5LP6B

Crystal structure of tubulin-stathmin-ttl-thiocolchicine complex
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
publication title Tools for the rational design of bivalent microtubule-targeting drugs.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 154
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5lp6B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5lp6B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5lp6B01
3V3TA 5BMVA 4LNUA 5C8YB 4WBNB 5JH7A 2Q1XA 2VAMA 3M89A 1W5FA 4HNAB 5JVDA 5CB4A 4YJ2A 3HKCB 1SA0A 1W581 4LNUB 5MN5A 5EIBD 5JH7B 3VPAA 5J2UA 4O4HA 1OFUA 5JVDB 5CB4B 4YJ2B 5KMGB 2Q1YA 2R751 3VO8A 4EI7A 3HKDA 4E6EA 3VO9A 4KWEA 5IYZA 4O2BB 3JAWB 4O4HB 3JATB 3WGJA 4B46A 3UT5A 4F6RA 3HKDB 4O4LA 3N2KA 4EB6A 5IYZB 2BTQA 4X1IA 4XCQA 1W5EA 5KMGA 4O4IA 3RYCA 5M7EA 3UT5B 5MN6A 3RYFB 4O4LB 4F6RB 3N2KB 4EB6B 3VOBA 1RLUA 4O2AB 1TUBA 2BTQB 3WGLA 4X1IB 2XKAA 3JARA 4O2BA 4ZI7A 5MN4A 3JAWA 5KX5A 3N2GA 4O4IB 3JATA 5LOVA 3RYCB 5J2TA 2XKBA 4B45A 3HKBA 5FNVA 1FFXA 3WGKA 3RYHA 5GONA 1TUBB 3ZBQA 4X1KA 3HKEA 3JARB 4ZI7B 1W5BA 4DRXB 5KX5B 4FFBA 3N2GB 1Z5WA 5CA0A 5LOVB 5LA6A 5EIBC 5LP6A 3C8LA 5J2TB 3HKBB 5FNVB 1FFXB 5LP6C 3JAKA 5GONB 4IHJA 3RYFA 4TUYA 3RYHB 1W59A 4X1KB 4O2AA 2RHOA 3HKEB 5EYPA 1JFFA 3RB8A 1TVKA 4FFBB 4TV9A 5CA0B 4EI9A 5LA6B 5LP6B 4EI8A 5ITZA 3WGNA 3JAKB 4ZHQA 4IHJB 5IJ0A 4TUYB 1RQ2A 4I50A 5EYPB 1JFFB 4O4JA 2VXYA 1TVKB 2VAPA 3E22A 3ZBPA 4DRXA 1Z5VA 4TV9B 4X1YA 3ZIDA 5IJ9A 2R6R1 4I4TB 3R4VA 5ITZB 1W5AA 4U3JA 4ZHQB 4TV8A 5EZYA 5IJ0B 4I50B 4U39A 4O4JB 4M8IA 3E22B 4X1YB 5CA1A 5IJ9B 4U3JB 4TV8B 3JASA 5EZYB 3WGMA 2RHHA 3M8KA 3RYIB 5LXTA 3VOAA 4IIJA 5CA1B 5BMVB 2GVIA 4I4TA 4X20A 3JASB 4YJ3A 5JQGA 5JCOA 1SA0B 5LXTB 4ZOLA 2RHJA 4IIJB 4I55A 5JCOC 2BTOA 3JALA 2VAWA 5LYJA 4X20B 5C8YA 4WBNA 5J2UB 1FSZA 4YJ3B 1RQ7A 5JQGB 4HNAA 3RYIA 4ZOLB 3HKCA 3CB2A 4I55B 4DXDA 3JALB 2RHLA 5LYJB
chains in the Genus database with same CATH superfamily
1AA6A 5I9NA 4ZZ1A 3WRYA 2QLMA 2PT5A 4RS3A 4MPPA 4EFLA 4MWGA 3TNYA 4UNPA 1QFXA 1Y8CA 4LFBO 4JGGA 4EFNA 3HLYA 2WWRA 1N33B 3VR6H 3L4EA 2ZUSA 4LRSB 1F2DA 4KWCA 2VJKA 3L0DA 2HCTA 4FYVA 4B5LA 3ZHBA 1U2RA 2R1VA 2OCXA 2W2TA 4BECA 4KXUA 3E8MA 2XADA 4FFSA 2IIVA 2A2ZA 1X92A 4EHIA 3WX0A 2QWNB 3S0JA 5T67A 1Q82W 2YQ4A 1JXAA 3N8HA 4RKEA 4OX9B 5G02A 3VZDA 2VPWA 1US8B 4DIDA 1E1RD 2W98A 1FNKA 1Y9DA 2V8OA 4AZTA 5EHGA 1XG5A 4JA2A 2CLFB 1TK9A 1CF2O 2VHVA 4NKRA 1NFFA 4DDVA 4YT5A 3EA5A 1H4TA 5C1DA 4C2AA 4EG6A 4XFKA 3CXCU 3RC2A 4M83A 2AKYA 1BE8A 2JAOA 4IEFB 3SYQA 5JNLA 3RJ5A 1JA0A 5L51A 1FLDA 4NTXA 5JY1A 4KNYA 2G9QA 4OATA 5D01A 3ZK8A 3UT5B 1I8TA 2N74A 4N5IX 1JG4A 1JEDA 5F35A 2GPJA 3EVGA 4B80A 4B45A 3KQSA 2IW5A 4G1UC 1SETA 2K4MA 1X3SA 3PFFA 4R0NA 2GZSA 1J33A 4KQ6A 4QWWA 5H4HA 1JQ3A 1BA2A 3GRYA 1PQUA 3JAKB 3CEPB 1W6RA 2JD1A 3T7IA 4C87A 3VRHA 5J5VA 5DWVA 2WHPA 3P94A 4A6XA 2B8EA 4P5DA 4ZCMA 3V1LA 1UOPA 2G5PA 3DOFA 1DDOA 3UO8B 2A0FA 4AP9A 4QQFA 1SZQA 2WM9B 1IZ9A 1XEFA 1XWWA 4BCBA 1QU2A 2YXHA 4K40A 3E4DA 3FYSA 1XCJA 4LI3X 4FZVA 3VR5H 1NI3A 5EIBD 3GZNA 1YC2A 1I7LA 2JAPA 3L84A 2H4ZA 2OTCA 3GFQA 2JI8A 4YB8A 4S1NA 1D7AA 2YW9A 2FFBA 1XKLA 3OOSA 1IOVA 4ZP1A 2N42A 5FJIA 5BWCA 2G1UA 4YR9A 2AC7A 1I80A 2O5VA 2EFHB 3EPRA 5CNKA 3DNFA 1VEWA 5DNAA 5H2FZ 3JQDA 4KFUA 4AJOA 1N9GB 2PH1A 5LMNO 3Q10A 1Z15A 3A6GA 1E3JA 1JYEA 1P1KA 3FYHA 1FFYA 1B8VA 3VYTC 1KPHA 3E89A 5J63A 5CCXA 4CL8A 5CCBA 4Q3LA 2ZIFA 1ZU5A 3DH0A 4HNRA 3GGOA 4DJDC 2PSEA 3GIDA 2ICAA 1O94A 4UTNA 1QIGA 3VU9B 1NAIA 3WNVA 3E20B 4C4PA 1AV6A 3IV9A 4DPKA 1SQBH 2HX0A 2V54A 2FQ1A 5IT9N 1ZEMA 4F0JA 2I7DA 1FZTA 1TLFA 4LJAA 2FEMA 3F6SA 4KLCA 1X7WB 3ASOC 4G0PA 1JKJA 1CZNA 1QWSA 1RPTA 2ANBA 4EHLA 1KYXA 4EUSA 3IMKA 3FDFA 4N0QA 1VGRA 4KL1A 1PJRA 2XA9A 2HP0A 2VWHA 3KXIA 4TTRA 2QMHA 4EO7A 2RGGA 4KX3A 1G8GA 5IM4A 2HGZA 2D1TA 4N8DA 1CY7A 4P4SA 3D1JA 2ZM6O 2F1MA 4GBJA 2QM0A 4M21A 4PXSA 4QNRA 1XMPA 1ABFA 4PYMA 3K9GA 3ZVMA 3GHZA 3VUEA 2VEDA 4G0YA 5DNCA 4GQIA 3LFOA 3CXHF 5DYTA 1X59A 4ROSA 5BW4A 1E9VA 1F14A 2ZUFA 3GLFB 3DCIA 2WFLA 3LBYA 4RLSA 5CYGA 3NWEA 4UE2A 2O2IA 4B35A 3LQ1A 4R1NA 3M99B 4GOND 2A8YA 1XD2B 4REQB 3U4QB 3EXFB 1V5IA 3GDGA 4PGMA 2G4VA 2Q5JA 2J5XA 4QYTA 1VSTA 4G28B 1P72A 1ZX1A 3LBHA 4ZAZA 5AKGA 4QEZA 1AKRA 2EW8A 2H1CA 2O2DA 3KZXA 1N32B 1XCPA 2W22A 4K26A 4EI8A 4CEHB 1FDUA 5MFPA 3JQ8B 3CMCO 1G8KA 4C0KA 4DV5B 3LYUA 4PFKA 4H7KA 3I39X 1FDRA 4EF5A 3MMXA 1NTZH 3PEFA 1JTVA 1KZ9A 3BXFA 5KCMA 5K3SA 3WBFA 2ZR2A 4XWGA 2HA2A 1XBLA 4D57A 1MC5A 2P9TA 1SKYE 1YOVB 1R5JA 3IIMA 2FETA 1UBUS 1SU7A 2WPNA 1H6AA 2ZT9B 4K9PA 4GPZA 4DRYA 1WOMA 1WXEA 4E2XA 1XRLA 4YQZA 1PJAA 3PXGA 3QTTA 4ZTZB 5CT4A 2F3QA 5B3LA 2Z3VA 4IQ0A 1UXGA 4FNAA 3FNIA 2OOSA 3GLQA 1SEVA 5CA0B 5LMUB 3C1TA 2DEUA 3TTXA 1AQLA 1AO0A 1FXKB 5KTPA 4B2YA 4HNGA 1RRVA 4ALMA 4YQFA 4P82A 4Q7KA 3KETA 4BLTA 3IHTA 4U2DA 2QWXA 1MJGM 4TLDA 4DE5A 2FSGA 4J16A 1SZCA 5KTTA 4XQ0A 4ZO7A 1SD1A 4ZOLA 3HZZA 1R0YA 5A4IS 3CMEV 2A33A 2JRLA 3KT8A 4A4DA 1LCIA 4TS9A 3ZDQA 4PWYA 4EARA 1JBQA 4CCWA 4ENWA 1XEWY 2C9OA 3CCMV 4FE3A 2PKXA 4K1LA 1V6AA 4XIIA 3TMKA 1OA0A 1DAOA 3V8VA 5LJIA 2ZTHA 1Q1EA 3VUFA 1TF2A 1ZW1A 3K09A 4IO1A 3NMUC 2H4YA 3RK1A 1P7GA 4RA6B 2VK1A 1T5OA 2XTZA 4QG7A 1SNYA 1KDRA 2G38A 2Z9CA 2OFOA 4EI9A 5FA5A 3TX2A 3C3KA 1CY8A 3Q7EA 1GV1A 4C30A 3HDYA 3TLGB 1A95A 4V02A 1UMDA 3MBKA 3JSNA 1S2IA 3L7MA 3Q9NA 2C2AA 3ADOA 3SZRA 2PGJA 1UAYA 2JKZA 3CF6R 3P32A 3NALA 3OLCX 1BSMA 1IEWA 3GJ6A 1EDOA 1A8PA 2OUKA 2NU9A 3E2MA 4IIJF 2QA4V 3GUCA 3WRVA 2H29A 1QV9A 3AL0C 5CM2Z 6NULA 1WDWB 4AJ9A 3LPMA 1QH0A 1SHZA 3EQ2A 1U7XA 4Z0NA 5HM8A 3SN6A 1U3LA 1TXGA 1SVUA 1EWQA 3FA2A 3GW8A 1ISJA 4MKXA 3RS7A 5ADVA 4HPXB 4EMTA 4EEXA 3QIVA 3ON5A 4YDQA 1GPBA 4DV4B 2C07A 3P2MA 3BHNA 5EERA 2WOJA 1VQ4F 3H4VA 5DH9A 4RMNA 5I9IA 2NU8B 3SQLA 4R2HA 4CH6A 5FYQA 1J7HA 1XAGA 1KA9H 1OX4A 1QBGA 1NC1A 3T3DA 1UMKA 1B3BA 3WWEA 2R1TA 3K9LA 4RA9A 2O3UA 2P0YA 3BHPA 2Q9LA 2XYHA 1C7ZA 3SJAA 2JEYA 4WSOA 3BZBA 3ZXXA 4LF4O 4RIGA 1B73A 4LF8B 3ZU4A 1WZNA 2Q21A 2DFPA 2A06H 5B7PA 3CBQA 1BJTA 3IOCA 4HQRA 2ZZNA 4FXPA 1HDYA 3ROZA 2DWCA 1NSFA 3U1TA 2XCTB 4QULA 3MCVA 5D3MA 3CIOA 3NBFA 3EQ8A 3QQ5A 1SWVA 3HE3A 1PM9A 1WVGA 2ES4A 4HD8A 5EXXA 1DELA 1X1AA 2Y76A 1MABB 3TRFA 1ZM9A 4BP9A 4YHHO 3IVRA 4KYIB 3FGZA 3CH5A 3OQBA 2XAHA 2Q4DA 2QSZA 4YRKA 3A1VA 4A6DA 5EE9A 3CPJB 4ZREA 2WT4A 4Q9IA 2Q6TA 2OECA 4BVHA 1WP7A 3UXEA 2R4QA 2K7FA 2PV0A 1NVMB 1Q7TA 1BROA 3VBEA 5KJ1A 3VU8A 3ZI4A 1P7CA 4MR9A 1F2UA 3WLAA 2ISQA 4JBIA 2P8JA 4PG8A 1MO3A 4LE2A 2FTKA 4JT8A 1XIVA 3UICA 1IUKA 4L72A 4U6QA 4NP6A 3E9RA 5FH9A 1DF4A 2O3QA 4JXXA 2Y69B 3TXSA 3VMFA 1XEWX 4DYDA 3QU4A 2YC4C 5C4MA 1ZWZA 2QMOA 2XGOA 2BFFA 1OV6A 1DB3A 1UKVY 3N2ZB 1EUCB 3K57A 2I8CA 1KEPA 5SYAA 2JGEA 1ZGHA 3WJPA 1CQIA 3K6RA 5EJ2A 1C0KA 1JL3A 1Z16A 2A1UA 3B2QA 3T34A 3CEHA 5GP1A 2LFSA 5AXAA 4MTGA 3DVRX 2E4VA 3DXRA 3EH1A 4DB4A 5KYXB 1HFEL 1BQ4A 4OPMA 1KZ4A 4J29A 3HCFA 3HGMA 3AT1A 1R6KA 1RP3B 3DZHA 1AJQA 2E89A 1RYEA 2CB9A 5LR6A 1K9SA 3ZIDA 1AGPA 3RUCA 1SGWA 4U7GA 5EZ6B 4X8OA 3ECCA 3SYCA 2QEXF 4OKNA 2H8KA 5KSOA 1E4VA 4D45A 3NEPX 2FQWA 3UH0A 1AG9A 4A0RA 3DEFA 1WETA 4YROA 3PF9A 1M6VB 2YWJA 1E0AA 1SU6A 4MW5A 3TRDA 4AJEA 3DLAA 5CFLA 3H2GA 3LO5A 2RNBA 2GERA 3W5HA 3KM0A 1U2DA 1LUVA 3NWJA 3KSDO 4NOLA 3AR9A 2QXYA 1RWOA 1K0FA 3M33A 3MN1A 3JQFA 5H8WA 1R4MA 2ZIAA 2MMCA 2QGZA 2HV8A 1EVQA 1UKAA 3S2EA 2EX0A 4HDCA 1TUBB 1LK7A 3WMFA 2R9IA 5KX5B 5KYWA 3LJKA 3W1EA 2IU4A 3EUEA 2MSLA 2ATXA 3QEKA 1JILA 3WLKX 4U7OA 1DO8A 2PHZA 2GFHA 1GH6A 4FDTA 1U2TA 4B7UA 2XUFA 1EE1A 4YXWG 1ZNQO 2DQ3A 2GCIA 5GIPE 1BEEA 5K8CA 4D6YA 3L7DA 2H18A 3FFMA 2NUPB 2V5AA 3SSMA 3KAPA 3COJA 1FFEA 5C8YA 3O9MA 1PR0A 2J4CA 4XR9A 3E9EA 2YN4A 1IDOA 4JYBA 1I7DA 3GCGA 5DOZA 4C3ZA 1YC5A 1RAHA 1VE5A 3KB8A 4MS4A 2EGGA 2ZYAA 3EVCA 1A8IA 5BW6B 1VMEA 2PS1A 3HKDB 1Z88A 4HNHA 5FRDA 1W88A 4HDNB 1G8MA 3FOEC 2FEXA 3E8SA 5EJFA 1NI4B 3ILHA 1C8KA 4BVRA 4RVDA 4C8EA 2PCLA 4I8DA 1G19A 4KB5A 4JV5B 4MW4A 3DT9A 5KNCA 3PRYA 5ETJA 3LI2A 2XTAA 2W0MA 3REGA 5BYKA 3C8HA 3EG9B 4F1KA 4FLZA 1IZ3A 2HMUA 4TZ6A 3A70A 4GWGA 4Q00A 3ADKA 3BK2A 1V45E 1FK8A 3N4YA 4B34A 2P6PA 1BX0A 5EHXA 2YEVA 2PR7A 4DWWA 1YSCA 4US1R 3HJWC 2VR1A 4BNDA 1NN1A 2WSLA 4NCXA 3ETNA 5GTHZ 4E15A 2BH9A 4CS3A 3W9UA 1WLSA 4ND4A 3TETA 4NFLA 5EMKA 4WJZA 4BWAA 5FOVA 1ZH0A 2Q8NA 3AB3A 3M4XA 1K6XA 4DK0A 1E92A 3QW2A 3MQ2A 4Z5XA 3N6VA 4NC9A 1FNMA 4O2AB 5JCJA 5I7OA 4HUTA 4RULA 4FM9A 3CT6A 2PQ2A 4UZSA 1M76A 2XE7A 4EFKA 1QQ7A 2Y3IA 1OFGA 2VK4A 5EJ6A 2KS6A 5B4VA 5SV2A 5HFLA 2FN8A 3WQSB 4JI7B 5LIRA 4JD5A 3G71F 2VK2A 1SBYA 4NDAA 2FJUA 3UWDA 3G13A 2N9UA 2JGJA 3T06B 2RMKB 2B8JA 1NZJA 1MJGA 1V43A 3K35A 3BXGA 1OZFA 5TS2A 3LO8A 4LH7A 1CUBA 1P4AA 3ER9A 2D1YA 4HBGA 2PX3A 3T5DA 2Q5EA 1EXMA 3FPGA 4WI1A 4IQ8A 4O5OA 4TYWA 1CZUA 4AU1A 1BOOA 3PDIA 2V5UA 5B8FA 4MV3A 2EQAA 4Q4JA 3ZMUA 1MOQA 1DFGA 3ZIAD 5CBHA 4M3NA 1BVUA 1EHIA 1BZKA 3CPSA 1ZZEA 4QU5A 1T25A 2Y0IA 3WSWA 3EN0A 1HX7A 1TC1A 3L1KA 4QJBA 2O59A 2IQ5A 4PQRA 4E1AA 3M2TA 4ZJUA 2P2CA 1KK3A 3UZUA 5DBEX 2IUSA 1MNAA 3A9UA 2OO5A 3B1JA 4JI3B 2JJ2G 1MSWD 3JD3A 4CRWB 2Z3ZA 2J9YB 3D7LA 4IIJA 5BYBA 1Z5OA 3VQVA 4JVOA 3V8EA 2ONJA 4UDXX 3HO6A 2J9GA 3LP8A 1SC5B 2P9GA 1R3DA 5DHAA 2IM9A 4LVOA 5IANA 4AQYO 4AG3A 2IXBA 3AEYA 2OIGA 3WSVA 2MSEB 1FTQA 4C0AC 2RGUA 2F90A 3IXMA 3LSUA 2CKMA 3D2BA 3CVOA 4LDJA 5JE8A 1DXOA 4LOIA 3V4OA 3QXJA 4HHEA 2P6YA 2FEPA 3MS2A 1Q0SA 1EUYA 3UW1A 3EWIA 4QDJA 1GNVA 2JF0A 4LRWA 5A3VA 4U02A 4JCCA 1ZVJA 5C2JB 3R3VA 3AILA 3K15A 5AW5A 4IIFA 4J94A 1G1MA 3CS5A 4D1YA 3H16A 1FUEA 2J6BA 1IXRC 3CX7A 1DG1G 4OL9A 3EAGA 1QDUA 3OZ7A 5AM3A 2YMMA 4UB6Z 3W04A 3P9YA 1OBHA 3QLUC 4BT4A 2V98A 2TS1A 2C2XA 2VBGA 2PU5A 3GJYA 3OLQA 2Q1XA 5JCPA 2R48A 1JPJA 3V48A 1SUIA 2OBLA 3U7QB 3HA5A 4I4LA 3UJCA 1ZI8A 3ZCTA 1NSYA 4I36A 1NVPD 3COPA 5F3RA 1YI1A 2AI1A 2QL5A 1UBLS 3GMTA 1D3AA 4E7OA 1QQ6A 3HY4A 3RUFA 3RU7A 3U3RA 2Q0XA 4GOMD 5ADUS 1XQ6A 3H8VA 4YRCA 5AO9A 3OSZA 1JI3A 2DZDA 4HN4B 3Q41A 3RROA 2NUBA 3MLEA 4CTOA 4O4JA 2UUAO 3F96A 3I53A 4IFIA 3VSBA 2WJWA 3O2SB 1AO3A 3PQ5A 4YIHA 2G70A 4KLAA 4DS3A 3VHRA 2D6FA 1FTWA 4A2QA 2J41A 4ZOEA 1V3UA 2JVJA 4D3DA 4X3LA 2JZOA 4BNXA 3W90A 1Q86W 4QQRA 7MHTA 4UXIA 4FUQA 2GBGA 2B3TA 3E9ZA 5FWNA 4JI1B 4B62A 1EQUA 4LRYA 4M0PA 4Q9KA 5A2QN 1CXZA 5CBGA 1NXSA 1NJIW 3RSOA 4F5YA 1V95A 2QPLA 3ZWAA 3EC1A 1P6UA 4BQPA 1W2HA 3PS9A 2C77A 3DFKA 4YAJA 2NZUG 3H5VA 2FW7A 1GNQA 1EUDB 1T9BA 5FL7A 2A1TR 3L3BA 5B53A 2IK8A 3G2MA 4AKHA 1UBSB 2GFQA 1JNYA 4WZAA 5HRUA 2XCRB 4MVJD 2H2DA 1N57A 4KPGA 1SC4A 4LIPD 3H5LA 3ELYA 4RE5A 5KYVA 4I50B 2NO5A 1WMAA 1C0PA 4HDRA 3CC4V 3JQRA 4WY2A 4A6PA 4HLDA 1A7UA 2PRJA 1QLNA 1M2HA 3ND6A 4UEQA 1R8JA 4DMGA 4YLEA 3PQ7A 1CULC 2GBCA 2P67A 1I6KA 2NU6A 2AHZA 4WN9B 1UZUA 3FWNA 5CEEA 1EHCA 4R40B 2QENA 4QFDA 4KWHA 4UTZA 2IS1A 3W78A 2WA2A 2R6JA 2GLTA 3RA6A 4OBWA 3W3ZB 2PT7A 4KHPO 1A69A 4Q12A 1JDSA 1GPLA 3UK1A 3ZQUA 5AI5A 1FFXA 3GJ8A 3OSUA 1O0CA 2G6BA 1D5WA 3PCXA 1ZR2A 4D0NA 2O2SA 4TQAA 1HEUA 1XI1A 3TEMA 2V6BA 1JEAA 1Y4UA 4B08A 5IVDA 1KYOF 3HSSA 1RI5A 3I5XA 2HLDA 2ILMA 3FN4A 3HXLA 4U3JA 1I0HA 5EUBA 1NQ3A 1QQCA 2E6KA 1QGDA 1MJ5A 4KO4S 1ZMTA 4YV1A 1DDGA 3AR8A 4DR2B 1GNLA 5L3EA 3TZKA 1QG0A 1YJ5A 4EBBA 5FT9A 3TB4A 2I55A 4RZ2A 3VQTA 1AGXA 2XGJA 3CW9A 4OBXA 5IULC 5KPDA 4C7JA 3S70A 4N40A 1QQBA 4O8ZA 3CKMA 4ZGWA 1L5GB 1C30B 1X0XA 3W4KA 5IKEA 3BJRA 1B76A 1NW6A 2PUVA 5D84A 4R54A 2ZRIA 5BSGA 4ILKA 2PKEA 4OXRA 2F1RA 1XV5A 3TLBA 4XPIB 2Y67A 1LI5A 4B87A 3MWEB 4EJ6A 5KA6A 2B7CA 3SQXA 3PIRA 3ZZNA 4BB9A 1EINA 4MWZA 3K08A 3G17A 5HXAA 4ZVKA 4MKGA 4YRBA 1KAEA 2POCA 2Z8XA 4GC9A 2FXIA 1R6XA 2ZIXA 1I9CA 3R7NA 3L9XA 2RBGA 3MT0A 1Q7YW 2Z4SA 2O6LA 4MUMA 2B25A 4DMKA 4GMDA 3EPKA 1M5UA 2I8AA 3RC1A 3RWBA 1QR8A 3LUAA 2W83A 1I5OA 1RADA 2DKNA 3VSEA 1Y8ZA 3KRTA 4IT5A 1PU2A 3BREA 4RZHA 4I5IA 1EGHA 3BRWA 4MWEA 1Y33E 2W6MA 3WS7A 2C1EA 4X88A 2CBXA 3FUUA 3MJTA 4IFTA 2GEJA 2GDZA 2L26A 3QEAZ 2JIZG 4TT3G 3WJ2A 2IXTA 5C7LO 4HUQA 1YS4A 5IDJA 2KBFA 2I2AA 1UAGA 3VZRA 3UUEA 3CHYA 3HACA 2P77A 2V9PA 3X0DA 2BGWA 1IX9A 2OM2A 2UU9B 2ZI9A 2G1JA 4PWZA 1W4BA 1UKYA 4Z9XA 2V45A 1N5OX 3GJRA 2AX3A 1WHSA 1CUYA 4HC4A 4FX5A 3O4JA 4RTNA 1T1EA 1G16A 3WJ7A 4TTIA 3UOAB 4F84A 2OCGA 4LFBB 1S8OA 5B1IA 1ML4A 4ZQGA 3CSXA 3BMQB 1MEOA 1TGVA 4ZQFA 2ZM5A 4BNYA 1ZVQA 1FUIA 3O93A 4I6GA 1G6OA 3NJRA 3I4LA 3A2MA 1K6MA 1KY3A 3AZQA 1DWQA 1GN8A 7MDHA 4P93A 2XCIA 1X9IA 1B74A 4V0KA 2A5YB 2DPHA 4PAQA 3CJQA 4QDKA 4PLZA 1U0RA 4N23A 1EWYA 2B78A 3W9BA 1WPGA 2I8LA 3WYAA 4DR5B 1HZJA 3BD6A 1NVPB 2C7RA 2QVLA 2DQYA 2HR3A 4MGHA 2GNOA 1ZWKA 4LZZA 3SK0A 4DUZO 2ZJ4A 3AESB 3N58A 2I4LA 2GCPA 1WPQA 3W3AH 2IYZA 1PNTA 1SKAA 3BFJA 3D4LA 4C6TB 3LXMA 5GZ6A 4EMUA 3GCXA 2CDRA 3DAGA 3QXXA 3MCAA 3ZDZB 2MOKA 2QUHA 3N87A 3C6KA 2HIAA 1EVKA 2YS7A 3ZE9A 1T9KA 1SIWA 2NTEA 2O6HA 3QX7A 2I5PO 2ZAYA 2O8CA 3FNGA 1TUEB 1FXHA 4EAAA 1D0IA 2QJOA 4LNUA 1IY2A 2X6RA 2DWPA 2XZLA 1KKDA 3EARA 3UMVA 1E1RG 4KWTA 2GEBA 3AGPA 2D0PB 1C1XA 1SKMA 2QTLA 4JVMA 4CMGA 1E5XA 1QX4A 4URYR 1VG8A 1SUDA 2VS1A 2PD4A 4JKOA 1ZHOA 2A9KA 1ZKDA 3NBUA 4R16A 1VMAA 2NTYC 3S3TA 2VYCA 2O8EB 3TQTA 2J1LA 1GFSA 4DG5A 4V0NA 3RBZA 3QENA 2O0KA 3L8HA 1DMSA 1FX0B 1S3SA 2VWGA 4MKFA 1T3ZA 4EB8A 4UHJA 4X1YB 4JJ6A 3EVKA 3VR2D 1SC6A 3QKTA 4RTMA 1T9GR 3GLGE 3KYJB 2G7ZA 3E8FA 3ZD7A 1FIUA 3H11B 4EGAA 1PNLA 2G9RA 1NJGA 1VI2A 5K3EA 4OMCA 4H3VA 3HO1A 2CHUA 4PRYA 3CLSD 3IIIA 3B4SA 4ZYVA 3BAFA 3FTEA 2I2BA 4XEHA 1TZBA 3JQBA 2CE7A 4JIMA 4AJLA 3WBBA 2ZPAA 4HZIA 4ZRDA 1ZIXA 4MAAA 4UTOA 5EE5B 3VKVA 2JL1A 5LMNB 5B30A 3JQ9A 4QDOA 4ZHWA 1YV9A 3JXEA 1JPVA 4FU0A 4QICA 4FT2A 1AQUA 2HY7A 3IFSA 2A78A 3NYRA 1LGYA 1FF9A 2NTJA 1V54B 2ECKA 4GECA 1KZYC 1RKBA 3RIHA 2WWVD 1YHZA 2AOTA 5JJIA 3ZHQA 8OHMA 5CYOA 1D5NA 3ES9A 1LVHA 3MBOA 1RQPA 3C90A 1FPQA 3RBXA 3LZDA 4EHBA 3TLXA 1JF8A 3GHYA 1V7ZA 3AF1A 5I8WA 2ZQYA 1F6DA 2FHPA 5JYDA 5LZ4A 4CKCA 3SJUA 1KAHA 1JR2A 5EJIA 4P58A 4NBVA 3LYAA 3NUGA 5LKAA 3NONA 4A2PA 1A97A 4BFZA 1SB8A 3BT7A 1YR2A 5BWBA 2PZ8A 1N2EA 5IBCA 3A7EA 1NQWA 1M10A 2PUFA 3FTNA 5GIPC 3QPVA 1BRMA 4TRJA 2GEDA 5EB0A 4RE6A 2G9VA 2YL2A 3F9IA 1N8TA 1NQ5A 4QHYA 5B7GA 3T0FA 2EQ5A 4FC7A 4B8WA 4S35A 4O2BA 3CONA 2JEOA 3FAVA 1E2BA 1B0UA 1K4YA 2ZM6B 4U3FH 4GVLA 3FPAA 3K0BA 2EJCA 4J8PA 4ZU3A 1MABG 1XA4A 4XGIA 5IM4F 3HG7A 5E9QA 4I1PA 5J9FA 2UYNB 2A9HA 1FTGA 1I9GA 2ZTUA 5KQLA 1XTTA 3WL5A 5L3ZA 1H8EA 3PEUA 2OZKA 3L41A 1Y9AA 1GO3F 2C83A 3NORA 2FP4B 4GI1A 3HPQA 3CLHA 3RBAA 5G4KB 4U63A 4HXGA 1NQOA 4L51A 2GTHA 3A25A 5HZHA 3NC1C 4C2BA 4DVGA 2R47A 4WCFA 2GK4A 4KV7A 3ASVA 4UPDA 4BNHA 1OBCA 2BISA 1Y1KE 4H0FA 1KQSU 5LD2B 3ZNPA 4JLBA 2F43B 1I1NA 1PLKA 3TE7A 4B76A 1NZ6A 3RC7A 3FF4A 3A3NA 4Q3KA 1E59A 3SJBA 2XXAA 4L0QA 4N1AA 4CR8A 1AJPA 3AVWA 5EOVA 3E83A 5TVGA 3JD2A 2O20A 2ENUA 4OHCA 2M6RA 3B8MA 3KKNA 4TMZA 4Z4IA 1W36D 3DHVA 4D98A 4TT8A 1KFKB 3QMWA 4LOAA 3FDJA 1XAJA 1PFGA 3BWCA 3HXQA 2Z83A 2H8CA 2FOIA 5B1SA 1FMTA 3TZEA 5IP5A 1N5IA 4W99A 4Z8YA 3ZP7A 2D0IA 4HWRA 1F2TB 4OHFA 4R1SA 3VJMA 2YWDA 2Z6UA 1XVUA 3MMNA 3JR7A 1OV4A 5TXGA 3N0VA 1K4MA 4NHOA 3SNHA 4DCNA 3KYDA 5DNWA 2JH9A 1KP2A 4IZHA 3VM6A 1JDVA 3HLKA 3PTLA 3WBJA 5AVRA 2KWIA 4KXVA 2WA1A 1TIKA 2CLSA 4MQFB 4OIMA 5DCLA 4QVIA 2DWQA 5E6SB 4OGQB 4BQSA 3MLAA 4Z8XA 2AFVA 1IHYA 4JFRA 1GM9A 3STUA 2P35A 5B4UA 2IHKA 5C80A 1S1CA 4B0PA 1I4LD 3KUUA 1H2NA 3X2QB 2CXOA 5BOVA 4ZOLF 2IPXA 1QIMA 1SVOA 3ZJUA 3DJYA 4NQ3A 1PVOA 2PJUA 2XRZA 3GJ4A 4MVYA 5H7XA 3F8SA 2VZEA 3ER8A 2PYDA 1N2IA 3AF6A 4Q4AB 4INOA 3R7BA 1NY6A 1ULBA 2J0VA 3L1JA 4V1CI 3UB4A 3V8MA 4O2LA 4ZN6A 2HMSA 1ETUA 4FMCB 1VQLV 4G97A 1BCRA 3D6AA 3JATB 5CDFE 1GARA 1SWWA 1GUDA 5INTA 3D4PA 1LK5A 5ICCA 2ZUWA 4U1RA 3GXOA 1QHXA 5IG2A 4DW0A 4LHWA 1DPFA 1XWFA 4BWFB 3PN1A 4HLUC 1PWEA 3JARB 4BQQA 2UUCO 2EWVA 4YCAA 3ICXA 1ATIA 1JQBA 3B9QA 2ZYTX 4UNSA 1UBJS 3VZBA 1YRQA 1BCSB 2RI1A 3QYJA 1M0SA 4A8JB 1HZZC 1Q43A 1TNDA 4RY9A 1ML3A 2ZYRA 3LKBA 1OGJA 3FZEA 3AEKA 4RDIA 2O8BB 4NL4H 3UO2A 2VAWA 4NV1A 3VFDA 4WKCA 5L6LB 4B6GA 1Z5PA 5AW0A 1NLZA 2HDOA 2XF8A 3DCJA 1L3CA 3BQNB 2KJQA 1URPA 1YL5A 4XAQA 1FFSA 1YL6A 5KTKA 3LY9A 4ASUD 1M56C 3VO8A 1Y1QA 2VP6A 2XHBA 1OLUA 2PD6A 2JLQA 3F71A 4EVQA 1NQTA 1XXHE 4NOMA 3UMFA 1OWPA 3E03A 4MA0A 1DIRA 5JS8A 1XZHA 4HX5A 4A36A 4OXQA 4OSOA 1UJBA 5G3YA 5K8TA 2VJOA 4JKYA 1MVLA 2B9VA 4DCOA 2ETNA 5BVGB 1UR5A 1QYIA 3PNOA 2NNUA 2ZRFA 2XPCA 4LF4B 1UIRA 2YV2A 4W5OA 3MLBA 4DRZA 3CO0S 2WTNA 3PD1A 3I9NA 2J07A 1ZMRA 3GJ0A 3CA8A 3TOZA 3IMFA 3NEYA 1O95D 3S5JA 3ND5A 3GDFA 3FMFA 4PDVA 4AYTA 4FDLA 1PGNA 5CLJA 2RH9B 2QSUA 3EG5A 3K1ZA 5IT9M 3AETA 2Q7DA 5ENZA 2GQ0A 4EVIA 4YHHB 1E6UA 2VWQA 1RZRD 3SDBA 1UEXC 3ZWQA 1XTKA 1YBAA 1NFRA 3BD9A 1G1AA 4DC1A 2EWMA 3N27A 1S2MA 4CM9D 1BS9A 3AH8A 1QFMA 1OAAA 1G6KA 2IHJA 2P6UA 5B1BC 1JDBC 3AK4A 4DV1O 2I62A 1V3QE 2IZ6A 621PA 3KCNA 3BD7A 1XV2A 4CEIA 2I65A 4YAGA 4HX9A 3B78A 4A5UB 2UXNA 3FCUB 4DXWA 1TQ6A 3ZXSA 1CEXA 3AHDA 3B6MA 2PH3A 3OJ0A 4XRGA 1YFKA 4JFAA 4HAWA 2C58A 2WU1A 1WBBA 5ALGA 2VYVD 4V2UA 5D5PA 4N9QA 5GJVC 2EF1A 2PVCA 2C9MA 2AXNA 1OSNA 3G0BA 2VBFA 3CYFA 4J0JA 4PZCA 3THXB 2J6IA 3RTGA 5BWNA 1IN1A 2ASEA 1K9MW 1REQA 1YK1A 1ZICA 4JNCA 2CL0X 1CFJA 4C7BA 2TMYA 4FDVA 1WY5A 1IWPB 3IT1A 1MFPA 2NYAA 3SR4A 3KOYA 1L4LA 3VI3B 4HDMB 3OT7A 1NBEA 1E1QA 4ZVMA 2UZ0A 3HA7A 2G8LA 5IS2A 5C52B 1BHAA 3LKZA 1TPYA 3BDVA 1O89A 4D6XA 1RWMA 5LP6B 4P80A 1ECJA 2XQGA 5THQA 3H1LH 2IKSA 4CUZA 2C8LA 4K2AA 4H0LB 2XT9A 4KMSA 2R8EA 4WZZA 2DOKA 1W36B 3OQIB 1WV0A 1MB2A 1XDSA 3GB9A 4D3YA 1YACA 3MEQA 4M0LA 3I0NA 3FNRA 4HBZA 4QKQA 5JQGB 3QX8A 2FW0A 1R6NA 2P75A 3M1YA 1G5IA 1MUUA 3M3DA 1GO2A 2WFMA 1E3WA 5D7NA 2JATA 1AV7A 3CG4A 4HPWA 2MR6A 4J80A 1M8GA 2HB6A 1WNSA 3KR1A 4XYMA 3SQNA 5ARBA 4V0MA 3LPDA 2CNLA 1VPVA 5FYDA 2HO5A 5MN6A 2Q41A 4BL5A 4NJMA 1O96A 3DCNA 1T1IA 4S0XA 4UCSA 1XPUA 1VECA 3EJ6A 3AIIA 4LJ7A 3AL3A 4BEBA 2Q2VA 3MDOA 3ASNB 3OI7A 4JYAO 4IXNA 1N2OA 3LDDA 4GH5A 3OJOA 1H69A 2E0IA 1UODA 3L8DA 2CDAA 2ZS9A 1R15A 2OTLF 4ALLA 2Z3YA 3ZD6A 3V8PA 5DLYA 4DW1A 3W6PA 3OBYA 4ARIA 5EE1A 4L2IA 5C8YF 1QYWA 5IXJA 5L9AA 3Q72A 2R7NA 5LZ8A 3B09A 2GJAA 3FTDA 5D1NA 3W06A 2HT1A 2GARA 3LWVC 2Z2IA 4W5RA 3BMOB 4FLUA 2AFIB 5JVDA 1JG2A 2GYWA 2EXXA 3OX3A 1JQDA 1TUIA 3VPAA 4RCVA 3DSRA 2CLDX 1K7CA 4TYPA 5IDYA 4IYRA 1ZL8B 3AXSA 1TYCA 3A6EA 3CCSF 1WR8A 3CJTA 4U2CA 1KFBB 2PUSA 1Q11A 1RLOA 2H0RA 1KJYA 3R75A 2KG4A 1TA0A 3R8XA 4ZIRA 2VG8A 2H1VA 3BFXA 2P9EA 4FLWA 3FFTA 2BR4A 3NHPA 1S01A 3H5RA 3IULA 3GH3A 4OJNA 3ABZA 3WGVA 4O1MA 2ZSKA 2HCFA 4CM4A 3T7SA 2LVBA 1DC4A 4HN2A 2VDVE 1XF9A 5C7YA 4LJRA 4V0SA 5J3JA 1V55B 2CZWA 4OJKA 5KWIA 4AMVA 5ENDA 4E33A 2I6XA 2PMCA 3H42B 4CDRA 2GN4A 1J8QA 4MXDA 1TU3A 2ZIMA 2O0HA 2CXSA 1A5SB 2IE8A 3FI9A 1MF7A 3PHHA 4IG4A 2JPDA 3SF8A 1OTYA 2FPRA 3RS5A 1GEEA 4BW0B 1UFKA 5E8RA 2R8YA 1JV2B 3AVYA 2X1HA 4LZWA 1GEGA 1QRRA 2PZKA 2YNMD 3A4NA 2NMUA 1CRWG 4CLXA 1JPUA 2QTVA 2YZKA 4Q9HA 1WCIA 5JZMA 4E5VA 4FCVA 5CFQA 2WYWA 3PC8A 5JBNA 4OM8A 2R66A 3CMAV 5CHEA 2V6GA 5FV4A 4ZAWA 2BO1A 1GTMA 4WESA 5AVXA 1YAJA 2OCAA 3JSLA 4I6EA 1Y5RA 1X7HA 2XDQB 5A0TA 1UPCA 2WE8A 4MB6A 1O9BA 3EQ6A 3TQSA 3T5PA 3S6JA 2PZFA 3LDFA 3KEFA 3P4XA 4IHAA 2H5LA 4BJHB 4TVKA 4KX5A 1TQHA 1G4YB 1LPSA 1OJLA 1JU4A 1KUQA 2WWIA 2AXEA 2B3DA 2KB1A 4J43A 4F8JA 4BOYA 3VDQA 1VYTA 4G0NA 3FCSB 5HDBB 3LXXA 1DJLA 1X1SA 2F9FA 1L7DA 1YOBA 1F5NA 4L8JA 3K73O 1Z7YA 2CLCX 5FBQB 1MORA 1RA4A 2K5UA 4EJSA 4GEGA 1ZK4A 1M5RA 2IYUA 3ZYZA 1PYOA 1YUBA 1PKEA 8ABPA 3HCOA 4BTLA 2BT4A 2J0UB 3DEHA 3MSCA 4B73A 3ZIAG 4LTNA 4U7HA 4L4XA 2H0QA 5FHRA 4PC7A 4TMFA 4DNPA 3SYTA 1VG1A 2DLCX 3WIUA 2Q3FA 1TZ2A 1UM9A 4AQYB 4FPPA 1S89A 1FP4A 4R69A 5F64A 1BEUB 5FFMA 1IXBA 5TVKA 4F9EA 5CCEA 2PMBA 4TXLA 3OPYI 2O8DA 4KOAA 1EDDA 2YYEA 3RFRA 1HNZO 3GLHA 6Q21A 2HRDA 3ZN1A 3I56V 3TIIA 3CUWA 3K71B 1HDGO 1M1YA 1TX4B 1YZUA 3QEBZ 4Y2YA 5GM1A 5A04A 2RGAA 1XYYA 2GWHA 4OO3A 1G0NA 3LPAA 1Q0RA 1HSOA 1CU1A 1POXA 2H4FA 1X80A 1RTKA 3K1JA 5GJBA 3KT0A 2CY0A 3UWOA 2OCCC 4MCAA 2C4MA 3C1AA 2O3RA 2JGNA 1MR3F 5CBPA 2CHSA 4BMSA 1RAGA 2MR5A 4X41A 1RWXA 1KYYA 2AFHA 4CQLB 3O3MB 4UW9A 4KWIA 2ECPA 1ZI6A 3IP9A 3M6VA 2ZE5A 1EBUA 3IL2A 4O0LA 3AF0A 1CR0A 4JLAA 2CSLA 4XTRA 4EFDA 3HI6A 4DCGA 3FZYA 1WCYA 5BW5A 5E2BA 3D7RA 4OXSA 2I22A 1NXOA 1NA5A 2WBLC 3PWKA 2FMFA 3CLUD 3NBMA 5LBIA 2J9FA 5ER9A 4EPRA 2A0WA 3T9DA 2Q1TA 3CSDA 3DL4A 5FBKA 4HWSA 4EB0A 5JXWA 4E30A 5IT9A 2ZK7A 4MVCA 1HT3A 5AHXA 5GM2A 3UFXA 1CY0A 1SOMA 3ZBHA 2HNBA 4ZWNA 5LQJA 3WPXA 2QN7A 3CUVA 1NU8A 1UIMA 4M87A 4BR6A 3NGXA 2OBYA 1UBEA 5HMLA 1UKBA 3HXOA 1S8AA 2UUAB 5DTEA 4BO4A 4OREX 5A6SB 2J87A 2OXRA 5K05A 3QJ5A 4CV3A 2OSBA 3CCEF 4O4JF 3VDRA 5F12A 4P9PA 3RTEA 1ZIPA 1SHJA 2O3TA 3PQ6A 2PMEA 2X3YA 3RTBA 3KIZA 3B1KA 2K1EA 1AQ6A 1JCHA 4A10A 1STOA 3F73A 1GM7A 3LUFA 1XTIA 1H3FA 3I45A 1E2MA 2NPOA 4Q3CA 4BKRA 2EILC 2LP7A 2Z5FA 4LJKA 2W0FC 4WNAB 2NUAB 5IT4A 3FYIB 2YDXA 1JLSA 3LHKA 4GZMA 2RHGB 3PLAC 1FNJA 2I4NA 5DZSA 1GG8A 3GPLA 1OCZB 2HZBA 1E5VA 3SQOA 3S0YA 1GGVA 4YJFB 4ZEOA 1GLNA 2EHJA 1BQ3A 1A3CA 3N0TA 3HJHA 5TV2A 3D8UA 4XOUA 4WOJA 3ZTTA 2GLZA 1QIEA 4X84A 1PSZA 2YQZA 4BQEA 1FC0A 2C94A 1F9EA 1OZ0A 1L7BA 4II7A 2OHIA 2F59A 2PUEA 3IB3A 3TD2A 1R1BA 2VP3A 3EGCA 1SBQA 3QTCA 1WUTA 2CSXA 2QW8A 5EWLA 4FQ7A 1P5ZB 3K5OA 3RT7A 3ZPXA 2OD9A 5FD8A 3UJAA 2ZBQA 3Q2OA 4IJKA 2IYTA 5HZKA 3U3KA 3HCPA 1M8PA 4KR9A 1NMYA 4LFAO 1GP2A 2BZ1A 1CQJB 4OF4A 1DKMA 3IT0A 1K5PA 2QMUA 1DEKA 2XKJE 3Q7IA 3ABMB 4TSKA 5D2CA 2XQJA 3OE7D 1NL3A 4MVJG 2ZIEA 4KHPB 1E6WA 2AD5A 1CR2A 4XSGA 3W7WA 1C7JA 3FPLA 4PX2A 4UNRA 1DLBA 4Z3DA 5GOTA 1J0DA 5BOSB 5DYYA 1FLAA 5HR5A 3ETCA 2XOXA 3IUQA 2QDOA 2N47A 3E1KA 5PGMA 4LA4A 4JUFA 3FYUB 3QWIA 2B7BA 3E0QA 3D6TB 3E8GA 1KR5A 1Z8NA 1NDHA 4C4XA 2H0AA 2Q0HA 3Q7SA 5JASA 4FKZA 4I0XB 1BXGB 2DKOA 5EWRA 1PWXA 4G4IA 3AHIA 3AG5A 3SHOA 2EFJA 4KO1S 2E4UA 3PC2A 3D31A 3VTIC 5LB4A 2PGOA 2DE0X 3FLBA 4O0MA 4QECA 1T8RA 3KQWA 3R9XA 4PTYA 5EGNA 2KSDA 1G0OA 1SBTA 2GD6A 3I37X 5J9PC 2BFDB 4IKPA 1ORTA 1CUJA 1PD3A 1J0XO 3FVWA 1R0BA 5ALTA 3EXG2 2A0KA 4UMEA 1U2ZA 2LGQA 1IC6A 1Z4QA 3FWKA 2JVDA 5DM60 2BEUB 4PAMA 1YDWA 3WLOA 1K73W 3BSYA 3I9LA 2FZ4A 2ERYA 4H13B 5KUMA 4O4IA 4D9IA 5B58C 2DECA 4P7BA 1M72A 3RIXA 2HOQA 2O5CA 3M0EA 3P97A 1GG2A 3WBKA 1EDEA 3TYXA 5CFPA 4R05A 1NP3A 4RBNA 3SJZA 2UVQA 1DXYA 4TV9B 4J3FA 2H6LA 4MI1A 4OY3A 4UEJA 1WWKA 1CS0A 2XUZA 5CVEA 2BHSA 1HK7A 4R9NA 1F3LA 2RGBA 4B8YA 4LZJA 1M2GA 5F78A 5KC9A 3ZR4B 4CJXA 3W2TA 4URVR 3LXUX 4P54A 3LNNA 4X54A 2O06A 4EUHA 2BBSA 1JI0A 4FFOA 1WW3A 5BVHB 3LA6A 2N75A 1YJ9F 4R84A 1WS6A 2I3GA 4ZT3A 1NUHA 4UUJC 4HKTA 1J9ZA 2X0RA 1IDSA 2BL4A 4MRMB 3BBLA 1J8YF 3N74A 1BHJA 4UFZA 2F43G 3JAWA 4HEHA 4Z7OB 3F3SA 1NIPA 2BGRA 1Y4SA 2JJ1A 1I4DD 1K6JA 5GJWC 4PU0A 1NWHA 3NG1A 4BX3A 2HSWA 4RF2A 1PFQA 1TFRA 3VKFA 2VYFA 1FVXA 2Q3BA 4LRQA 1TIBA 2WWHA 2Z30A 2JIQA 2VSYA 3P9CA 2YWEA 1AK1A 4L9WA 2Z98A 4TZTA 1QVAA 3A6ZA 2P5YA 4NZYA 2XYRA 3CEJA 3JZMA 1ACLA 3HFJA 1VMGA 3P9XA 1T9AA 1NXPA 1RZUA 4D99A 5J2UB 2VUTA 1NV9A 1QRTA 3GP5A 5ALUA 2ZAMA 3W8FA 4AKIA 5DXJA 3C3YA 2VP9A 2RHMA 4DBZA 1DX6A 1VL5A 4DMHA 4X3MA 3CNQS 3U3MA 1QYVA 5AUNB 5ICFA 2OMEA 4X97A 2MYPA 1BXRB 1A9QA 2F6RA 4X7PA 2JAWA 4DUZB 1QZZA 2PH5A 5JNSA 1XVVA 4OQXA 3SEFA 4HQKA 4C6HA 3EGDA 1UBNA 1IJBA 5KSZA 2UXBO 2VDUE 3NT2A 2WEKA 3IP7A 1GK9A 4FFBB 2EKZA 5FXMA 1BGYH 1Z36A 3EFHA 3IPAA 5LLDA 5L7WA 2IH5A 4GWKA 1E89A 2VJLA 4MWBA 2G5TA 3WLEA 1USVA 2JCSA 5I8PA 3KTOA 2LUOA 5AOAA 1CRPA 2R96A 1CETA 3LUDA 3OUTA 1CUCA 3G67A 2PUCA 2V1DA 1N6HA 2JGUA 2IQIA 3RIMA 1ZAUA 5CA1F 1GZHB 3IEMA 4J9YB 1JHVA 1BW9B 1RVV1 3SZUA 1T5TA 3ANLA 4EGSA 1IM2A 2ZYHA 4HTFB 1DTSA 3M4NA 3QF4B 1S6YA 4U2GA 3UXYA 1YKSA 5A2QM 2RK3A 3MQ4A 4N39A 3AUJB 2QTNA 3L7CA 2V96A 3PD0A 1T0AA 4NU0A 2GT1A 4CIDA 1GGFA 2HP8A 3PHJA 2O3JA 1PEAA 2BKLA 3TW6A 3VTKA 3D4NA 4G4GA 4IV5A 5J59A 5B12A 4BQNA 2RCYA 5KTRA 2JS7A 2HJRA 3HUFA 3BGVA 1EMDA 2RB5A 4YHBA 1X1DA 1P0MA 2JRIA 1X94A 4KK4A 1YI2V 2DPXA 2HSGA 2ZWOA 3SEQA 5T6MA 4WW0A 5AM2A 1J7JA 4YPFA 1CT9A 1PUIA 5FOQA 3COVA 2YBEA 2YJ3A 3X1ZA 4UUPA 1FAFA 3A8TA 4WDRA 3DEIA 3ITEA 2RGWA 2WQ6A 3RFUA 4EITA 2X1LA 4Y6LA 2RGNA 5ULLA 2OTJF 3VVLA 1P9NA 4LDZA 3GLVA 4JI5B 5D5HA 2QM8A 1BMDA 4HT3B 3T3EA 2D2EA 3QJGA 2Z6AA 3NXKA 5G4VC 2XF2A 5BSTA 2YRWA 3DMPA 1ZJJA 2RK6A 3D4IA 2FZWA 1W96A 1FJ2A 3QOYA 4GPIB 4OGFA 1ZGJA 1SHLA 4X1KA 1J5XA 5LWHA 1Z0FA 3K70D 3VDXA 2PT9A 1R8YA 5H5JA 2C5LA 3IX7A 2VHWA 1OASA 3GVXA 2FW8A 3SPHA 2XGMA 4ABYA 1UXHA 4BASA 3B3QA 2I6FA 3TMAA 4NENA 4XX0A 3AZPA 1ZSYA 1YFLA 5SYMA 4ETMA 1SOUA 4MVJH 4B47A 1UK7A 2H3HA 1C8LA 3NOXA 1VIDA 4XWOA 2AHYA 2YXYA 1XTSA 1YIAA 3EVEA 4XQGA 5A03A 4F2WA 2HBYA 4R1OA 3DE4X 4D25A 4X8MA 1EN5A 3DZKA 4FYXA 1CYEA 1L8LA 5DI9A 2AMYA 3R0XA 3FCAA 1BT8A 3I3SR 3UFBA 1L5ZA 2PS3A 1U0EA 1EFPA 3JPWA 3DBHB 4O2BF 3OPQA 4FNOA 1KI8A 3OM0A 4LJYA 2RGYA 1AVMA 3DOUA 3L93A 4GZRB 3WIEA 2ZRQA 1Y5MA 3O75A 3FX7A 3U0ZA 4FJ2A 2R4UA 1F06A 2F1IA 4HFJA 3ZMTA 4G4ZA 2G77B 2PUGA 3EFEA 1KI6A 1ZJZA 2A4KA 5IJ9B 3ANMA 4EH1A 1I2ZA 1UZMA 4LDAA 2EBOA 5AHOA 3OT1B 4GS5A 4KAFA 2EAUA 4XVHA 3BEOA 4JGBA 3NKVA 4XARA 1PT5A 5IRCD 4ZYUA 1QTQA 4RJTA 4OXNA 1J0AA 2J45A 2AZMA 2VOEA 2RGCA 1GFWA 3SEZA 1J24A 1OYOA 5CK5A 3H19A 3JQ7B 4GPD1 4QOEA 2WJVA 2YMLA 3QPUA 2P2LA 1KJWA 1TCBA 2EFDB 2UXDO 3T4ZA 3GBVA 1QYCA 1ZIOA 1U31A 1NUAA 1QAQA 2PUDA 2VLIA 2G1KA 4DOMA 5FNVA 4IY1A 2GRJA 3WGIA 4D80A 2GX6A 4IZIA 5GANK 1D6NA 2GLXA 2J7PD 2HPVA 3S2UA 3LMKA 2N48A 2FMTA 1X0VA 4CGZA 2BFCB 3BSFA 4YALA 4TVOA 1U0SY 5LDDC 3QUAA 2VJMB 3O4HA 1NUQA 3EXAA 4AJ1A 3GUYA 2XWQA 2X0IA 4M38A 4F11A 5J40A 4UPEA 3GLFE 2PMKA 4G4SP 3DWIA 4QVKA 1FVFA 2A9JA 4R8KA 4DFDA 1TLLA 2HTEA 3A26A 1QHFA 1M8JA 1AK9A 2PL1A 3LQ4A 2K9PA 1VL8A 4G4VA 4JOQA 3RG8A 1OGIA 3VKUA 3GWOA 4FFPA 1MX1A 4D9FA 2ADQB 3KKOA 4H27A 1G8FA 3X1YA 3LIPA 1G9TA 1LDEA 3ZZMA 3CCJF 3AKDA 4BWVA 1OYVA 2WKSA 4AMBA 3U5ZB 1Z2GA 2OAGA 2CMKA 3MTBA 1UJCA 4AI8A 5HY4A 2CXTA 4M1EA 3CD6F 4YCSA 5CXQA 4JA0A 3ED1A 4ZKEA 1JMKC 5CB8A 1CUXA 4YRMA 4HLNA 4TN5A 3UT6A 4J10A 4ND8A 3PCTA 2BCGY 2XASA 1YB2A 5FOTA 4F4JA 2XA1A 2HLNA 5JMWA 3NS7A 1PGPA 3D5TA 4MYDA 1ODEA 2C29D 3S06A 5DOVA 4OKSA 3BMNB 3WMWA 2JCBA 4YDSA 2W6JD 3C3BA 4NE7A 3PNSA 4BQOA 4L8FA 1KO5A 8MHTA 4PX9A 3KYCA 3E9NA 1PYDA 4YV7A 4CT0A 3DYVA 2XITA 5F77A 2UUCB 1GPJA 4C0BA 2DPMA 1VQNV 2C4HA 1L7EA 1QC5A 4BBJA 5ITVA 2WLLB 5BZBA 4I6JA 1ZNWA 5HP8A 3L04A 3E81A 2DWUA 5K1PA 2AK3A 4B3MO 3WK9A 1SRRA 3E3OA 4G8BA 5KVAA 5IZ4A 3DG9A 1SCJA 5HYVA 3IR9A 5K0JA 4Q7MB 3HN7A 5FUXA 2FR8A 1Q91A 2HXSA 1ISIA 4XLLA 3N2EA 5KWJA 4ZHQB 1D8TA 2JIRA 2P4SA 1KAGA 2EFCB 5JMTA 1YVPA 3WL8A 5LQCA 2CJXA 1K92A 3UJ3X 3IO3A 1KF0A 4WNYA 2XHZA 3FWHA 3OVMA 2W2QA 1E2KA 4CKWA 4M1QA 4OPAA 3TRIA 3SVZA 2D1FA 5JSKA 2OHHA 2Q1YA 4HRVA 3L8YA 2W71A 2DJVA 1FJXA 3HXPA 2IP2A 1CE8A 4AO8A 3LX8A 4HYEA 1DZIA 1JG7A 5L7YA 2C78A 2CWWA 5HM6A 1F0YA 2W6QA 2HZ7A 2Q6OA 2AOXA 4HAYA 1F38A 3WPWA 4ASUG 2CBGA 3RT1A 3OC0A 1V1RB 2V7EA 4RPGA 3KL2A 3DC7A 1GAJA 5HQ3A 4FYHA 2WNSA 3OIUA 3FB4A 5AXBA 3AKEA 4PBTA 1QF7A 3RW9A 4WERA 4TMTA 5CA1A 4GYKA 3NPMA 1T2FA 3TNJA 3ND8A 1MO4A 1JIQA 3DC2A 2ODEA 1WBJB 1OKKD 1HE1C 1TL7C 5LNK6 1TZCA 1LWNA 1WPXA 3SBXA 2AG8A 1P61B 1ST3A 2YZ7A 4K6OA 1KI1A 5DXFA 1RPAA 1UKEA 1NASA 2OFFA 2I6SA 3T5AA 1XTRA 2XQIA 5A2QA 2X86A 4RLQA 2KHZA 4IPTA 5JAOA 1TECE 1JY8A 5EIOA 1MH9A 1K6IA 1XE3A 3IALA 2AJDA 4HNUA 1F8GA 1XVLA 2FPMA 1W52X 4UHBA 4FSHA 3B85A 2QLNA 3SC6A 1X1CA 1L5QA 2E21A 4NNOA 3W2GA 1Q2XA 2LE0A 2DBQA 4P83A 1HT0A 1QBZA 3IUYA 5HUJA 4YRJA 1GPKA 1GZVA 1FS6A 5DBOA 3WLNA 5DTQA 3SZMA 1DAHA 2VQFO 1IDN1 4UU0A 1NU6A 2LKCA 3LLUA 1JBKA 3VHXA 2BE3A 4IOMA 1K33A 2VWKA 2PZSA 5JCOC 4KYTA 2I2WA 3OWHA 3IVCA 4JQCA 1QZTA 2XCLA 1NXWA 3MM4A 4DXDA 5T64A 4L5JA 9GPBA 3ZV3A 4P5EA 4YJ2A 4KNVA 4BJ3A 5F3WB 4JQOA 2YUIA 2O1SA 7ABPA 3U7GA 3SVTA 1DC3A 1OVMA 1ZXLA 3C0KA 2J3HA 4NBKA 1EGQA 2ATKC 4B5KA 1Q0TA 1ULUA 1VPTA 5AQ1A 2XQKA 3K9BA 1J21A 2IPOA 2IVZA 4R1LA 3PCRB 5KJFA 5EC1C 3I34X 4FMPA 3UV7A 3VJLA 1ULZA 3I2GA 2ITCC 4G1EB 2UYQA 2QN6A 3MIZA 1KKCA 5EYPB 1GPMA 1OH5A 3V00A 4DYHA 2I78A 3TCUA 2GJ4A 3OWXA 3VAYA 3IEXA 1LVGA 1LQTA 4MX8A 3D3KA 1Z35A 1NM5C 1SVLA 2OFXA 4H2DA 2ID7A 4ND3A 4DDKA 2C4TA 4GNKA 2WF5A 2C98A 3THYA 2HMVA 3IBGA 1H2YA 1TT7A 2W93A 2Y0CA 2V6IA 2EL7A 4N7BA 4PICA 1Q17A 3U49A 1AILA 5JPDA 3KXPA 3LBIA 1Z62A 1R9GA 2UVPB 5H80A 1TA9A 4U0JA 4M7WA 5KDLA 1WHTB 3CPQA 2WU0A 3F6YA 2P6OA 3E9QA 4JYAB 4DG8A 5AVYA 2N1MA 3JQQA 1Z2OX 1DBQA 5E3IA 6YASA 1PPJH 2C9BA 3FAZA 2W8BC 3O8OA 4NECA 3IJEB 3AUKA 4LJ5A 1IFXA 1EZJA 2HJHA 2VHEA 1KSGA 1ZOOA 4PHCA 5ALRA 4GO1A 1V8FA 5CPFA 4ZJYA 5HQJA 2FEWB 3AQ4A 4P5PA 3ANTA 4WN3A 5JPIA 4TVSA 4G41A 5BV2P 4QATA 3QUQA 2BFEB 4TZKA 5I45A 4BFWA 5BPHA 4P7KA 2P90A 5ALSA 4MWSA 1NKDA 4YUWA 2C9ZA 1ZHHA 4YRZA 4PGFA 5LXTB 1GRVA 4DV3O 4LZAA 2DBYA 2X1VA 5T4HA 2OGTA 5LQMA 1DXHA 5JVDF 1NBMD 4I5DA 5AJTA 1XLTC 4HNAB 3OC6A 5C5EA 5KWEA 4KFTA 3DOOA 4IWXA 1IE3A 4FONA 5E8JA 1U28C 4KXXA 2GM5A 4G07A 2W9XA 2H7YA 5CFZA 4ADSG 3N2KA 5EB1B 1DJMA 4U8GA 1T13A 3CYPB 2VDJA 1SCDA 1T4GA 1UMBB 5DNYB 1NRXA 1OQAA 3K53A 1TM5E 2KLHA 4UUMA 2FW9A 2F1KA 4IUCS 1W42A 5A4KA 2VAVA 2PL5A 4E2WA 2JGDA 3DMTA 4V3BA 5DNUA 4BMZA 5DI3B 3A32A 2IEBA 3E7WA 3D64A 3U3DA 3AK3A 3JQPA 3OF2A 2VTBB 3ZOPA 2ZXFA 3RC3A 4CYMA 5DCWA 1Z3CA 4F4CA 2ZB4A 4GKBA 2OHVA 4MUNA 3SAJA 1GHTA 2JHCA 1KAOA 3QF7A 2NAFA 3JYCA 2C2MA 1WTCA 1ZL0A 3IAXA 1A04A 3V46A 3WGTA 4PS0A 2IXAA 1AGNA 1JEJA 4B6RA 3A28A 4PCAA 3TFOA 4GBMA 2F3TA 3GYGA 3PFNA 1TMOA 3GRCA 3K03A 4DQ0A 4C3VA 3QYPA 1R88A 2EZTA 2NVWA 3DULA 2W6PA 1DIAA 5AVKA 3C6ZA 4XVRA 2VNAA 3N86A 5J58A 5JMOA 4LX0A 2JDIA 3HEBA 4PM4A 3Q8KA 3RVPA 2GPSA 3CNNA 3SSOA 1HG1A 2BD0A 3KWLA 2I7VA 4UVGA 5T6BA 4B3GA 3DBLA 3WK7A 4CQMA 4RKQA 1T2UA 2DP4E 2OR3A 2QX6A 1DSSG 5B1NA 3FFBA 3QVGA 2DQ0A 3CB4A 3WJ1A 1Q6YA 4G0VA 4AC9A 4WIAA 5K1ZA 3BJMA 2ZE8A 4NXNO 4XI9A 3OY7A 2NXCA 2GUWA 3ESXA 1ZMOA 3ZS8A 1IUPA 4X85A 1IOWA 3RVZA 3AFNA 3G0IA 1F8UA 3QKIA 5DLQC 3CCQV 1ONPA 1Q0PA 2ZROA 4OYYA 3MPUA 1GG9A 4X1IB 4TSFA 1X1EA 3BJIC 3JSXA 2NZ2A 4JBGA 5AVWA 3H2IA 2W6ID 2YR0A 2A9OA 2XLBA 3L8MA 2VP2A 3HL0A 3FBGA 1H7MA 2HCBA 1JRLA 2GAJA 2GZ3A 2V7PA 3ACDA 3WGNA 3ZV4A 2F1HA 2CUTA 2LRHA 2CC2A 3I6ZA 1VPWA 2LR0A 1ZMXA 2HVKC 2GUZA 1QHTA 1S7CA 4U4AA 3G9QA 4DIBA 3H9UA 4NR1A 1SXJD 1HNZB 5FBZA 3Q5DA 5DNVA 1CUWA 1R9NA 3HP1A 3EFBA 3TQHA 4POOA 1LPOA 2JVIA 3PJFA 1AHIA 5IK2A 5JSQA 3VR3A 2QKAA 4YGXB 2VCEA 3RSZA 3OZFA 3RJTA 3GEPA 1BWRA 1XQVA 1MG1A 2B82A 3X1MA 3EEIA 1O5IA 1KDYA 1IY1A 2WM8A 3U9SA 1FBNA 3T5GA 5L4SA 5EC2C 3K7EA 2JHPA 2UYCA 3QUBA 2D3OW 1NBWB 1QYDA 3SJ7A 3WA7A 3ADPA 3X2EA 2OORC 1T3SA 4KTTE 2JGAA 4Q16A 1Y76B 5JROA 3C41J 3BRSA 3BICA 2I7XA 3S03A 3HJRA 1KETA 2PLNA 4P84A 2XODA 4MMZB 5KDDA 4ZXFA 3E3NA 4L73A 5F23A 3K8OE 4F86A 2Z56A 3T1QA 2ZUEA 1ZOLA 1O6CA 4IYJA 5TR9A 4G37A 2ZSBA 4S2UA 2IF0A 2AK2A 3PFIA 1I5EA 5HJ2A 4X90A 1WCXA 4G2NA 4AKSA 5KHGA 4AUNA 2EATA 2VPYA 2XUAA 2Q0OC 1ZVKA 4PLFA 4PC6A 4A9AA 4XW2A 1V9SA 4M8LA 4IH1A 3MHTA 2HC9A 2F1OA 4ZAVA 3CR7A 3VSDA 3UW3A 3G2LA 4XWAA 1RLJA 5D87A 4F46A 4MTOA 4P36A 1QKKA 4IBOA 3KKZA 3R0VA 3PXXA 5JJ5A 1HMYA 2HS0A 4KVGA 1KZ7B 4L75A 2IZ1A 2Q2NA 3TOSA 2WPDA 3UMJA 3WO0A 5AT1A 1ETHA 4HAIA 4BRUA 1M2EA 3SC2B 3GH1A 3M6AA 4YCJA 1WB9A 2Y1OA 2WQZA 2ZE7A 2SECE 4PLYA 2CT8A 1EIZA 3QU9A 2Q9UA 1QORA 2OKGA 4DLZA 2W2NA 5ALXA 3L2OB 5L3VA 2PXAA 3VNAA 1J2TA 1E5DA 1GGMA 1I2MA 2CZGA 4HB0A 1UPUA 4QYXA 1A9XB 2GOYA 2P3SA 2YZNA 2QZ9A 3HJFA 3I64A 2B21A 2V7GA 4OQNA 5E1MA 1QNFA 3I1JA 3H9QA 1VZ2A 1GKYA 2IAFA 1VRVA 3P9IA 3F4LA 2LFRA 3QNEA 1CQZA 1GU0A 3KJZA 1V9CA 1L7RA 1OFIA 2WUDA 1BFKA 4CFYA 2AR9A 2B5WA 1BG6A 3V7FA 2R68A 3OZIA 4XUDA 1YQQA 5AFSA 3FHTA 3H0CA 5DN6A 4MVUA 4LVNA 5I5GA 4E1BA 3T9FA 1KIFA 1AN0A 4XM0A 3DOIA 4CMJA 2AIFA 4LFAB 3AV3A 4TLCA 1T36B 1PG2A 2EG5A 3OLVA 2FGKA 4ZKDA 4G86A 3WRXA 1M1UA 2R3SA 3A3YA 1PUJA 4JOBA 1IBSA 1R0CA 1D2GA 1WQ1R 2DG2A 4G24A 2XNDA 1OF1A 3C8DA 4DZRA 4HVAA 1N34O 1XN1A 4OU4A 2TMGA 4MUHA 3IUNA 4JVSB 4NOJA 1PJ8A 2I9KA 4G1FA 2R8ZA 1RXEA 3G9ZA 4MGZR 4KQFA 1F0PA 1L4HA 4Q9NA 2ACVA 5K3OA 2JA1A 1T0JB 4NXMO 4EPWA 3HNRA 4RTSA 4E08A 3OE7G 2UZ1B 1R37A 3CNOA 3S3XA 4R50A 3ENVA 3NNSA 4F38A 2M1XA 3JQGA 3R9IA 3IC7A 1T8WA 4NMHA 4L78A 1CJKC 1I1HA 4XGQA 3QTLA 3DE1X 2OSVA 3EB9A 3AP3A 1C3LA 4LHZA 3AJRA 5A0FA 3TIFA 4KMOA 4Z1MD 2QR2A 2ZQMA 4XDKA 4JN6B 4FJ0A 2VDNB 5IJ0B 3T3PB 1A5BB 3TK1A 3CTMA 4Z9BA 3BERA 1PL8A 1L7VC 3QEMA 2QG6A 4G1VA 4NJEB 5HCUA 4ZAXA 2WVHA 1SQ5A 4R5HA 3WZ2A 1GZ3A 3TSYA 2B2NA 3EEBA 4CIVA 1HYBA 4QEDA 1GU1A 5GW7A 5AVZA 1QMGA 3VVCA 2ZOSA 4EY4A 2GJKA 4JEHA 1AROP 1FBTA 1RBQA 2BP7B 1QIHA 3G5TA 4JLOA 3ENQA 1V1MB 4WCDA 5J1SB 4AX8A 1F51E 3G7UA 4O4IF 4OX9Y 4H60A 2OFPA 2IZ0A 3LD9A 2J9XB 4R3UC 1GA4A 4HATA 3CLTC 1G5HA 4D5EA 1IYZA 4KQ2A 1NNI1 4IGFA 3CF4G 1GV0A 5EE3A 1VF7A 4RY0A 4LYGA 2VAXA 4Z2YA 3UAWA 1CN7A 2H17A 1M7HA 2EZPA 2ORWA 1UF9A 4Y6GB 4DA8A 1SRQA 3AG7A 3EGIA 2HU5A 4TL8A 2A3RA 1TKRA 2Q9CA 1FXKC 1SA0B 4Y9UA 5CM9C 4DT1A 3VNSA 3GHHA 4G5YA 4FE4A 5HCNA 4B4UA 2WB4A 2PD3A 1O58A 2CUNA 2ORYA 3L8FA 5EJ9A 2CTRA 1SXJB 2BFNA 1D9ZA 3SLKA 4KKVA 4UUAA 1HLDA 2DBVO 2JFUA 4K28A 3B38A 4I4NA 5DW3A 3V2IA 3WB2A 1IHXA 4RNDB 4L9RA 4XXHA 1ND5A 3L7NA 1RXCA 1TU4A 2EULA 4JUBA 5C81A 3A2LA 1PAUA 3PC3A 2OD7A 1RQLA 4BN4A 2C04A 1U0BB 4PZLA 4X3OA 1R4NA 3D3JA 2OVFA 4GT1A 1M7BA 4DDUA 1T6XA 1I6WA 3L0IB 4AK9A 5CA3A 1IN6A 2H9AA 3Q8LA 2GAOA 4P4TA 3V97A 5IYDO 3PYMA 4JYYA 3UYLA 4C7UA 1G60A 1NVVQ 2V65A 3TI7A 2C4NA 3B89A 3CX4A 1ULSA 1GFZA 3CC7V 3CRRA 2ZODA 3OUSA 4OK3A 1CUHA 1IBMO 3K0DA 2I1LA 5E38A 3WL3A 1PK7A 1AR1B 4WK0B 1Z7BA 2VJAA 4AS3A 5HGJA 3V33A 1GTVA 4QWMA 3WFVA 1JH9A 1ZUQA 2UXBB 1VQMF 2DH6A 3DUWA 4O4HB 1MAAA 4KDEA 1L8AA 1J0CA 1V4VA 1LDGA 2XUQA 3TDKA 3M5WA 5G4UC 1K27A 3ZXUB 2AMLA 1Z2DA 4C04A 4EW1A 1YHNA 5E0OA 2QZZA 3TVYA 2PEYA 2QT9A 3GAFA 4Y2PA 3NHUA 1T9CA 1YRYE 1UKCA 1U04A 4I2NA 3I76A 2P7TC 3H01A 2C5FA 2QSYA 3KU1A 2HHAA 5EIBC 4FEGA 3FXAA 3IH5A 4Q0MA 1IURA 3M6WA 4JLJA 4CLRA 1Z7EA 1XZ8A 3RVSA 3EYAA 2P69A 5C8XA 1T6YA 4X71A 1A1VA 1AB3A 3BPZA 4B3XA 1T9ZA 5FUBA 5ELXA 1IU9A 3HYNA 2OPHA 3B60A 4HP8A 3L6OO 1X70A 1AIPA 3ID6C 3KPYA 5LQSA 2DRIA 1Z0JA 4D7AA 2PO5A 1BWSA 3KTDA 3G3EA 1XMIA 1Y9EA 5HKBA 4FLFA 3T3OA 4UUNA 4YTEA 3M5CA 3IKLA 4IZ6A 2CMFA 3U7HB 4X7BA 2NO7A 2ZAOA 4NY1A 3AVOA 1TZJA 1SVKA 2R8OA 3MCZA 1LBQA 3D3IA 3EQ7A 3WDKA 2YVKA 3MUOA 1VCNA 4DIOA 4MAMA 1AGRA 3T12A 4BV9A 3G2QA 4N6OA 3QFSA 4GM4A 1JQAA 2V9YA 4UCWA 4DY4A 1SHTX 3GMDA 4DWVA 1PVVA 4MR8B 4TM8A 1V8BA 2JI7A 2OT5A 2GHTA 3HK2A 3EFOB 4FGKA 4OQFA 1TAUA 1UQRA 2EIMB 1MNQA 2PZMA 1KORA 3G2NA 3JSAA 4RDHA 3VNBA 1M4UA 2VT3A 2G4CA 3QELB 3O26A 3D36C 4ND6A 4RPIA 3EIEA 1XNGA 4F6EA 4RH1A 1SUFA 5L3QA 1HKHA 4IFEA 2JK0A 4MHTA 2OG1A 3PL1A 1D2MA 1AI6A 2MT9A 4DY6A 1P33A 4LPSA 1Q3HA 3G2KA 3HH8A 5BN3A 1YD7A 2Y69C 4J1TC 3S55A 3OCVA 2I4OA 3TAHA 4WOBA 4C4WC 2ZXWB 1ZUD1 2OXFA 4HCJA 2BFOA 2CK3D 1BIFA 4FIDA 1Q16A 1FW6A 5KHAA 4YP6A 3S40A 1PF7E 4YR7A 1NHGA 3M2PA 3KIPA 1JJIA 2LDXA 1IBRA 3EDCA 1QDLB 4GXNA 1KFCB 4ZVPA 4DLLA 1D6SA 4GZ5A 4MVJE 4XVUA 4J7ZA 1AQIA 3EIOA 3I28A 3A2NA 2CCJA 1UP4A 1ZD1A 1O5TA 5AI4A 1ENZA 4EY7A 2JFQA 3OFKA 1LSOA 4FCTA 3ETGA 1ZW6A 5IHXA 4JAVA 4AYWA 1S4MA 2JBHA 4BRZA 4D92A 4ZEWA 5J4HA 1YQNA 1PGJA 1ZLYA 4HZUB 4X91A 2Q68A 5CB4A 1R1DA 5CXXA 4RKRA 2Y6UA 4Y1RB 1OUMA 4BQRA 1MGPA 4Z3OA 2FEAA 4UMDA 4WOCA 4FZRA 3AYXB 4EB6A 2ZUUA 2PZAA 1EK2A 4N3NA 1GIAA 2AW5A 1CZKA 5ESRA 3BTVA 5EQFA 2HYIC 3K0HA 1DIGA 2H48A 2IW1A 1XCBA 3V5NA 3FMOB 3RRXA 5K1XA 3H8WA 1WG8A 3IC9A 4DGQA 2PEZA 1NJ8A 1XRPA 3UQYS 5C8VA 4RHFA 3UH1A 4YJDA 4N48A 1RYDA 1VC2A 4ND1A 3B12A 2O14A 3ZRXA 2ADMA 3EC2A 4M0DA 4WH0A 3T80A 3IBFA 2WF7A 4CI9A 1MX9A 5F2EA 3DR5A 4AZ3B 1Z18A 4L3WA 4ES6A 5GOZA 1QB8A 4M1MA 1A88A 2F17A 1DGQA 1PG5A 5CN0A 2UXDB 3DV9A 3EGEA 4RIEA 1WA5A 3UA3A 4LE1A 2OYRA 4KQGA 5TGDA 1YDHA 3WLMA 4WZBB 5TSDA 2WZQA 3MRSA 3RVQA 2GN8A 5FWYA 2IU0A 2PGAA 2FMHA 2I66A 4M1OA 1NE2A 1CIVA 4UFPA 2VH2A 4WXMA 5FNVF 3NTXA 3KYBA 4LG1A 1E5TA 4Q7EA 3SXUA 5E1DA 3M5PA 1N7GA 2HPHA 1IV3A 3OPMA 1VXOA 1Z07A 3FKQA 5T3UA 3NBYC 3QW4B 2OCHA 5BQ5A 3ZEAA 4WE3A 4I1OA 1WBDA 4P2BA 4HEQA 1ST2A 2ZVDA 2DETA 3B77A 2IIPA 4K6GA 4DV0O 3VI6A 2WILA 4OQQA 4AN4A 1NPDA 4MW1A 1D2RA 3QSYA 5AJYA 4EPYA 1QVRA 5B66Z 3K6SB 4BEJA 1IPFA 1ZIDA 1YZVA 2EQBA 4JXZA 3RS3A 3JR3A 1WZEA 5TQ2B 2Q9AA 1HY3A 2VUSA 4Z49A 1KYVA 3GXBA 5HJ7A 5E3JA 1JA1A 2WIKA 1JX9A 1E3DA 1XMSA 4NTYA 1H9CA 4RXUA 1NBHA 2P7HA 4O4LA 1VQOF 5A5GA 4CI0B 3H1GA 5JSZA 3EHBB 4F6RB 4D6PA 1OR8A 2I87A 3G0GA 4DV6O 3D3NA 5IYCO 3ASZA 3HS3A 1OBVA 5AVTA 3IE0A 3OZDA 1MOSA 1YR3A 1LA2A 7REQB 1C9DB 1HE5A 1TTTA 1QO7A 3OKCA 4DEYA 1Z5VA 2ABWA 4C7XA 2GXAA 4H6VA 1I6MA 3ICOA 4RAQA 1MBZA 4JEMA 3DF7A 2BRUA 2CHQA 3R6TA 3ZY4A 1A9TA 1G55A 3DXYA 2O23A 4H16A 3R7AA 4UU1A 5ERYA 4Y2JA 3DAPA 4JPRA 1XUOA 5JSUA 3R0ZA 5AKJA 2YMQA 1H2MA 1IHPA 4TWJA 2AZ2A 5A4AA 2ZRGA 2IBSA 4IIHA 4ROTA 1U11A 5D8DA 3GPBA 4XWKA 4ZZ2A 1DPGA 1TMGE 3E2IA 3TTUA 2HWYA 1OA1A 3GLIB 3KBOA 5G0VA 3MMPA 4B3MB 2G83A 3ZBTA 4GR5A 4NH4A 5GMOA 2HXYA 5DU2A 2W6JG 4F56A 1X2BA 2PH7A 3FCCA 4WVLA 4F06A 2VDQB 8AT1A 4ZT2A 1E4OA 1UPGA 1H2RS 4GQBA 2IPNA 3OAAA 1YIOA 2FFJA 2BOBC 5AHKA 2LZ0A 2DYRB 1ULAA 3RVRA 5EJGA 4BYGA 1FNNA 3WMXA 1Q3EA 4E5UA 3RKSA 1NYLA 3E1YA 5HQTA 4D9CA 4BGUA 3CVYA 3FY4A 5HIIA 1W5TA 4PTLA 2QTPA 3U7IA 4RK6A 1GGHA 3G59A 1NN3A 2WG1A 1NYRA 2ZR8A 2F55A 3C2QA 2GBPA 3GRFA 2FEKA 3M4ZA 3IMPA 4QUAA 1MG5A 5DVZA 2IEIA 3D5QA 2PZGA 1PT6A 1CUUA 3OIWA 3H9BA 3M34A 1W0JD 1SBNE 3CWZA 4BNWA 4KP7A 3OFJA 2GEVA 3I61A 2Y1DA 1RYNA 1Y3HA 1B6SA 3EE6A 3OOHA 4Y9TA 1EWTA 2RB4A 2O1XA 5AICA 1P4GA 4FYJA 1PV4A 4FQ5A 2ZVJA 3UXMA 4FK5C 1PNOA 3DOCA 2I03A 2P0EA 3NP9A 2EF0A 1JX6A 5A5EA 2Q2WA 4M7RA 4DM4A 2ZDQA 1DCMA 4Q19A 3VISA 4FJCC 1M2OB 4WGFA 3U13A 1AZTA 5U4QA 3ZVKA 1XF1A 3ZD9A 1VMIA 5JBQA 1Y8RA 1BJRE 4ONEA 2W6ZA 3E9MA 2YIAA 5H3LA 4WA7A 4LXIA 2FMXA 2GBOA 1EDBA 4Z2AA 4YAWA 1SRYA 4IRMA 3Q8HA 5ALVA 3BE6A 3AM4A 2QW0X 3OU7A 3KKPA 1K63A 1U1GA 4D7TA 1ESDA 3QEOA 4H77A 2FJPA 3ZXIA 4OLHA 2EX3A 4I46A 2KE5A 4HYTA 1S3IA 2L17A 1F12A 3WA6A 4QE9A 1DKUA 3PGXA 2FZGA 4KO8A 1OI4A 1FL9A 2X8JA 3K1AB 1GSAA 4DJFC 3OZEA 2BFWA 1XZCA 3RYCB 3S8MA 3EC7A 3HBLA 1G21A 5KEIA 5BR7A 3P9SA 4ANFA 3UMMA 1JHAA 4TRRA 4Q4LA 5AJHA 1Q2UA 3H4MA 1ULHA 3GPIA 2HCJB 4JT2A 2XRYA 4QGSA 3V1NA 2D62A 3SPCA 3VBCA 4GPAA 3TD5A 1QCEA 2EIHA 3GC6A 4YI5A 2TRSB 3B70A 2XB9A 3BA6A 1GADO 5IKMA 4Y7CA 3FFWA 2AWNA 4DILA 3R40A 2ODMA 3AHFA 3PVZA 4YJ2F 2WJHA 1VFNA 1T2EA 1DMRA 2HDNB 2IYAA 1BYUA 3QTYA 4FNMA 5KB3A 5FB3A 2IS2A 1SIUA 2WLJA 4FYWA 3E5HA 4WEQA 3EIUA 5EE0A 1H1LA 1RM0A 3E6AA 3SYPA 3O0DA 1DWPA 2YRFA 3RJZA 2OXEA 4G81A 1TC2A 1PL4A 1IQUA 3C6QA 3TLJA 4Q3OA 5KCZA 3SI7A 1W48A 5EEGA 4EENA 2RK4A 2QTCA 2ALJA 1N5MA 4MTXA 3BB1A 2CVZA 2V1XA 1EX1A 1PNVA 1XXLA 3MRXA 2HA5A 5DP1A 5LZ7A 2R8BA 2A9VA 2H4WA 5LZ2A 4F8EA 4F4LA 4HN9A 4IP0A 4G1MB 3AEIA 1XEAA 4R71A 1FY2A 1I3CA 4MKZA 1MG0A 4QL3A 1RJ9B 1W85A 4NG5A 1J7KA 2JFOA 4GICA 3WDMA 4BMPB 2Z4RA 3WO1A 2ACWA 2M2IA 4X6XA 4L22A 1K4CC 4LXXA 2AUTA 4XGKA 3T3MB 1NF8A 5GADl 3II6X 2L69A 3E58A 5KWSA 3A6LA 3BXZA 1DRVA 5DMXA 4I3GA 4AY2A 4XD7D 4AY5A 3B1WA 1MGOA 1KQGA 4W9NA 1SPBS 3A6FA 3RWRD 3E9DA 1XZPA 4PTZA 2OHGA 3RC9A 1LPAB 2BYTA 1XK6A 4N0PA 5CAEB 1MT0A 4QD3A 4FB4A 1SM4A 4DCCA 4G5OA 1KPGA 4DW8A 4EATA 1EBBA 1ORQC 1A5AB 4WV3A 3OTFA 1GGKA 5D00A 4IGKA 3PNPA 4DQDA 2W2LD 4BP1A 3CQ9A 4GSLA 3Q9LA 3NKLA 1NOJA 4K8XA 1WABA 1QCDA 2XKKA 3EHDA 1K8XB 4IDBA 4ARZB 3C3WA 1G5TA 1RLMA 2WFZA 1W581 4P0TA 4GDFA 2W2KB 2QZJA 3WWPA 4YRIA 4KP4A 3RT3C 2Z1UA 1H4VB 4MPJA 4BGEA 3CMMA 2IYYA 3D2AA 2EINB 1ZKMA 4IXDA 2I76A 2B61A 1NBMG 3WL7A 1EJ0A 1AK2A 1GQYA 2VSOA 1T0PA 4D8XA 3G2JA 1NKSA 1P7WA 1IIBA 2PBLA 5FWDA 2CHFA 3FIUA 3O4FA 5AH0A 1CFZA 1IXMA 3IE1A 1DTWA 2XWPA 2WJ4A 4NS4A 3QSGA 5JWPA 1N2CA 2O2CA 2Q8QA 2IW3A 3U7JA 2I4MA 1GG5A 3VHQA 2QAIA 1THZA 2AFIE 4TL9A 5A05A 1PW7A 1U94A 5K3FA 1U7ZA 3O92A 3OW2F 4YBZA 4IS3A 2QL6A 1DQYA 3PXCX 3OP1A 1VQPF 1YITF 3NZEA 3H75A 3WQRA 4QRHA 5REQA 4AY6A 1BQ0A 3MQFA 3H1KH 3LYHA 4LSGA 1Y63A 3INTA 1HTTA 5CBKA 1R7RA 2SCUA 2H4XA 2ITDC 4X6LA 2VYQA 1E3IA 2I0FA 1F2VA 2ATCA 3LNCA 4C2TA 2XHEA 2J8ZA 2YBDA 2EDCA 3FFXA 2H2FA 2J0EA 3WNBA 3D5EA 5JJLA 1NR1A 4EG1A 3NC0C 2HP3A 4RV9A 4LY6A 4OYLA 2HA7A 2R00C 4NXNB 3OF3A 1H6DA 4FBGA 3K96A 5KKAA 3EF3A 2CWJA 1JAIA 5CMUA 4AJJA 4RTLA 4NE9A 2Z2JA 1USKA 3A1CA 4MO2A 5K0CA 3K30A 4FCCA 3VZPA 2PS0A 4DANA 3QWHA 1XQXA 3NRJA 4RF4A 2XDYA 5E7IA 1A8QA 4GYYA 3EXHA 1UJ2A 3A0UA 1AGYA 5CJPA 3AERB 1I3KA 5IM5A 3AR5A 2F7SA 4MWTA 5KA5A 3K20A 1C4XA 2EZ9A 3NWBA 5DISB 1QFZA 5K8LA 3KDSE 2OVBA 3GJZA 5BT9A 5GJCA 3UHAA 3KJQA 4EL5A 4D79A 1U0GA 1JWBB 3TOXA 4RLHA 1L5OA 3TH5A 3TFWA 1PQYA 2B37A 1ODCA 3X2SA 2NYVA 3RJ9A 4Y8VA 4BKMA 4A8HA 3LSSA 3PU6A 1LXCA 5EQTA 4Q1BA 2VYND 4EDHA 2QVYX 3H86A 4GHWA 4IKEA 3ZBPA 4CMEC 2HIGA 2Z9BA 4BVLA 4QJ4A 4H7IA 1TAGA 1KEEA 2AW3A 2Y1GA 2W6IG 2QT1A 5EXDA 1QH8B 2GRUA 1L8DA 2NUTB 4OHVA 2POQX 5LYJA 5IZCC 4OK5A 4RCYA 1XDGA 1E6MA 1C7EA 3U60B 3SHFA 2J59A 1T6NA 3EUAA 4TGLA 1NI8A 3J81k 2GBLC 3DGFC 4NUTA 4DABA 1O4WA 1N4DA 3UANA 4RF5A 3VV2A 1WA8B 2RB9A 3L7KA 4DMFA 1PSDA 3K70B</