4IA 5EJ4A 3IL2A 3AZOA 1OFGA 3KYDB 3C1TA 5EWMA 2JD2A 1PZXA 2ODTX 1E0DA 1JVBA 1XLTA 4JSTA 4MVJA 3OGCC 4RSHA 3VR6H 4EGCB 2GTHA 4Z4EA 3ER8A 2REBA 2XOKD 1RADA 3C8HA 4BMZA 4RA6B 4GVPA 2VCYA 3MCQA 1YJAA 2BE9A 3UHJA 1VQ8F 3EJ6A 1Z6XA 2YZKA 3E1SA 4OQPA 4KE8A 3F67A 3O8QB 4OHMA 3IEXA 4XX0B 2C9CA 5DYGA 5ENVA 3C97A 3I2FA 1WP9A 3KFXA 2AWNA 3PK0A 4FINA 2JARA 4HNRA 1QIFA 4TLEA 5CMLA 3VSAA 4IV8A 1ZD9A 1ZVQA 4YAOA 4EELA 2VK8A 3VBEA 1Z6YA 4UMVA 1CF2O 1TTQB 3K4HA 3MBIA 5EHNA 3TRKA 5THQA 1BMFA 3STVA 3I5XA 1IIRA 1MD9A 4MYHA 4UXNA 5THXA 3RTEA 4Q7MB 1IB0A 4BLTA 3NC1C 3DOHA 4I81A 1Z12A 2KPOA 4JQSA 4ND2A 4PHGA 1ISMA 2A5DA 2ZYGA 1M6VA 1IL0A 2J3DA 3IEPA 4HLUA 3ZQ6A 5IXJA 3HO1A 3W5SA 1VG0B 1SOMA 1J6UA 2GDSA 1FXWF 4M83A 4XLZA 5AVOA 3U16A 4GXQA 1C0PA 3FYTA 1SVWA 4PSDA 5SY4A 3ZBQA 1VSBA 2IPOA 4J2TA 3AG4B 5C8YA 2I1QA 3RIEA 4DV2O 2CVPA 1R0WA 4MAAA 4D9BA 5JFGA 2AZMA 4UDNA 3HJAA 4C0QC 1B4DA 1L7AA 3SHFA 4UB8Z 3WRYA 5CFZA 1OFIA 2VR1A 3IA2A 5IJ0B 5CW2A 2WLIB 1BE6A 1M7GA 3JQCA 1M57B 3SZRA 1LFDB 3I9MA 1P2DA 5GY7A 1GCUA 1XNHA 4BB6A 2ZP1A 3RVBA 3PWSA 4QIHA 2AZ4A 1TU0A 4FGZA 3EHBB 1EBOA 1E1CB 1XRJA 2ZT9B 3V4ZA 5A4IS 3AXSA 2R72A 1I94B 1J97A 2IJGX 2PZBA 4HATA 4U5QA 5B6PA 3JVVA 3ANLA 1PCXA 4QDOA 4YMLA 4G0UA 1XLUA 2V45A 4Q48A 3IHTA 5DLYA 2QYHA 2GAAA 4OHVA 1XFAA 1KDPA 2XVZA 1H1LB 1FDOA 3GQBB 2OA0A 3E18A 4D41A 1E3TA 4EPTA 1UMDA 5B4UA 1H8EA 4PNPA 5AKIA 3H1JH 4BXOA 1SVMA 2Z08A 2R8XA 2HF8A 1Y3FE 1G2OA 2QA4V 4IHJF 4L4SA 4WFEA 4CFSA 4DV7O 1Z0SA 2ZUSA 3U7HB 1QRUA 2FMTA 4BO6A 3HU5A 4BRWA 2HJHA 4IUBS 1CQXA 3PGJA 4WSOA 4BTVA 2BC9A 4H4CA 4R69A 3ROGA 5JAPA 2QMYA 1CDEA 2XAUA 1D9ZA 1QE0A 3D5QA 2FEOA 3E82A 3D31A 2GBLC 4GL4A 2MWMA 1WDMA 2ZINA 1SUDA 4NKGB 3ZUPA 3CCRV 3GQVA 4OQQA 3WO1A 1S0UA 3M6AA 1YHQV 4JYBA 1UXHA 1WZ2A 5CU7A 4TLDA 3ABKC 4OPHA 3S3XA 2JKYA 4J2OA 3GBSA 1UBFA 4GU5A 2WSSD 3PT5A 1XDSA 2VPQA 1ESDA 4HNHA 4I7EA 5JMOA 2FPXA 3DXRB 4BMSA 4DR1B 2N3ZA 4CF7A 1Y1SA 1T6BY 2HV9A 2Q1SA 1TEZA 1D2CA 1NP3A 2D0PB 3GLHA 3LYHA 2F8MA 2OFWA 4QNHB 3VYUC 2BEWA 2PUWA 3V7FA 1TJPB 2YNMC 3I6BA 3OF3A 3FVTA 4MS1A 1DTSA 2HPZA 4M8NE 4NBLA 1SNYA 4C89A 5BV0A 5LA6B 4WY8A 4YDRA 2CT8A 3FWPA 1CDZA 8ADHA 1WSDA 2A59A 2B37A 3HFRA 3KQYA 3RAJA 1ESNA 4IH1A 5K6RA 2GAIA 1E79D 1QRAA 2QBYA 1NVEA 4UTPA 2O7NA 4JBXA 2FCAA 1P62B 2JIZG 1TKCA 2IZOA 2XEDA 4HXGA 2WU0A 5AVJA 1KQSF 1X7OA 2QJOA 2YWGA 2A6PA 3CUYA 4Y0AA 3KKMA 5DB4A 3WLAA 4EFMA 5GTIZ 4HGOA 5GTHZ 1U8CB 2B5WA 5T8KC 4F72A 1U0OC 2F00A 4W82A 1EZJA 3CCLF 1GRNA 4JUDX 1YD7A 3BSYA 4WCFA 3VDRA 3DMDA 3TOCA 4K1LA 1W34A 1Q5PA 2NUTB 3M9XA 1RQGA 3OJ0A 3P9KA 1LPSA 3EC7A 4KK4A 1NFFA 2W8ZA 2GN2A 2RGWA 4L9SA 4MR9A 4QBGB 3CLHA 5F3RA 5AXAA 4BEJA 5AIAA 1N5IA 2XNSA 1TD9A 1ZMBA 5FUBA 3ZJYA 4A0QA 4BTEA 4WT7A 1Q43A 2SKDA 1P4RA 2EVWX 2YCBA 4C14A 4M22A 5IXSA 4LZJA 2VTBB 1IVSA 2VZLA 2HQRA 3PDHA 1E9EA 2BR3A 4GZ5A 1MH1A 3RBZA 2FQQA 3SEAA 1I33A 1KKMA 1GM9A 2HS4A 3OTOB 1PGQA 1UXGA 3LW8A 2G9NA 3G68A 1YL6A 1E7WA 5EUCA 1K3TA 1GR1A 4C4SA 3LNTA 3GMSA 2JJYA 4B4OA 3VYVA 3BZUA 4RTJA 4WNAB 1SKBA 1ZR2A 3CCVV 4BNMA 3VGJA 1VE1A 5FHRA 1M6HA 4NZPA 3A6GA 1XF9A 3LK7A 2YV4A 3FSEA 3H1LH 4G9BA 1X15A 3A9CA 2MJLA 1JX9A 2JI8A 4FWBA 5JEDA 2IHZA 4TXHA 1T8PA 2QM4A 3BPZA 1ZU4A 3QEMA 3OBYA 1PPJH 4ND8A 3Q3HA 1LV8A 1A9RA 1P4JA 1HL3A 4IHQA 4ZAYA 4DM4A 4GDFA 3MBKA 1I3MA 1QCDA 4JLWA 1H3FA 1U3VA 5JJNB 1E9BA 2O8NA 4TT3D 4DC1A 1V1RA 4MS3A 3I12A 1AMUA 1YVPA 1WUKS 4N3AA 3ZWAA 1BDMA 1X94A 4URZR 1JW9B 4A2CA 4IYJA 3U7IA 5KSZA 1N3IA 3ELDA 1NZJA 3OKAA 4X3PA 3CCUV 4RYLA 1JLMA 4WFGA 1DPFA 1JG1A 1W44A 2YIBA 2QT9A 1VZ3A 4V3BA 4XJSA 3TX6A 2R6FA 3FOCA 1E2FA 4I1SA 4R2LA 4L6CA 5JG7A 4JUAA 5FOSA 1NY5A 1LQ2A 3NKLA 4G97A 4OHPA 2OZEA 5BMOA 1KU0A 3HJCA 4QVIA 4YQFA 5JATA 1TPYA 4RTOA 2JDIG 4DMCA 1OPXA 1H7MA 2CEKA 1WQ3A 1JKXA 3KQWA 4RAOA 1NT2B 3L74H 1MNQA 5AOAA 4X65O 1F4LA 4G65A 1E6KA 3BHMA 3A1NA 1V1JA 3GWKC 1P49A 1V6SA 1JYFA 4RVFA 3RUIA 4C7BA 1CQIB 2HFEC 1CS0B 1ULBA 2SCUB 3RKSA 2H54A 2CW4A 4JV5O 5C1DA 3GHZA 5BV8A 3LC1O 4RFSA 5FEUA 1Z5VA 2D54A 5CR9A 3GWZA 1SUEA 1N9GB 4RAIA 3BDVA 3SBEA 5JRDS 4GECA 3C3CA 1E1QG 1G60A 1RYEA 3COSA 3HDHA 3UWKA 4PI2A 1JJ2U 1TF7A 1C1HA 2C3UA 3FFXA 3N6VA 5LFAA 3O95A 2C7QA 1KDZA 4O2BF 1SKYB 1XJ5A 4JJ7A 2WBLC 5BO5A 4BU0A 3RVLA 2QXTA 5AVSA 2D8MA 3BJIC 2VT6A 3LKZA 4Y2XA 1NN0A 2BBOA 1OBHA 5LGTA 2NV0A 1G0OA 3CCCA 3GAZA 3IP5A 3AVYA 2ZYTX 2Y2VA 1JFFA 5JH7B 2A94A 3GEHA 3IOMA 3QV1A 5KYUA 1XZNA 2YHIA 4P32A 1QHNA 2VT2A 1UIMA 4JVOA 4RV9A 1YIJF 3T38A 1KJNA 3S1AA 5ELMA 5CA0A 3L79A 4DUGA 4NMHA 2IXEA 4XR4A 1COWA 4ZVSA 2XYQA 2JGJA 3B89A 4H3VA 1P84F 2EIMB 4ARIA 1HNWB 2OTJV 1JJFA 2DKNA 2W37A 4LHVA 4QUAA 1V8BA 1AR5A 2AC4A 2F8LA 4UUOA 1BD3A 5HRUA 2PWYA 3JQ7B 3CRVA 4LVOA 3UV7A 5JAIA 1U5AA 1WLEA 3WMWA 2GZ3A 1NAHA 1TE2A 4I3HA 3X2SA 2ZAYA 4DW0A 3L3BA 3NHUA 3MGAA 3R7NA 5J4VA 3ELCA 5AW8A 3IE2A 1TAGA 5IT9A 2J6IA 3OCWA 2WLJA 4UVAA 5DM6V 1HV8A 4PA6A 2MTBA 5C5CA 4RCZA 4QDJA 9ABPA 1B16A 1Z2NX 2JANA 3H1BA 3IVMA 4IJ5A 3I72A 1LKZA 5AM1A 1XEWX 3OVMA 2AOUA 1PL6A 2Y99A 1AP5A 2A06H 2CNLA 5CEEA 2WU3A 1MZEA 1L5RA 3OE1A 4WLVA 1GHTA 3G2QA 3DBIA 3U3ZA 4GXNA 1V55B 1M8PA 2C3MA 2E1RA 3VPFA 4BLRA 4Q9NA 2ZYRA 2W0MA 1NSTA 4JP5A 3ULKA 4X9XA 3WC4A 3W5AA 1Z2CA 4JB8A 3GJYA 2PZEA 1Y33E 5ALFA 1GSHA 4BKQA 5IDXA 1XT6A 3VQWA 2HLHA 2YUIA 3FKSG 5JIBA 3NAZA 1TQ2A 5DTEA 2B30A 4LI3X 1W85A 2BGLA 4GPTA 1R3UA 1NXSA 1T1IA 1V9PA 2O23A 4TL8A 3TAHA 4BW5A 2GUZA 2QSJA 3FNRA 4M87A 4ARVA 4B47A 3HLKA 1DXYA 1GAEO 3OLYA 3QITA 4IGIA 1USUA 3ZD6A 2GZLA 1QYCA 4O2LA 2PUBA 3T34A 2MT9A 3SFTA 5HXAA 1W6UA 3ZE7A 2XA1A 2QDKA 2POQX 5KAMA 2MK3A 1RIIA 3ZLVA 3V42A 1K68A 4KPYA 3OAAG 3RSHA 2VTEA 4B7EA 3OCUA 4RUKA 2GNAA 1FOEB 2WLLB 3WAKA 3C9SA 3GT3A 4FU0A 1EZ1A 2R1VB 3KQLA 1YR9A 1SCBA 3NUQA 3HADA 1W8IA 1U4SA 4DCNA 4KRXA 1O0CA 4D4KA 3G7UA 1YUBA 1S72F 1KJJA 1NUAA 4WBSA 5ALGA 2B4KA 4UBNA 2NPFA 3UWSA 3K0HA 1O89A 4MW5A 3O9MA 3FYIB 1D04A 1EHYA 1DAFA 3CJRA 3E48A 3G2LA 3NIBA 5DT9A 2Y71A 4AJ2A 4H1WA 3CRMA 3A2LA 3QVNA 3NTRA 1QBZA 3G79A 4JYYA 3QLUA 4NHOA 2RGYA 3MWGA 2PX6A 3D2AA 2GLZA 4M8IA 2R6AA 1W30A 3BFXA 2HJSA 1K5PA 3S02A 1U2RA 4AS2A 5EIOA 3VAZA 4EX7A 1L7VC 1XHZA 1GNRA 2NMUA 2CFIA 1PDVA 2FJ0A 3PUZA 2VTVA 4UB6Z 2CZCA 4N7MA 1IHUA 2BZ1A 2QLJA 2Z3WA 3GN2A 2QOEA 1B8UA 2UYKA 1LPMA 2GEJA 2W2NA 3A04A 3T3GA 1P1JA 3FSGA 3HH8A 1KMCA 5B7PA 4EMBA 5LDHA 1MABG 2EILC 2BZGA 2PSHA 5DBOA 1OTHA 3LNNA 4TWKA 3VUEA 1EHIA 4UEJA 4YUAA 2D1QA 5I3CA 5K0JA 3WV4A 2IE0A 4UJ3A 2YUAA 3I3OA 4M7WA 3WZ2A 1SXJE 3WWZA 2ZRLA 4P34A 3P0ZA 4LJ5A 5CIWA 3SIPA 4DUPA 2IBSA 4PZZA 5JAMA 1CWUA 1UAGA 3HBLA 1JQJC 2YH2A 4F1KA 5K0GA 2UUBB 4R0NA 2HS0A 4OKSA 3DVAB 5EIHA 2J5QA 1L5MA 4E32A 3T80A 1PX2A 3IHLA 1PL8A 2HLDD 4CR7A 1JDTA 5KX5A 4AWAA 2ZS8A 5G4UC 3MG9A 4OQZA 1GPYA 3KVNA 4ENPA 3VNBA 3SGLA 1RLJA 1GL9B 1MB9A 2XCLA 3A2FA 2EZ8A 1QQTA 2P9ZA 3I6ZA 1OZGA 3GEBA 3VHXA 4A6XA 5IANA 1E3IA 3OMWA 5K6AC 3PNSA 3W8EA 2JJ2D 3WDSA 5GONB 1YCFA 4M76B 3P9XA 1DK1A 5H83A 2E5LB 4XJTA 3CO5A 3MELA 1I24A 5DW0A 2Q5EA 1L7DA 3JQGB 2Q7HA 1X1BA 3BE4A 1NFQA 3L7LA 3VC2A 4TYQA 5DMXA 2PHNA 3WL3A 4ZCMA 1G5HA 4LFBO 4Y1EA 2A86A 3HCBA 3WYNA 5B55A 5IS2A 3WPWA 1U2EA 2VZ8A 4O6VA 1W88B 1PR2A 2E82A 3F97A 3FDFA 1XLVA 4TTVA 4Y2QA 2IWHA 3SC4A 5BR1A 1K8AW 4GPZA 1KYYA 2I2AA 4J80A 3BAFA 4E2FA 2Z1DA 2RJNA 2IRWA 4ZKIA 3OEEG 4EAAA 4ACAA 1YUMA 3W7XA 2QZJA 4N12A 5JXWA 5IHPA 2DH5A 5DOZA 1MSWD 1V0JA 4ZQCB 3RRZA 2HHCA 4CU5A 5HUHA 4NX2A 2QQ5A 2PR7A 1IM8A 4WLUA 3INGA 2QG9A 2ECOA 1XNGA 3V9PA 1JJIA 1QO9A 1ZWZA 2GHRA 4I1UA 4NBKA 4OCZA 4DQ0A 1R6AA 2K87A 5JAHA 1VJ0A 2O2JA 3DMHA 3UCFA 4N18A 4YIHA 3DL4A 1ES9A 1Q90D 1GPAA 2QR4A 4X9QA 3Q9LA 4XYBA 1GTOA 3OJFA 4DM7A 4ZOAA 3ZDDA 3EVNA 2H2AA 1O9GA 3K12A 2JKVA 3LT0A 4N54A 2Q99A 4DG9A 4QE7A 1VPTA 3D6VA 3E8XA 4JCOA 5I6DA 3U6KA 3PPIA 2Q4DA 2GYVA 1EK2A 3HJHA 4EA8A 3BMQB 4YCLA 1JWBB 1VI6A 1B8PA 4M88A 2E74B 3HKDB 1CRWG 4EY5A 5B1EA 3NM4A 2GBIA 1U6JA 4EHKA 4HDKA 3JQQA 5H3HA 3UAOA 5J2UA 3MJCA 1KK3A 4GNRA 5TJ9A 4U3FH 2IYPA 4EO7A 4QE3A 1LUAA 3HDVA 1IZYA 3JD4A 1HT1E 2V3CC 3UAGA 1DC6A 4FR5A 3IAUA 1NF3A 3ZWWA 2FOXA 3DNPA 2XRMA 5B1IA 3OIVA 3DV0A 3FRJA 1GV0A 2HUNA 3GVPA 3B1YA 3LBFA 1OR8A 4R2JA 2ZOVA 4BZQA 1Q86H 4XPZA 2UVDA 1FKAO 2JIMA 3OE4A 2FN7A 4DLXA 4N5HX 5KYTA 4UVHA 2LBWA 3VNUA 3SHOA 5LM3A 3GHHA 1US8A 3VU0A 1GQOA 3EG5A 4Y0NA 3JQ9A 2EGGA 2ZRHA 3AP3A 5LOVA 5G4KA 5JJKA 4AP9A 3AHIA 4EG0A 4D9KA 1O8CA 1SWWA 4GIBA 4XUDA 1YONA 3ZS9A 3DKVA 4V2IA 1CQJB 2P5TB 2PD6A 1WPXA 1LPBB 2Y1GA 3N0TA 2ISCA 5ITWA 2I91A 3K5NA 3ZKWA 5T4HA 2HHJA 1PTJA 3UT5A 1B6GA 1GL3A 3UAWA 1YL5A 3AM5A 4EB6A 4G4YA 4MKGA 2IF2A 1KFBB 2VPWA 4O4IF 3IPYA 4BT7A 3E7WA 3ZRWB 1XPJA 4NFSA 4ZQGA 4ZHSA 3V1TC 1QCZA 3ZBPA 1J24A 1QDLB 2JVDA 2VZ9A 5L4NA 4NCHA 1NXTA 1I7FA 3H8WA 3GWOA 1N33O 4PIVA 1P6QA 3PQ2A 1DS6A 1I3LA 3C5EA 4F1WA 4S2UA 1EMDA 3COPA 3QBDA 1LLFA 1TF2A 3PWKA 4R71A 5K01A 1JDBC 2FUNB 3ZP7A 3TSWA 3KQUA 2PVSA 2IU3A 3KJIA 2ZU6A 3CLTD 4DVGA 2KSDA 4H31A 5LKRA 4Z3KA 3MSXA 3PHBE 5U4XA 3F5WC 4XSVA 5ERYA 4PELA 1SK9A 1MOZA 4V0ME 4Z86A 1E99A 1KYVA 1P5HA 4O4HA 5EJIA 1IATA 5DX1A 3CZMA 1UAYA 1B8NA 4BX0A 4WN3A 1KFEB 1MPXA 2Q3CA 3I39X 2ALJA 3LFUA 1RJFA 4X3OA 2WLMA 3HB3B 4PGMA 2NYAA 5KS2A 3ASZA 2LBPA 4NU8X 2X5KO 3FUWA 3BS4A 4MVSA 1XA4A 1QVGU 2CXUA 3K9BA 3PD7A 1Q86W 3DMYA 3OIGA 2XMDA 5ALSA 2IHNA 4FGUA 4YCBA 3GJ5A 3D59A 3LOUA 4NFHA 3VOUA 5I5EA 5FPRA 1RPOA 4B3SB 3B6MA 3I9OA 1DKRA 2H1RA 1SUCA 4UVCA 2IXFA 2JIPA 4GLXA 3MCZA 4MDHA 4PRLA 3SNKA 5CEFA 1U0TA 5GM2A 1VPLA 3DJFA 3PEEA 3C70A 5AHRA 5A6SB 1ZINA 2J9RA 3WK7A 4ZOLB 1OAKA 1PWXA 1Y6ZA 2WT8A 2ZULA 3K1JA 4KSYA 3I4LA 2HLDG 1Z0AA 1XPUA 1RCUA 2YCLA 2YXNA 1WKBA 1OV9A 4TUYA 5KOHA 1ZKMA 2V3VA 3R7FA 4GMGA 3IGAC 4KP7A 1U3GA 1H2LA 3SKVA 1OGJA 3CVVA 2EZ9A 2AN1A 4ZXFA 1L1RA 4MS2A 1EFRG 5DI3B 2JCYA 1R74A 1OFTA 3H11B 3VMFB 1AKVA 4QWWA 2XLCA 4I6GA 1F1BA 2I8LA 3LAWA 2XDQA 3JW8A 2AF3C 3C6YA 3HXTA 3EIFA 1FU8A 2FPKA 2HF2A 3H16A 4HI0E 1R8YA 3X1JA 3L7OA 1HKUA 3OZEA 3P9SA 3MWEA 4CC5A 4HEJA 4JAAA 4PQFA 5L3DA 4FHFA 4P5DA 2UZAA 1NVKA 1QVWA 5BNFA 3SDBA 4F9GA 3ZU6A 2F7SA 3SPGA 2LGJA 2CNWA 4PSVA 1JXAA 4D1YA 4TMVA 3CJHB 2UYQA 4N5LA 1HR0B 3WIUA 3DC5A 2DSTA 8OHMA 4FHCA 6ABPA 4YWJA 1TT7A 1YOBA 3EIQA 3MYRA 2D5BA 2ZYIA 4LJ9A 1PV0A 2G63A 2O2XA 2OYCA 2VRCA 3NEJA 3V8MA 4BLSA 2ZYAA 4H7HA 3K0AA 3PQ4A 3CC2F 2QUZA 3DFFA 3WWDA 4AJJA 4C22A 2NTNA 3WHKA 2G7ZA 2HRZA 5DM60 4C7JA 4QAQA 1UJ5A 3QE2A 4L74A 4AS1A 4OXIA 5JAUA 1O6BA 2FV8A 1GQRA 2Q29A 5C37A 4TWAA 3WB1A 1UCFA 3TTUA 1OXMA 1KVUA 3QNWA 1DCMA 2D00A 4KPUB 4RPIA 3T6KA 1ZK4A 3IURA 3K70C 1ZD8A 2JJ1D 1GV1A 3OP1A 5FLXA 3THWB 3FD9A 1YI2V 3OQNA 1NJ6A 3RYIB 2X7JA 3EB9A 3PJSK 3KXLA 5ESWA 1UBTS 1AGYA 4GYJA 2ANBA 4CI0B 1C29B 3DOJA 3E5NA 3KKPA 3OM3B 1NZFA 1SC9A 3OJEA 5HILA 3WQSB 3CS3A 5JNSA 3EUAA 1BYIA 3DMGA 3D7NA 3OZBA 4OSPA 4O4LB 3H0CA 3T1YO 2NACA 3EMDA 3IS3A 3OAAD 2PRSA 4FMPA 2XE4A 3TZ6A 1CUDA 4JLMA 4UVDA 4MYTA 2WPDA 4CCYA 1JQLB 2V7QD 4ZEMA 3UKJA 4MVUA 1ANKA 3B7GA 1W5FA 5J2TA 4MA5A 3GNTA 3ROMA 2J6HA 1XTBA 1RXUA 1X3SA 1H22A 3BMXA 4MLZA 4PICA 5FUQA 2X6CA 4L4ZA 3KXKA 2AC7A 4HVCA 1PDOA 3JD2A 1KSJA 1LPNA 4WCEV 1GGHA 2FZKA 2I4NA 3KO8A 4IRMA 4AJ1A 4C88A 1I0ZA 4DMKA 4ZK6A 3PC6A 2QORA 3WKEA 2ORVA 1N0HA 3D4IA 3Q0IA 2YW2A 1SXHA 2J9GA 2PK3A 1XAGA 4WF9V 3LUCA 3Q85A 4I50F 1OLUB 1OBCA 3AEQA 3FYDA 4UATA 4UHFA 1L5SA 1P4AA 4LCBA 3TR6A 4BNIA 3F47A 3F46A 3X1YA 3JQFA 3H1HH 3ZHQA 3LP6A 3BDIA 1JSCA 3GH3A 1JJAA 4RQUA 3P2MA 5EC1C 2OB1A 3ZWMA 2UZ4A 1HQCA 1U0GA 2IUYA 4N5MA 3F1KA 2ECKA 3ZE1B 1DDOA 2Y1OA 4GOXA 4LMRA 3ETGA 3BFPA 3ABKB 3VOSA 3K6KA 2DMXA 1R3DA 3RADC 1OA1A 4MWGA 4RVDA 3KKEA 2J3IA 1M6EX 4ROSA 1ECJA 1F8FA 4JMLA 3BE5A 4X66O 2AD1A 5D7BA 1RHUA 3E3AA 2HMVA 4LN1A 2OL4A 3K5IA 2QJRA 4L50A 4ZXPA 2AKYA 2J9FB 3ODPA 5FI1B 4DLLA 4GMFA 2WJZB 3AF2A 4ANFA 3ETDA 1C2YA 1P7ZA 4QUJA 1TUIA 1ODEA 4LZAA 2O7RA 1MB2A 3WYDA 3S2FA 4Q3LA 2R6HA 4LCJA 5CVEA 2QRPA 3OONA 5JC8A 2I3AA 3QM1A 2WQ6A 1ZCAA 1C7FA 1UINA 4HRXA 4OMCA 1QVVA 1POWA 3UYKA 1P0IA 2O0HA 3F5SA 2H0RA 3AEUB 2P9GA 1TZ2A 4PRKA 4BIMA 1KA9H 2C4NA 4DR4B 2V6FA 4X6XA 4AYWA 4TYYA 5A9RA 5JS1A 3LA6A 2CHQA 3NTQA 3T1VA 3LWPC 5KQLA 1N32O 3Q6IA 1R5JA 3DONA 4D0NA 1P39A 5AIBA 4X7RA 2EBOA 1KKCA 1QKKA 2CLMB 2NUBA 5EZSA 4DLYA 3W1VA 2ZD9A 3PFNA 2IIQA 1YQEA 4J4BA 4TWZA 1Q6ZA 1Y37A 1KI6B 5FOVA 2VBIA 2V9CA 3R7DA 3QPUA 2ZVDA 4JOBA 4RPHA 3QX7A 2EJ7A 4KKXB 3U44B 3ZVLA 1T26A 3TLJA 1NOKA 4NXMB 2JFZA 1EVYA 1I0IA 1NOIA 1OX4B 4WTOA 1TZCA 4WXPA 5J23A 1SC5B 3MBOA 5EUMA 5HKAA 1I7SB 1S6YA 2X9VA 2JDID 1FPOA 3OJCA 5EI5A 1GGVA 2UUCO 1GK9A 2YVKA 2W98A 3A6JA 3AOEA 4F06A 4BNDB 4IILA 3Q72A 4LPSA 1U9IA 1F5SA 3OPQA 4OOFA 2NVWA 3RC3A 3UMJA 4IT5A 1QBKC 4OJTA 4KPFC 4LG1A 2NVUB 4PG8A 1YR2A 4WN9B 1G8PA 3AUUA 1KRXA 3S44A 1OB5A 1NN3A 1TLTA 1WZCA 2X9QA 4M0UA 3CC7V 2DFLA 4J29A 2JCVA 3O82A 2V65A 4MUJA 3C5CA 4KWEA 4ER0A 2I2DA 1M5IA 1FXKB 5TXGA 1F2DA 1XTKA 1JRLA 2K6GA 2R5FA 4FEEA 3BK1A 2GAFA 3IEUA 1B23P 2KLHA 2WB4A 4KWCA 2NQ8A 3FPHA 1Z28A 1QHIA 4QQNA 4IXNA 1KU9A 4KP4A 2I7XA 5HP7A 1M72A 1JQ5A 4BT6A 2PTMA 1OYWA 1URPA 5GJCA 1M5RA 3D1LA 4GMXA 3ZN0A 5DCLA 4BBJA 2HT1A 1DJOA 4HBZA 3HJRA 3E1YA 1YBFA 4AI6A 5A5VA 4WJZA 1QPBA 3PLAE 3CLSC 4X3CA 4HF7A 3VU9B 4BE7B 3S0HA 1JIJA 1UK6A 3D6UA 3UHFA 4EPWA 3F2VA 3TL2A 5TMPA 2LUOA 2OQ2A 5TNXA 2XIQA 2OIEA 4YLGA 3Q98A 4RETA 3MTJA 5DMHA 3SMQA 3U10A 2AW9A 5LJIA 2YXEA 3BEDA 2XAFA 3LVBA 1PNKA 1BCSB 5CX1A 5GW7A 4AF6A 4CL8A 5HRAA 4X54A 5HIIA 2JBAB 3U7QA 5A4DA 3ADBA 3EXFA 3JR3A 5EXEA 1SXQA 4JITA 4F4LA 4BO3A 2YWJA 3SBXA 4RKRA 1BSVA 4O4JA 1KECA 1Z7EA 5TDHA 3A10A 3EE6A 2RCYA 1IB6A 5ECDA 4UTVA 1TVEA 1GM8A 1EM8A 2JI4A 1P73A 4P7FA 1KPIA 4MB2A 3HSKA 2JGUA 1O9HA 4TXNA 4BV8A 3C1OA 3KLOA 4KI0A 4Q21A 1FUKA 2ZIAA 3PIRA 2RK4A 2BFDA 2GFHA 4DBVO 2XTZA 4X1OA 4QPZA 2R6ZA 2OTJF 2Y1DA 1QF9A 4ETMA 5AUNB 2Y4NA 3GJ4A 2XA2A 4ZZ2A 5GQSA 3S5JA 5KI6A 4YIOA 3GCWA 1BNCA 4JODA 5ALJA 3WNVA 3ON5A 1D9XA 5HTKA 1XZBA 5L6MB 1LDNA 1L5HB 5BURA 2DPLA 1QVAA 4H7EA 3GAMA 2XTAA 4HEA6 4ZEOA 4D74A 1QFSA 2PN1A 3EDMA 3O3NB 1II8A 5BVHB 4MO2A 3A3NA 1OKKA 4BVJA 3O8RA 4J16A 2JLYA 4M89A 1U2GA 1DC3A 1YJQA 2B98A 4COOA 3S3WA 3KU1A 2MSLA 2ZROA 3D2LA 3N4ZA 1PD3A 1C8KA 1N7IA 3E9RA 1C41A 3GG2A 3HYTA 4OPMA 3VXKA 3S4YA 2DB3A 1IV1A 2EULA 4C4ZA 3QH4A 2WFAA 3DLHA 3SOPA 5JS7A 4L8GA 1NIPA 4C4AA 1PFKA 1ZISA 4YMUA 2VYND 4HDMA 1NV9A 4IIHA 4NESA 4X65B 3WO0A 1VKRA 1IY1A 2GM9A 4FEAA 4CM4A 4R2XA 2WM3A 4MYCA 3CWBH 3DB2A 3P2YA 5KUKA 2B33A 4GZMA 3BG5A 4M1WA 4EUSA 1SBNE 2XPCA 4GSLA 5EWJB 3P5SA 3LT2A 4E6EA 4DXAA 3D0KA 2VQFO 5B1AC 3L6UA 4HXYA 4PX5A 4HNAA 4UAJA 2XQGA 3PFGA 4A0RA 2A7WA 3A6PC 3AF3A 1ZOIA 2JIZD 2AFIA 2WHPA 1R4MA 1P3JA 3ZE6A 4A0GA 4IZIA 3D8RA 3TIXB 3WIVA 1SD1A 2ZT5A 1OI7A 1QGDA 1M93A 2HEPA 1VQPV 3DB1A 3OY7A 1UANA 1QRRA 1VCHA 5EKSA 3VQTA 3K71B 4EY8A 1CJTC 4EG1A 3G23A 4R3WA 2FWPA 3NCTA 2WSBA 3PWTA 1NVDA 2D0IA 3IV7A 3PENA 2NYUA 2AWOA 2X8BA 4CUJA 10MHA 4FYKA 2UYOA 1N5MA 4IY1A 1PNTA 1X86B 5AJZA 2Q3LA 1O0SA 4G56A 1NMSA 5BQFA 3JVEA 1QDUA 2AXTZ 2FX5A 3GNSA 3PCRB 3SDLA 3UAYA 3FOAA 4OLHA 3WLJA 1L4BA 4B3RB 2AD5A 2QW1A 3G7NA 3MIIA 5LB4A 4EOGA 4Z4IA 1KYXA 1VHDA 3I2KA 1KDTA 1JB9A 3T4ZA 1XYVA 3NC0C 3VU8A 1IU9A 3NOVA 2QP3A 1ISSA 5T67A 2A5GA 1PG0A 2P41A 1NQTA 5JSQA 2ZWOA 2YR0A 2O5VA 3HMKA 3X1KA 2E89A 4JX9A 4ZCSA 1O4VA 2WSLA 1IBSA 3OTIA 3INYA 1B14A 1KXZA 2QD3A 3KOOA 3QPVA 5JCJA 4B6OA 4EJFA 1PJZA 1XZKA 4GI1A 3RC8A 1EDDA 3H1IH 1ADJA 4IJUA 1SPBS 3EPKA 3KB2A 3A4TA 2JIDA 3M6WA 3EZNA 3JQBC 3GAAA 3SYCA 3SPHA 4FLVA 1J9EA 4RJLA 4LYDA 5HZHA 3ESRA 5ITSA 5CT5A 1H2XA 3MRVA 4JZYA 3C3JA 5J5AA 5C46F 4ZVOA 2VWJA 2R25B 4K86A 4M8LA 1XPRA 5I4CA 3GFQA 4MX8A 3DVLA 1TF5A 3JU3A 4A6PA 5BY1A 4RJJA 4UW9A 1SOAA 1QIGA 2V4DA 1QIKA 2ZWPA 4E08A 3HKCB 2H1CA 5LYJB 1NT4A 5IP5A 2C2XA 4MVJE 3SICE 4LOHA 1CE8A 1XRNA 4GMDA 1OZ0A 4I99A 3UGQA 4D81A 2P6NA 1AV7A 4URYR 4EFKA 4RF2A 1XI2A 1K66A 2WEKA 4ZZ1A 1SQSA 3JZFA 4DMGA 3B1XA 3ZDZB 3ICEA 3DR3A 5ECYA 4LDNA 4DCJA 1BE0A 1E5DA 2M98A 1HKHA 2C1EA 4LXGA 1GUDA 1E5LA 2PH3A 4MIKA 4MGIR 2GASA 4V1CI 1QLJA 3TQSA 1SCIA 2IXGA 4NXMO 3C4QA 2FFRA 4KUGA 4NSNA 1RAEA 2X8LA 3I01M 4QO8A 1VYHA 1KBQA 5HIJA 3M34A 3OZAA 4LJKA 4MWTA 4YRCA 1YHQF 4MUGA 3S3TA 3VU3A 1H9AA 5DNCA 1XMSA 3WZLA 1EFPB 3A1VA 3CIFA 4NIMA 3R6WA 2JAQA 5KAPA 3WYAA 1ZHOA 1R9GA 1GRCA 3IDZA 2W6JD 2WJVA 5A4AA 3H5OA 4LTDA 3THYB 1KYIA 1MGOA 1N32B 4P30A 2OCHA 1INLA 3K57A 1QR6A 1XXLA 2GFQA 5LGUA 2OYRA 1NQOA 1RPJA 3DSRA 2VA8A 3L9DA 2Q5CA 4G5QA 4JB2A 1ORRA 2WW8A 5E0OA 2FEMA 4K8ZA 4DV6O 3RC7A 1EXDA 4JI1B 3RYFB 2PTGA 5C31A 3WMXA 5IUKC 3TINA 1M54A 1IZ8A 1OAPA 4GSYA 4KVZA 4BKUA 1ZN9A 3DKRA 2AR9A 3TQTA 3VH1A 4MT8A 1NU6A 5B5SA 3EZ6A 4JR0A 1LSJA 3HBNA 4ISBA 2C54A 5P8WA 1BVHA 3HYLA 1Q1QA 1BCRA 1V5WA 2XODA 4JELA 1Q14A 4L22A 1Y7TA 1Q74A 4HJRA 4OYLA 4MPDA 3JYCA 5LKAA 1ACLA 2Q9LA 4OXSA 1R9NA 1Y8RA 3I52A 3EGEA 1E64A 3I9JA 4M54A 4R6XA 3VJMA 3JSNA 1QHEA 1W7AA 2ZNJA 3I4FA