5LP6B

Crystal structure of tubulin-stathmin-ttl-thiocolchicine complex
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Tools for the rational design of bivalent microtubule-targeting drugs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 154
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5lp6B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5lp6B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5lp6B01
4U3JA 2Q1YA 3JAKA 5C8YB 3JARB 1FFXA 4I4TB 5J2TB 4IHJB 4LNUB 4YJ3B 3RYCB 4O2AA 1JFFB 4U3JB 4X1KA 4X20A 3RYHA 3UT5B 4KWEA 1FFXB 1TVKA 5ITZB 3VO8A 4E6EA 3VPAA 5EIBD 3N2GB 1RLUA 3WGLA 5EYPA 1FSZA 5KMGB 2R6R1 3VO9A 4O2AB 1W5AA 5LP6A 4FFBA 4X20B 5JVDA 2GVIA 4TV8B 1W581 1W59A 3JATB 5LP6C 2VAWA 3WGMA 2VXYA 3HKCA 3RYIB 4TV9A 3M8KA 5EZYA 4ZI7B 4DRXA 4DXDA 5FNVA 5LP6B 4O2BA 5JVDB 1TUBA 3JALA 3ZIDA 2VAPA 5JH7B 4IIJA 1Z5WA 3VOAA 5LA6A 4O4IB 4X1YB 3JASA 4DRXB 3HKEB 1Z5VA 4X1IB 3JAKB 4EI9A 5LA6B 3JAWA 4U39A 4TUYA 5GONA 3CB2A 4XCQA 4HNAA 4X1KB 3RYHB 3WGNA 4WBNA 5CB4A 5BMVA 3VOBA 5M7EA 1TVKB 1SA0A 2VAMA 3HKBA 5EIBC 4O4JA 3E22A 4I50A 5EYPB 5CA1A 4HNAB 3HKDA 4FFBB 4WBNB 5CB4B 5BMVB 3RB8A 3V3TA 1SA0B 4M8IA 3HKCB 3WGKA 4TV9B 2BTOA 3E22B 4O4JB 3N2KA 2BTQA 4I50B 5EZYB 4ZHQA 5CA0A 5CA1B 5JQGA 5LXTA 3HKDB 5FNVB 3WGJA 4O2BB 5MN4A 1TUBB 3JALB 5IYZA 4IIJB 5MN6A 3N2KB 2BTQB 5LXTB 4ZHQB 3JASB 4F6RA 1W5FA 1W5EA 5J2TA 3M89A 4LNUA 4O4LA 5LYJA 1RQ2A 5IJ0A 4I55A 4YJ3A 3JAWB 1JFFA 3UT5A 4F6RB 4ZOLA 4TUYB 4YJ2A 5GONB 4EI7A 1W5BA 5ITZA 5LOVA 2XKBA 3N2GA 4O4LB 5LYJB 5MN5A 5JCOA 5IJ0B 4I55B 3HKBB 5KMGA 5JCOC 2R751 3ZBPA 4O4HA 4ZOLB 4YJ2B 4TV8A 3RYFA 2RHLA 3JATA 5LOVB 4EB6A 5J2UA 3RYIA 2XKAA 4B45A 1RQ7A 5IJ9A 4ZI7A 4B46A 5KX5A 4O4HB 3C8LA 3RYFB 5JQGB 5CA0B 2RHHA 1OFUA 2RHJA 3ZBQA 5J2UB 4EB6B 2RHOA 5C8YA 3JARA 5JH7A 4EI8A 3R4VA 4O4IA 5IJ9B 4I4TA 4X1YA 4IHJA 5IYZB 5KX5B 2Q1XA 3RYCA 3HKEA 4X1IA
chains in the Genus database with same CATH superfamily
3GLGB 2FN4A 2I8AA 3LC1O 1BS1A 1UFKA 3MNFA 2ZBVA 3D6AA 1HGXA 3L0BA 4Q20A 1Z22A 3KX2A 3K8ZA 2PTHA 1WQ4A 1BCSA 5C4MA 1LCIA 1CUVA 4XGKA 3CURA 2ZITA 3VNRA 5DECA 4BQOA 4E2FA 4GPAA 2G72A 4RS4A 4BVAA 4P6VF 3HM9A 4K9RA 3MMXA 4K6MA 3IQDB 2WD7B 1LSOA 1A97A 1FDTA 1A2QA 5DM1A 1DAIA 1E7YA 3QXXA 4CGYA 1FSSA 2BM8A 1Z88A 2D2IA 1I0HA 3TTYA 2JBHA 4JQCA 3PA6A 2ZBPA 3EJ6A 1VHTA 5GZ1A 1TZMA 4F1WA 1R3JC 4WKNA 1F38A 1G8FA 1FNJA 2CTWA 1GARA 1VPDA 1M1YB 4DLLA 3CG4A 2B8EA 3D7LA 4LF9B 3SJBA 1R6NA 4J7UA 3KVRA 3U44A 4V03A 2HHJA 1AKYA 4O4IB 2O0MA 1KJ9A 2WWXA 4C29A 2QU7A 3OIYA 4ZOBA 3ZWCA 4YJFB 4DLBA 1VLQA 3SHVA 1XZPA 4IUYA 2AKEA 2DT4A 1TZBA 1LPAB 1X3LA 4CKXA 1SZXA 4TRRA 3FB1A 3WLJA 3ZWVA 3GF4A 2IWRA 4J6FA 3MRSA 5TC4A 3EWAA 4MKZA 3OTOO 1Z07A 3D4BA 2QP4A 3IDQA 1GN3A 3ZUPA 3NHJA 4WN9A 1U43A 1RHQA 2ACWA 4R0MA 3TQTA 5FPQA 1W40A 4Q9IA 1GITA 1WUIS 3ZU6A 2BD0A 2VTDA 3Q6IA 3AV3A 1IEXA 1WD7A 5HS6A 4DBZA 3IULA 4OJMX 1XYVA 2J3LA 1ZJ5A 1J21A 1PZNA 2DQKA 2DTDA 1CK2A 3AT1A 1I3MA 1LNZA 1IMJA 1M67A 3MGCA 3K9BA 5DULA 3ZNPA 2PD3A 5BP7A 2C42A 1BD3A 1QJCA 4WCDA 3SJZA 3QI2A 5LBIA 2EOAA 2LFRA 2WFAA 4GMFA 1QV6A 3VO2A 1V1MB 1U1GA 5AUQA 1ONNA 4DZRA 3NQ41 3F7NA 3IKTA 1JX9A 3SG0A 3LCRA 4GVPA 1EZVH 4C4WC 3OMIB 5CR9A 1HDRA 3ZX5A 4A6PA 1TB4A 1ZVVA 3BKWA 5LYJA 4FJ2A 4V0KA 2REQA 4N0QA 1ILEA 3F0EA 1YA8A 2HW8A 2G80A 2XE4A 4LFAO 1SF9A 4MMXB 1KDPA 3EZGA 2B1RA 2Q07A 1QG4A 3VZRA 3SQLA 2X9GA 2QK4A 2OHGA 1OC4A 2X19A 3WKAA 3OE4A 3DFZA 1K5SA 3NWBA 2D5BA 2OHFA 4UAGA 2V6MA 3AGPA 4YQYA 3KJKA 1XJ5A 2AN5A 4H9GA 3FHTA 4JLDA 1I5RA 4E3ZA 3X1MA 3AR6A 3LLMA 1YB4A 1QG2A 1XLUA 2ZT8A 2EIJC 1H2XA 3CCMF 4FLMA 1IJEA 1I3OA 4PPFA 4QDZA 2JRLA 2C82A 2H17A 4DF3A 3JW8A 3MINB 5JG7A 3VDMA 2P2SA 4JVLA 2KB1A 1D2EA 4IPTA 4ZWNA 5JJJB 2OE2A 5AW3A 1G5HA 4BQSA 5AKYA 1T4CA 3DA8A 4GP9A 4XIGS 2QTTA 3KJZA 3AK1A 4CUZA 4BJ3A 4LJ8A 4D9JA 3TJZA 1VI6A 3MTAA 1X92A 5MN5A 1RDFA 2HLHA 4MVJD 3ABKC 3O74A 3P2YA 4H77A 4RZ3A 1A04A 4PBTA 3I3FA 2V4ZA 2VP6A 1EWTA 5BVGB 1ZPDA 1C1XB 1ZDMA 2ORWA 2H8CA 4W5RA 5AWFC 2IDKA 3DOCA 4LXQA 1T2UA 3FWPA 3BREA 4HMQA 3MJ4A 1K27A 4DNFA 4I5SA 5JVDF 4IXMA 3SVLA 5A4KA 1UMDB 4H7HA 4M8KA 1V3QE 4PRLA 3NIGB 4MVJA 3V8VA 4ASUD 1L1FA 2AXPA 3ZLTA 1ETHA 1V5EA 2QDOA 4EA7A 4RGQA 1K9VF 2V03A 4JGGA 3T7TA 3PQ5A 4B3HA 1ODKA 1KU6A 5AXAA 5LZ5A 2YW9A 3CF6R 3N74A 4E5VA 4DJTA 1N1EA 3B7WA 2R86A 1H0RA 5CDFE 2X42A 1SVOA 1Q1EA 1QS0B 1W4BA 4Y6GB 3CN9A 5AI5A 1SDSA 2OWDA 1B00A 1P4SA 4K81B 2LPMA 2EX1A 4HGPA 3FPCA 3IUQA 4BDSA 1YRWA 2W4IA 2VP4A 3TINA 2ITDC 4LXXA 2IODA 3NAMA 2A35A 2O7RA 1UK8A 3ZQUA 4N8DA 1YJ9V 5F7XA 1Z82A 3QVGB 2JCSA 3HA3A 5CT6A 3DKRA 1JSXA 3AFMA 5CFLA 4F84A 3K5HA 3OUZA 5BQOA 1X7WB 1UKZA 3GVPA 3LCMA 1G2QA 2QGFA 1CUDA 3NB0A 1KIFA 3OESA 4TQUS 2BRUA 3LX8A 3MJFA 4HI0E 3T5PA 3MTJA 1XHLA 4Z1MG 1CJCA 4TSFG 2C3MA 5DPMA 2JBWA 5CDUA 5FLXA 3D01A 3ETLA 4LDJA 4CT0A 4WQMA 3VZQA 3P52A 4KDRA 3JQEA 3OCZA 1J7KA 2V9ZA 3FH0A 1R0WA 1H2WA 3GMTA 3SPJA 1MORA 1X19A 3HZZA 4KFSA 3R7DA 3VPCA 4OMCA 3P9PA 5TMPA 4BKMA 1UKVY 2GPWA 5JBNA 6GPBA 3TBKA 3THYA 2WJJA 3A2KA 1X7DA 3SBDA 1WXHA 3PC7A 2OR3A 5E7MA 4J41A 1GCOA 4IDBA 2CZCA 2BZ0A 4PBSA 4QYMA 5FPOA 2AX4A 3LL4A 1JSLA 1HT2E 3MW8A 2YWJA 2YJ3A 2WZCA 2HVJC 2RK6A 2XB6A 4KYUA 4MS4B 3VHXA 3O7WA 1TKRA 2ZE8A 3MCZA 3T15A 4WLNA 4UU8A 1S1CA 4YLGA 4A15A 2E4WA 3NTUA 1ZXBA 3UY4A 4JR0A 3A0RB 4I81A 1YZUA 3PHLA 2I1LA 5B1SA 2WU4A 5CITA 5E6RA 3GEIA 3N6XA 4FQ5A 1GFSA 3RT7A 5K51A 3KKZA 4QC2A 2NO4A 4RSGA 5DNWA 3H9UA 3WTBA 1OH7A 1I6MA 2DLDA 5K8LA 1HRDA 2OB1A 2R6ZA 4V2IA 2Y1WA 3KLMX 2JLUA 3ZHQA 5KBYA 4LOKA 4NS1A 1HZZC 3NTOA 1FJXA 2YXDA 4F4HA 2P68A 1A50B 3G8CA 3L07A 5FOXA 1WSDA 4JJEA 4UTRA 4R2KA 2JGIA 4MR7A 3W7SA 4W5TA 4DUYO 3HB4X 1G7CA 4KO4S 4RWUA 4UREA 3LOPA 4KXRA 1U7TA 1I3NA 4TPKA 3WLQA 2Y8EA 1XI2A 2OVBA 4Q6WA 3D3EA 3I6BA 2AFHB 4YLYA 1E2JA 3CINA 5EJ9A 1M1NA 2XD9A 4Y1EA 4FD2A 5CVVA 5LZ8A 4X84A 2Q6LA 1C8VB 3Q9LA 4PWZA 1EU1A 4K6GA 4JN6B 3OGIB 5L3GA 1MMMA 1E8DA 2OCIA 3AK4A 5FA6A 3O4HA 3H9VA 4AKGA 3V2HA 3GJTA 1GSAA 4AI8A 3INGA 1C9EA 5J2UA 1Y6GA 2EFJA 5H3CA 1X7ZB 5AP9A 4TTIA 3R9WA 1JHXA 5BV8A 1YTLA 3D59A 5ERGB 1YB5A 4QGFA 4QYIB 5E2AA 1F2DA 4Z3OA 4X41A 3WLNA 4PGAA 3ZLUA 1FP7A 5BW6B 1FA9A 3IUSA 2A2ZA 4PS1A 3SF8A 2O2DA 1NULA 4E31A 1UJBA 1PDVA 4XCQA 2BMAA 2F8MA 5AKHA 2WV9A 2NXNA 1KR2A 3RSHA 4OX9Y 2J5KA 3SDLA 3H65A 1CUSA 2SKEA 1AVMA 2BEVA 4NU8X 1PPJH 2XF2A 2Y0CA 3K1AA 3O0TA 2EZPA 4LNUA 4X3CA 3T06B 2J1LA 1MMFB 3HA5A 5EMHA 1ZN9A 3R7WA 4RCYA 1JYSA 3IL2A 3QKTA 4KLRA 2AZMA 4Q9JA 4GI1A 1U1CA 1M0WA 1KO7A 2PZMA 5LQNA 2AFRA 5BY2A 1QGUB 4RHFA 1PNOA 1B6RA 3DMYA 4EFMA 1UDXA 3NOQA 3OD1A 3C43A 1KWGA 3U7IA 4F5ZA 1EMDA 5ALRA 2HCRA 2PH3A 2W2QA 3GRUA 3QY0A 3KLNA 2YNMD 5HP8A 4G2KA 2KSDA 2F67A 5HY1A 1J8YF 3BK1A 2X0RA 5BN5A 1QNFA 3H1GA 3KJGA 4G5OA 2VQEO 4L5BA 1FP6A 4I50B 4N6OA 5HY0A 1F9EA 1V37A 2N47A 1YL6A 3A4YA 3ZZUA 1SRYA 2P6NA 1S89A 2CJWB 1Y1PA 4OYRA 5K99A 3K5LA 1B0UA 5K20A 1ZBDA 3OJCA 3L8DA 3IHTA 1CK4A 1MA3A 4Q16A 4BJ6A 2AZ2A 4MR8B 1MIOB 3WSWA 1O8BA 5IJ9A 1U1EA 4A0FA 3S28A 4H2DA 1W1WA 3E3AA 1GZ7A 3T5MA 2ZLBA 1B26A 3SPIA 3UT5B 3FB6C 3QMVA 4JJFA 4DV2O 4M9XA 2WLLB 3KO8A 4C0WA 4LSGA 1KKCA 4IYJA 3AFHA 4FEAA 3T2MA 2FCAA 5EUCA 2YDXA 4YRSA 4AUEA 1W36B 1KFKB 1U7WA 1ECJA 3HYTA 1XA0A 3E35A 7AT1A 2NXJA 4MR9A 3QVMA 3MBOA 1KJ8A 3RUCA 2EX4A 3JZDA 4UHFA 4JVSB 2Q8QA 4RORA 5K3BA 5K6AA 3E1YA 1STOA 1QU7A 2CB9A 2I6SA 2FJUA 2RGNC 3Q3VA 3CX8A 2YMMA 1NR1A 1M6YA 3UG7A 4HX5A 4Q01A 4HQLA 3K8OE 1GKFA 4B6QA 1VKHA 5JSYA 1V6SA 4HUJA 1R8YA 2XGGA 3IIMA 5JNTA 1FLAA 1XPJA 4IGEA 3VMFA 1L7PA 3PRYA 4FKBA 1BAPA 4DV6B 3RA5A 1PE0A 1OVGA 4YY3O 3UGQA 3ICVA 1RC1A 2FPRA 4KQJA 3MFYA 3UV6A 3ZDEA 2D74A 1C9MA 1AY0A 4F5YA 5TB5A 4E14A 3KPUA 4E09A 2JJ2G 2NWQA 1EFTA 3PFBA 3ECCA 1NFFA 4MVJM 3IMFA 5DIZA 1H2MA 2YRFA 3CEMA 1MKYA 5JWOA 1P2FA 3F67A 3BCHA 2W8BC 3ZY4A 2WLSA 3FLAA 2BEUA 2WNIA 4FX5A 2PN1A 3SR0A 1IY1A 1G20E 1BE8A 3A1UA 5CPBA 2HPHA 4QQNA 1Y4SA 5I7SA 1CY0A 1NXTA 2EZ8A 3BXGA 5EAZA 3WIOA 2M6KA 4YHHB 2H11A 3WK6A 1TGYA 4JASA 4LF4O 2JFWA 2E5FA 2EXXA 2C2OA 2AUTA 3LM8A 3HP1A 5ALUA 2CTRA 4RF4A 3K79A 5EHIA 2OCKA 3AUAA 2PQ6A 2V7GA 3WJ1A 2K7ZA 1CZNA 1SUWA 4DCOA 3I76A 3KFLA 4JS0A 4C05A 3EMDA 1VLMA 1TUBA 4GI5A 1C0PA 2W6ID 2QM8A 2PMPA 5HE9A 1F5SA 2I2DA 4ND4A 1BDJA 1PEDA 1K7XB 2GHRA 4HPXB 4U6QA 2ATKC 4PZ0A 1S5JA 4FT4A 4U0JA 4XDGA 3DC5A 2P2NA 2NSDA 4HX9A 3ZRXA 2OV1A 2ILVA 1IQPA 2Z2ZA 1W2GA 3A3PA 5AHKA 2JI8A 3I6IA 3K6SB 3E7XA 3S1LA 1V6AA 4COKA 3BDVA 1P2GA 3HCPA 3CC4F 2LBPA 1ZSNA 4O4LF 5EE3A 3DVQX 4LY9A 2PCJA 2LKDA 4DV5B 4JYYA 4JJ7A 4E5YA 2PF4E 4CBVA 4ZO7A 2OILA 4JXJA 1JPXA 4PA6A 3G59A 4G4XA 1CJVC 5HS4A 4ESVA 5J4YA 1MA0A 3R23A 1ZNZA 4MV1A 3LNCA 1RFGE 1Q81H 4LF5O 1OLOA 3I56F 5CJJA 2X1LA 4L8JA 1RHUA 1DLBA 4OGWA 1U99A 3WP1B 1A9SA 2CTPA 3LUTB 1H2SB 1ZNQO 1RYDA 3A9CA 1H2NA 1P4HA 3HM2A 5JAZA 5IVPA 4C7OA 2NLOA 4BMYA 4B7CA 1N3LA 2NUTA 3OM1A 4KH0A 2Y1LA 3MUFA 4GYWA 4OQNA 4RH3A 5DTMA 4RCZA 3K20A 4BZPA 1FP2A 5BN4A 4BIOA 3GP3A 2YYSA 2FP3A 1XNGA 3EFOA 4V39A 4FZ1A 4C8EA 4E15A 3KLPX 1I2BA 3HFSA 2Y05A 1R0ZA 1EK6A 4L2IB 2Q2QA 4TXNA 4LV8B 1UANA 3ZE8A 5HBGA 2GK7A 3PSAA 1GRNA 4KNVA 2AJCA 3VO9A 2IK8A 1UJMA 5TDHA 1YEWA 4GPD1 1YJ8A 2J3QA 2IYYA 4GQAA 4HPWA 2H1FA 3CXRA 4NB5A 4B4WA 3SQNA 1ZGBA 1WY7A 1T2NA 1JHYA 1UBFA 1UF9A 5AKKA 4FKZA 3ND5A 1FL9A 4BP3A 1U9IA 2Z8YA 3U9TA 1NXQA 4BLUA 4OHOA 3TLGB 1TKBA 3Q88A 2EJVA 2B98A 1MBZA 1LWOA 3T80A 1HDCA 2VDMB 1SU8A 3E61A 1US6A 1Z15A 1COZA 4DXWA 4WCVA 4ZOLA 3BB4A 2IC5A 2IQIA 3C5CA 2JGFA 1EH5A 1HDGO 1QFJA 3NVKE 4HAOA 5E6SB 4GXNA 3AB3A 4WEQA 3T0FA 3GYGA 1N2IA 2HWKA 1IG3A 2IEZA 4UUOA 1YTFB 4EHIA 3Q9SA 4WZAE 4WLVA 4M7PA 2I80A 1DZIA 4RTKA 2PGGA 4PSDA 3RYCB 3ET4A 4DGSA 4DEVA 4A36A 4AS2A 4WFHA 4V0RA 3QPUA 1RSOB 4FFSA 4OI1A 4Z1OA 1PFUA 5HKBA 5TT1A 3TN7A 4K1LA 3LIIA 5JS8A 1ESCA 3NJ8A 3EMKA 5F4ZA 5G0VA 3JWJA 5M7EA 3ZZMA 3VNQA 4EY4A 1Y1SA 5D00A 3ZV3A 5BPHA 4J1SA 1BXGA 3FPEA 1DJPA 4IIHA 3BL5A 1FQKA 3UHOA 4ERHA 1CUYA 1QWOA 2RI1A 1UQTA 2C4VA 1HQKA 1L5HB 3A70A 5BNFA 2IJHA 1CF9A 3PTLA 3AW8A 2VHUA 2D5CA 3F47A 3C3JA 3K09A 1AJQA 5HK8A 2ZRAA 2PLAA 1WNFA 3D64A 4ZOCA 5DWDA 1LDEA 3SKXA 5FORA 1MOPA 1BNCA 4MIYA 2Y1OA 2UYPA 4KZPA 4ZP1A 3OQJA 4N49A 3MJVA 3WQSB 3SYMA 1UAAA 3RHTA 2YKGA 4CXMA 3P3PA 2WFLA 1TJYA 5I5EA 4YRMA 4FDLA 4S12A 3IT2A 4FS3A 3R7AA 4OOFA 4HLNA 5K9ZA 3OFNG 4DV4O 1T5TA 1BRTA 5EFOA 4TKVB 2HX1A 1SXGA 3PKJA 2VH1A 3IELA 3MCTA 1PO7A 2V7PA 4PAWA 2EW8A 3V32A 3HDGA 2BGKA 1J7JA 1NLYA 4ROSA 4U7HA 3R0XA 1EK0A 2GM3A 1JEYB 4GG1A 3MS4A 4PDMA 1K8YB 4PFQA 4CLHA 1GL7A 1T2EA 1SKAA 1R1MA 3N4YA 2PPVA 1T8PA 3LWQC 4DPMA 4BTLA 4CFSA 3ABSB 2XOKD 5G0TA 1FBTA 2O1XA 5UKDA 4PYNA 1BSVA 1DDGA 1UBOS 3OECA 5JV5A 3MN1A 1GDDA 4QELA 4Q1FA 4YWHA 2IP4A 1XTUA 1KKLA 3E9MA 4CKYA 5EJMA 3HH8A 3ZQ4A 2NT4A 4CHGA 2A3RA 2JANA 2J3IA 1KC1A 4FPPA 4OFBA 3TD6A 3DZ8A 4HDKA 3CRZA 1PLLA 4ARZA 3PD7A 1DGQA 3JQ8A 5JSHA 3OTOB 3DE3X 3L6CA 5ESRA 4YT2A 1XO1A 4ZMSA 1KY2A 1Z3IX 2Q5IA 2FTKE 4JJ8A 1YFZA 1CUUA 5AUNB 1X25A 1ZK2A 2NLJC 4ZQBA 4Y1RB 5TS3A 2G36A 3TI7A 5A0TA 2XUZA 2VAPA 1W57A 4CR6A 1OCZC 1XU9A 2VATA 5L3SA 3N1UA 4GVLA 2CLSA 1R6XA 3D1JA 2HYIC 4LRSB 4JELA 3TTUA 1RPTA 4DE5A 3RRMA 1DOHA 3OF2A 2CNDA 2DQYA 1FXKC 5BOSB 5HOQA 1TJ5A 3WFJA 4NHEA 5E8RA 5CIWA 3GLIB 2UZIR 2MTBA 2QMZA 4Y2SA 2ZKLA 2QAGC 3CSXA 1DPGA 4ZQFA 3P32A 1DUIA 4K8XA 3QLEA 3R5KA 2PYZA 3LDEA 3RARA 3T4PA 5JAUA 1K5DA 3QXHA 3DZKA 4KR9A 4AW9A 1G8YA 5LHIA 3HU1A 4BS9A 3MMNA 4I4IA 1EP1B 3MG9A 1NQOA 1S8NA 1N3YA 1WMDA 3FUTA 3P2IA 1YUMA 1T9GS 3EQ6A 4R3NA 1NUHA 4OJQA 2B9EA 3AP2A 4EB0A 4JUDX 4KXQA 1X7OA 3F9CA 4LFAB 1EFKA 4YCLA 4G0WA 2ZT9B 2J33A 1D4ZA 2IVZA 1TF2A 1MO6A 2QQEA 4DJDC 3KQTA 3CG6A 3MJTA 3HA7A 2CKDA 2O3JA 3K5WA 2C1ZA 3VH1A 4DXAA 1YCGA 5MN4A 3UC5A 3QTTA 2KTVA 4ZEOA 4J0CA 5BSRA 1SXJC 1UFYA 3BMQA 1XJCA 3DE5X 1ORDA 4HSEA 2OA0A 5HQJA 1NH2D 2HEPA 1Y7HA 4ZEVA 4HYOA 4HN9A 2FW7A 1PGOA 1M34B 3IP6A 3DE4X 1XRJA 3UV3A 5C35A 2J87A 3EC1A 2AQIA 2M6SA 4X89A 7MHTA 1LA2A 1YITF 3VDNB 3IOYA 4PGHA 3F4LA 2XNCA 2AA3A 2FLVA 2Q3MA 5JJEB 1AX9A 3NHKA 1VBNA 3ZCTA 1U8EA 3D4OA 1XN4A 1CP9A 2CN1A 1QAOA 2RBEA 4JXKA 3BJRA 3I5XA 1Q1GA 1GJRA 3O90A 1Q91A 1SULA 4F3RA 2DTEA 5F4BA 4L5AA 2Z30A 5AVSA 1P1IA 3PAFA 4YAWA 2DPHA 4AECA 1A4XA 5AKJA 5FB3A 2R1VA 3QKIA 3RK1A 4RPCA 3FMIA 2D1SA 1SM4A 4Q6BA 1CR0A 3JQBC 3NH6A 5KAIZ 4Y0VA 5EOVA 5T8KC 4BMCA 1YVWA 1E1RG 4AJ4A 2O7QA 5FV7A 2WWFA 5H3HA 1JSZA 1JDTA 1O6CA 3ZBHA 1P7BA 2X1HA 3IR6A 3RIEA 2YZMA 4LFCO 5F51A 1GL3A 4AD8A 5KQGA 3E5MA 4BB9A 5FOWA 5FJ4C 2C2HA 5IAGA 1PWYE 2DH6A 2KX7A 4ZMBA 2JVKA 3AVUA 4N5IX 4NFHA 2WPDA 3CPHA 4LE1A 4KQFA 2JL1A 1OCOB 1DXYA 2ODEA 4KXFB 2J6HA 2BH9A 5HFLA 3VC7A 1MO3A 4Q3BA 2W0MA 1S3IA 4K87A 1NG1A 4A10A 4N6NA 4J1TA 4RO2A 1Q5OA 5BWBA 3H2GA 1UJNA 3U7HB 4CIAA 3AKYA 3G6KA 2CXRA 1HBJA 3AG3C 3R9XA 5L45A 2J0EA 3VV3A 2H08A 1AKRA 2CLLB 5A9GA 5JROA 1G4UR 5HUQA 1I30A 3SHTA 1NQXA 1QFYA 2W00A 1T0AA 1PBNA 1KKUA 1XZLA 4TLDA 4MS2A 2XKAA 5AVYA 2Z2KA 2FRVA 4F4DA 3V5NA 1M1KW 1FVHA 3BZUA 2W71A 3GIWA 1D5NA 3K92A 5IEJA 2I5PO 1HNNA 3DFMA 1DK1A 3G6WA 1P31A 4E5PA 4JR2A 2Y2UA 4ABYA 5KYVA 4W63A 1Y33E 4R8CA 3FPSA 3WMEA 1P6QA 3ZMTA 1Z0JA 2CFRA 4FC6A 4H7KA 1X70A 4WFIA 3CCVF 4AJ9A 2Z8YM 4KN6A 3MCVA 1G21B 3OG9A 1OLSA 3KT6A 1IIRA 3GVHA 4MUHA 3IAAA 4XYEA 1DIBA 4MZXA 3CNEA 1XD2A 2R48A 3DFUA 4RNCA 3K6RA 2Q7GA 1VG9B 4QWWA 3TNYA 4NE9A 5ENDA 3GPBA 1MC8A 1KNXA 5AHWA 2WJ4A 4R0NA 4RKRA 1WP8A 4NZNA 1I13A 2QE7A 2RHJA 2A7XA 1KKMA 4IHJA 4Q4JB 2Z4SA 2Q0AA 2I6GA 3C3CA 4FNGA 4TVSA 2P2ZA 3AR9A 3TLJA 1FPQA 2HCFA 3SR4A 1CY8A 1JH8A 2O8FA 4FE3A 4O2AB 2L26A 2Q6AA 3HPRA 4LMBA 1M2NA 2GD6A 1ZRMA 3GOQA 3VFDA 3U80A 3EODA 4FDUA 1C30A 2YUTA 4J0IA 4KRXA 4DIBA 3JD1A 2QLJA 1N34O 2XAUA 1LU9A 2ZSHA 3VZBA 1PEAA 3LUHA 3RS7A 2VF7A 1JPJA 4HRXA 4FSDA 2Q6TA 2VDJA 3NGMA 2BGJA 3LKBA 3UV7A 3NRJA 3WO0A 4LGYA 3F97A 1K8AH 2ZM5A 3ZV7A 4N48A 4UUMA 1PWEA 5BV1A 5TGTA 1JFSA 4MW1A 2WV7A 2GETA 4Z5XA 1VIDA 5EC8A 4F5EA 1U9JA 1WWKA 2A9RA 3P2OA 1X7XB 5JCOA 1YRBA 4Z53A 4TVBA 4BO3A 2VZLA 2I2XB 1FFDA 1ZR4A 3GD7A 1S2LA 2WNSA 4DREA 3HZHA 4F3YA 3C7CB 3OTFA 1W55A 3A1DA 3VNBA 4LFBO 4RD4A 4ALNA 5TQ2A 4I0XB 2IS2A 1J90A 3PHHA 2VPPA 2KI5A 3V33A 3EFBA 1JTEA 5AKGA 1HK7A 1SJ9A 4MWBA 2R85A 4U7JA 3ICCA 3ZK9A 1XTTA 2AG6A 3TW8B 3ILHA 4OU5A 4FI3C 1HT1E 1QVWA 3AEUB 3A25A 2RGWA 4FM9A 1RBYA 2Q67A 1VJDA 1YO6A 3DV2A 2W4QA 4P33A 3B1YA 5IJAA 5EKDA 1UBEA 3UJ6A 3KETA 4F5WA 2OMKA 4JL5A 4EO4A 1JFRA 4C87A 5EPUA 3YASA 5JARA 4X1YA 5I8PA 5FOVA 5EI5A 3NCHA 2PQ0A 2B6HA 4ZYUA 1TF5A 3ABOB 1X1EA 4UV8A 1FYVA 1LLUA 5LP6A 2QR3A 3TO5A 4ZU1X 4MKIA 3F3KA 4WMLA 1G1MA 2WKPA 4ID3A 3GEHA 2HHLA 5IDVA 1DT5A 4IIJA 2W43A 2PMDA 5T3YA 2XIJA 1M10A 1KJQA 3E2IA 1SWVA 1W4ZA 4IFIA 2AZ4A 3QLUC 2ZT6A 1II8B 4AO7A 3O1HB 3PQ7A 5JS1A 3OA2A 1A71A 2P4QA 2OTLF 5EB1B 3FTCA 1C0IA 4U7PB 5AW6A 1SH7A 1QF6A 1WM1A 2QLMA 3DLIA 5L3RA 4MA5A 4J0DA 1AKEA 3MCQA 1PI3A 1RWKA 1HSOA 4NCAA 2JIPA 3QVSA 4P80A 5T4FA 1WG8A 1YI2F 4EJMA 2OBXA 3RJZA 4UBMA 3WADA 2PZSA 3VXKA 2Z1DA 2PUTA 1SZTA 5ALWA 2FMTA 3CJHA 3DLPX 4TT3G 4EPRA 2EZTA 1YJWF 2V1DA 5EXDA 4PC1A 2VQEB 2IYFA 2P65A 3JQDA 2JVIA 4P8RA 2GBOA 2OKCA 4KQKA 4KMRA 3VUEA 1HEYA 2AUNA 2CUTA 4RADA 5DCUA 5A0VA 1SVKA 4D9GA 3TE7A 2XUDA 1GTZA 3IXLA 2G1UA 2HLNA 1K86A 5HTKA 1N92A 3CKLA 4EBFA 4XA8A 2C5BA 2WA2A 2I9PA 2NADA 4CG1A 5LZ2A 5ICFA 2FPWA 1HQDA 3D6HA 3ON1A 2F3SA 1EK5A 2QTNA 3WS7A 3W3AH 2NAPA 5CT9A 1K33A 4LK3A 3F4KA 1SD2A 4DV2B 1B8VA 4IHKA 4ONEA 3EULA 1S2OA 1OKKD 1E69A 4KX3A 1P33A 3D8TA 4WECA 4RUEA 3QFTA 5TT0A 3ROXA 3TXSA 3ADCA 3ST7A 3LT4A 1UMBB 1VKOA 5D6NA 5BN3A 1OHHA 1XZNA 3SS9X 1C4KA 4ZYZA 3WYEA 3LTEA 1N6PA 3FSRA 4AS1A 5U4XA 3TM5A 2EKLA 3ZIAG 2G08A 2Y1FA 3PL5A 5DWVA 1NQAO 3VYTB 1VJ1A 2H4YA 5ES3A 3ZU3A 2XZLA 2WAYA 4OQFA 5SZHB 1T3SA 2QIPA 3R6LA 2CFCA 4EUFA 5DNUA 3SE0A 4K8OA 2VHVA 3VI6A 1ADFA 1Z5VA 3G68A 4ABMA 1JU4A 3VVLA 4YY3B 1IHXA 1DAOA 1WMFA 3O4FA 3EF1A 4PEVA 2W2LD 3EN0A 1N2JA 3T1QA 5DP1A 1IL0A 1CG6A 1PX2A 4AJKA 2X9VA 3UBMA 4C8IA 1T8WA 3FNGA 5IDWA 1AQNA 3USZA 1PG0A 2MINB 1QVGU 4LY0A 1TGVA 2QVXX 4BBZA 1T6XA 1T9CA 4X93A 4DT1A 1R6UA 3ASVA 2G6TA 5EJAA 3WB1A 4O1MA 3T3MB 1Y37A 3DDOA 3C74A 5BR4A 1JHZA 3GLFE 3T1YB 3H84A 4KU4A 2QNBA 1E0KA 5B1AB 3H19A 4J3FA 4UUQA 2GCEA 3SWWA 3X43A 2A0FA 4OX9O 4DWJA 1BH2A 4LF4B 2JIBA 3DD5A 1QH1A 5EHZA 1SC9A 3WLMA 2AR7A 2WUFA 3A1NA 4KE7A 3PQDA 4FLYA 3HCCA 1EI9A 4EFNA 1V9LA 4WFKA 2EL9A 1XOUA 3O2QB 3CUTA 4FMTA 4XX0A 4RQFA 3RF6A 4I8DA 1ZW6A 3DEJA 2CNBA 4AY3A 5CDYA 4MPDA 5CGQB 2VJKA 1SXJE 5ITSA 2CNNA 2AV6A 4C30A 2YXBA 3OQ6A 1KQSF 3E2PA 2ZJYA 5IT5A 2R7NA 1KYQA 3PQ2A 3I58A 2XJ4A 1IC6A 4MPTA 4BP9A 5IM4A 4CLDA 3E4DA 4BTEA 5FWXA 5ITZB 3LC0A 4KXUA 3VU9B 2OCCB 2L18A 2XAQA 1DIGA 3M4XA 1C3XA 1KBHA 2HF2A 3DWGA 2VT6A 1GADO 3ZCXA 3H5TA 4AILC 5T6BA 4LKOA 4OPMA 3WKDA 1ZVJA 2N1BA 2P62A 1SQ6A 3ZZ1A 2YN0A 3CLRD 3MJHA 2OQ2A 2BTUA 2X0KA 3H0EA 3NJ4A 4HBZA 2JCYA 4LF5B 4Z0NA 5B64A 3OEED 1T5EA 2AK3A 3L8YA 1J5PA 3N87A 1M5IA 5GONB 3T3OA 3SQDA 2BN4A 1AB5A 1VE3A 3KOMA 3ZHCA 2DT8A 1YVRA 5I7FA 1Z35A 2AOUA 2YFQA 1KA9H 4YRNA 4MJLA 3CH7A 4L4RA 4UU1A 2N9UA 3ZHRA 3KUUA 3F6PA 2A8YA 3ET5A 4F2GA 1O03A 1KB9F 2PY6A 5CEEA 2J5BA 1FRVA 3OJ0A 4B79A 3RVKA 4ITRC 1PUJA 4BO8A 1A5TA 1NA5A 2WP0A 1O08A 3OEEA 3PUVA 1JA1A 3CRVA 1PF7E 1DTOA 1CKEA 2PLNA 1G5IA 3BD6A 1FDSA 4YCAA 4A0GA 5HXAA 1P5RA 1I7SB 1QJ4A 2CHQA 2NO7A 1C5KA 4NS4A 5P21A 4Q3EA 1UP7A 1ZUWA 4YN3A 3K4HA 4YMTA 2VQFO 3B3QA 1RFLA 3TUIC 1WA5A 3Q9NA 2JLCA 2GJ9A 4E5SA 1BE1A 1N0UA 2WJ6A 4RTQA 2KWIA 3G4SF 5L3CA 4MVJF 2WTUA 4F97A 3EK2A 4CT4B 3DONA 3NETA 1IK4A 2PX5A 4Q82A 4B6PA 4PX3A 3ZI4A 4UFOA 2IHNA 2GZMA 1TO6A 4FDMA 4BVSA 1EXNA 3A2MA 4CIBA 2WK1A 1GRJA 5AVJA 2Q46A 1U4OA 3DM9B 4LZLA 4HNRA 3BQMB 3VU8A 4X1KA 2O1SA 3U19A 1NJ5A 2XY4A 2FUG6 4BEWA 2BKEA 3L8CA 2RHDA 1OE0A 4OSPA 4KSBA 1DEXA 1DJNA 4JUBA 4XGIA 5M2QA 1PJ3A 1YAHA 4UEQA 4ZDJA 1OX4B 2ALJA 3PXBA 3UZUA 3H86A 3GELA 2R6CA 3SVZA 4MGIR 3DT8A 1PVVA 5BQXA 1DKMA 1JHUA 4MQ4A 5LP1A 1U9ZA 3KWFA 4DM7A 1OX5A 2GLTA 2R4QA 5AK5A 2WA3A 5AJHA 4AZWA 3RTCA 4TTRA 1I2MA 2I71A 4M1EA 8AT1A 1K4KA 3J81N 4AWAA 3GROA 2CXTA 2X6RA 1G8PA 3QUWA 5KKCA 5A4IS 4MJ3A 1CS4C 2G25A 1A8UA 5DLEA 3CF4G 4ZV9A 4UVAA 2J5XA 5JMPA 2Y3IA 3WIEA 1W7AA 1YGYA 3TR6A 3F2IA 1ORHA 1URFA 4C78A 4LYYA 1A8HA 4U2FA 1BQZA 4JB8A 3PXGA 2WSSD 4F7DA 3BCSA 1UFOA 3C3TA 3QOFA 1NQWA 4ZT2A 4Q93A 3WE7A 4NXNO 2DUUA 1UODA 3QE4A 5HMMA 5A2QN 4LY6A 1NTRA 3LFTA 2X41A 1P0FA 4Q9LA 1KVSA 3O94A 3S0YA 4F4JA 3KXKA 4RX1A 2EJTA 1XFAA 4ASUA 1P19A 3ENZA 4YRJA 3X1KA 2VHCA 4DV4B 2L0XA 2JRCA 2BUBA 2CF5A 3MTEA 4IJKA 2DLCX 3RFCA 4ZA2A 3VPDA 5K0EA 1A4RA 2HF7A 4Q21A 3JQ9C 4N5NA 4RNDB 3T4ZA 1BL8A 4N7RA 1P1FA 2EAUA 1WLEA 2NO9A 4BZQA 2ZROA 3UJ3X 5EMMA 3K31A 2VYFA 3OGCC 1O7JA 4B8YA 3UKOA 3C87A 1G5QA 3PWKA 2F6RA 3B20A 3GDGA 5D5HA 1I8TA 1ZSPA 2DVMA 2ETVA 4MAMA 4RC9A 1VKRA 2OZEA 2OHHA 3DCIA 2EJUA 1BW9B 3GFQA 4M7WA 4JAAA 1U0TA 2D4AA 5CVTA 3GEDA 1UJ5A 1GNQA 5DK6A 5EHNA 4MEJA 5H16A 1CUHA 3NYIA 3DH0A 3ZV4A 2M1ZA 1UWVA 3PEVA 3LDCA 1DRKA 4KOAA 1F20A 4PZUA 3S02A 1OIVA 1Y6JA 3A1WA 5F21A 1FTNA 2FP4B 2C1EA 1M2VA 5CHYA 1Z26A 5CBGA 4Q4AB 1SCAA 4OHCA 4K6OA 4LVCA 2XOEA 4NARA 4AY4A 3NDBB 2AG5A 3BWBA 1FFEA 3FKQA 1JEOA 1ZC4A 3HB7A 4BNKA 1HE3A 1ULBA 3EFFK 1UEJA 4CW7A 4FBGA 3PGLA 3TZKA 1T1IA 3RUAA 4AWBA 3VJRA 1ZJ6A 2ATEA 1RLTA 2BIFA 2QUIA 4D4GA 5KYNA 3GJSA 2EBUA 3OCJA 2ZNJA 2YWFA 2C5LA 5EA2A 3LQFA 1KJJA 3DFFA 3WGVA 3V4OA 3C45A 3NP9A 3NBMA 3JALB 1GZ5A 1SQ5A 4WFEA 5BYKA 4UHEA 1AUOA 3KV1A 1FLNA 1PSZA 4DQ0A 5JEEA 1NKTA 5TX7A 4B43A 1Z0ZA 4C21A 4A0QA 3F5TA 2KW5A 5TR9A 1WLSA 1KRWA 1GO1A 2JFYA 3HBAA 1SUBA 1RMQA 5FOUA 1IBRA 4EO7A 2RB4A 3F6BX 1LTHR 2XRFA 4R71A 3JYLA 3KR1A 3WGLA 3P4XA 1LWNA 1Z47A 2FLWA 4KUGA 2FR8A 3GO4A 4FTWA 1CZLA 4KYVA 4R3WA 1D9XA 4JI7O 1J9EA 1Z12A 1NQUA 4E70A 4XXHA 1N8RW 4UOZA 2BP7A 1T5DX 3JRNA 3WRXA 3CYFA 2PJZA 2XPCA 4BEVA 2G8LA 1EDOA 2BMVA 4ZJPA 1ULSA 3THXA 4JHLA 5FNZA 1BA3A 3FBTA 4CLRB 2ZF8A 2Q6OA 3GEGA 3BK2A 2HWUA 2X86A 3BXHA 3FOFC 3M89A 2C5GA 4E33A 3VPBA 1KU9A 5G1NA 1WKCA 3IB6A 5EVCA 2VH5R 3ZWPA 2BDEA 2ZDIA 4BPBA 4YS6A 5JU6A 3OZWA 1H2ZA 3W7UA 2SHKA 1T4BA 2CVPA 5TEVA 1IY9A 4H1HA 2FLKA 1TA8A 1QRAA 3R9KA 5FTJA 1D0SA 4MTLA 4YRCA 4L9AA 4Z9YA 1NR5A 1EJ6A 4QICA 1N5RA 3RVSA 4HFJA 2PWYA 3KSBC 4ZCIA 4X91A 4TL7A 1MRSA 3WQHA 3ZDQA 1IUPA 2VSOA 4HAZA 3TKAA 4OB6A 1R6VA 2EIMB 4OQYA 3OEHG 5LVAA 4FBMA 4O4JA 4QWMA 1H2AS 2AMVA 1TA0A 5D3ZA 2BOVA 3HR0A 4IV8A 3DMNA 4GLJA 4CCYB 1Q7TA 2HXYA 3MIIA 1O54A 1F12A 3QF4B 3KLBA 2AFIA 3FYSA 3IAHA 3NV9A 821PA 3VZPA 4MTCA 5DCLA 1R88A 4JYAB 3JATA 1QO7A 1NBMD 3HUEA 2XUPA 5JO0A 1I5OA 3CB4A 4CMHA 3FB7C 3WK4A 1D2MA 2VBIA 2J6IA 521PA 5E8JA 1AKMA 3CMMA 1ISIA 3KCYA 4D9NA 2EIXA 3OF3A 1EE1A 1M2OA 2QD4A 4G4ZA 2EILB 1DX4A 1JYEA 1TA9A 4OAQA 3VNUA 2EINC 2C31A 4LHZA 4EKNB 4NECA 3STXA 2UYNA 4KGXA 3IPRA 3ZE2B 5ECWA 1MAAA 4Y9SA 2AX3A 1NOKA 2JCGA 2ZXWB 4DJEC 3DBLB 1K2VN 1WETA 2VP2A 3IQXA 4NENA 1Y9DA 2FW8A 4DDMA 1K73W 3QEMA 3R3VA 4XTCS 2BTQA 1RAHA 4B48A 3OZGA 1Z5UA 3I2HA 1IU9A 1LTKA 2VCYA 2P9BA 1GA6A 1N5IA 1U7UA 4BNDB 2YNMA 2PWPA 1V8PA 1YFKA 5JDCC 4KR0A 2ZANA 2HCBA 2X6AA 3QFFA 2MSLA 2IW5A 5BRAA 1NBEA 1U3DA 5K8CA 1RJ9A 4MRAA 4MIOA 2AMFA 3BA6A 3FN4A 3TSAA 4G2NA 4ND6A 4LDAA 3ROKA 3K0TA 2BFAA 4N0MA 1T91A 1NGSA 2XUOA 3HBNA 3W7TA 5KREA 5BXZA 1KEUA 1V48A 1AZLA 1M4UA 3QA3E 4P4UA 2O57A 2FZVA 2PMBA 1SU7A 3OOJA 1IZYA 1L1RA 2ZCJA 4QNMA 2G1AA 3MRVA 1NQ3A 1T36B 2OO7A 3UQ8A 4QGPA 4QOJA 1FFBA 1VQNF 1QX3A 2IYOA 3SEQA 4KJZA 5GJWC 4RANA 1GZHB 2XAJA 2BSKB 2A5DA 2V5VA 1JVMA 4WSOA 3ZXSA 2HUNA 2AG0A 5JCPA 1N0IA 3JAWB 1IZ7A 1N34B 1Q5PA 4NAVA 4B3IA 3FWNA 5BUCA 1YH3A 3IB3A 2O8CB 1UOEA 2QA4F 4WXPA 4XWWA 4ER3A 5FA8A 3KBOA 1FYXA 1OXSC 1E3MA 1S4MA 2IPAB 1VQ6V 2Y6UA 2A9OA 1W87A 5FTNA 2A9KA 3HJUA 4K9KA 3F90A 4X20B 3BGIA 4HDSB 2YHSA 3CMAV 3ESAA 2AGVA 3ONDA 3K0AA 3LDFA 3W3AD 4FUTA 3LG2A 1HYGA 1TVCA 2PT6A 4NXMB 1PR2A 4G0OA 3F74A 4HAMA 4V0NA 1Q83A 1TIBA 5FEUA 4CQMD 4V38A 1W49A 1NAHA 1KK1A 3MQWA 3ROZA 3RABA 4LYEA 3D7KA 5ENVA 1OI7A 2H2DA 4JVOA 3FPAA 4BFTA 2B4KA 4XOIA 5ICSA 5L7YA 4WFBV 4Q37A 5K45A 1CLEA 2BHTA 5FEMA 4DOMA 4PLYA 3K1TA 5K3SA 1FXUA 3AVOA 3JSAA 1LX7A 2IEAA 2HMYB 4WV3A 2OM6A 3I55V 1PG2A 1IUOA 1Z4MA 5FLXN 3WAKA 2HA3A 3BWYA 2E1RA 3H5RA 4CQMA 3CF2A 2GCGA 3M9XA 4J4BA 4KWEA 1BMQA 3EHDA 4HH0A 4NAHA 4U0KA 4A8TA 4YCSA 1PN3A 1RC8A 3OQHA 4L87A 3L4SO 2PVSA 4BGIA 1THTA 5B7PA 1T25A 4GUDA 2P6YA 2WMDA 2DETA 3G80A 5AW0A 3OPYA 4BT5A 1U3TA 2HKOA 2AF3C 3EZNA 3BHMA 3F96A 3OW2U 3ZP7A 3JQFC 4L74A 5LXTA 4GFDA 3O0DA 2W6IA 4UW9A 4KXWA 4KQ6A 3NX4A 1TW2A 3H3JA 4B7KA 4ZQCB 2PBZA 2OQRA 2Q7XA 5FTWA 3O8CA 4E12A 4E46A 4Z4EA 2ZJ1A 5AJYA 3REQB 1SC5B 4C01A 1OZHA 1C7IA 3ND7A 4GLBA 1RRCA 2HDOA 3WYNA 1JHOA 1YIJV 3AZQA 4S1PA 3JARB 5CN0A 3ZE7A 1SAYA 4ZOLF 1H42A 3HXPA 3LF2A 4D6XA 1A9XA 5H6QA 5DX0A 3SJAC 1JNXX 4K86A 1E63A 3JCUZ 2HL6A 3U4DA 3DL7A 1VRCA 4EF6A 2H4ZA 3KUXA 3T34A 3G2JA 4FGLA 2GB4A 3JASA 3L49A 1UDBA 4UMEA 1P1RA 1DBSA 4A0RA 4OXNA 4PV1B 1KDZA 2C2GA 1VG0B 1YDXA 1LNSA 3OCVA 4D6TH 1G5RA 4LC1A 5BVHB 3EE6A 3RHZA 1E5TA 2J6CA 3R3WA 3DPSA 1O5IA 2I4OA 1FTSA 1VQ7V 3IAFA 1TTQB 4GH5A 4BGUA 3JPYA 5DV9A 3HO1A 2FWBA 2WD9A 5AW9A 1KQNA 4QE9A 1OBCA 3R4VA 1DPFA 1O94C 4R1TA 1HOTA 1P72A 1EZ1A 1RRMA 2F8TA 4E2WA 4RL4A 2SBTA 1OZGA 2F1IA 4KO2S 3CRCA 1TRHA 4X71A 2VJBA 1BYIA 3K5NA 1HYBA 5EZYA 3KZVA 2AF4C 4CMCA 5CFPA 1T5OA 1UAYA 3LBHA 4GR9A 3OD4A 2GPSA 1RP1A 2POQX 1Q6ZA 5B1NA 1Z13A 5IK2D 4TTAA 4EKWA 2OK8A 3N5CA 1ZN7A 2PCLA 3QFSA 3WZLA 4Z1MD 4JPRA 1NQ5A 4TSFD 4DCCA 1YCFA 4QO7A 4OH1A 4EG3A 2UZAA 2YRWA 4XDZA 4YQZA 1VE9A 2JDIG 3QGMA 2ZUTA 3I9V6 3NT4A 4HWTA 3TGLA 3I52A 4NC9A 1XWFA 4YRGA 3AV0B 3NC4A 4EITA 1DCMA 1JDVA 3DZJA 1H2LA 1I80A 4H17A 2A9PA 4AZ0A 5IK2A 4BR6A 3W6OA 3OMXA 3DMHA 3CZ4A 4KQMA 3KTOA 5K3OA 4OXIA 3LYHA 1B1AA 3PG5A 4BMOB 3KT8A 3X1XA 2YWCA 3GRPA 1T43A 1Q92A 2ZT5A 1XXHB 3LX5A 4B82A 4PG7A 1XCOA 2CH7A 4I9HA 1W4LA 4WE3A 3C3EA 4P53A 2WAMA 1O58A 4E2YA 3LNMB 1RCTE 3O4VA 4PQYA 3PDUA 5BSWA 3GJRA 4KGVA 3G8BA 3SJCC 1V96A 3CP1A 1YA4A 1MG0A 4G25A 1PV0A 3UMMA 1ECBA 5CHEA 3CVOA 2ZR2A 3CCSV 2V65A 4RQTA 1DC6A 1ENPA 1RI5A 3CCEF 2DKFA 5FI0B 4B2PA 2POCA 2HGZA 2YYAA 1J2YA 3KIZA 2I6UA 2ZAUA 2EBHX 5LDHA 2KJQA 2WWRA 2XNHA 4CKEB 1M6VB 2R5NA 3MQ4A 4MA0A 1VQ8F 3M83A 1ZGHA 1L4FA 4I8IA 1E5LA 4RVOA 3IAYA 3EGOA 3PFFA 4K7JA 3W3ZB 2C2XA 1KAEA 3MT9A 4PYKA 4D3SA 1LKZA 1ZM4A 2CV2A 3K9AA 1AQJA 2QZPA 4EFLA 1FS0G 1EEXB 2GPNA 1DG1G 2GLUA 2H00A 3F7TA 3GGGA 3KNZA 2Q29A 4BLRA 2YC2C 1S3GA 4LJLA 4M1SA 4ALMA 2QL7A 3K0CC 5JADA 1W5FA 1XAGA 4JIGA 4HEA6 4BNLA 2ZUBA 4BRSA 4AG6A 3C15C 2EYQA 4OM8A 2ZJAA 5JDIA 2IPXA 5LJLA 4PHFA 3ADBA 2H2FA 4CM8A 4DSTA 1VE1A 2VRBA 3BFRA 4KEAA 3GGSA 1LFDB 5ICEA 1I24A 3BD7A 5FYDA 3GJZA 4HGYA 3TKLA 3P4UA 3DZCA 2I87A 4DB4A 2XOKA 3KYBA 2JA1A 4UE6A 3LCUA 3RK4A 3NPMA 1GLNA 2P4HX 2PHZA 3IMEA 3PGMA 4BVJA 7MDHA 3TXXA 3NAGA 1MEEA 1VQKV 1PVDA 5FNVA 3ZRWA 4YCJA 1S76D 3LLCA 3I1FA 2OOKA 1KH1A 5KVQA 2ARKA 5KWEA 1TUEB 3JSLA 1UIMA 3HJGA 4FFNA 2XQKA 2RBGA 1S2IA 1UP4A 1OZAA 4ZRMA 2QXTA 5I7AA 3ESQA 1U97A 5EB0A 2V1XA 3HNPA 1NZJA 3LT0A 3FNEA 3FY4A 5I4KA 1QM5A 1YF3A 3FBAA 5K0JA 1GMGA 4BMXA 1UIRA 4XQ9A 1NLMA 4LE2A 1ZLYA 1YASA 2CVLA 1QQTA 3T4XA 3SAJA 5C8YA 4NQ3A 2FXVA 3CPEA 3K0KA 1E8NA 4QDKA 2YIJA 1EJBA 4HLUC 2VQFB 1YB6A 2HMUA 4PCVA 4DLZA 3I92A 1GGKA 2XTNA 6LDHA 2WHPB 4PRZA 4ZKIA 1K7CA 4XB1A 1EUCB 3JQ7A 4BYGA 4ZIRA 2ISSD 1Y9ZA 4OTZA 1Y76A 1GNTA 1WBBA 4A6XA 2CCJA 2WFZA 1KSFX 3DYBA 5CA1A 4HNAB 1RYBA 4MI9A 2CXXA 3G2KA 3LWNA 3JYNA 4INJA 4WFGA 2P0EA 1E5XA 3FTPA 3TSOA 4I6EA 4N76A 4ERXA 2IOFK 3MERA 4TUYB 1YULA 4KLZA 1S9HA 4MW4A 4LR3A 3CCCA 5I4CA 3PRHA 1GAQA 1FS6A 3COZA 1YHZA 4UUAA 4TQ9A 5G4UC 4P7BA 2EIKB 1RP7A 5EY5B 4EY3A 1BHAA 1CJKC 3IKMB 1XQ1A 3CC2F 1LLFA 3GHYA 1J4AA 2ZSJA 4ETWA 3F9RA 4QRHA 3M5PA 4R9RA 1NW8A 4RZSA 3ABLC 1C29B 2EEZA 4C6TA 4LH6A 5IWAO 1T6NA 3B6EA 2PA3A 3TR0A 4Y2PA 2C4WA 1K97A 1YDFA 1Y9JA 2YV2A 1BZYA 3VYUC 1Z45A 1OWMA 3BORA 2Q0XA 2E74B 4MHOA 3ZDZB 4L5IA 2OQVA 5B4VA 3ZHUA 5BY1A 1WPGA 4XAQA 3J7AC 2V74B 2VQ6A 4WCFB 5CLHA 3IAM6 4GQIA 3SC2A 2BAGA 4M98A 1J0XO 1K4CC 3THWB 4UB8Z 3L92A 1UXHA 1FMJA 1MRZA 4NXNB 4CE6A 3G2LA 4NX2A 3GJ6A 4S1OA 3USES 1Z5PA 4EW1A 4MW7A 4UUNA 2CJFA 3NTRA 3GCGA 4OHPA 1DARA 1KI9A 4IWYA 4J1NA 3VC1A 3A3KA 1R5JA 3E58A 1VQLV 3IUMA 1XC7A 1GN2A 3OE7G 3R5HA 4JT9A 2JAXA 3IUYA 4OXSA 2VDWB 1X7PA 2JJ2D 2MYNA 3TZEA 2FE1A 2BBSA 1IAQA 3SZOA 2NU7A 5FTLA 3FPGA 1YDGA 1O97C 4N0DA 2MMCA 2QTFA 4G5SA 1ZCBA 2K4MA 3CV3A 5TJ9A 4UNNA 1M56B 1E3WA 3H75A 4B2LA 3E20B 3EVKA 1O6GA 1GHTA 2ZPUA 3A9RA 3TGPA 1XCLA 2IKSA 5A6SA 5BW5A 2JJ2A 2F43B 3NFRA 3H99A 2PGDA 4D74A 1XQ9A 4Z9XA 3RK0A 4S0ZA 1KTVA 3TQSA 3UHPA 4F1JA 3FNHA 1MH9A 5IDYA 5T7BA 1ULAA 2XLCA 4X24A 3O8BA 4X6XA 3F8TA 3SZLA 1Y81A 1NVXQ 5J2TB 3CRW1 1S9DA 5FQOA 3NGXA 1RS0A 1JKMA 4ZODA 4UD2A 2VH2A 5BYJA 1GFZA 5CTAA 1HW7A 3I5AA 3C3KA 4CLOB 1GKUB 1PW5A 5HDBB 3WGYA 2UXNA 5HGXA 2PU5A 3HRKA 2W2VA 1N4AA 1RI2A 3UH1A 3WB0A 2HP0A 3Q2OA 2GO1A 4TMKA 4FKMA 2X13A 4RGBA 4PYQA 2EBWA 4L76A 3E89A 1E6EA 3E9ZA 2Z56A 3EY4A 4C8GA 5BSFA 4JBNA 5LBUA 4HNUA 4HHEA 3C1TA 3MUNA 4A1FA 3PNKA 1E0SA 1XKXA 1YR8A 3RUFA 1PSWA 2GQ0A 2ZJ2A 5A04A 1Q0UA 1SIOA 3L6OO 3NWJA 4DC0A 4KSCA 4DLUA 3BMOA 4EX6A 3RUPA 1RYNA 1ZINA 1CYDA 4LHVA 2FCRA 3K96A 4LAFA 3OH8A 5C7YA 1IV3A 2IHBA 5JAHA 4D6YA 3HY6A 1NC3A 1KH2A 2I2CA 1LEHA 3GLTA 4FGSA 2Y48A 1XVAA 3EMVA 4G41A 4MYUA 3FXAA 3U9LA 3EDCA 1Z5OA 1T9GR 3SPGA 4ZFNA 1MT0A 4BECA 3TXAA 4DUYB 3ZJYA 3TOZA 1L4NA 5IJXA 2UYYA 3SXJA 3G9XA 5LP6F 4D9FA 3L0OA 3QG5A 4KWTA 3A6ZA 2WAOA 4UKDA 1F2UB 1OREA 2V7QG 2YWRA 3A06A 1CS0A 3TLAA 3D5TA 4IIJF 4JSYA 4IIUA 3L1UA 3MTBA 2AJ8A 1WXDA 4IFTA 4CF3A 2BMDA 3HRIA 4EG7A 1B3RA 1GAWA 1ADBA 1KAMA 2L6LA 3RYFA 3PDJA 4CU5A 3OQMA 2TMKA 3RVOA 4KXNA 4X66O 3KAQA 2NZXA 1DQSA 2W83A 1KQ3A 5KYUA 3RVQA 3W5DA 4MTXA 1J97A 2Q50A 5DNYB 3IP3A 4A92A 1E9DA 2XDQB 1J24A 3FG9A 2DP4E 1QQBA 2JFGA 2W93A 3L5KA 4TKMA 3GP8A 2QY9A 2FC3A 4OCZA 4K28A 3CLTC 1JGTA 3UWPA 2GCPA 2PO7A 1S1MA 5E9WA 2VRNA 3RU3A 2C95A 4HV4A 2GXAA 1JBQA 2JH8A 3IAXA 1CERA 4ENUA 1QV9A 2I1WA 4UC0A 2XXAB 4HWSA 1VKNA 2O50A 3LHIA 2YIDA 4NH4A 1DF4A 1NRIA 2J0UB 1H94A 3GGPA 1V11B 3FF4A 5GM1A 2C2MA 5CLLA 3RT3C 3KCQA 2P2CA 4MWSA 3ZTTA 4DHEA 4G86A 4N0EA 4ALIA 5AJZA 1U0JA 3ZXUB 3FVQA 1ROPA 3U3DA 2PUEA 3RYIA 3ZMVA 4L15A 2QRVA 1GN4A 3AB8A 2FJ0A 4TMVA 1YD7A 1RZVA 1F4PA 4LQ4A 1L5GB 3TIIA 2GK6A 1B15A 2WJHA 1MAVA 4X6YA 2NVOA 2JS3A 1U2SA 1SOVA 1RBMA 4KQ1A 1JS1X 3DZFA 3HCRA 3NXKA 1ZXLA 5IABA 1GYQA 4RPJA 5J5CA 1MX9A 2EQBA 2G9NA 1ESMA 3B38A 2O5RA 2PL9A 1OGIA 5F2NA 4BLPA 2QTBA 4YRQA 2VOEA 1U7DA 3ZRVA 2AKAB 4Q66C 3K0FB 1I08A 2G38A 3RFXA 5FBLB 3EPLA 2IXDA 2ZYVX 2P5SA 3DQZA 4L0DA 4OXQA 3RWBA 1NHWA 4H6WA 5C5IA 1K34A 2C1XA 3F3SA 4G2TA 2JCVA 1HDYA 5KOHB 4UB6Z 3PWSA 1S7GA 2MMGA 3L7JA 5ED4A 4E5NA 2IZ6A 2NUPA 1LK7A 5ITVA 3RUDA 2ZAGA 4E4EA 4FLXA 1JDNA 2X7RB 1ST2A 4W4TA 3ETEA 5HM6A 2PKCA 3IVGA 4DK1A 2PFGA 3SP1A 1W30A 3VPSA 2OAQ1 1PWXA 2XDWA 1HE1C 2BJVA 3K0GA 2D59A 3ZZ0A 1QHHB 1JW9B 3B3AA 2QPLA 3GG2A 3OFND 4D0LB 3RDPA 2EARA 4JU8A 3F46A 1TQHA 1V7QA 4N3NA 4WD3A 3RODA 1L5LA 4GT1A 1RWBA 3DOFA 3GJQA 3QH4A 2Y1XA 3LW7A 3P9XA 4C43A 2UYHA 4M99A 1QP8A 2RC5A 4WK4B 1T29A 1F06A 1Q7EA 4NJEB 1CUBA 3IQHX 3SYTA 3CXHF 2VJOA 4YX9A 1DX6A 2A84A 4D4IA 3P0FA 4FFDA 4A5SA 5KMGA 4KP4A 3IPLA 7REQA 2X15A 1LSJA 2RJOA 3ZI0A 3LYAA 1OKKA 3DMTA 2AI1A 1AKUA 3K32A 1A8QA 5A9TA 1Q86H 1XMPA 2WWWA 4NZMA 4TLBA 3SSNA 4UZFA 1Z56C 1TX4B 2VHZA 3UMFA 4NESA 2RK3A 1YJQA 4GOJA 1VJCA 3RNLA 1QHGA 3HFGA 3CU5A 4EVIA 4OMFG 4YQEA 4MVJI 5FUWA 4MI1A 2RQ6A 2C98A 2ZTMA 3RVDA 1V7CA 3A0HZ 3WGKA 2QWOB 1KI2A 1ZA2A 4G0UA 3TVTA 4CI0B 1K68A 2ZIFA 1DWQA 4I1SA 4BPRA 1OBOA 3BC1A 3NBAA 1T2CA 3VU1A 2W2LA 3S4YA 3OLZA 5AK6A 2CHEA 1FTGA 5LQRA 5KTRA 2VNSA 1GPYA 3THSA 1SHLA 2R1TA 1OCCC 3WDLA 3I1YA 1WU8A 3C6ZA 1CCWA 4E88A 2I4LA 4XQEA 5LDGA 3U4CA 3HL0A 4KVZA 4ZQIA 4FFOA 1QRTA 1H6DA 1XP5A 3FDZB 4Q24A 3DE0X 5AIBA 1G4AE 2A4KA 2HSGA 3ZIDA 1HE2A 3GFGA 3GZNB 4X8LA 4OGLA 1JFVA 5FBVB 2IP2A 2VUTA 3GCZA 4DA8A 5CW2A 4OJYA 1NTOA 3JTEA 3FR8A 2JS7A 1KYYA 2WD7A 4IEFB 3TTTA 1XRGA 3W7VA 3LDDA 2BFNA 1HDIA 1PKXA 4QBTA 1SURA 3G2MA 3F8WA 2PUDA 3ZN0A 3A4MA 3EARA 3L7OA 4AN0A 4XB2A 3MLEA 4B3JA 2B7CA 3GEMA 1AI5A 2O9JA 5LYJF 2ZVQX 3CCQV 4U1RA 4TV8A 4IINA 4XDLA 1IHYA 1XKLA 3WLHA 4ERNA 1KEKA 2WICA 1EVYA 2DOKA 4BZXA 4WZBB 1M1YA 4J0GA 3IQWA 1KSHA 5K3AA 2DLNA 1OMOA 2PIDA 3WK5A 3A27A 3O5AA 3D3WA 2W6ZA 1BEZA 3B13B 2C5EA 5H5JA 4KFCA 1GCAA 3TAHA 1FRNA 4RJJA 3OX4A 3ZNNA 4ZZ1A 3PEEA 4YJFA 4O25A 4BJ1A 4RVGA 2UVQA 4RHXA 2QPAA 1DINA 1R5OA 3CR8A 4M86A 2SKCA 1POWA 3LA6A 2N75A 3IUJA 3RVBA 3DDNA 1KYTA 4QEKA 4TL9A 3MOIA 5C34B 3I42A 2MSWA 4R1LA 4O1HA 3DHNA 4Y2HA 3I39X 2EKZA 1E1RD 3OMLA 3Q4HA 3JD4A 4K5QA 5F35A 1FIUA 5JFGA 4MGHA 3AUFA 2QEQA 4ZGGA 5K2MA 1E6MA 3LUCA 2R84A 4UULA 3UJ8A 3IJ5A 4MP8A 3I83A 2FQQA 2Q1SA 4ZQGA 1OBHA 4E07A 4AAYA 1IZ9A 1ODSA 2PS1A 3RVMA 1KVQA 4PQRA 4X3MA 1W4CA 1MPTA 2ZS8A 1RAGA 2SECE 4ID9A 4N82A 3KPVA 4RVDA 1WZNA 4D4KA 3VQTA 1DBFA 2SNIE 2GSMB 4XDHA 1BQ0A 4RY0A 4YNBA 1N25A 4IEEA 1E1RA 3AK2A 2XEXA 1XDWA 1PBTA 3BTVA 1I7QB 5LU9A 1CT9A 5EJ8A 3L4BC 3LPNA 2I6RA 4REQB 1NXWA 2GFHA 3CLVA 1LC0A 3AH8A 5KNBH 1GFIA 3AIMA 3M99B 4DSNA 2ZTLA 3IODA 3D2AA 5BWMA 2FPMA 1XROA 1FRZA 3K70C 3D36C 4YJ3A 1Y8CA 4YI5A 2DMRA 3IP9A 4CMAA 3O3NB 5F1OA 3OFVA 2ZWAA 1H23A 3LXRA 3F7YC 5H4GA 1ONOA 4UJ3A 4EUEA 4PSVA 1VB3A 1OT5A 1MR3F 5AKXA 3H04A 4K9MA 5EXXA 1PNVA 5IYZB 3ESXA 1P2VA 4K2HA 3KUDA 2C2WA 3P4EA 2GVNA 3R3YA 4ZCQA 1X7YA 2NQTA 3PNYA 3R3XA 3ABUA 4H08A 3FGNA 2X1MA 2ZINA 2P41A 2PT7A 4WNAB 1YUBA 5DNVA 4CIYA 3PX7A 1Y7TA 3I9FA 4PHCA 2XIQA 4CH4A 1VPVA 2Q99A 3C5EA 1ZM2A 5E9QA 3OKPA 2LVBA 3BN3A 3MINA 1YJ5A 4EKDA 2DPLA 1UBMS 1QZZA 3WB9A 3HWSA 3PNPA 1U3LA 2H4WA 1I32A 4NNJA 2W0SA 1P8AA 2ZP1A 2QW1A 3Q10A 2JLZA 1E8MA 2PE5A 1NF9A 4L4SA 4UCFA 5JAIA 4TMZA 4UEOA 2PLFA 3TUJC 4F6CA 4NZZA 4H35A 3QSYA 1BS3A 4B32A 3UJHA 3ZWYA 2VYQA 1GU1A 2OTCA 3W2HA 1CHNA 5CM2Z 3S81A 2C04A 3CPWF 4AKSA 3SJUA 4XLLA 3V2UA 5BVGA 2GN4A 1C1XA 5LFAA 5HQTA 3S0JA 5F73A 2QR5A 2R60A 3H1KH 4Q4CA 4JBXA 4YDRA 1CY2A 3ZHTA 3NMUC 1E18A 2AMYA 3WWDA 3ENWA 3ABTA 4NTYA 2RONA 3B51X 3HVRA 1GM5A 3ZC3A 1UMDA 1EG2A 1PGQA 3INNA 3QVTA 1L7EA 1Q7CA 5IKXA 3SS8A 4M6WA 3I6MA 2XWSA 3CWCA 2P5TB 2ARHA 1SEVA 4A27A 4NEQA 2IYAA 4JBLA 1N0WA 4HDQB 5AJUA 3S1AA 5DBIA 4DJFC 1QF7A 1I7NA 1JAZA 1KHHA 4QM6A 2ISCA 3PFCA 1PX0A 2PKXA 3QLJA 4QO8A 1QS0A 3PKZA 3DKKA 4LZAA 4HJXA 2YJ5A 1MNAA 2WSSA 1Y8QA 4JYZA 4ZVSA 1QK3A 4EYOA 3GJXC 1N2CE 2D6FA 1FMTA 2ZBQA 2OCYC 4UM8B 3ULKA 4EI2A 5MGNA 2ASVA 3L4EA 1QTIA 3ZK7A 2OBNA 4BE9A 1C1DB 5BRJA 1J5EO 4JI2O 3QPBA 3L7BA 1F51A 3VO8A 4RQAA 3QVGA 4DQLA 1ZR2A 3VTZA 1B4DA 3B2QA 5DWQA 4R0VA 3ZWDA 3JX9A 4ZAGA 5EZ5A 4AO8A 1WZCA 1N33O 4M53A 2XMPA 1T3TA 4EPVA 4HWKA 2G63A 4HFMA 2C8LA 3GX1A 3IMCA 3BDAA 3TGWA 4LTDA 3IURA 5K0BA 3IKVA 1I10A 3I2JA 1WJGA 2D62A 5B3AA 1EFHA 3JD2A 9MHTA 3KS9A 2JLSA 3JY6A 4QYSA 1KY3A 1P18A 3GWZA 3QHQA 4DEXA 1QOZA 1K3TA 3WNBA 3L7DA 4P4TA 3E48A 3EDMA 3QXJA 1DJQA 2HRRA 3UQYS 1WUTA 3KELA 4A0SA 5FI3A 1E1CB 3ZYZA 4PPQA 5C3MA 4NUTA 3N86A 4ZALA 5J2UF 4AKEA 1V4VA 3AU9A 2LJ2A 2GNOA 3MS7A 4OHVA 1V2HE 2E18A 1X87A 4WY5A 3RLFA 4G5RA 5IEBA 4PX2A 5LMCA 2UUBO 3V97A 4DDKA 1U8AA 1YZKA 3GRCA 2VP9A 3L0SA 4MS4A 4X1IB 1L5OA 3B6MA 3TLCA 2GGSA 1P9LA 4Y1FA 3WL5A 2B78A 2GPYA 1MD9A 4ARBA 1NW4A 3A0RA 2HA6A 4KQ9A 3I0ZA 5I3ZA 2QN7A 5DEIA 2GLXA 3G49A 1OY1A 4R6WA 2V6IA 3FI0A 3ZP4A 5J4VA 3HU3A 1QK5A 1M54A 2BM0A 4CL0A 4C4YA 2Y92A 1P81A 4KDFA 2WINI 3LWOC 5DHRA 1RLMA 4O4JF 4ILEA 3COSA 4TT3D 1VHAA 4BUZA 1OB2A 4AM8A 2RHOA 5E4JA 2PANA 5FL3A 3ERNA 4BMPB 1O2DA 4PO1A 2DECA 1J70A 4EG8A 4ZO6A 3ZJTA 3V46A 2C2ZA 4D99A 2PK3A 2R6FA 1M2FA 2J3MA 4MOWA 2QD2A 1JCHA 4ZN6A 3E9RA 3KWMA 4YMGA 3D0RA 2PGJA 3W6PA 1G6Q1 4DM4A 3FUUA 3NBUA 1OWPA 1XZEA 1ZNXA 4FCWA 2AFHA 3M1AA 4TT3A 4RPHA 3JAMA 1RRGA 4WBNB 4MLCA 4XE5A 1P77A 2RAPA 3T12A 2OC4A 3QW4B 5A5GA 1GCGA 1AQ6A 1HH4A 3W8FA 2PNJA 2NV0A 3UAVA 4L8FA 2GUGA 1WCIA 4LUCA 3PB3A 3VYSC 4NCIA 3WDMA 2VP3A 3FJ1A 5IWAB 3A0BZ 4PGGA 3O95A 4BO5A 1NQTA 1JFLA 1E89A 1X7ZA 3HYSA 1GPBA 2W98A 4JYPA 1JKIA 4XFJA 3ZIAD 3Q0EA 4B3XA 3M3DA 3OD5A 3IT0A 4LN1A 1FNSA 3AHHA 3PDIB 1U8UA 3WHIA 1Y1RA 3MCWA 4LFCB 2IQ5A 1WCYA 1ZBQA 3K4PA 3JQ6A 2C2YA 1NURA 2NR5A 2QLTA 4HDRA 5E1OA 2J8ZA 1E3DA 1M1ZA 1I0IA 4DXDA 2AZ0A 2RGXA 4G0ZA 4EEKA 1NTZH 1V43A 5H1YA 3DSRA 2XBUA 3IBYA 2HBRA 5CBHA 2V7VA 1UR5A 4HCJA 3HQ4O 1A32A 4MEBA 4N4AA 2ZR8A 2P3LA 3DAGA 2PLRA 4JX8A 3S2SA 1EFCA 3IERA 1QV7A 2ZDGA 3DV0B 1JFTA 4QE7A 3ZIAA 4FN4A 1KP3A 3MWEA 2P3OA 5L6MB 1H85A 1E2HA 1OPXA 5IDQA 4BWFB 3QEBZ 3CWZA 3NYWA 4LC9A 1IPEA 4JLAA 2CF6A 4KDEA 1Z5GA 3VSAA 5JY6A 1YZFA 3KKNA 5K0GA 1BVHA 3MSCA 2CLOB 1MX5A 5L3BA 1L5ZA 3HR4A 1C9NA 4NL4H 4I9QA 2GKGA 1DBQA 4D3YA 2H1IA 4NBLA 4M9QA 5BO5A 3LDTA 3SSAA 3NBZC 3R24A 1Y98A 2AE1A 3CPSA 4WW0A 4FN5A 4WXYB 3C8UA 4K0RA 3TIXB 2DXIA 1NBMA 3MYRA 2WA1A 4H6XA 1CY7A 3NYRA 4LBEC 3TPFA 4O63O 3KU1A 4LZOA 4XRRA 2ZQYA 1T9DA 3R74A 4S2EA 1K4DC 3EA0A 4B34A 1L9KA 1JXOA 3EBOA 1PS8A 4MMZB 4C4AA 3LQYA 4HOYA 4I50A 3L8GA 4HS4A 4TM8A 1I9CA 4Z3DA 5HZHA 4RIIA 4BQPA 3H2YA 3ZCPA 4OLJA 4QXMA 3EOBI 1W36D 2NG1A 2CJWA 2O2EA 1Y82A 1SKQA 3N07A 3ORRA 1QYVA 4QA9A 2MU1A 3PNVA 4JLKA 1GYPA 2HR1A 3GT4A 5IE9A 2IHKA 4MR8A 4IFEA 3MCUA 2PG3A 3AZOA 2FHSA 3D3KA 4EGQA 1LZKA 3DE7X 1ZK1A 2A9VA 3ZDYB 3U26A 2WLLA 3R5SA 1D04A 2Q7DA 2VOJA 5E2IA 5HF5A 4ANFA 4IZ6A 3AINA 1ILWA 4L0MA 2WZQA 5CMUA 1PZXA 3GUCA 4ED9A 1V45E 3NVAA 2IUSA 1IOZA 3PGKA 4EG1A 3AF2A 3VTFA 4BAZA 4BW0B 3U4IA 4B47A 2Q8VA 1N7IA 4W6QA 3K94A 3FSGD 1MJNA 2NUBA 2FE4A 5GIOC 2NN4A 2WLJA 4JUCA 3L8MA 3EQ8A 1NN3A 4A6EA 3UEOA 4C7UA 3F4BA 4P08A 5LYYA 3ABMB 5I7RA 5LM3A 4CN9A 3N7TA 2O05A 4JAVC 4OP3A 3R7FA 1R3IC 5LOVB 5A9SB 1XAJA 1UWLA 4AJLA 3VBBA 5LXTF 1GQ2A 4PTLA 4DVGA 4JLNA 1P45A 3VAZA 1JVSA 1L5RA 4ND5A 3L8FA 3D1LA 2ZR9A 3VGJA 4BO1A 2XVAA 1R1DA 4EATA 2FB5A 3GN1A 4D8XA 1SUAA 1N78A 2F43G 2PTGA 5H4HA 1J8MF 5CLIA 4QTTB 1V8FA 1OWLA 2QN8A 4Z4FA 4KV7A 5K0LA 2CCKA 4LFBB 4X66B 3V4RA 1EBBA 4KJXA 3H9BA 2OGTA 4CRWB 3AIIA 2MSNA 4TTVA 4J76A 1O1YA 2XYRA 1MF7A 2ZVZA 4D02A 3W3AA 3ORQA 2Q4BA 1JQ3A 3X1JA 1KFCB 3GPIA 3W06A 4MWTA 5F1YA 3K59A 1XN1A 1BCRB 1KZHA 3CKKA 2VWGA 1VMKA 2AN4A 5E4YA 1KECA 1JUDA 3C5HA 2XRZA 4KN8A 2OP0A 1PYDA 4HBNA 1XZQA 4L08A 5JQGB 3GFTA 1VI5A 1D0IA 3LBIA 3QE2A 3HMKA 1IHPA 4FHDA 3KAKA 2V3CC 1E9FA 3C9SA 4MYDA 1JVBA 3BSSA 1OFVA 3K2XA 3LAWA 1HNWO 2DFKB 1GNPA 1NY5A 4K3VA 4M0MA 1PQWA 2BPOA 5IAKA 1NM5C 1I7DA 3CN7A 2OXTA 1IONA 5FAKA 1KQPA 4NCHA 4L3OA 2ZSFA 5LLDA 1K7SN 1AUPA 1IX9A 2H2GA 4HQ6A 3OO0A 2ES4A 3L4JA 2NV2B 2X0IA 3X2QB 3K6SA 5EZYF 2QJ1A 3AF6A 3T1OA 5SICE 5HKLA 2G9VA 4HADA 3RI3A 4DCMA 1I3KA 10MHA 1X13A 2O2HA 3RASA 2AOTB 1SB9A 2FMKA 3FHOA 1CFJA 4OJNA 2QMEA 1NUUA 2K2QB 3ZCQA 2HA0A 2ZIGA 2R0QC 3H5VA 4QIWF 3NANA 5B6JA 2O2YA 4JVMA 2YHUA 1XCMA 3CCFA 4GKVA 5TGZA 4ZGWA 4Z2YA 2X5JO 2ZAOA 1T0PA 2XCUA 3K72B 3ASNB 3LFHA 3HBMA 5CH3A 4PO3X 2W4MA 3DPUA 2IELA 1LS6A 4G8JA 4DCPA 2D3OW 1R6AA 4D42A 3STVA 4JWKA 4E7PA 2DR0A 3OZVA 1IJKA 2XMDA 2WYOA 2ODQA 3RIGA 1TYAE 4DA0A 4LRTB 4QZVA 3ZHYA 4IR7A 3NKFA 4G01B 1YT5A 3W9SA 4EHKA 1OCRB 4WGFA 3CF4A 3UAZA 1PJZA 3CRQA 1M72A 3EG5A 4PHHA 4LWSA 1IN4A 3GQBB 1NF2A 4EJSC 4ML3A 2ZRKA 1EWYA 5H59A 4LIPD 2XUIA 4J0HA 1TKCA 3WGUA 4IXWA 3ANNA 4ND8A 5J3JA 5EO3A 1WBJB 2PXHA 2VNIA 5ALKA 5AVZA 4NV1A 5K5EA 1DAMA 1MCZA 3AB7A 3RC2A 3ICQB 4ZQHA 2BC9A 2XWQA 1OV6A 3R6DA 1SBZA 3CO0S 1HMYA 4LYJA 4LVNA 2ONJA 3AR5A 2DFDA 2X0DA 1MIHA 2IUUA 4QBFA 2OBFA 1YTFD 3QITA 1DIHA 1PJSA 4KE6A 1TEHA 3SLKA 1T5LA 4OBBA 1SKYE 3N3BC 4IDNA 3JAMM 5ALJA 2DG2A 3DXXA 4CT5A 1H2YA 5EXPA 3J7AR 2XOXA 3TLGA 2QLLA 3PJSK 4P9OA 2QKYA 1W94A 1C3LA 1B0PA 5BNTA 3ZGXA 1SS3A 5ELMA 3ZGYA 4P5DA 1IHUA 4OHFA 1NX9A 1O4VA 1HPLA 1GPAA 3KPWA 3AU8A 3ADOA 4C2UA 1UBKS 1NF8A 1UPFA 5E6SA 3ZWOA 3KHNA 1AZTA 1C2YA 2HV8A 5CX1B 1X4TA 1SCQA 4Z1MA 4TSFA 1QIFA 2A5LA 5EC1C 4L6CA 1U2EA 3B6IA 3UAGA 3TIFA 3RYCA 3IQGX 2O3SA 4IOKA 4QXOA 3HVKA 4C4TA 4QOEA 4G9GA 4PXAA 5AM0A 4D7AA 1V4BA 4QJIA 1J0BA 4ZYYA 1NJIH 3TUZC 4EH1A 3ENVA 3NEAA 4CWAA 2YCBA 3BGWA 1CUEA 1OYOA 1QKIA 5KNBD 2DQSA 2ZIOA 2YZ7A 4OX9B 3Q7RA 1JTVA 4TZ0A 5EKUA 3MUEA 2DX7A 1WCV1 4RDCA 3HJAA 5EE0A 1EESA 1BHBA 5BMVB 3PUWA 3CC7F 2Q21A 2YR0A 5FNVF 2VDLB 2H65A 1Y1LA 1L5HA 5KUMA 5T57A 4FVTA 2NZVG 2R87A 5CTJA 3DDCA 3I6QA 3SYOA 2JLXA 2QORA 4AP6A 3TB6A 4P34A 4B8ZA 2UXDO 4WFJA 4TX1A 2LO1A 2MCFA 3LWZA 1W42A 3I4LA 3C6YA 5REQB 3IC5A 4NIMA 2R1UA 1RWMA 4GI3A 3PC3A 2K1EA 5DYGA 2I03A 3W5AA 3IXQA 4DMHA 1RBZA 1W6RA 1CUAA 4M8SA 3H9CA 3KDSE 3ZH2A 3VYRB 4BOYA 1YC2A 3BDIA 2VHTA 5AR1A 4INZA 4TLLB 5HE8A 1BX3A 1LPPA 3MWJA 5CT4A 1MXFA 4TKVA 2OXEA 1LI5A 2WU1A 2G9IA 3H5OA 3KQLA 1HDEA 2G9UA 3B1VA 4JGBA 1TPZA 2BHRA 2YJ6A 5ISMA 3VOBA 3H5NA 1JEYA 4US0R 4LOLA 1VCOA 3A31A 2R8EA 3HBLA 1ZWKA 4UFNA 4M21A 3TLBA 1FYFA 2V5AA 1ZH0A 3BIOA 4N5HX 1W8IA 3SIWA 4B83A 1NQVA 3DXRB 3UCFA 2XZOA 2GN2A 1WKVA 5EVJA 3F0FA 2QHXA 1D2HA 2ZSKA 3UB3A 2P5UA 2DHDA 5LZ4A 1DWPA 3I1JA 2O6LA 1VA4A 3K5MA 2DERA 1IDN1 3CPQA 3E0QA 1KI4A 1GV1A 3QBDA 4GEGA 4YT5A 4W5OA 1J0DA 1JU3A 1T24A 3IEIA 1VQ1A 1E2GA 1NAIA 5BQ5A 2KLBA 4YP1A 3E9YA 3E2EA 4HN4B 2RGUA 1VIBA 1DKOA 4E4YA 5CNIA 1PK7A 1FUYB 3OEHD 3T5TA 1RLGA 1YR1A 4FEYA 2INGX 1XDZA 5C7LO 4IQ0A 3TLXA 5EIHA 5BOSA 2H6LA 1CUZA 2PFKA 3SOPA 3GLIA 4RIHA 3Q7QA 1VTKA 1LI4A 4OFWA 4WY8A 3EZ2A 4QXRA 3JWPA 4KRGA 4RD2A 2G0AA 4TRNA 4D8YA 4Z9AA 3P0RA 4F9FA 1V9SA 2M9MA 3UWMA 4WOKA 1ZN2A 4WK0B 3BMNB 4MUFA 5CVDA 2FWIA 4QQKA 4QTYA 1XRQA 3D3QA 3QUSA 1I94O 2Q1XA 3FM9A 2RB5A 2Z4TA 2C7GA 3W2TA 4S05A 1TADA 1RTTA 3TL6A 2J0QA 3PXAA 3UA4A 2ZETA 2GTIA 1YL7A 3W2FA 1CX9B 4RYDA 4CL3A 2FGYA 2FWMX 1SXPA 3O8QB 5JXGA 4I2VA 4P82A 4TZKA 2BFPA 1VL1A 2A33A 4OHZA 4GLLA 1GSHA 1U96A 4FGZA 2UVPA 4RSRA 3TKYA 3E81A 2E75B 4LCBA 4QPKA 4QFDA 3QV2A 4ZRNA 4B6RA 3SHFA 4CCWA 3BEOA 1G18A 1OB5A 2V6GA 4M9UA 4HGQA 3OU6A 4BRWA 1JFFA 1PF5A 3I2GA 5ALDA 2OENG 2Y0IA 2FFQA 4TM7A 1Y3IA 2MR6A 4MIEA 5CXXA 4JEHA 1EM8A 4GVXA 2UZ1A 5B58C 2XE8A 3IVAA 2OEPA 1V3TA 3R40A 3S29A 5JCXA 3P5SA 5LJIA 1QH8B 3CCLV 1TKAA 1YKGA 4EMUA 4G89A 2DUMA 1NVBA 3S1SA 4EP1A 4RJKA 1RKVA 5A62A 1D7AA 2BFCB 1W59A 3O8DA 1JIVA 1RCFA 1PLJA 3ND8A 2HYDA 4IKPA 3D0OA 2H6EA 4OGQB 1RQLA 3CO5A 4F86A 2GARA 3ESBA 4R41A 3EEOA 3EUWA 3ZHBA 2FG7C 2YW2A 4NTXA 3N7AA 3U6KA 3SY8A 5IT4A 4OXRA 5GTHZ 1CV2A 5HY2A 3Q7SA 2WJPA 4OHRA 2HHHO 5L53A 3JD3A 4FYXA 2PH1A 5GIOE 2Y77A 4MQFA 4NBNA 5K8JB 4UAJA 4EG5A 2WIBA 1G8AA 1VYVA 4HDCA 4ZI7A 5IBCA 3MTGA 3CZMA 3G5UA 4JNKA 2OFXA 4IHJF 5I5GA 3HXKA 1HG1A 1T4DA 1YJXA 1Q0QA 4YRDA 2VZ8A 8ADHA 3P97A 3UMCA 3DZBA 1ZSYA 1ZJ4A 2XGMA 1RJFA 1N2EA 3NCTA 2NP6A 1JU9A 2QTSA 1K6JA 3C1UA 4EY7A 4Q19A 1SZDA 2QENA 5KA6A 3R1IA 3FDIA 3KP1A 5CYFA 4GNKA 1J5EB 4JI2B 4JQOA 4FBLA 1V8OA 2GBLC 4I19A 3KSRA 2WEKA 4FMPA 1DKPA 2C5FA 3D8SA 4LQLA 2ZIXB 4CDMA 5ANRB 2B35A 1N33B 3EVNA 3PEYA 4QBIA 1RFYA 2QRHA 1Y3DE 3KHTA 1HDOA 3EC2A 4AZSA 4BNTA 1USVA 4EAAA 2Q0HA 3EGXB 3PE6A 3FPLA 1XAIA 3TZ6A 1C3OB 4G5HA 2XYVA