5LP6B

Crystal structure of tubulin-stathmin-ttl-thiocolchicine complex
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
428
structure length
422
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Tools for the rational design of bivalent microtubule-targeting drugs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 154
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5lp6B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5lp6B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5lp6B01
5KX5B 1W5BA 4LNUA 4FFBA 5EZYA 4O4LB 1OFUA 4ZHQB 4ZI7B 3UT5A 2R6R1 4YJ2B 4IIJA 5EIBC 3JASB 3HKEA 4E6EA 5JQGA 4U39A 5C8YA 4X1KB 4I55B 4O4IA 5GONB 5IYZA 5J2UA 5CA0B 3JAWA 3RB8A 4M8IA 3ZBQA 5CB4B 4DRXA 4O2AB 1Z5VA 5EYPA 2R751 5JH7A 1FSZA 5MN5A 5CA1B 5IJ0A 4HNAB 3E22A 3V3TA 1SA0A 3RYFB 3RYCA 5FNVA 2RHJA 4O4JA 3ZIDA 4U3JA 5M7EA 4IHJA 4O2BA 3JALB 5LA6A 3RYHA 1RLUA 5KX5A 5JCOC 4O4LA 5J2TA 4O4HB 4ZHQA 4ZI7A 1Z5WA 4YJ2A 2RHHA 2VXYA 3JASA 2Q1YA 3HKCB 4I55A 5JCOA 5GONA 1JFFB 4TUYB 3JARB 4F6RB 5BMVB 1W59A 3N2KB 1RQ7A 5CB4A 3WGLA 3M8KA 5LYJB 3HKBB 5CA1A 4EI9A 4HNAA 4DXDA 2Q1XA 3HKDB 5LP6B 1W581 1TUBB 3JALA 4YJ3B 1W5FA 4B45A 5MN6A 2BTQB 5IJ9B 4X1IA 4X20B 4O4HA 3CB2A 2XKAA 4I4TB 4TV8B 3C8LA 5ITZB 3HKCA 1JFFA 4TUYA 3WGMA 3JARA 3RYIB 3JAKB 2XKBA 5LP6C 3VO8A 4B46A 4F6RA 4XCQA 5BMVA 3N2KA 4X1KA 5LYJA 5KMGB 1TVKB 5CA0A 3HKBA 4X1YB 5JVDB 4O4IB 3N2GB 5IYZB 4O2AA 3HKDA 5LP6A 1TUBA 4I50B 4YJ3A 3RYFA 5JH7B 4ZOLB 2BTQA 1W5AA 5LOVB 5IJ9A 4X20A 2VAMA 4EB6B 4WBNB 4TV9B 4U3JB 3VOBA 5LXTB 3WGNA 4I4TA 2VAWA 4EI8A 5ITZA 3JATB 2RHOA 5J2TB 3RYIA 3JAKA 1FFXB 3R4VA 1W5EA 4LNUB 4FFBB 5EZYB 5KMGA 1TVKA 4X1YA 5JVDA 3UT5B 3N2GA 2GVIA 2RHLA 4IIJB 3HKEB 1RQ2A 5JQGB 3WGKA 5MN4A 5C8YB 4I50A 5J2UB 4ZOLA 3WGJA 3M89A 3JAWB 5LOVA 4EB6A 4DRXB 4WBNA 5EYPB 2BTOA 4TV9A 3VO9A 3VPAA 4EI7A 5LXTA 5IJ0B 3E22B 4KWEA 3VOAA 1SA0B 3RYCB 5FNVB 4O4JB 2VAPA 3JATA 4X1IB 4IHJB 4O2BB 5EIBD 5LA6B 3RYHB 1FFXA 4TV8A 3ZBPA
chains in the Genus database with same CATH superfamily
3AFMA 3KVNA 1CNEA 3K6SA 3BIXA 4GR5A 1IL0A 3RD5A 1VQLV 1JNXX 2XYGA 1A9ZA 4BCCA 3F5WC 3ETEA 3G2OA 1PVOA 4K46A 1NASA 4UTVA 2VPIA 3PDUA 4LZOA 1L4MA 2DKNA 3TECE 5JDCA 1MTZA 3WL3A 4D8UA 1I1HA 4NATA 3I2JA 2FMKA 3ZH9B 1U5AA 1ZN8A 4X3CA 2IHBA 4V0NA 2OB1A 3NEAA 3HJWC 4ALLA 4TM7A 2QMUA 3TXQA 2WSSG 1GZDA 4P80A 3H1KH 1CFZA 4IRMA 2ZI3A 5EUQB 4PZZA 5K20A 2BFCA 4OHVA 3THXA 1IZ8A 1DTWA 1XQ1A 5BN4A 3FPEA 1JP7A 2VNSA 4FM2A 1BOOA 2SKDA 4U2DA 4B7CA 5TJHA 3EOZA 1XYVA 3DCNA 1VP7A 4Y9SA 2P5YA 3VYVA 3TOCA 5F2EA 3NWOA 1Z6PA 3UW3A 2OZLB 4XYMA 6ADHA 4DQLA 2ATCA 4CF5A 1WULS 1LLUA 4YV7A 1KK3A 2BH9A 5IZCC 1TGYA 4I4CA 2R751 1P2DA 1T5HX 4O2BA 2GS9A 1W4RA 4OQEA 2QX9A 4RTNA 4QPJA 1OAKA 2PZBA 4FFKA 1N9KA 5A9TA 5I7WA 1N4DA 3SJAC 3TTSA 3ZDQA 1WTCA 4B76A 5C7IO 2YTZA 4KRXA 2Z9DA 2YQ4A 1Q0HA 1SKMA 3VR5A 3VZSA 1ECJA 3ZWOA 4I4TB 1AI4A 3RVRA 4K2AA 4BQEA 4M2LA 3S2SA 2WILA 2WSIA 4DYLA 5H68A 3TW8B 2P4KA 4DEVA 4AP5A 1PWEA 3O83A 4N12A 5EQJB 1F23A 2V45A 2YS7A 2XHEA 4DMKA 3KWLA 2H07A 3O31A 2RD2A 1S5JA 3SIVA 1K92A 2HHHO 1JPUA 2H48A 1PBNA 2HH9A 1FY2A 4K0KB 4HAYA 3OOEA 1T2DA 1XRSB 3AF0A 4WGGA 1FYDA 2W0SA 2EX0A 1CUVA 1EZ1A 1AHNA 3HXLA 1HK7A 4FE3A 2FMXA 2NWQA 1VPDA 4Q3EA 4AD8A 2ETXA 4XWTA 3PK0A 2RHJA 1I3CA 5L3FA 3AJAA 5A06A 4MI1A 4DLTA 3IELA 2VTVA 4JELA 4EEZA 2HR1A 1D07A 3D8RA 4EA7A 5JS1A 2HU2A 1XHFA 1W0JD 4FGJA 2WTAA 3SM3A 4A9AA 2OV3A 3ILVA 1VIVA 3U81A 5FTLA 2F90A 3FX7A 2H65A 2AN5A 2R5NA 5JWRA 1LEHA 3PGA1 3A3OA 2HU5A 3NH9A 4EG0A 4QG7A 2QG6A 3HJFA 5E3HA 1EDDA 2QWNB 3IAS6 2WG1A 1QH1B 3WL6A 4PWTA 3LU1A 2FZEA 1W88A 4GM0A 10MHA 4HQ6A 4EYQA 1KRXA 2YYYA 3WNBA 1CX9B 2QUIA 4K6KA 1D1TA 3C6XA 2JIZA 3OQVA 3T80A 4MVJD 3DPUA 4HD8A 4LF6O 1A4XA 1T3TA 4I08A 3LUCA 4J3NA 3WNQA 4P54A 1V5IA 4NHOA 4YP6A 4J29A 2BH2A 1VE5A 2GH1A 1PR1A 3L6BA 4UEOA 1NV8A 4NAVA 1C2TA 4WI1A 1C9NA 3UIEA 2WD9A 4O1IA 2PSHA 3JTEA 2ZJ7A 2QE7G 4GC9A 2GEBA 3PGLA 4ZOCA 4RFLA 3B60A 2XAQA 2QXUA 1JPVA 3VNRA 3QUBA 5EHNA 4OP3A 1XJCA 3I73A 4PRZA 2DWDC 4UPEA 3ASNC 2HF8A 4O5AA 3ZDEA 4UTXA 3B7GA 1Z2GA 2RHBA 4F97A 1SQQH 2WLSA 1SU6A 1U11A 4D44A 2D7JA 1FNDA 4TV8A 2OYSA 1G41A 2EDAA 2W8BA 5EZSA 4NMHA 4C03A 3THSA 1TQ8A 2O07A 5HF6A 4DRZA 4OXIA 1T5IA 3OH8A 2YXBA 2OG2A 5IP5A 2IK8A 3MTIA 3MHHC 2Q5ZA 2HJ9A 2XUFA 1SKBA 3NBKA 4Q9IA 2Z1UA 4IDHA 4CEJB 3IXMA 2P78A 3KYDA 3M5PA 2B2XA 1KZGB 4HXEB 1UBMS 1JEQA 4L8YA 4Z1OA 2AUMA 3GOQA 4TMVA 1J23A 2I3GA 3TR0A 2GN1A 2LJ2A 1E79D 3N7UA 3F7VC 1UBEA 5LXTB 1ORIA 4CR6A 2OB2A 1TRKA 6GPBA 1UMCA 4TKUA 4XI9A 1W4BA 2BCGY 3RPEA 3HDYA 4J1SA 4U2BA 4R8CA 2RHLA 3PFIA 5IMBA 4S2UA 2NU7A 3FPAA 4DV6B 2IXBA 4CU2A 4KQWA 1CJKC 5I48A 1NXSA 4J7AA 1GN6A 2IUEA 2NXCA 3ZBPA 1IONA 3V1YA 3EUWA 2ZPUA 4KFTA 1QRTA 4XZ3A 3GLVA 2BFPA 3RUAA 1PS8A 3A9UA 4EF5A 4IS2A 2IBSA 2YICA 4HNAB 2F3TA 3C3BA 4PGMA 1SKYB 2G38A 3ZY3A 2D3TA 4HYOA 1BC5A 4J2OA 4BX0A 2CXQA 2DLCX 4JBGA 1XXLA 2JAWA 3JV7A 4RTLA 4RK6A 4P9OA 3RWRD 5K01A 2FMUA 3AKZA 2IZZA 1R8SA 1TVEA 3CRVA 3NNDA 3W7WA 3EHEA 2IYQA 1KBZA 2XQKA 1ZH6A 2FLWA 4MV3A 4LWZA 3JVIA 2OIGA 3J7TA 1ZPDA 5HJEA 1LUAA 4R1MA 3K09C 2QGFA 1A7JA 4MB0A 1DX4A 4HADA 1OJLA 4J8PA 1RMTA 1Z6YA 2P9JA 5F2KA 4JUCA 1P4JA 2FWRA 2XYHA 4JIMA 4I9HA 4ZVKA 2FPMA 1S3IA 2JEXA 3IXLA 2HNKA 4EFNA 4YS6A 1BS1A 1URFA 2ZI7A 1SVIA 3DTUB 1DAEA 4NK4A 1HT1E 5KTYA 3QITA 4RAIA 1F6DA 4KN8A 1N2EA 2H4JA 4IUDS 2C0PA 2UZ3A 3A6ZA 2JLYA 4EYOA 1NF8A 3GLRA 4Q1FA 3U6BA 4H0CA 2OHVA 2EEPA 1YDWA 1XMQO 3W1VA 1VIYA 4JYPA 4RVSA 3OCJA 3NKFA 3BD9A 3KVRA 4QICA 4CDMA 2F8TA 4LDPA 4FX5A 4PANA 1XROA 4FZJA 3L74H 3FF4A 3B7PA 1QD9A 2FHPA 4TTTS 4ZYTA 4FZ3A 4HXYA 1XRGA 4IMPA 1CPYA 1E2KA 3ZOKA 5HBGA 3H2KA 3L1KA 2OEPA 1GYRA 5BY2A 3CLSD 4KN9S 2ACKA 1T13A 3PHHA 4Z7OB 2B20A 1ZL8A 3RS3A 1M3SA 1YU6A 1OXVA 1IBLO 1I2CA 5I4IA 1RBQA 4I4TF 4TWJA 3N2EA 4G1FA 1TZCA 2ZBUA 4MICA 2DTEA 2QMHA 1Y34E 5C4GB 3OZXA 1M0TA 1GUZA 2A4MA 3GD5A 3W1EA 3MWDB 3IXQA 3LBAA 3COWA 4JI8B 1D2NA 2CMFA 4BNTA 1H05A 1XPRA 2H94A 3GVIA 6AT1A 3VV2A 5DKFA 1A2QA 1FLDA 1H5NA 3FRHA 1QGUA 1XZNA 4U6QA 2VZ8A 2QVBA 1Q50A 3I5MA 2BHTA 5LZ8A 4D1YA 5D3MB 2Q5EA 3C3CA 2FPRA 5DP2A 3CYOA 2OAP1 3QWFA 4B6RA 2G9RA 2V0GA 3HXMA 4JMPA 1UBCA 4NONA 2APJA 4UVIA 1E0KA 1C1YA 1Y81A 4E21A 3RU3A 4GMXA 1NU1H 1XUOA 4EDFA 4OFBA 1GG9A 3ZGZA 4H2DA 2R6ZA 5KKNB 1T5TA 3IR6A 2WLHA 1ZY2A 2ZYUX 1I0IA 1CV2A 3FVTA 4JDPA 1BE8A 2W6JD 5F5NA 1FDSA 1US8A 3NU1A 5ANRB 1UDCA 2D1QA 2ZJZA 3GNTA 1Z8HA 3TCXB 5ETJA 2MHCA 1GDDA 1P5FA 2XAGA 1FTSA 3ZHBA 2J5QA 3QEOA 1W0JA 5DH9A 3EVDA 3O91A 3W5BA 3RBAA 2L2QA 4BN4A 2EC5A 3VVMA 3USZA 3CVOA 3I01A 2QRUA 4IDFA 5K0SA 1GGFA 1GKLA 3LSYA 5AUNB 4DA4A 5JASA 5LKRA 2CL7X 5AXCA 1QIFA 3HYRA 1BVYF 2HFKA 3TL3A 3RYFA 1EUDA 2Q49A 4D02A 4RSHA 4PZEA 4S04A 3QXCA 4YRBA 3QNUA 4HQKA 3DOIA 1Q0PA 4CM6A 5JQGB 2EILC 4EPRA 3U80A 3GP3A 2OTJV 4UBOA 3U3XA 3KD2A 1Y66A 4LS3A 1KI1A 4MVJA 1KI3A 4HZ3A 3I09A 3AR6A 1BE0A 1H8HD 2G4VA 1P49A 1U99A 2J32A 4HZUB 1IOVA 4D46A 1I2AA 3DE1X 2EBOA 2BEWA 1GN3A 3CEPB 4RK1A 4CEIA 4O08A 5ITSA 3E7FA 2CMGA 2PZEA 5JNUA 3DZJA 1Y4SA 3QLJA 3IS3A 3Q6NA 4K7JA 3OAAD 4PTZA 4F9GA 2WUGA 1DHRA 3UAGA 2FMTA 1EHCA 3IT2A 4I8IA 1RJDA 1X1SA 2XAFA 2YJ4A 4QRHA 3E0QA 5A6VA 1GZUA 4KTVE 1H1LA 2A9RA 1WRBA 5G1NA 1ZIPA 4RJKA 1T0HB 4ND3A 2C00A 2QZJA 4KFSA 5GM2A 5EEGA 1DCTA 3MCAA 3S3XA 1PGJA 3T3MB 2G0AA 2V3VA 2ZE6A 4L0DA 3OF3A 1JSCA 3V8RA 4ZTZB 4R8VA 3D0OA 3C24A 2AJ8A 1JJVA 5KTTA 3PE6A 2DFNA 5IS2A 2FZ5A 2IU3A 1QQCA 5B66Z 3BJMA 4B6EA 4GI1A 4EB6A 1KVTA 3WMEA 3CPWU 2ZRQA 4ZV4A 4OO3A 3NUGA 4EG4A 2I1QA 3FSJX 4EJSA 4ED9A 1SF9A 3WXBA 4A6PA 4EGCB 4DADA 4LZZA 2QK4A 2PX0A 3VR0A 1XL4A 4LX8A 4ER5A 3ABZA 4EVSA 4RCVA 1KSFX 4UVDA 5I5EA 4NTWA 4DM7A 3Q2OA 1N0WA 2QVZX 4CC6A 1YCIA 1EZ4A 1QLWA 2GLUA 3DZKA 3HVKA 2DE0X 4IDNA 2VKTA 3P7MA 2P3OA 4J0KA 1L8LA 3ZGXA 3A25A 5IWAB 3G0HA 1IDSA 2ZIZA 2DQ4A 3E4DA 1SCUA 4NVRA 2OD7A 5C8DA 1CYEA 3C16C 4FCTA 5EGNA 3Q4HB 1W19A 2EWVA 4EGSA 1X1AA 3T1NA 1VYUA 5LMCA 2QNIA 3RN4A 5B1NA 5BSKA 2H7XA 5C52B 4KFMA 1DBFA 5H9VA 5BW5A 3U11A 3EXIB 3AINA 3B2EE 4LSZA 2WIKA 2CK3G 3AHHA 1YZKA 4MA5A 5GM1A 2WY2D 4BGIA 2A9JA 1JHQA 2ZAOA 3DXRB 1Y74B 4QTYA 1I32A 1E32A 4J4BA 2YC2C 5CD1A 4JPRA 1N2JA 3PE4A 1YI8A 2OXTA 5JDIA 4RD4A 4NC9A 1OFGA 1JE0A 2J4CA 2NVBA 1EKXA 1WOMA 4GLFA 3QUCA 1XEXA 2J7KA 3WNVA 2B3TA 2W6IG 1P9NA 4H1UA 3TDNA 2NLOA 5CHEA 3IVMA 3FYUA 3DHWC 3TRIA 1SOAA 3FCYA 4E7PA 4R6ZA 3SC3A 3OE5A 4KPEC 3TLJA 4QZVA 5ALXA 5LC1A 3A1SA 1FX0B 3KYCB 4ZAGA 4L78A 1DRUA 1ZHHA 3KHNA 4EA9A 3NI2A 4Z2WA 3WGKA 1WHTA 4TYNA 3IHKA 5B58C 4EKGA 3HO8A 4JJGA 1S2DA 2Z1MA 5DTQA 4ILKA 1I4OA 1EFRG 2AK3A 4F3NA 4JLJA 2PUJA 1X1QA 3VPHA 5IYDO 2O2HA 3ZBHA 5A3JA 2VJYA 2X2OA 1GOTA 2FG5A 2XUGA 1SBNE 3FZEA 3VYTC 2PGGA 3ZE0B 4A91A 2AD5A 3UKMA 3MT0A 1AGRA 2A5GA 4KCGA 4YWJA 5AG2A 4RENA 4M1SA 4XSVA 2VT6A 3EY4A 4ZI2A 4TWZA 1UZUA 4GU5A 1QFJA 1SXJE 3V9PA 2D2XA 4Y18A 2XXAB 2OXIA 4KFRA 3FDZB 3NP9A 4UNNA 3FGPA 1XQ9A 3QENA 2K2WA 3EVKA 5CA0A 4FD2A 1T9HA 5FAXA 3KJKA 2AOUB 3BA1A 4W5OA 2Q2OA 2V3CC 2J31A 1VJ5A 4E13A 4BLRA 1E69A 2NU6B 3I8SA 5K51A 3CXRA 3L5KA 2JW5A 3VR3D 2C4KA 4URWR 4TRJA 4Y6OA 2BTOA 1A1VA 1N2SA 5KOJB 3Q40A 3LSTA 2R72A 3H9BA 4V03A 2OSVA 4N0DA 3VR4H 2J45A 2QGNA 1ZKMA 2W8BC 2FYTA 1GGEA 2WLKA 1GCAA 4KO3S 5IU6A 3GEBA 5CM9C 1A50B 5COQA 4CIWA 3F7TA 5B12A 1I4EB 1GQ2A 3C7CB 4TSRA 3WKDA 3H6HA 3EFHA 1RPRA 5BQOA 1AQUA 1Q6IA 2PWYA 4MW6A 1T6BY 3P94A 3OCVA 1V9SA 4TZKA 5L4LA 4E7OA 3F9IA 4I50B 4DJTA 2JJ8A 2JGDA 4J76A 5ALOA 1YAHA 3MWEA 4JEMA 4H1HA 4CMKA 1ENOA 5LUBA 1VQ7V 4LPSA 4R6WA 1RRMA 4B79A 4I99A 3AG2B 2W6JA 4HR7A 4B8WA 5JY6A 4ETMA 4B7EA 1K88A 4RDCA 2ZXUA 3ZJZA 1NBMG 3RC3A 3F6SA 1EBBA 1SCJA 2B61A 5IPFA 2VTBB 2Y8EA 2AMVA 5AVYA 1GSOA 5LQKA 4N3GA 1C4WA 2GFHA 2PJUA 3G2MA 1PPJH 2CZWA 1DINA 2QA4F 5JYEA 1JYSA 2QSYA 5FB3A 3KOZA 5JQGF 2WJ3A 4JT9A 1Y63A 5AI5A 1KTVA 3A4TA 2ZB3A 2PBZA 1MJFA 3IPXA 4DR4O 3PIIA 5BURA 3ABQB 3N5KA 4DMCA 1I7NA 4UHEA 1N0NA 3RYIB 1XPJA 1WMDA 2LCIA 4V0ME 3TS1A 4UVGA 1NQXA 2O2ZA 2BTUA 2X0KA 1OGYA 3L4BA 1E4EB 1QYRA 1FUKA 1RRVA 5E6SA 5K0TA 3BJEA 2XGJA 4MB2A 1KARA 2I7DA 3MCTA 1I7DA 3GEDA 1KKMA 3LCVB 2MTBA 4LUCA 3SYRA 1KZ6A 4CLOA 4ALNA 2HMYB 4ZHYB 4NU6A 4FEEA 3L01A 1H8HA 3MWFA 3OX1A 3K9FC 4YCJA 4B3TB 4C4RA 3AUAA 2Z9CA 3ZJ5A 5M5BA 3E8SA 1DBQA 3ED5A 1XEQA 5F7JA 1E7KA 5JSQA 2M1XA 3OAAA 3FMFA 1H2GA 4KIUA 3E18A 3GQVA 1YBMA 3OF2A 2ZRPA 2GRUA 3W4IA 1LX7A 1JXMA 1BSVA 5L7WA 4LRXA 4M22A 5FPKA 3AFGA 3I72A 3WYAA 2ZJ1A 3WLHA 3KALA 1Y3CE 4NQ3A 3D6FA 1AI7A 1KPIA 3WP0A 2HQOA 1NZDA 2QXTA 2P9QA 4TT3D 5HRAA 4BVBA 5AYVA 1AJPA 4EHAA 1HW7A 3W7VA 2DVMA 3JWPA 1XTVA 2ONYA 1QBZA 1JHPA 2NGRA 1YS1X 3O2SB 1TVKA 1ML4A 3OLCX 5T57A 3TQIA 2QRZA 5ARCA 1NVKA 2JATA 2CGOA 1EH5A 5A3QA 4Z4CA 1DO0A 4OYYA 1NHGA 5LA6B 3NK6A 1W5BA 1AT1A 1TADA 4EYEA 5T5QA 1N3LA 3B89A 4ATNA 5JHGB 2Y27A 5HE8A 4IO0A 3KZ1E 2RH8A 4DLRA 1H2LA 3I5YA 3U0BA 1M6EX 2V59A 2W42A 3UJ8A 4KKVA 4K9PA 3CLTD 4AX8A 3ML1A 3SXUB 2JIMA 3KQPA 5L9AA 2YCLA 4QFCA 4A5SA 3TQHA 3HB9A 2IXTA 1Z8DA 1GMGA 1Y8RB 2FY8A 1YTLA 2Q5FA 4MWGA 2VNKA 4L50A 4H3KB 2IEBA 3VJLA 2OWEA 5KO2A 2Y1EA 3LHSA 2WB4A 3IEIA 4DBLE 3CE9A 1L6IA 1GTSA 3UHPA 4U7TB 4L8WB 3V32A 4ZREA 2OO5A 1QZUA 2VDOB 3FNHA 2IOHA 4KBYA 2XCLA 4IIBA 3REQB 4JLMA 2BP7B 2QZ9A 4RD1A 1OAOA 1WU8A 2JAUA 1BFDA 1BKDR 3DLPX 2L42A 2BJVA 1H4SA 5LGUA 1B23P 4KX5A 1K5QA 1TCCA 1P0FA 4XUEA 1X77A 1XFDA 4K6MA 3C8UA 4KL8S 4NS1A 3U31A 1SCBA 1IY8A 1M2FA 4IOLA 4WFEA 4RZ2A 3KKQA 4ZBMA 3K12A 3MJCA 4L5AA 4OU5A 1FJXA 4JZGA 5I8ZA 3PA6A 2E55A 4G2TA 1ZLYA 4Q9AA 4ALJA 2HSGA 3AY7A 3WGOA 1L8AA 2Q67A 2OHFA 4ZU1X 4D41A 3FKSD 4RZXA 4ZGGA 1HM5A 4RMIA 4JI0B 3EGXB 4WHMA 2VSQA 5IBRA 1CRQA 1GTRA 2PJDA 1YZUA 3QFSA 5DASA 4ZI3A 4MQEA 1WAZA 2B6NA 4G27B 1ZUIA 3C6ZA 1D6NA 1B1AA 3V8BA 1WPBA 1O08A 3EBPA 4Y2VA 2C99A 2QAGC 4JVSB 5CXXA 3SC6A 1IN8A 1KI2A 4RF3A 4Q6WA 2ENUA 3D59A 3M1YA 4OHRA 1RQ7A 1WCIA 1VL8A 3IT1A 3PFBA 1OLOA 5F23A 3VJMA 3R6TA 2OV1A 1IBMB 2VQFO 3EXFB 1DUVG 4LBZA 3EXEB 3ZEIA 4UBLA 4DDVA 4B3JA 3B8MA 4KIGA 1GM5A 2YVQA 3DGFC 5EMKA 3RT3C 3Q11A 1FQOA 4Y1EA 5JI2E 3IA2A 4RHTA 1QGZA 2R1VB 3X2FA 4B1FA 4LVUA 3VR3A 3NTRA 1URPA 2HBRA 1K5SA 4G56A 2X0NA 2NYUA 3CBGA 4A26A 5A4KA 3UCXA 3VGJA 3OHPA 3F7OA 7REQA 3LIIA 3VVLA 3OZCA 2OP1A 2VP6A 4F11A 1NTKH 2A5FA 1G63A 4IM7A 3CZPA 2XRYA 3GUHA 3PWSA 2F2TA 1BRTA 4K05A 1NUHA 2JJ2A 1EN5A 4RGQA 2RI0A 3E22A 4TN1A 2A9QA 1WCV1 2AXQA 3D4NA 4EJSC 3BDAA 1V8FA 1WU7A 3RIGA 3E23A 4TUYB 2P6RA 1E2EA 2Q8PA 1DOZA 3PPWA 3EORA 3IQZA 1IWPB 1Y42X 5B1DA 1DF5A 2VP4A 3V7NA 3K0GA 1NLZA 2Z04A 4X64B 3SY8A 4OBEA 3ZNPA 4HAUA 4UDXX 4BFYA 1BX3A 4GYWA 3DAHA 1JEDA 4KXRA 3IAUA 2VAMA 4C4AA 1Z74A 4AULA 4TLCA 3STHA 3X2EA 2XMGA 3Q3CA 1U0SY 1W73A 1ZA2A 3PX2A 2P4EA 4YJFA 2XAJA 1G8GA 2CDAA 3L7MA 2BEUA 4PZDA 3TW6A 1WY7A 4XR4A 4MVZA 3FVVA 4JI2B 1UT8A 2JANA 4B4VA 2NUPA 4ZT5A 2G5PA 3F3YA 2WAXA 4FM9A 3BYQA 4RQAA 5ALQA 1C2YA 4RV5A 3V7UA 4HAOA 3ZUPA 3KQNA 1FQJA 4NZZA 3U4HA 1O6ZA 5F7ZA 3HO6A 3KZKA 4YAKA 3PTZA 1QFXA 3L8EA 2XXJA 3ZWWA 4JITA 3FNRA 5AW3A 2IQQA 1JDZA 4Q24A 5JDIC 4PGHA 1O58A 1Q43A 2I3AA 4F4CA 1GRRA 3FNFA 1QH9A 3Q3HA 1Z06A 4HEHA 3L6OO 4R8RA 1OV4A 5ALEA 1N2ZA 1VRCA 5E4TA 4MW7A 4B4KA 1SKAA 2DM6A 1KEEB 2YBDA 4HAZA 2KPOA 1B43A 4A23A 1IXKA 5DN6D 4P86A 2R8OA 3PWTA 1U7HA 4HO1X 4B48A 1ELOA 3L79A 2GNOA 4RVFA 5IHPA 1XZFA 1ZISA 3R4CA 4XW2A 3R3ZA 4JMLA 1D2GA 4M0CA 3GCXA 1VBFA 4MR8A 1Z2OX 4B31A 1S1CA 5EJ6A 5DNYB 1G5QA 1YJ9V 3KQYA 4AYTA 4IJVA 4DV0B 2FUEA 4Z8YA 3CCRV 3U3ZA 3K14A 1FDWA 4QGAA 5J23A 2E37A 4NMLA 4C6TB 3LQFA 4L08A 1Z82A 2OZKA 3IQHX 1XDUA 1OYWA 4XWKA 3P9SA 3LUDA 5IASA 2HK6A 4JZKA 4F8JA 2Z0AA 2R47A 3F49S 4CHTA 2XUAA 1NVEA 4KXNA 1VPTA 5EG5A 4F6RA 3KPJA 1TYEB 1TRHA 2HLPA 4IGGA 5KOHB 1KKCA 2PGIA 2RHWA 1J42A 3AERA 3E27A 2O2XA 5J4YA 4NXNO 3O4JA 3EIFA 3HG7A 4P7GA 5KREA 4HWRA 3VBEA 2VRWA 1ZICA 4OHMA 2WICA 5DTMA 1KH3A 4HUQA 3GNLA 4EK9A 3ORQA 5K9ZA 4CEHB 5IUNC 4RA6B 1ZA1A 3CLSC 4BNKA 4CJXA 4Q01A 5EY5B 4HNSA 1RJ9B 2DFLA 2O5CA 4MW5A 1K3TA 4RFSA 2HR3A 3FB8C 1KOFA 5CBFA 2HPZA 3LSUA 3F6BX 5BUZA 1CJSA 4BKPA 5CT5A 4M8SA 3DTVB 3LDHA 4BGVA 4YBZA 1JHYA 3TLZA 2VQDA 1R9NA 4CL2A 1MAVA 3MMPA 1K8AW 3QKRB 1KJ8A 3EVEA 4PJ0Z 2P91A 4AIRA 4Z7QB 3AK1A 2OCCB 1SZXA 5DYWA 1IY1A 2NZJA 3VKWA 4KLNA 2G1JA 3MJTA 1COWD 4OHOA 2CT8A 1AKNA 2JJ1G 1L5QA 4LDJA 2NP6A 3JVDA 1CP3A 1USKA 2QP3A 3B48A 1YXBA 3TNFA 2I2WA 3JVEA 1VG9B 3OZBA 2QVCA 3CH5A 3VHLB 4MB6A 3DC5A 5EJIA 3LDAA 3IKEA 2CUZA 4BWYA 4YONB 1OXTA 3GLTA 4RANA 5BXYA 1XR3A 1VA4A 1ZGJA 4LOJA 1T25A 4LHXA 3OTIA 3ORSA 4JH0A 2LD4A 2ZYVX 4LGCA 3V3TA 3R23A 3AVTA 5IH7A 4QHTA 4O33A 2PWZA 3VPCA 3O92A 3O26A 1BXRA 3G88A 2ZW9A 3ZC3A 2OCYC 4OLAA 2QUZA 2XJ4A 5JC1A 5CEEA 1C29B 3L3BA 1O77A 2H63A 5K3BA 2QWQB 3BXXA 1YR1A 2WJZB 1ECLA 3IAM6 4GDFA 1XCLA 2HZ7A 2BM0A 1ROPA 4JZ2A 4RVDA 1UJNA 1KFKB 4DUZO 4YXWD 1AI5A 3PNBA 3H2YA 1TK2A 3HNOA 3GDOA 3HVJA 1XMIA 4UVHA 5LMZA 5I9BA 3CC4F 3C8DA 3L07A 5IARA 3P9CA 1TTTA 3DMFA 1Z88A 5DTRA 2VHUA 3PRKE 2JIZD 4D99A 3L4BC 2XADA 2EZ9A 2FFQA 2FRDA 4BZZA 2BMAA 2FN8A 3BH0A 1I6KA 2QQGA 1OH5A 4ISBA 3LOUA 1S2MA 5DEDA 2WQZA 1CLUA 4MH0R 1OBFO 1EJBA 4U3JA 3KKPA 4DNPA 3KDPA 3RT7A 5JCOC 4CF7A 3W9SA 5KA6A 3LWBA 3M3DA 5AW1A 2XNJA 1YVEI 5KVAA 4YDHB 3FMVA 4NOMA 4Z8XA 5F76A 3M1AA 2EFEB 1GFSA 2Q0XA 2JHCA 3I9MA 2IY7A 5SZJA 3AHIA 2CVHA 2XNHA 3RJ5A 4GI2A 5IDJA 2P9BA 1VQ6F 3CCSV 2P79A 2EFDB 1U7XA 1EXNA 4NBSA 4DR6O 5SZKB 4RDIA 1FSGA 4I36A 2RB9A 4E5KA 3PXUA 2PKXA 5EE5B 2QWOB 4EHKA 3C6YA 3AR4A 4JHXA 1BD4A 2WM9B 2EF1A 5B3KA 3CR7A 5DK6A 3KEGA 7YASA 2HU7A 1VMDA 1P0MA 5DCWA 3NHJA 3F3MA 5KYXB 4KLAA 4B9EA 3S7ZA 2PDAA 4JUBA 2WPNA 3OBWA 3QUWA 2EFYA 4FYJA 1IN4A 1EVQA 4NVPA 3N7TA 4UXJA 2FJ0A 3CURA 4LFAO 1NVVQ 3KSUA 4PG5A 4NBVA 3OEHD 4Y2JA 1Q11A 3RHTA 1DEHA 4OAOA 3R9IA 1XWIA 2DT5A 3N39C 5CH8A 2FP4B 4LF7B 4EOGA 2YRXA 2PGXA 2HIMA 4ODIA 5K2MA 3VKGA 3AU8A 4MVQA 4OJTA 3RODA 4CM5A 4PLWA 1J2YA 3GA0A 3JYHA 3EWAA 3ZGYA 2BZ0A 4NZNA 1JVBA 3UOGA 2QD4A 2WWRA 4ZP1A 1V45E 2OBFA 1AR4A 1TNDA 3AETA 3PC4A 4BO7A 2IEYA 3REFA 2GBIA 3AVYA 1N2GA 5CN0A 4KQ6A 1Y4AE 3C7KA 3W7UA 4MI9A 1U2SA 3S1SA 4BNLA 4ZAYA 1QLEC 4Z51A 2G7MC 3A9SA 3R3VA 4CQMD 1SG0A 3WI7A 5HW0A 1KAEA 5AI9A 5K2OA 4JUFA 3K2EA 2OO5C 1V3QE 2FZ4A 3JVVA 5HTOA 2RMKB 4XIYA 2CHEA 3LUFA 4BQRA 4MLPA 5HTKA 3K5OA 5IN5A 3REGA 3BK2A 1Y76B 3JWIA 1SIBE 2E6KA 2HA7A 3FI0A 4BC0A 2GYUA 3ZD7A 4MTXA 2CLDX 1YE5A 2QKCA 3FCEA 1BXGA 1HSZA 5HQ3A 2VDKB 2XT9A 1D9XA 1Q6UA 4FKMA 3ILSA 5A7HA 3VNAA 2XQVA 3J80M 2WF6A 1VI2A 2DP4E 4Y2TA 1JQJC 3OTGA 2G5GX 2YIMA 1DBIA 1O1YA 1QUFA 3K2IA 3N8HA 8ADHA 1ZNXA 4MS3B 4EYSA 3MJVA 1R4NB 4R2HA 4BNJA 5C8YF 5CB4B 1X3LA 3LO8A 3RW0A 4MINA 3D6AA 2JLCA 3S81A 2HM7A 3MA0A 3DBOB 4X24A 3CMAV 2IYRA 4YAEA 2LRHA 5FHQA 4UXNA 3SIXA 4KQ2A 4CUZA 4QYIA 1XV5A 2LGQA 4DHWA 1KZHA 2HSEA 3WIUA 4RDXA 5KYUA 1BDHA 3LLUA 3RC9A 2REQA 3K35A 4BDSA 3EF0A 4OLBA 1EDEA 2IQ5A 2Z83A 1A8PA 3VC3A 2GZSA 4JSRA 4P3PA 4M0PA 1FDRA 1B0UA 1C1XA 1ESCA 1Q1QA 1U5BA 5IKPA 4QSMA 2A0YA 1WZEA 1GZVA 1FUIA 2C59A 1GNSA 1Z6GA 3NX4A 2ICAA 3AKEA 1BMTA 4TWBA 2G8NA 4RV9A 3MGAA 3EVZA 4EFBA 4Q48A 3MPOA 1W36B 4HLNA 4Q66C 2GD6A 3RRZA 4RO2A 3DMNA 3QFHA 3AZQA 5CFPA 1DV2A 4BAYA 4JEHA 3VH3A 1T1JA 3NEJA 4G81A 1EVJA 1E9SA 4O4LA 2N1MA 1GNLA 1XN4A 1Z5WA 3DE7X 2HNBA 3CEAA 1GQYA 2GBGA 3ZI7A 4LF4B 1UFOA 2OILA 1VKOA 3CRQA 5IC4A 1NULA 5LP6B 1VB3A 2VSYA 4ZDWA 3GRVA 1Z75A 1COWA 4J7ZA 2IITA 5E38A 4DCVA 2R7MA 5EESA 4RKQA 1T6NA 1XEWY 3JD0A 3VR5H 3DEZA 2W83A 4P8RA 5JMTA 3D7SA 2GESA 3PFNA 1A5ZA 5CG2A 3S2FA 1Y48E 1WB7A 5HA5A 1LCIA 3ZIAA 4ZODA 1E6MA 1HDXA 4AMBA 1VJTA 1FNSA 3DB2A 5FJ4C 2OHJA 4KPGA 3VOAA 3ZQUA 2HA6A 3CUKA 1DQZA 9GPBA 1SXJB 5BN5A 4WLNA 4V3BA 4MEBA 4OIMA 5ELLA 4GP7A 2DPYA 3K2BA 3SS8A 3AM5A 4CKBA 3TD9A 3UG7A 1ONNA 1IIBA 4KBFA 5DLPA 1J99A 1AMOA 2Q3JA 1JDPA 4DG5A 3WMXA 3CUEF 2MYNA 4L7QA 4OQDA 3IQEA 1RU3A 1W5SA 1EUCA 4CI9A 1HA3A 1N0IA 1KK1A 1Q7YH 4IVQA 2Q5QA 3PYLA 3GT3A 4YXWA 2V1UA 3MT7A 4JGSA 1LLDA 4H0FA 2CFCA 2ZKOA 3AG3B 3FZNA 4LWSB 3JZIA 3DT9A 4LK2A 3IMPA 3MRXA 1OY1A 2YFYA 1ZUNA 4GKKB 4OI4A 4P7BA 3ZW9A 5FPTA 3I2KA 5L3QB 2G88A 4NV1A 3K0CA 2GCEA 5ENVA 1M1YB 1NLYA 5F9FA 2Y2UA 2EFCB 3PFHA 5AVRA 3LF2A 3PGKA 4NMWA 1C5KA 3ZCQA 4DIEA 2DSNA 3NS7A 3UHOA 1Z0AA 2IF2A 2XOKG 4QLOA 1HDEA 4X95A 4TMZA 1LKZA 3WQRA 5CLHA 2ZG6A 4AX4A 2E6UX 5AO9A 3HWSA 3TLAA 2EYUA 1PNVA 4GZLA 4LOHA 2V1XA 3VPGA 1FP2A 3WAJA 1CEYA 3DZ8A 2QPLA 1ABFA 3RSCA 1UKAA 1I0ZA 1NQOA 1RVV1 4NJMB 3BA8A 4GR9A 3KQOA 4MW8A 3ZXYA 4IDAA 2BTQA 3H3FA 3LY8A 1QQTA 1CZOA 2DUNA 2CXOA 5ITZA 1V8PA 1PCXA 2YWDA 2W90A 5JALA 3IUSA 1Q6YA 3B6JA 3ERCA 4EQZA 5EUCA 3R3SA 3D5EA 3PFGA 1E0AA 1MKYA 4Z3DA 2PX8A 4E1VA 3B8NA 1B2RA 3OEHA 1XD8A 4CV2A 1TJNA 1J2JA 2HV9A 1WB4A 4ZXPA 3D8TA 4M0LA 3IDOA 2LZ0A 2OUIA 3B38A 2OT3B 3GF4A 1MT0A 2Q5IA 4BIOA 1R7RA 4U4AA 2ADPA 2IAFA 1IN6A 2YV2A 3ETJA 1PTJA 4R7CA 1OIXA 3W6ZA 1P7VA 4G0VA 4GPTA 3GEHA 3CLTC 4PG4A 1X1EA 1T8UA 2J6BA 1FDOA 2HRDA 3FOCA 4RD6A 1USGA 1MB4A 3ZDXB 4BQSA 2R62A 3OFNG 3G2LA 1OROA 4AMYA 5C8XA 5HDQA 5HM6A 3CPWF 1IZ7A 5DX0A 1Z0UA 3KKMA 1SUWA 3KJQA 2O8VA 2OECA 2OXRA 4QOEA 2QR2A 4TLBA 1I3KA 3WKBA 4P4UA 2ZJAA 1FFXA 4FYMA 2Z43A 2EHJA 1KOGA 1EFDN 2ZBQA 2Q5OA 1Y4MA 1ECBA 4Y2HA 1WP4A 2VGNA 4CQMA 1MOQA 1YDXA 4FR2A 3N2YA 3KXLA 2ZRMA 1QHNA 4MV1A 1BE1A 2QWRB 1Q0LA 3UAVA 2WJWA 4TTVA 4XVRA 4QYXA 2K1SA 3CMCO 2Y4OA 4WXYB 5TV2A 1QG2A 5HWEA 3TLEA 1PI3A 2V96A 1KI4A 4QTTB 1RACA 4URFA 4UFOA 1HZZA 1I2ZA 1N57A 1TM5E 3UB3A 2IFTA 1YTUA 4IFBA 2C78A 4GICA 4QBIA 5LD2B 2VWHA 3D01A 3S1AB 2PY6A 3TRFA 3DMTC 1P7CA 1T2VA 4EELA 5CB4F 4FT4A 4LECA 1YJBA 3AV3A 1AUVA 1C1HA 4PC2A 3A0BZ 5FHRA 3RANA 5BSHA 4O6VA 2WYOA 3CZRA 4ZMBA 4CHGA 4ZT3A 3NGLA 5KB3A 4BZXA 1XWWA 1J5EB 5IRCD 1M76A 2HI0A 2ZBFA 2W6ZA 4QG3A 2X2EA 2ID7A 3HDJA 1HNNA 3C6QA 2ETNA 1MC5A 2HKOA 4WE3A 4ZHQB 3C8HA 1GXSA 1JKJA 1HXHA 1R0WA 3QU9A 1VQMV 2Q7OE 3UJ6A 1D4ZA 2QBYA 3Q15C 3UCEA 4ACBA 1BO6A 1EFVA 3H83A 3SGLA 4NS4A 4PYIA 3Q88A 3RUFA 3SBOA 1AO0A 4P4SA 2NQ8A 3AG1B 2X6BA 4IAOA 5FPPA 3U49A 5K45A 1T0BA 4BTVA 2ZRNA 3DQQA 3VPFA 4DR5O 4JI6B 3DF7A 1FZQA 1QCEA 1Q82H 4XIIA 2ZRJA 3HTNA 1A97A 3U7EB 3EHDA 1OYVA 3RNOA 4CBCA 2FU5C 2GAJA 3PFWO 3I6YA 1XTIA 1G3RA 1E4YA 4PDLA 2AFHE 3GGCA 3MWGA 1JSXA 1YQTA 1WM1A 3ZNQA 1DJLA 3WZMA 5H7XA 1ZVJA 5ICSA 1UPUA 2ODAA 2ZYSA 3RIXA 4BKQA 1VPLA 4WW0A 1FLAA 2EW2A 3LG2A 3UMGA 3M99B 5I47A 3AESB 4CBVA 2BGGA 2CJWB 1W76A 1WD7A 3HP1A 4P5EA 4Y9RA 1KRHA 3A2LA 3FX2A 2D5AA 1M6VA 2AMFA 2O6HA 3LUJA 3MC1A 2RHCA 3ENWA 4RZIA 1UOEA 2XNSA 2V0CA 4C4SA 5LU8A 2VHQA 2PEZA 2NUTB 3UGKA 3WLEA 1PJ3A 5D6NA 1CB7A 6Q21A 1IOLA 4C6HA 4KOEC 4F4HA 3FPHA 3H8JA 1WHSA 2CN1A 3AF5A 4U3FH 2BOCC 3S0WA 2B2CA 1IWBB 5DHSA 3L49A 4ZPXA 2R48A 3LNNA 3THWB 3WDSA 5AJYA 5TVGA 2UXDO 4P38A 1Z0DA 4P7KA 2DOKA 4ZCRA 3RUCA 4UD2A 2L0XA 1ZWZA 1J8QA 5IJAA 3PL1A 4M3NA 1T6YA 3K1AA 4J0DA 2BIFA 3K9SA 2V5AA 1UP4A 3CSDA 1CY1A 4K8RB 1DRWA 3CJQA 1Z2CA 4HNTA 3SYQA 3QIVA 4Z9FA 4YASA 3AEXA 1I5XA 3PHBE 2ZIUB 5BR8O 3P9KA 3AVVA 4GOND 1XHOA 3DUFB 2XE4A 5DSXA 2B69A 1L5FA 1AXRA 1JHUA 1G5TA 3QLUA 3U4CA 4WK4B 3U3DA 2XKBA 3DXRA 3KJJA 1ZW6A 3VHQA 2I8LA 1X25A 1FFBA 2FPPB 4LXIA 2QRHA 5EGSA 3L9DA 1JHOA 2O2JA 3UOWA 4JBWA 2XCIA 3X1WA 4KKXB 3PXXA 1JFTA 2X2PA 1PKXA 1F17A 5HPYB 3S0JA 1A3CA 5EZ6B 3OZRA 1R3LC 4E5NA 3HFSA 3HCWA 1X2BA 4AJ4A 2N48A 1QH8B 1K75A 3CIOA 2OTCA 1ECFA 3CA8A 1P2SA 2YZNA 1JE1A 1TF2A 1X8KA 2ORIA 3RIHA 5EAIA 3Q3IA 3AY6A 4IEIA 4MVJH 4DRXA 3SDBA 3KJIA 4LW8A 5JDCC 3X1MA 1NBHA 3BFKA 4U2EA 4TVOA 4FUTA 4LRWA 4CV0A 1YK1A 1QC5B 1S3JA 2VATA 4DNXA 3D7KA 3LPAA 4F2HA 1E6UA 2JCSA 3G8CA 4NI5A 1NUQA 2H4HA 3OHSX 4WK6A 3H1EA 1GD1O 4LV8B 1XP5A 4U0JA 1R0RE 2O2IA 5JJ5A 4M1OA 4YQEA 3UA4A 5C7OO 3FYTA 2BEVB 3LXXA 3CGGA 4KU4A 1JLHA 2A30A 4XEUA 4PA9A 4DQKA 2VOJA 5ULLA 5LXTF 4X89A 2C5EA 1JIVA 3CR3C 3TZBA 3F0FA 1C9MA 2UYYA 2R5WA 1OFUA 1MZEA 3VQYA 1UK8A 3DLTA 4X6LA 4CH5A 3RVZA 4L1KA 4QGSA 3T06B 1KIAA 4QPJC 1G0NA 2C9BA 3ZWMA 4LYFA 4M1MA 4UUBA 3DE3X 3YASA 2VK4A 1WUTA 1OXSC 1COZA 3N8NA 4RVNA 3PJDA 4I0XB 1OLUA 6LDHA 4UM8B 3JZMA 2VDPB 4RMNA 4ON9A 1QVWA 1IC6A 4Q03A 3S06A 2CNDA 4MPPA 3VI3B 4IMIB 1X42A 3KWMA 1BDMA 5EHZA 2WHQA 4LZWA 3TRHA 3N5CA 3ICWA 3MJRA 5EWLA 2UU9B 4IXWA 3HRHA 1B26A 3DMGA 3I04M 2PGJA 3AEYA 2VF8A 2K7ZA 3K05A 1R0ZA 1HDIA 3OWOA 7ABPA 1G21A 2GHIA 3C3YA 2BE3A 4XKJA 5EJAA 2RSLA 1SVSA 2VA9A 3II6X 3R3XA 2CDYA 4MUIA 3UN1A 3FRJA 1ZMXA 1NMUB 3AEKA 3JQ7B 2OORA 2ZUWA 5BQ5A 2V7UA 2FW7A 4NF2A 2M6KA 3KTAB 3QI2A 3E35A 1TFUA 3C5CA 3ZV7A 2IYZA 3CRCA 4Q4DA 2ZTSA 3G0GA 4JI7O 4MVXA 2BKUA 2FSHA 3JYPA 3OT1A 1AZSC 3KD3A 4EYGA 3EE6A 1AS2A 5HJ7A 3GU3A 4AZ3B 1AIPA 2MR6A 3T99A 3PKZA 4AN4A 3S4YA 2C58A 4EKNB 3CF4A 2Q2QA 1H3NA 4HNQA 2RHOA 4XDLA 2PMEA 4AQYO 1G1MA 2AX3A 4B80A 1H2AS 3CPSA 3HBJA 1J09A 3M5DA 5DSTA 2E5LB 3CW2A 2A1UB 2ZR2A 1KK0A 2MW2B 2IYWA 5DLYA 5TNXA 4D3YA 4FJ2A 3OTOO 1NM5A 2EZTA 3Q7PA 1ZJ4A 1YCFA 3ZN1A 3ZY2A 1Z18A 3N70A 5MGBA 4M9CA 3IEVA 3OMWA 1VQ4F 5B1SA 4AMUA 4A73A 2XLBA 5FEUA 4S1VA 4MA0A 4L87A 2VKQA 1WX1A 5A6SB 4FSHA 4NL4H 1WMSA 2FQXA 1S4QA 2VJCA 4BFWA 1EX7A 3W4JA 2SCUB 2XIQA 3U9TA 2QM4A 5AVOA 1KYWA 3R66A 2YH2A 4D8TA 1XRQA 1F1BA 1YBFA 3LFOA 2R65A 5EMHA 3IOYA 4TX1A 1EE2A 3ZZ1A 3GBVA 2OG1A 4FDVA 1DG1G 3K0FB 2QVLA 1X7WB 1YDMA 4AMGA 3T12A 4HHEA 4BWGA 3G8AA 3DTNA 4Z9AA 4ZFNA 1YUMA 5BOVA 2DN9A 1PLKA 1G66A 2VDNB 3ESZA 3WB9A 1KY2A 3FSRA 2AG0A 4P34A 3EGOA 1KKUA 1NC1A 3CTPA 3L8YA 2VPYA 4PPFA 2JJ2D 1VKHA 5A62A 1XDBA 1L4YA 2AHOA 4AMVA 3A1FA 2V7EA 3GAFA 5F1YA 1CUZA 3VTIC 2DMXA 4IP0A 2PE5A 4WPGA 1B73A 4EENA 1TD9A 3A6GA 3JWEA 2CSLA 3I8XA 2CVOA 2L19A 2JK5C 3DE2X 1E66A 5LM3A 1EBFA 4JI1O 5A1JA 2GKSA 3PPIA 2VLIA 3PBKA 4QOSA 1LI5A 1DRKA 1QSGA 1F0YA 2BEKA 4KHPB 3WYDA 1CN7A 3KQQA 2V9ZA 2I6DA 3IUBA 3OPMA 4MPRA 4B3BA 1QIGA 2WMDA 3N76A 3DDWA 3NMUC 2K9PA 1W41A 3HVRA 2GRAA 4B6SA 3ZMVA 1PFYA 2A1TS 3SPJA 3NEYA 3LVQE 3TVDA 1KORA 3G9UA 1U4OA 1L3BA 1UOOA 4AJOA 3GW8A 3F5DA 3DQPA 3RYTC 1M8KA 4YQFA 4LX0A 1ZOOA 3IP5A 3R9XB 4TKVA 3HB7A 3K0AA 2EIJB 2Z8XA 3FE2A 4G5OA 4LJ7A 3MBIA 1ODFA 1KEUA 3P5SA 3AC0A 4AW9A 4HDKB 1V9PA 2PYLA 2GK7A 4CCWA 3CRNA 3FZGA 5EXDA 3I1IA 3F6YA 5C32A 2ZINA 2BGLA 4D26A 1BEEA 3HSSA 1ORRA 1FDTA 1UXGA 1N32O 4GUNA 3CWZA 4TTPA 1L7OA 4D56A 5B6JA 2WWIA 4R2MA 2NO9A 5I7EA 2NTVA 4M1WA 3BJRA 4GMDA 4HDMB 2BP7A 5EE1A 3OURA 1AKQA 4MLZA 3UY4A 2PMBA 4C5BA 5TX7A 2I9PA 5IM5A 2WLLA 4W6ZA 3LNTA 4M54A 3PEVA 4WNYA 1N6HA 4K8OA 2GK4A 1CLEA 1G17A 2XVYA 4JCOA 3ZV6A 1XDDA 2ZJ0A 1RC8A 2XAAA 4HPXB 4HEA6 4G4XA 3EEBA 1LI4A 3D3NA 1UWKA 2TMKA 1YA8A 4QE9A 3LKVA 2ONCA 3S8YA 2QTAA 3U60B 4EGJA 3ZWYA 1OZ0A 4G5QA 2X0DA 5L6LB 1W581 4QUAA 4B09A 4XDZA 4IHKA 4RTOA 3IIKA 4ZDIA 4V2IA 5FBQB 2R8BA 4IY1A 2QJRA 4J7KA 4MX8A 5JVDB 3CX3A 3ZX5A 1EGMB 4MPTA 2PUGA 1B41A 2WD8A 4KUGA 4DIDA 3DKKA 1RLGA 4L57A 1OXMA 3FROA 2N0SA 4KAAA 4HI0E 1LDNA 3CW8X 3C97A 5BW8A 1Q7EA 3OTHA 3OQHA 3LW7A 1E8NA 3VO9A 3WWYA 3HSKA 2PRIA 4UCTA 4PX2A 1DEOA 3KVOA 1PT5A 4IL6Z 4ITUA 2V4DA 1QORA 4J11A 1IEXA 1I4TD 2Y1CA 3LZ6A 4MS2A 3LVRE 3P4XA 1PUXA 4DR2B 4Q4HA 4AYWA 1VGRA 1FCJA 4QU5A 2WWVD 1OX6A 1MABG 4PONA 3KHUA 2FK7A 3HR0A 2PU7A 3ZI0A 4DXHA 2W4QA 3OT7A 1V5EA 4CMIA 2WPDA 1NVPB 2W98A 2C07A 2P69A 1KMIY 3HS3A 1XFAA 3FPFA 4XB6B 3SF8A 2GK6A 4K2HA 3ELYA 4KWCA 3U48A 3FLAA 2Z1TA 4ZARA 5I3ZA 2F66C 2HJWA 4FNAA 3PVSA 1ST2A 1BQZA 3SC2A 1X86B 5KHLB 2RBEA 4MQUA 1ARZA 2IYSA 4DLWA 1J7HA 4ITRC 3SQXA 3E9ZA 3WE7A 3S8EA 1W30A 4PA7A 4GKVA 3EK2A 1NIPA 3P9YA 2BO1A 1K6XA 1WEKA 2FEKA 3Q3VA 1CUGA 5BSGA 1X7YB 1A69A 1B42A 2XPCA 3BWYA 2QPAA 2IBMA 4TQ9A 4D81A 7MHTA 4YRMA 1TO6A 1RWPA 1QZTA 3L1JA 3L8HA 1EVLA 5HKLA 3EG9B 5EWRA 3HN6A 5T41A 1TX4B 2FN4A 2CW4A 3OMXA 4QXPA 4JB2A 3HM9A 4DQUA 1MO2A 4ZU6X 3E48A 4N0QA 2YEVB 1OU0A 1W9HA 2XWJI 2MSWA 2WU1A 3RQIA 1CD5A 5ADHA 1ZD3A 1YJWV 2ERYA 2F67A 5A5GA 4DIUA 3H4TA 2GSWA 5COBA 4I1SA 2PA0A 1X39A 4B7ZA 4MWBA 2D2IA 1WNTA 3O85A 1N2HA 3WLNA 1L4UA 1GAEO 3BL8A 4R81A 1KJIA 3M89A 2EL7A 4G28B 2PS1A 3DXXA 2F1MA 3KM0A 1SXIA 1LF0A 4FFBA 1SOVA 4MRAA 1JCHA 4MQFA 4FYXA 3K96A 3GPBA 1SBYA 3T5AA 1GTL1 2V98A 4HNRA 5B1IA 2XUMA 1X1TA 3LKZA 4ECAA 4ZVVA 5L3ZA 3GV0A 2YCBA 2GCOA 5AM4A 4JAAA 3A04A 3IT3A 4LHSA 4HDNB 1CUDA 3WGYA 1KYOF 1R5NA 4R68A 3CVJA 1SVUA 3V4OA 2OCDA 4IJQA 4AJHA 4D4HA 1XVIA 3E9RA 1N3YA 4D4IA 2A9HA 2JS5A 3I2FA 4R69A 2D54A 3N6VA 3WWOA 5C34B 2PTGA 1XMVA 1Y98A 4I50F 5KINB 4FTWA 5IFKA 3M2PA 2HD4A 4QOJA 2LW7A 1M56B 3D8BA 1XRNA 3ZU6A 5KIAA 3UJCA 4YDQA 1SUFA 1MRNA 1N2XA 3PP8A 4RULA 4ZDKA 3LBIA 4AFNA 5C8YA 1D7AA 1QB7A 5K0FA 1J0EA 4RJLA 3M2TA 1DAMA 3E84A 2C84A 2P9GA 2GZ2A 1I94O 1PZGA 4L72A 1CS0B 3LHFA 4IYJA 1PZXA 3TCKA 4CEHA 4RA6A 3V1KA 3CCJF 1JHVA 4JB3A 3O65A 1OVGA 4PU0A 1SZJG 1F2TB 4RVCA 2Z5VA 4OLJA 1POWA 4N23A 1W75A 2AIRA 4X45A 1ND5A 3A1UA 3DB1A 3ZGLA 3DBVO 1DJNA 1LRJA 2RGNA 4OXYA 3ETQA 2V4MA 3T1QA 3IULA 4UOZA 4B3MO 3OM3B 4I5GA 1NNUA 1SDSA 1XSEA 3D6VA 1PWZA 3QJGA 2O14A 2RGAA 1OJ7A 3AVWA 3TL2A 3E4CA 4ZI7B 2IV2X 2UVPA 2Q1TA 4YYZA 1C7FA 4Q7EA 1FFSA 4QECA 4KV7A 2RHHA 2WWXA 4E11A 3VM6A 5J3JA 1DFHA 2DJVA 1GSAA 4ZCIA 2FDXA 2FPXA 3FYUC 1XAJA 2XI4A 3AK2A 2VZ0A 4KX3A 3AY3A 3NDIA 1KYQA 2NUAA 4JVNA 1PZEA 2DUWA 2PWPA 5AVUA 1Y1KE 3KU4A 1RSOA 3WTCA 2O5EA 5H1YA 4ESEA 3AG6A 1X8LA 2VWGA 4N21A 3GROA 5E95A 3SSMA 2VL7A 4C88A 3R3HA 4RWUA 3BOSA 4W8GA 5ALSA 2DF8A 1I7QB 3KB1A 1XLWA 2HLDD 5K3CA 1CUFA 2IC5A 3COYA 4I5EA 4C7MA 3CKLA 4X1IB 1ZD2P 2WJYA 2W4IA 2BDUA 3FUVA 2A88A 2WMOB 621PA 3W2HA 2AQ8A 1NM5C 4Q18A 5LA6F 3B53X 2IJGX 4FZ5A 2NACA 4BTEA 4DW0A 2CCJA 3M4NA 2J6HA 2O8FA 2NYVA 3MHPA 4CLXA 3CPHA 2IUYA 1BHSA 2OWDA 1V54C 5JRDS 4TYWA 5I4CA 3ZWKA 1HDGO 5EJ4A 2UXBB 3UFXB 3W3ZB 3GZTB 3ME5A 3I2YX 1XZBA 4NFLA 3TZLA 5EJMA 3GVCA 1SC6A 4ZV9A 1E2JA 2WTXA 5DI3A 5AJZA 1QGYA 3R41A 4DIKA 4H1WA 4JA0A 3UQ8A 4ZYYA 4RJJA 2P2CA 4WUVA 2JEYA 3L18A 4B6GA 3GAAA 2AKAB 3GFQA 4HVLA 2H5IA 4B5LA 4NK5A 2GPAA 3HO1A 4JFAA 2I29A 4DR1O 1E1RD 2I6SA 4IDGA 3W90A 4LC1A 2AF4C 4KI7A 1ZU5A 1A4IA 4UZFA 3TZQA 4CMHA 1S4MA 2NMUA 2PGOA 4DR7B 3AG7A 3E9QA 3GR6A 2DETA 4ZVQA 4G9GA 4HBZA 2ZDGA 4JI3B 1PSZA 3FBWA 4LH7A 1RE0A 4YMHA 3L8FA 4J16A 4QJFB 1PG0A 2V3WA 3ZIAD 2GHYA 3TBKA 4IH1A 4ND4A 1G98A 3CEMA 2E76B 3FFMA 2PKEA 4PHHA 4DJEC 1WMFA 2OBYA 3EGVA 4JD5A 1QKJA 2EG5A 4MAAA 1BRMA 3IPYA 3GGJA 4L4ZA 2B1QA 4ID3A 1X92A 4D6XA 1GITA 2FTKA 3HLYA 2HBYA 1RLOA 5IKOA 5EWMB 4FK8A 3RAPR 1EFTA 1PS0A 2GPJA 3LBHA 5K0CA 3T7RA 1XTKA 3FUXA 4MKZA 4FXPA 1FFCA 4C4WC 3LC2O 1T26A 2Q1WA 5GZ1A 1V4BA 2W6CX 4MVYA 1H4TA 1AF4A 3H1LH 4WNCA 1OCEA 2XWBF 4F0JA 3MFQA 4L07A 5C35A 5BNFA 1LC3A 2D4AA 2AFHB 4MPJA 4EA6A 1GEGA 4Q34A 2JGKA 4PSDA 1ODSA 3EH2A 3LDEA 2QKSA 2Y0DA 4F6CA 1QJCA 2EIMC 5ED4A 1J6UA 3EIEA 2QYTA 3V1MA 3OQIA 3L40A 3HWX1 5G0WA 1VQVA 1T29A 1RRCA 2CL6X 1LBHA 1LQ2A 3FAKA 4ER6A 3CINA 1CRLA 3H2IA 1TJ3A 2IHTA 3PC2A 3NTXA 4CQNA 1XBTA 1XU9A 3D3EA 4CQJA 1KYYA 1VCMA 1LW7A 1YR6A 5B3LA 2WT4A 1Y76A 4WH0A 2J0VA 3RT9A 2EJ7A 3IQXA 2NO5A 4OF4A 2PLWA 2X6RA 4EBBA 1BROA 4H1VA 2RJOA 2O52A 3IIIA 1M2VB 3AEQB 4UEJA 4POAA 2CYAA 3LGAA 2Q4TA 5IFLA 5CHYA 4K88A 4RCZA 3RFFA 4L8GA 1P1JA 4WF9V 1PLLA 5FBRB 4LYGA 1OHHG 4ZHSA 2G80A 1JG7A 3AUFA 1RXEA 3N86A 4NH4A 1TUIA 4KC0A 7ADHA 2H52A 4TUYF 3EF3A 5B4VA 1G2IA 1U94A 4BY9D 2HCBA 2HQRA 1CUSA 4DQXA 3UH0A 1I5OA 5B6IA 4DC1A 2F95B 4YV0A 1CFJA 4IYHA 5BUCA 1O9BA 3DC6A 5C1IA 3CNHA 1RIFA 1LFDB 1V1RB 5HFLA 1ULBA 1O6CA 2XMZA 5EHQA 2MSLA 1XRPA 4TMTA 3D1JA 1AC5A 1BDBA 2GO7A 3CZCA 3UGQA 2IHUA 5AHWA 4CG2A 2EULA 3VZRA 3ZHSA 3LW8A 1HKHA 4F21A 3DE4X 3ZHXA 2OZLA 3M6XA 1BS9A 3NYQA 2ZM6O 5GW7A 2JBWA 3MDSA 2EQBA 4OOFA 1UC9A 3PB3A 4HQ0A 5KVQA 2YNMD 1HNXB 4QPDA 1HE4A 3EF1A 5IJ9B 2QTHA 2AMJA 1DIGA 4EZEA 2CHTA 3GFFA 3I6QA 2ZP1A 4NNOA 2ZYIA 4UM5A 2PYJA 2XQGA 1P0PA 1JT2A 3GDFA 2H2IA 4EHLA 4QTUB 3LA6A 3COZA 2QMYA 4I4TA 3MTJA 4B3GA 2YJ3A 5CVUA 3E3OA 4L76A 1P45A 3R4VA 1PZNA 1QVGU 4B3IA 4UUAA 3RSGA 3U37A 3RAFC 2JDIG 3TW8A 4UVAA 2VJNA 4TLEA 5D1NA 1NQAO 2PL9A 2NN4A 4MO9A 1HSOA 3R7FA 2IS4A 2A0KA 1R6TA 1YZ3A 3NJ8A 1E5DA 4MNTA 1HE2A 2YN4A 3R7AA 4FOPA 2YRFA 1MOFA 2QN7A 5C5EA 1M57B 3TZEA 3ZNNA 4N01A 4IUYA 3QY0A 5NULA 1VP9A 3GD7A 1LV7A 1IG0A 5ESRA 1HV8A 2PEYA 1WIWA 2ZAYA 3S27A 3ESRA 5KPDA 1OAOC 1ODIA 3QJ5A 1R15A 1KI9A 3NHZA 3WYEA 2GBPA 4D9IA 1JWLA 1X19A 2Y69B 4MWTA 2VP5A 4JSYA 4OMFG 2ZDHA 4JWKA 3WKEA 1IZZA 3EVNA 2DERA 2QEXV 2PHNA 2RGXA 1TA8A 2H92A 5E3IA 4Y2YA 1S7GA 1ULZA 1AU9A 2HWWA 3PDHA 1Q14A 2WUFA 1GCGA 3H1HH 2LWIA 3NANA 3NBUA 2O5RA 2DBZA 3RLFA 5I9NA 2HLDA 3CN9A 4KB5A 5EE3A 2HLNA 4ZALA 4M0KA 4ZAFA 3TTYA 2JFUA 1TKBA 1JA9A 1EXWA 1OSNA 1OWPA 2CLOB 1EM1A 3E82A 5DX1A 3P9RA 3DVLA 2QB5A 3EISA 2D6FA 1QH1A 4RFVA 3HI6A 1WA5A 1ORTA 4LYDA 5HS4A 4QGPA 2KB0A 1AXEA 1KY3A 4LWSA 5H9WA 1G2QA 3EULA 3AMVA 1W2HA 3WLJA 4W4KA 1LD3A 5IT9M 1HEIA 3ESXA 5JU6A 5J1TB 3WU2Z 1M1YA 3DYVA 2JFYA 1SBIA 1XNRB 4L22A 3RC7A 4RKWA 1B3QA 4C43A 3EDQA 1GA4A 5BSEA 1ZGHA 5JFOA 5JJBA 2OD2A 4INPA 5KWIA 2IIPA 5LMNO 2QL6A 3HB4X 2J6IA 1LW6E 1D1PA 1LBQA 2X0IA 3NHRA 1AG9A 1MD9A 2YS8A 3OC6A 1J33A 2M6SA 1ZXLA 2F3QA 4Z1VA 3AL3A 1YAJA 4KJXA 1P2VA 2I03A 1BJTA 1I9GA 2WE8A 5BQ3A 3K79A 3KKKA 5KHIA 2BKAA 2H18A 1VE1A 1EWVA 2Q5HA 2DR2A 3TVYA 4P32A 1E1RA 1K4CC 5KNLA 2HXSA 4X62O 3QW4B 1BMDA 1V3UA 1W52X 3R77A 2WP0A 4G5YA 3WP1B 2IIQA 1Q7CA 5CEJA 4H1TA 4QULA 5JPDA 1KO5A 4BT4A 1HZJA 3E05A 4TSFG 1XB2A 3UMBA 4FDUA 1HNZB 1K5DA 1UBLS 1DBWA 1FP7A 1QFSA 3GRCA 4XEHA 5DE3A 3EW9A 5E9JA 5J1SB 4NZYA 1IAQA 4IXDA 3D8HA 2O59A 4OTZA 2YZ2A 3PNKA 2DT4A 4HH1A 2O3QA 4KYIB 1YL7A 4CEJA 5JOQA 4G0QA 2BDEA 2X1HA 3R7NA 2GKGA 4XDGA 3O4GA 5L3EA 3S0HA 4UNSA 3W77A 1OZGA 1SBTA 4S3MA 3J7AR 4P7FA 5LXTA 3ZP4A 1RBMA 3BD8A 4A0FA 2I1LA 5FFNA 2YHSA 4LVCA 1IZ3A 3SBDA 1UK6A 1C3EA 4X0EA 2O19A 2AG5A 1D6JA 1UBFA 3H6GA 2PLNA 4JOQA 1PV4A 1GL9B 1XO1A 1LWOA 1OB5A 1A9XB 1C7QA 5JD3A 3L7DA 3AGPA 1YI2V 1QJ4A 2I34A 1HP8A 4HNAA 4A2QA 2Q9AA 2Y4NA 4ZCQA 1USWA 2QTLA 2WDZA 1P1FA 5H80A 4RAOA 5H5NA 2QG4A 5TMDA 5I4BA 5FL3A 2Q0AA 2JNWA 2E48A 1NW9B 1ZVQA 1PU2A 4QPNA 4DJJA 1G8HA 1NQ3A 2YJ5A 3ZMZA 2MOKA 3R0PA 2NIPA 1KFBB 1QX4A 1TPYA 1RQGA 2AZDA 2YWRA 2B9ZA 2QM8A 1XMOB 2X7HA 3U0OA 3ZTWA 4MIOA 4KVGA 1S72V 1RZVA 2QJWA 3D43A 1YF3A 3IOEA 1LQTA 4RKFA 1SK8A 2W93A 4DA8A 3DBLB 1LBEA 3H5AA 4AVYA 3AFHA 2V9PA 3T2MA 5J5VA 3UJPA 5CB0A 4KQKA 5BT8A 4AHCA 2HSZA 1GO0A 3ZTYA 1GV1A 1HRDA 1F3LA 4R2WA 1F06A 3RRFA 2Q0OC 1T43A 3M8AA 1XLUA 3QU7A 1TIPA 2VJQA 3CCQV 4X6XA 4LJYA 3HM2A 1YRYE 2HY7A 2H8GA 5HJ2A 4R8KA 1QYWA 3GMIA 4F3CA 3ZH2A 1DUIA 2BFDB 3STWA 1S01A 1ISJA 4YRNA 3A37A 2KHZA 3QVNA 1ZC3A 2SECE 4GT1A 4BJ5A 4OBXA 3RF7A 5CVVA 4G65A 2CCKA 1ESEA 5SZHB 1EFHA 4FEAA 2YDXA 3LT5A 2FSVA 2ODEA 2UYNB 2B7CA 1C9EA 3NJRA 2YYZA 1YHZA 3I9JA 4R4JA 1UR5A 1SN7A 3T5MA 3QLVA 1DEAA 3AO0B 2ZUVA 3CZ9A 4KQ1A 1EEHA 1IPHA 2IVZA 1U2RA 2WBLC 1Q81H 4C20A 5DX8A 2IKSA 4FYYA 3H7IA 2IYEA 3AR7A 5EA2A 2YNMA 4R9NA 4LF9O 3GN1A 4GVLA 4IIHA 3L77A 3MWDA 3KKZA 4ICIA 2ZRAA 2UZHA 3NM6B 1ORDA 3MTQA 2OHWA 5D84A 2I4IA 1LNZA 5FUMA 3RIEA 2HP0B 3AESA 1CJCA 3ZE7A 4RF4A 4RPKA 3WA6A 2TYSB 1R3KC 2P3SA 5D3MA 3T3NA 2W00A 4A16A 1QVAA 2CY0A 3LHIA 3RUEA 1CVLA 2XYPA 1Z7EA 4J16C 5BV0A 2AJDA 2H29A 3FVRA 1SXQA 1UKVY 3S5JA 3WGJA 3JAWB 4LMAA 5EXSA 3DZIA 5ALHA 2XNKA 4RPGA 4R1QA 1QANA 4EKEA 3LWVC 3UG6A 4NUTA 2UUCB 3HCPA 3JPYA 2ILVA 4L7VA 4Y6LA 3MD0A 3O8LA 4EKDA 5C5CA 4PBSA 3QKTA 4XFKA 1V1MB 4H18A 2FSPA 4YI5A 121PA 4O1MA 5IT4A 1XDZA 4C8IA 1DMRA 3OE4A 1ANKA 4X66B 4ZXFA 2WLTA 5FBVB 4ZO8A 1DQRA 3T7TA 1OWOA 5B1OA 4FFNA 4BZPA 1GTMA 5EP1A 4BYMA 3WG9A 5DIFA 1GGMA 4WK0B 3UV3A 3LAWA 3VJKA 1K7SN 2BM1A 2IPLA 1JEOA 2HJGA 5L3CA 4CR8A 5ALZA 5DZSA 3HN7A 5KLVH 3JZAA 2FRDC 1Z7WA 3Q8KA 1S8NA 4IUBS 4OXQA 4RH0A 3RFRA 1VECA 2C42A 5LBTA 5FV7A 2HPAA 1JQBA 4TL7A 2YVUA 4D9JA 4ARVA 4PYLA 4FLEA 5JQGA 3TG2A 3T15A 3COJA 1ECGA 1JEEA 2OTMA 1XL0A 2GLXA 3EVBA 5IN4A 3K06A 4HZUA 4N5HX 4KPYA 2A3QA 5C1OA 3SYLA 3SZ3A 2D5BA 2IGBA 1C9DB 1TLFA 3QX3A 3CX7A 3MW8A 1YQNA 5LP6F 3S2UA 3UB2A 3TR6A 4X63A 2FW6A 1K6IA 1WWKA 5HKAA 2X6CA 1AB3A 1DIBA 4BO4A 3KT0A 4M0DA 2PZLA 4LFCB 2H54A 3RIMA 3DL7A 5JJKA 5E1OA 3PQ5A 2MMGA 3I4LA 3HB1A 2J3LA 2ZWMA 5KDOA 1TMKA 4H7DA 4ZAVA 4EUHA 1H1TA 1YA4A 4E2LA 2AMTA 4PN7A 4A0GA 1FTYA 1MV5A 1AKMA 4PLHA 4NR1A 5TGDA 2QGZA 1QM5A 5KDDA 3K30A 2QJFA 4M89A 4UQOA 1P9WA 2ZRDA 4OFWA 2XB2A 3PKJA 4LF8O 1V55B 3LYAA 1K8QA 4DSZA 4B45A 3HGQA 5MN6A 3AX6A 1TM2A 3IIEA 4RQBA 2AW5A 4HAMA 3ESJA 3LT0A 3PLNA 4B2YA 5JO0A 5DLQC 1BMFD 3NRCA 1L5GB 1ZO8A 3BB1A 1NI8A 1FSFA 1XZEA 4PC3A 2R8XA 1YQWA 5CAEB 4BVRA 1QQ7A 5HM8A 3HR8A 5THKA 4YLEA 4V0OA 1AJQA 2OCXA 2XXBA 3OCCA 4KEAA 1W4ZA 1E2FA 1SIWA 2JEZA 3MN1A 1UF9A 1KEZA 1VPEA 4CKYA 4MVWA 5JXHA 1G8JA 1XVTA 3Q4HA 3P2MA 2E5FA 1VQNF 2D8MA 4GI3A 4NCNA 3CM0A 1UL1X 2ILMA 3OIVA 4OBWA 3I9NA 1Z9BA 3GMDA 2AHRA 3EXIA 1OAAA 3LE8A 1M5IA 3KUKA 2NX2A 4LY3A 4CT5A 1FFEA 1B3RA 3NH6A 2DEUA 1L7NA 1W4CA 1Y74A 2WHRA 3UM9A 3AGQA 1OIVA 3D5QA 5FI1B 1IK4A 4CZZA 1JFLA 1JU3A 3HZRA 4OHZA 3G2IA 3D7RA 4MSUA 3BILA 3LSSA 2H4WA 2JJMA 2ORWA 3X43A 5JR3A 4RNCA 3IALA 6ABPA 3QPWA 1FL9A 1SG6A 1ZXBA 4Q1DA 1FB5A 5HZGA 3I42A 4RO0A 2HLHA 1VJCA 3OJXA 4UHHA 2N04A 1UPCA 1R66A 4RL6A 2Q99A 4M46A 2PQMA 4NLLA 3LHKA 1HG1A 3IAFA 2AC7A 1IPEA 3BHJA 4N0EA 1LJLA 3HLKA 1FX0A 3KYCA 3KYBA 3P0HA 3DZFA 1A8HA 2ZREA 2X5JO 4KRFA 3QPVA 2D1FA 4I1RA 2EWCA 1C7JA 2GPBA 1TM4E 2R2GA 5DWDA 1XA3A 3O5AA 2C92A 3RFVA 3UHFA 4YT2A 3KKYA 3PDCA 1GL7A 3CC2V 1YQQA 4JQCA 2C8VA 2B7BA 1ZMRA 3IILA 2AS0A 3SKVA 2LO1A 1P62B 4HL6A 2HJFC 4GIBA 3PQEA 4P2GA 4ZYXA 3T1TA 3J81k 4OATA 1X9GA 4YRDA 3IH5A 4DLNA 1NW3A 3BJIC 2R68A 4ACAA 1A0OA 1TOAA 3SBXA 3QWAA 1E6KA 1NZ6A 1UKYA 2XXAA 3A1VA 2OR3A 2B3DA 3FDZA 3F4LA 2WF8A 1H2BA 3SLKA 1KO7A 4GS5A 3G2HA 1QE5A 2H2FA 4AXXA 4ZHVA 2AOUA 3HEBA 1DFGA 2Q29A 4QDXA 4QUIA 1EUQA 5K1PA 5J2UB 4F45A 4HP8A 1L9XA 4OJMX 2CE2X 4MRRA 1PQYA 2NU6A 4MUYA 2PT7A 4ZI5A 4XIFA 3W79A 2ODQA 1K7FB 1Q77A 2QZSA 2EIKC 2Q6LA 2H1HA 2NLJC 4EEQA 2FN3A 2G07A 1IU9A 3OGCC 5KOJA 1VL0A 3MTAA 2G77B 2VHCA 5H16A 2PF4E 4HX2A 5SYMA 1M1ZA 4M49A 1NLFA 1IBCA 2Z6VA 2WPDD 4BO5A 4RKEA 4UU8A 1LLQA 4J3FA 3UBMA 4Z9YA 4OGFA 4OK5A 5IBCA 2X7RB 5A02A 2H11A 1NY5A 5CVEA 1GO2A 4CG3A 4C3OB 1Q90D 2RK4A 1FNMA 3KVYA 1Y7PA 3IP3A 3IEMA 1WP9A 1FS5A 3H65A 5CB8A 4RQTA 5FOQA 2QRGA 3ISJA 3T54A 2XX3A 2BN4A 1D4AA 2AJTA 3D7NA 2C2WA 4Q7KA 2V54A 2ZXFA 4GRDA 2JBAB 1YZNA 5BSUA 3KNZA 1ZINA 5G0UA 4I50A 5F3DA 5DBFA 3W05A 1EINA 1GH6A 4E2WA 1PAUA 3SPIA 3SVLA 5C53B 3GYQA 3DT8A 2ZI4A 2HQSA 4QQFA 1Q7YW 2FR8A 3G13A 3DNMA 3QVGB 4E3ZA 4GF5A 3EPRA 5C7YA 1RHJA 4ZHQF 4RBNA 2V97A 1AROP 3KT6A 2O1EA 3ELDA 1IDOA 3UMRA 3GT7A 1Q8IA 2FMLA 1Z4LA 2B8NA 1CIVA 2IEDA 2VTBA 1M66A 1TK9A 4F8EA 1RJGA 1DCKA 2CWWA 3BBPA 3K9NA 1CK4A 3OPVA 3KT8A 4JI5O 1G6OA 3OLYA 3ZWNA 3BIJA 2FMFA 2WHYA 3C87A 2XUOA 3D8CA 1DEXA 3VC7A 1MVNA 3QNEA 1NF2A 1KZ4A 4K9DA 4EAQA 4H31A 2Q4BA 3RI3A 4BNHA 3RYIA 3K0CC 1F51E 5E1BA 4S1NA 4AJ1A 3QH4A 2N42A 3DSQA 3NHYA 3MUFA 4BMCA 3VYSC 4GOMD 1HO3A 3QO8A 2H5JA 5CNIA 3R9KA 3ZHYA 4CR7A 1E4EA 4DMGA 4JV5O 4L8VA 4OQXA 4V3CA 3CEJA 1Z68A 2XAUA 2O6LA 4UQLA 2Q9LA 4GP6A 1NLMA 3RRJA 4WZBE 4MW1A 1BX1A 4RF5A 1KEPA 4OH7A 3A1TA 1U1EA 2GF2A 1IXSB 1YEWA 4ZHWA 5KTNA 2JI4A 3L7CA 3V8VA 1QK3A 3OIUA 1I6LA 1P5RA 4KK3A 2JCBA 1AOXA 2F3PA 4ZRNA 1L0BA 1U8UA 2B34A 1OPXA 5L40A 1LPMA 3QTYA 3DBIA 4WFJA 2YUTA 3REOA 4KXLA 3MOGA 4CKZA 3LZCA 1AS3A 4Q4AB 2FGJA 4TWKA 3BMXA 3THYB 3UICA 3F5MA 2GYYA 4S0XA 4KV9A 1WXIA 4N5LA 4KITB 5BYBA 1RLMA 1HE5A 3GH1A 2WK1A 3FI9A 3E8FA 4QX6A 1J7KA 3Q8LA 4YCNA 1WDTA 2D5IA 3I55V 4UCUA 3ZI4A 4U5QA 3QNMA 1IUOA 1LQUA 4LFBO 2PX5A 2FSVC 5J59A 4I55B 2OCKA 1X0VA 2ZJ3A 3LUAA 1L7AA 2QHXA 5LA6A 4AO6A 3QLVC 2GN4A 3AEIA 1DLBA 4PFQA 3U19A 4KPFC 1LDBA 2C20A 2QX8A 3DCIA 3L8DA 5C0OE 3IKVA 3U26A 4MKXA 1PTJC 1N25A 3CE2A 5IAGA 2X6AA 1BMFA 2YNMC 1VDMA 3ICQB 1MV8A 3GJZA 3DTVD 1CUUA 1CXZB 2B35A 3K04A 3RWBA 3V4VB 1OYYA 1Q1BA 3GLIE 1WB5A 2R6GA 4EX7A 1Z22A 2CBZA 1EWTA 3SXUA 3F1KA 5JNTA 2J9FB 1P73A 4K9KA 2GN9A 2CNLA 1Y8ZA 1SZQA 5LJLA 1CJMA 1Y8RA 1I8TA 5JFTA 1R1DA 3L6EA 2C3PA 3ONNA 2WF9A 3WAGA 4JC4A 2VQEB 4Q7QA 5DCYA 1JQDA 3WQBA 3DWFA 4C4OA 3OIGA 1E94E 3LK6A 4KYTA 4Y7CA 3UKJA 1TF5A 3DFUA 3MLBA 1VGVA 3OPYI 3MCUA 3OZEA 1GFIA 4EABA 4G0YA 4D8WA 3HKCB 4F85A 1P75A 2HDWA 2MIIA 4BPRA 1HZZC 2A5YB 1QHFA 1E1QA 3K94A 2LCFA 2VBGA 1FYEA 4WADA 1JNYA 1Y5NA 1V96A 3REQA 2JF0A 2QQEA 1E61A 5CDSA 4HN2A 4CFSA 2AFVA 1Y9EA 1GQRA 3S0YA 3QEMB 4JBXA 1Z6TA 7AT1A 4EPWA 1PV1A 2QNRA 3ABIA 5GZ6A 5BV8A 4AKSA 2YY7A 1H48A 1UM9B 1BKYA 1CY4A 5A2QM 1Q15A 1I4DD 2X6QA 2PY5A 3MEQA 3TFQA 1DAFA 3I5UA 1GP2A 4PDMA 1HTTA 1WDWB 4PO8A 4RZHA 1V41E 4Y6RA 4LN1A 1U8TA 1N36O 1EFKA 3LZDA 1LV8A 3PUWA 3WMRA 3B1VA 2YEVA 3J81M 1KS2A 3AP2A 3ONDA 4A36A 3RM3A 2GZHA 5EXTA 4E6EA 1JWAB 2HHJA 1Q82W 4IZIA 5DXJA 3HCAA 1TA4A 1GEEA 1MSDA 2PWAA 3ZHUA 1SRQA 4Z6KA 3EGXA 1XD2B 3BGSA 2WUVA 4P36A 1QS0B 3P10A 4OIFA 4R54A 1GRCA 3A4NA 3FDJA 1N7IA 4JIGA 3PIDA 4MRVA 2F00A 1Q0UA 3QVJA 4Q9NA 4YY3B 4NDZA 4G0MA 1T10A 3N1UA 2AZTA 1INLA 3FYDA 4IEFB 2QE6A 3TMAA 3ZHVA 1Y7TA 4K26A 2GR9A 3TXYA 3F8TA 1A82A 1E8DA 1KEVA 2WNHA 4JFRA 1V39A 4TN5A 2EGUA 1IE3A 4LHYA 2QR5A 4AS2A 3B51X 1E0DA 3ZVRA 3PZRA 1E3LA 1NVTA 1Z4MA 4HN9A 3EXFA 4KDFA 3F0EA 5EHGA 3S29A 3EXEA 5IAOA 4JLPA 4HBNA 3V8NA 1HL3A 3B9PA 3G6WA 4QYTA 3TQTA 1XOUA 2R1VA 3THOA 4PHGA 1P6QA 1EU1A 1VSVA 2CKMA 3BFXA 3L7AA 4PPQA 4HWGA 1QR2A 2BMWA 3VFDA 3QYJA 2NO0A 2A33A 2JLZA 1Q3TA 2CHQA 4YCBA 5AK4A 1YV9A 3TGWA 5AI0A 3Q7EA 2IUUA 2DQ0A 2CJFA 2J67A 4BXOB 2W0XA 3QTLA 3VBCA 3FYIB 1R1MA 1R27A 3JQDA 2JJYA 2EXXA 4TUYA 3OQJA 1EESA 5C80A 5HS6A 3INRA 2IV7A 3ZE2B 2QLJA 4FKZA 1WDLA 4DCCA 2XA1A 1ONSA 2X0LA 4NOKA 1J9ZA 3F9CA 3UAOA 1R4AA 3RV4A 1YBAA 1N0JA 2OPBA 3DWIA 2YIJA 3JQ6A 4FYHA 3Q10A 1U1DA 1P1KA 4ZYLA 2QI9F 2P77A 2I7TA 2XTJA 1TO1E 1IQ0A 2CUKA 5JYCA 1F2TA 2P35A 2BSKB 1W35A 5ICEA 4B40A 1NVVR 2G09A 1E7WA 2FETA 5CNJA 3RT1A 3MLAA 4J7XA 1XREA 3WWPA 4PINA 4GBMA 4MI6A 2WVJA 1XN1A 4JX9A 1EP2B 4Q9DA 1E1DA 5A4IS 3T7CA 4UAGA 3AUSA 3ZU5A 4WXPA 3H1JH 1IY9A 2VXYA 3MZ0A 2YVLA 2ZI6A 4XLTA 5B1HA 3FUTA 1RBYA 3RFTA 2E4UA 1RXVA 1R0KA 4X3MA 4WESB 3QLUC 2OC9A 5BZBA 3NHPA 2H5EA 2B2NA 4GBGA 4EO7A 1KY5A 2ACEA 3OBYA 2G8LA 3K92A 3Q7IA 3BIFA 1XBLA 4Y6SA 4N7MA 5AW8A 2E4AA 3ZS8A 1GL3A 4AMZA 1NVXQ 4OHWA 1QR8A 4RIEA 4K9MA 1OXUA 4NQRA 1H4VB 3NAMA 1VBMA 1EBUA 1X2EA 3LBFA 3QXJA 4LBEC 4FZRA 5E0KB 1HDRA 4BLSA 2K7FA 1KEEA 4YMWA 1MB0A 3HJRA 3MWYW 3ETGA 3HEMA 3K58A 4DW1A 2QM3A 3JAMA 3KG2A 4UE2A 5HR5A 2VHZA 1TTQB 4WJLA 1U0OC 1EP3B 4IV5A 1H2WA 1JKIA 1LK0A 3H9UA 1W4LA 3IDZA 4RQEA 2FB9A 3INGA 4G4GA 2R1TB 3H05A 1K8RA 4K3VA 3IGAC 2OQVA 3A0RB 3NQ41 2GFQA 3K9QO 4Q1BA 4X1IA 4D0GA 4C7UA 4L4SA 4C6TA 2AN9A 4NFYA 1Q57A 3JR3A 3F6MA 2ZIEA 3FLEA 4FCCA 3QIAA 4AAYA 3HBFA 1G291 2ZEJA 3VTKA 5LR6A 4II2A 3PT9A 4MVJP 2X9NA 4DWVA 5KOHA 3G17A 3JQQA 4LHEA 2TMYA 1XRJA 3GMTA 3EVGA 4MDFA 5CIYA 1XHEA 2H7VA 5HXUA 2FR1A 3A1NA 4L0MA 3V4FA 2WKRA 2OCIA 3WLQA 5EPUA 3O9MA 3WGTA 5BN3B 1RJ9A 1Z6ZA 5IEJA 2H8PC 3T5PA 4BMVA 4XH9B 4RTKA 1W36D 1SFRA 1JPXA 2OV8A 3QMMA 1PO7A 3I45A 3IPCA 2Y1OA 3V1NA 2OQ2A 3C5VA 2QSZA 3DTVA 4IWNA 1YZVA 3FFBA 4NU8X 1YQUA 2QL7A 2OZBA 3K57A 3L0DA 4RS3A 1QU3A 1O0BA 3I64A 4F86A 2OD9A 2H0AA 2N46A 1T4MA 3QKRA 4Y0AA<