5LP6B

Crystal structure of tubulin-stathmin-ttl-thiocolchicine complex
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tools for the rational design of bivalent microtubule-targeting drugs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 154
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5lp6B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5lp6B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5lp6B01
3R4VA 5LYJB 5M7EA 4B46A 3HKBA 4FFBA 4U39A 3WGNA 1TVKB 1W5FA 4F6RB 3HKCB 1W59A 5LP6A 5J2UB 4X1IA 5JVDA 4I55A 5GONB 2RHOA 5IJ9A 5J2UA 2VAWA 4KWEA 3HKCA 3JAKA 2Q1YA 1W5BA 3HKBB 3JARA 4IHJA 5EIBC 4I50A 1SA0A 5EYPB 5MN6A 4O4IB 1Z5WA 4O2AB 4IIJB 4O4HB 3HKDA 4ZHQB 2RHJA 3JALA 5FNVB 4O4JA 4X20A 5LA6B 4F6RA 4X1YA 4EB6B 5IJ0B 4DRXA 4ZI7A 4LNUA 5LXTB 3N2GB 5IYZB 2R751 2BTOA 5JH7B 2GVIA 3ZBPA 3VO8A 4X1YB 4X1KA 4EB6A 5IJ0A 3JATB 4O4JB 4X20B 5LA6A 5CB4B 3JARB 5LOVB 3RYFB 5JCOA 3VO9A 4YJ2A 4IIJA 4O4HA 1RQ7A 3RYIB 1FFXA 4O4LA 5JQGB 4I55B 5GONA 5J2TB 4EI9A 5LOVA 1W5EA 5CB4A 4WBNB 4M8IA 4TV9B 3UT5A 3N2KA 3JASA 5EZYA 2VAPA 5C8YA 5IYZA 3N2GA 4LNUB 5LXTA 5LP6B 3VOBA 3JASB 1TVKA 4O2BA 4I4TB 3E22A 3C8LA 3WGMA 5BMVA 5ITZA 5LYJA 3ZBQA 5FNVA 4YJ3B 3CB2A 3JALB 2XKAA 3VOAA 3RB8A 3N2KB 5EZYB 1OFUA 3JAWA 3RYIA 4B45A 4O4IA 5JCOC 1SA0B 5EYPA 3RYHB 5CA1B 4XCQA 4IHJB 4EI8A 4I50B 3JAKB 5J2TA 2RHHA 3RYHA 5CA1A 2XKBA 1TUBA 5KMGB 3JATA 3V3TA 1JFFA 4X1KB 2R6R1 4HNAB 2RHLA 2VXYA 4X1IB 5JVDB 4TUYA 3RYFA 1FSZA 4DXDA 5MN5A 4HNAA 2Q1XA 4U3JB 4ZI7B 5BMVB 5ITZB 4DRXB 3E22B 4TV8B 1W581 3HKEB 4TV9A 3HKDB 2VAMA 4WBNA 3WGKA 4O2AA 5CA0A 1RQ2A 5MN4A 4I4TA 4O4LB 4O2BB 3WGJA 3WGLA 3ZIDA 4TUYB 5KX5A 2BTQA 4EI7A 5LP6C 3UT5B 1Z5VA 5EIBD 4U3JA 1RLUA 1W5AA 5JH7A 5IJ9B 2BTQB 1FFXB 5JQGA 5KX5B 1JFFB 4ZOLB 3RYCB 3M8KA 1TUBB 4YJ2B 5KMGA 4FFBB 4YJ3A 3RYCA 5CA0B 4E6EA 4ZHQA 3JAWB 3M89A 3VPAA 4ZOLA 4TV8A 5C8YB 3HKEA
chains in the Genus database with same CATH superfamily
1THGA 1K6EA 1XTSA 4JEUA 1QWOA 3FB1A 4E5KA 5M7EA 3LNTA 1FPQA 1Q82W 4R31A 4C8EA 2MOKA 2A0YA 1QVWA 1PU2A 4BY9E 1T9AA 3QE0A 3THOA 3U10A 1O6ZA 1XD2B 1SETA 1I10A 1NMZA 2VTDA 3H5NA 4G4JA 4MI9A 5DNCA 4WTOA 2X8AA 2V9YA 1J20A 1RAEA 2ACVA 1Y5LA 3SDLA 2YCLA 4OOFA 3NIFB 1U7UA 4ETMA 4BVKA 2AG1A 5C53B 1QV9A 1H6BA 4WK0B 3HKDA 3GMTA 5IJWA 2PRIA 5HK9A 2HIHA 2PGIA 5HMLA 1Q91A 5JPCA 4MW8A 3MINB 3CTPA 4FE3A 2ANCA 4NRDA 2LJ2A 4OHVA 5DHTA 2R8RA 1W36B 3OQOA 2OXTA 4HDOB 2VJYA 1Q1QA 3N6VA 4M83A 4CUJA 2VSQA 3HI4A 3OJ0A 3IVMA 1XU4A 1FYDA 2KSQA 1YKSA 3V7QA 2OUKA 4FZRA 4HH4A 3KJXA 1ZLYA 2CTWA 1IUNA 5DNDA 4R8MA 5EGSA 3SPHA 1JILA 3ZDCA 3AKYA 1YSCA 2TYSB 2PYLA 2RIPA 3L73H 1CX9B 2ZRAA 2D1YA 4I1IA 4RD3A 1ZR4A 2HCRA 1KR5A 4LRYA 4I55B 4OK5A 4G4VA 1CEZA 1VHLA 3K5LA 5FHRA 1OROA 4K81B 4G5SA 2GD0A 3ZHSA 1HKHA 3U3MA 4BZPA 4NARA 3S0YA 3SHFA 3PTLA 4OCZA 5IASA 1PJAA 4GOMD 3WDKA 4F6CA 4R1UA 4IILA 4N6OA 1EQUA 3ZWKA 4AD8A 1RJ9A 1SGWA 3E8SA 4F71A 2VL7A 3P3PA 2ZDIA 2PCJA 3SK0A 3L2OB 4BLUA 1NNEA 5FLXM 4LF5O 5E38A 4ZQBA 3ZY4A 2QP3A 4ER0A 1TB4A 2QA4V 2XX3A 2BEUB 3OLZA 2CN1A 4MIYA 4US0R 1FS5A 3RE3A 4IG9A 5CA1B 5HF9A 4YV2A 4WE3A 1CUYA 3A3PA 4RPKA 4RUKA 2I3DA 1KPHA 1PL7A 1G4HA 2I80A 2QS9A 3DOFA 2IDMA 3E9EA 3IT0A 1BSMA 2NO5A 4XGRA 4LKRA 1LRKA 1SZJG 1K4YA 1H0HA 4YUVA 3TSWA 5KU7A 3D3IA 4L3WA 3LQKA 4KQCA 3PEYA 5A71A 4C08A 3H18A 1QFZA 3A1DA 3IXMA 1GNPA 1ZINA 4M8LA 3K9WA 3ISVA 4DIEA 2MHCA 3UMMA 1M0TA 1P33A 2D4AA 4G2TA 1CIPA 4D4LA 3KXLA 4JCOA 2XMRA 3IHTA 4Q93A 1BCSB 4RSRA 5JYEA 3M7IA 5H5JA 4ZYXA 1DCKA 1TNDA 2IBMA 3AUXA 1IOWA 1FXSA 1V3UA 3GEIA 5DE3A 3JTEA 4EGCB 1R4ZA 1ULUA 4RHAA 4L5CA 4XYBA 2MSEB 1X7ZA 2PL5A 1FQWA 1RNLA 1ZU5A 3DE1X 1HOTA 5KJ1A 2EFDB 1MOFA 1KO7A 4R8SA 1YHNA 4WIAA 2X3UA 1YRHA 4L85A 5HZKA 4AK9A 2HGSA 4X41A 4D9JA 4EZIA 1L7DA 2O8DA 2ZCEA 3MD0A 7MDHA 3A6HA 3PCRB 4OAOA 5JEDA 5AOAA 3SYRA 4AJHA 3HM2A 5IABA 1Y66A 3U5ZB 2P79A 3D3NA 1FKAO 1ZNYA 1J9ZA 2GNAA 4R3UC 4V24A 5C4GB 2JCYA 2OB2A 5FV4A 4DA7A 3HJAA 1NFFA 1T8TA 5ALYA 2AG5A 4LWZA 2H29A 3ZDFA 4YV1A 3ZHQA 2CMFA 5CEFA 4BQEA 1O4VA 2DBQA 4OGQB 5K1XA 2HFKA 2IXDA 2PYIA 3RYCA 4G01B 3FPAA 4I5FA 1LK5A 4KX5A 2MYNA 4GP6A 4N41A 3BFKA 3SC3A 4J7JA 2E5WA 3HDJA 4MVQA 3HFGA 2DG2A 1LDMA 4R9UC 3L9DA 4GZRB 3KVRA 5D3MA 3EW7A 3ZD8A 2FLWA 1DWPA 2VT2A 4J76A 4PN7A 1L5HB 1V41E 2A4MA 4QJFB 3DTVB 5LGNA 3OA2A 3ZLTA 1JHQA 3HWX1 4B48A 1IUKA 1NPYA 4CEJA 3SDBA 4X7MA 1HM5A 3SVZA 1KWKA 3ORSA 3KG2A 1JQKA 2P9HA 2V7XA 1FDOA 3JYLA 3P2IA 1NNSA 3SLGA 2WU4A 3DCIA 4D4JA 2UXBB 4ZHQF 2R97A 4A82A 5F5XA 2BEWA 2VKTA 2DYSB 3HRKA 3K79A 3PDUA 4OGKA 5FBQB 2PH5A 3P0RA 1Y1SA 1Z7BA 3M8AA 2G5CA 2W37A 1U0RA 3B9PA 3QFRA 2GPAA 2EVWX 1ADBA 2VP2A 4M0UA 4OB6A 4ZCRA 3C3TA 1PK7A 2GRAA 2O2XA 1GN2A 3DPUA 3SU8A 3M1LA 4E2WA 4NYMR 1ZW6A 3SQOA 4DB2A 2UYNA 1OU0A 2C88A 2HO5A 3T34A 3ZBPA 1E8MA 3FDFA 3NFRA 4E6PA 3GFTA 2WMYA 1R9GA 3UCFA 3MK31 2J59A 4MW6A 3ZZNA 4F1JA 1SC3A 1II0A 5CB4B 1RM1C 1NC3A 3CCLV 1PSWA 1BE3H 4ITVA 1TKAA 4B6JA 1RZRA 2VP3A 5L4NA 3PJEA 4EHDA 2RNBA 3A0BZ 3SE7A 4N7RA 1WA8A 1JJBA 1L7XA 2QV0A 3Q8WA 1Q86W 4L27A 4OYRA 5A6SB 1JFVA 1NGSA 3FIUA 3GLIE 2WTUA 5EHGA 1X7DA 4MDYA 4B7XA 2WHEA 2CD9A 3E53A 1DPGA 1MF7A 1QS0B 2GEBA 3CR8A 2JGUA 1BEZA 1FQJA 3ZWMA 1VQVA 2FPGA 1KI2A 4PF1A 4MYTA 5JVDF 3UMGA 4LGMA 3V55A 3KR2A 3ZDYB 2EIXA 1A9TA 1LKZA 5A3QA 3AY3A 1ILWA 3KEMA 2EIJB 3FHTA 4YCMA 2OZLB 2W58A 3NC4A 5IKXA 1AUPA 1I94B 3UJNA 4B45A 5TQ0A 3PWTA 3LMEA 1SD5A 4CF7A 5ARCA 3KSMA 3BERA 1P29A 5D5QA 1ONNA 4D42A 2XZTA 3ZI0A 2A5LA 4WZAA 3WRXC 5K4HA 3EXFB 3DEFA 3FZGA 4R7TA 1IY9A 5CNJA 3ZMSA 4Q82A 5DT9A 4K9KA 1SD1A 3RSHA 1ZCZA 3IKVA 4GDFA 4B6OA 3HPRA 4H7JA 1YJWF 4XX0B 4K1XA 1NHWA 4MUGA 1KFKB 2NXCA 4B6RA 3BH0A 5TXGA 3O83A 3MLAA 4IXTA 1J39A 1MP0A 2JBAB 3OPMA 5DW3A 4GPTA 4J8PA 1ESCA 3ZZ1A 3AI7A 3QMVA 1NDQA 4G5GA 4HQLA 721PA 3NK7A 3FLMA 3K5PA 3OZWA 3EY9A 1NH2B 4FW9A 4BBAA 1TPYA 1LUVA 4EW2A 2ZI9A 3O8LA 4KRGA 4ENRA 4E07A 2FZGA 1OI4A 1ZFNA 2FDRA 2PX8A 4FM2A 3B1XA 3HB7A 4QVKA 3TNLA 1C8KA 4F7WA 4HAMA 1ONSA 1JXMA 2HBRA 2B0JA 3OKCA 4MTGA 1UJCA 4IS2A 4M7WA 4S2UA 1RYDA 5IKOA 5CD9A 4H15A 1CR4A 1FP4B 2NSYA 3P9CA 1E1KA 1D07A 3HU3A 4NY1A 4QRDA 4RZIA 3EHEA 4H13B 3CYQA 1Z16A 1U0JA 3DC7A 2FQYA 1DXHA 5AKYA 5TY0A 1YJ9V 1PT7A 4CKCA 5K6AA 4W5QA 2D7DA 4BVLA 2QI9F 4YJ2F 2CL0X 1BYIA 3WL4A 1OR8A 3AR2A 4MWBA 1QIEA 3OMIB 4CMIB 2GZ3A 5ADVA 3MBIA 2C7GA 2OHOA 3N39C 1EHYA 2AJBA 2WAMA 2JG3A 2OT5A 1V71A 4GPAA 3QKWA 4Z8XA 2GA8A 2CFRA 4RIFA 1UWVA 3TL6A 2FXVA 3GFBA 1XQVA 3UK1A 3ELBA 3N75A 3U4CA 3WLEA 4TVBA 1T2DA 1F3LA 3AW9A 3A6FA 1TC2A 2Q9LA 1F17A 3A6JA 3LUFA 5IM5A 4Y2TA 5JSKA 1T5OA 4H1VA 4TM8A 1W5BA 2XD4A 3UWKA 1IHYA 2VYCA 4KBFA 1VP9A 5F9HA 3CWQA 3G5MA 1L5RA 4GEGA 1YITV 1AUQA 2FR1A 2BH2A 1T15A 1JCHA 2PKYX 3ED1A 3OIFA 1ML3A 4ITUA 4UNQA 1NT2B 4JI0O 1IK4A 2VSFA 3GCZA 1FJXA 1XEXA 3RBXA 1CR1A 1QCCA 3FOEC 3JQPA 1PFQA 3GGSA 1KD1H 3KKNA 2AOUB 3I8XA 1A7KA 2JI6A 2WVAA 3IQDB 4PDRA 2BTOA 3Q7IA 4GAEA 2MSLA 2V8OA 1XTZA 4RNDB 2PFGA 5KHIA 3V3KA 4JU8A 5H3LA 3RVLA 2YXYA 1JY8A 4YQFA 1DBIA 2P62A 2ILMA 5CW1A 4ALJA 4BLWA 1K7DA 1RC1A 4BHTA 3LYUA 4BFLA 4DABA 4UB6Z 4Y9UA 4BO2A 2BCCH 1WUTA 4G28B 1ZTEA 5JQGB 2JKZA 2XNKA 4F93B 3DFUA 3QYAA 3HR8A 4CQMD 1EGQA 1R6DA 3OR6C 2HMTA 3IRVA 3L1IA 5ICCA 4EHJA 1H2NA 2HVKC 3CW8X 4BAZA 3EWIA 3SWWA 4MUIA 4BNNA 5C37A 3L8HA 2YC4C 2W4QA 1E5XA 1T5HX 3BD7A 4JUFA 1V4NA 3COVA 3RS9A 1XEQA 2J41A 1IFXA 2BI4A 3DKPA 1CY0A 3JD3A 3EY4A 4PIVA 4RIHA 5EVJA 2FMKA 3LNMB 3F2IA 3L0ZA 3K1AB 1DE0A 4R01A 1F2UA 3HR0A 2VHYA 3BL5A 3F71A 4S0XA 1NM5C 1HDCA 2FSSA 3T4EA 4BO8A 5EUBA 4ER6A 1T1GA 3OQMA 1OT5A 3RG2A 2RH5A 1QIFA 3G9UA 4Q39A 4FLYA 4UMFA 1IM8A 5FA8A 1XYVA 4LQLA 2HS4A 4CWAA 4KLNA 1LF5A 4EW1A 4E5NA 3RVOA 1NZDA 3ASVA 2XYVA 3C9RA 3OT4A 3PA8A 1QQTA 1YHQV 2ZYDA 5B3JC 3E9RA 3EVTA 4RAQA 5LB2A 2I55A 2Q6AA 4UBIA 3KAPA 1VF5B 3K03A 1LBTA 3LVFO 4IKEA 4P7JA 4BQFA 5LJLA 4HAXA 4PHTA 3EZYA 3HVJA 4UASA 4AWAA 2QROA 3K05A 1SZPA 2IYUA 4BO7A 3OTOO 3NVKE 3IBSA 1ZRNA 5F1OA 3KE8A 3JAMA 2YN2A 4BLVA 1PR5A 4UXNA 4R9RA 3NU1A 4O2BB 4C7BA 3V6LA 3RQIA 1II8B 5EXTA 3KWFA 3OQBA 1GTRA 3PNYA 1FMLA 3OW2F 2VR1A 4J43A 4L5JA 3RODA 1V9LA 4DT1A 2AN1A 4IIDA 2Z9BA 3P3NA 4RY2A 5REQB 2F1RA 3SS8A 1KXZA 4QU8A 1QQ7A 2ZYTX 1EFPA 2YHIB 2IQQA 4WV3A 4QYIB 1PR1A 1IIRA 1FFXB 1Y1RA 4EA6A 3QF7A 1DG9A 1KEWA 1WW3A 4WCEV 4PPGA 4IL5A 2VF4X 1YZQA 3W8FA 1PW5A 1NF3A 1LU9A 2GN1A 2JF0A 2OMKA 2NUPB 3B1FA 1P4JA 3D4LA 1GDDA 3DWFA 3LQYA 4M0LA 2NUTA 2O19A 2WPNA 4QLAA 4EGSA 3QFFA 2NQTA 1SC4A 4IIVA 1T0JB 3H17A 3OQIA 3RARA 4YAUA 1G0NA 1RR6A 5HRAA 3FDXA 1JFRA 1VOTA 3KAQA 3U0BA 3KQHA 3I0MA 3WGNA 1SK9A 2XTZA 3QMPA 5IHPA 1RM4A 4RH3A 2VWHA 2OBNA 5L3QA 4LI3X 4KQJA 4PRZA 4ZD6A 2WKQA 1W2GA 1KFJB 1XKLA 4K40A 5KTOA 2LUOA 4NS1A 2ECFA 2GCGA 2OE2A 5PGMA 4V03A 1N6OA 2IC5A 4YXFA 1SUSA 4WWHA 2A57A 2VUHB 4HGOA 3OHPA 5GADl 2I1VB 1NJIW 1Z5WA 1J06A 5IVHA 3NJ8A 2D00A 4PC7A 4RM2A 2CFIA 1LBSA 2AOUA 3DT6A 4P4SA 5DT2A 2RE8A 2WPDA 1A9ZA 4C89A 6PFKA 4K2AA 3OBIA 4JYAO 3U62A 1E9EA 1JEQA 2R25B 4ZFNA 5D1NA 1IJEA 1LS6A 1GYPA 1LDNA 1UZAA 1WBDA 3F3YA 1XN1A 4KVZA 4LOHA 3IQWA 3WS7A 5BWOA 2GVIA 4AZ3B 5KSYA 4X63A 1DMRA 4DV5B 2ZSKA 3MCZA 3QUAA 2D7JA 3B5JA 2IVZA 1GAXA 3F0EA 1PR9A 2W6PA 2AOTB 3WR5A 2W71A 3KUKA 3VQVA 1CJKC 3JZDA 1OAKA 1YE8A 3NZEA 4M0CA 5E9JA 3K06A 2XLBA 2NZ8A 4ZGGA 1VLJA 2JL1A 1V1MB 2OLKA 4G09A 1W5EA 4BNWA 1XMOO 2G07A 5DU2A 2G0AA 4U7TB 1JLLB 3AJ9A 4MZXA 3UXHA 4YMTA 4JODA 2B3DA 2R4UA 4D9IA 1WU8A 3G4SV 4RSHA 1PZGA 1JHAA 3JAMM 2PBLA 1N5OX 3OECA 4LQDA 4J3NA 3FAZA 3T8YA 2A9OA 2OORC 1GL9B 3F6CA 2F9ZC 4RTKA 3OZXA 1I5RA 4B3RB 1G4AE 3HR7A 3M3HA 1R6AA 5IUJC 1RYBA 1USUA 1OA0A 3STYA 4DDUA 2BMVA 3GPBA 5TB5A 2UXNA 3JPYA 1P0IA 1UOQA 3BORA 3CUUA 3FSGD 1NVEA 1R1MA 2Q4TA 2RH8A 4OU4A 1OFTA 2IP1A 2FSVC 2QM0A 1VE3A 4KBYA 3QLTA 4UFOA 3T1YB 3EQ7A 5JYDA 3CJHB 1E1RG 3K0FA 2JI8A 2NW6A 2AXPA 4MI6A 4UPVA 5F3RA 4COKA 4UAUA 5TISZ 2PL9A 4YECA 4Z49A 1S7GA 4RUEA 3W7SA 2GHTA 3OBWA 3MJDA 1JQBA 3NIDB 5D1HA 3TJMA 4BB5A 3EPJA 1BG6A 2ZI6A 3FMOB 4OYHA 3CO0S 2DWOA 3RS4A 1FBNA 1I7DA 1CF4A 4R7CA 3X2QC 2Q5IA 5EC2C 2JFWA 4MTOA 4OPHA 1L5GB 2NLOA 3LQ2A 1CZKA 2AL7A 1CZOA 2GA9A 4JLDA 4R1NA 3SXPA 3C1UA 4CI9A 4DJFC 2RJ3A 2V03A 3PE6A 2PMKA 3P9PA 1MT0A 3AFIA 3VAZA 1Y34E 1A4UA 2PKEA 3PYMA 4L0QA 1GA4A 3TQIA 1JSRA 3GLFA 3V2UA 4K8RB 2CZQA 2FSFA 3KXDA 1DDGA 1WCYA 4C1BA 4CMCA 5AHWA 2ZZNA 3BICA 1X1RA 3ITKA 5F7XA 3WG7C 2A30A 2E87A 4J16C 3LBAA 4IIHA 3NONA 3WTCA 2UZAA 1ZO8A 3NHLA 4U2EA 4MKHA 1C3VA 4Q4JB 3A6DA 3E84A 4B75A 3QELB 2BZGA 2QJRA 1P5RA 5TLSA 3RIGA 4CCYA 1WMEA 2QJWA 3GZTB 3APQA 1T8RA 3IULA 4O08A 4E5DA 5CEJA 1RPTA 3A1EA 3VVLA 2HLDG 2N46A 2Z58A 4C7OB 1QVGU 4R3WA 5K0TA 1LLDA 5LKRA 3CWCA 4C2UA 2D2IA 2UKDA 1E1YA 2PX6A 2HQSA 4QOJA 4QWMA 4RZ3A 3P9ZA 1O7JA 4P5PA 4ZP1A 2QKSA 3ABMB 1LDEA 5G0TA 1CU1A 3E9ZA 1K9MW 1ZHHA 2XRFA 3DPIA 1CJBA 1E1CB 2X7XA 2VZ9A 4M60A 4MUXA 4U7DA 2OWOA 4ZRMA 4I5DA 1JMYA 2R1ZA 3E9DA 3EXAA 2A9VA 2PS9A 2NX2A 2YRXA 2RJOA 4JH0A 1TRHA 4MGHA 2CLIB 4LSMA 5ALFA 1VBKA 2IHYA 1VPLA 3AF5A 1N1GA 3PI6A 4P8RA 3T4DA 4QXPA 3SR3A 4WL0A 4ETIA 1UQRA 4JLSA 1ORTA 2VQEO 1WA5A 2XWQA 2HMYB 1E2HA 3BSSA 2R70A 2I2BA 3GBSA 3HWRA 3O4FA 1EBFA 4QQRA 4WT7A 5IBPA 3GWGA 4B8ZA 5EB0A 3CEMA 5JPDA 1RJEA 2IXAA 5LR6A 2ZIEA 3GRVA 4XYLA 3BWMA 2WAXA 4I1RA 3FNGA 4H08A 4KZKA 3F90A 3ZI7A 4LBYA 5CT9A 5LIPA 2GZDA 3KKPA 5A3RA 4N12A 4FYMA 2ZRKA 3ICEA 3VPXA 1I0LA 2G25A 4XWYA 2HPHA 5JSQA 2R5NA 1NH2D 2YXNA 3FA2A 3SX0A 2QEQA 1V1MA 1YHYA 1JVBA 3HBAA 2MW2B 4JZGA 2WR8A 1GCUA 1FXHA 1NF9A 3N5CA 1D0IA 5CT4A 1GL6A 5BUSA 3C9UA 2DBZA 1KP2A 2WYWA 2PYZA 3IE0A 2OORA 3WK6A 5DXFA 3QF4A 3VBCA 2W2XA 4OHWA 3TLEA 1BHQ1 2V6JA 5MFPA 3H6HA 3SPCA 2RBEA 4RD1A 4P0QB 2Y1GA 4HUJA 4EYSA 1YMQA 3VDNB 2FWNA 4PG4A 1EUYA 4KIWA 4ATNA 3C74A 3EUAA 2YKGA 1L4NA 1LC0A 2YBEA 3BIWA 2Y0PA 4GE0A 3ZYCA 4CLEA 4J9YB 1BH2A 4RO2A 3AF0A 1EA7A 3P8ZA 5IAOA 4O4IF 1K66A 2GOYA 2RHHA 1OCZC 1G4UR 2EDAA 2GPJA 2XKBA 1BMFA 1RYZA 1TJNA 2UYPA 4PD4F 2R9IA 1LH0A 1U2GC 2ZYRA 4Q47A 4R5MA 1G8JA 1YACA 4M98A 4C0HA 4EARA 2ZYUX 4Q3EA 5HUJA 4NJEB 1XEFA 2JJ2G 1TT5B 3TFWA 2AN5A 4OFZA 1YBMA 1C9EA 3M6LA 3V1LA 3WYBA 3V1MA 4H1HA 1J33A 4I55F 2YW2A 4AO6A 4CEIA 4BJ1A 3A25A 1JW9B 4GGMX 4L2IB 2A7QA 3RSCA 4TYYA 2HNAA 2ZUWA 1Q92A 5KLVH 1TTTA 4Z1MA 3A2NA 2LW1A 3N8IA 1PD1A 4ZOLF 2OBYA 1QHEA 2NXWA 4DZZA 1CLIA 3OM1A 5DSTA 1ZUD1 5HKLA 2DYRC 3PVZA 4L9SA 1GG2A 2WJIA 3H9UA 2Q6TA 3KBOA 3KZNA 4LYJA 1X92A 2OHGA 5I9MA 1BIFA 1RXEA 3DCNA 2H2FA 4L1KA 4UPEA 2P2CA 4WZ6A 2CLOB 5F51A 1CF2O 2FX3A 1YFZA 2R9VA 1GKYA 1JG1A 5C31A 1NUSA 1QGUA 3DDOA 1N6HA 3UBMA 1YR3A 5JEEA 5HRUA 1Y4AE 2H2HA 1I6KA 3E83A 1ZIXA 4DEVA 4EVSA 4LRWA 3M1YA 2RSLA 3E2MA 3KO8A 3C6ZA 3L4KA 2MYTA 3ABZA 2VDVE 2XBUA 3I9V1 2IV2X 4W1RA 4NAVA 2NU8B 1JEDA 4ALMA 1N2HA 1TU0A 1A5AB 2A5FA 2D0PB 5G4UC 5B66Z 2HTFA 2P2YA 3CXHF 5E7JA 4GT1A 3ZJ5A 3HM9A 1VCIA 1GH6A 2FRDC 2H31A 3BFVA 3NBMA 4FIZA 4DUYO 1QC5B 2KQXA 1THTA 1EUDB 3LWQC 2XXBA 1FNJA 1RYMA 3OEED 2VWKA 2X5KO 3NTQA 4QELA 3FYTA 1GM9A 3K35A 2Q3CA 4G4SP 3STTA 4BE7B 4BEWA 5KC9A 2D8MA 1I3CA 1T4GA 4IOLA 2G83A 1G41A 5H7XA 4UNSA 1Z8FA 3WYDA 3EZFA 5DM6V 1BROA 1KAEA 3LI2A 3ONDA 5FNVF 5H3CA 4QREA 3FRIA 4LRQA 1N8RH 1TJYA 1GKUB 1R12A 3A1CA 1W5SA 1PJRA 3CX7A 3H4IA 3HJUA 3IESA 3PGVA 2Z2IA 4PIPA 4XEUA 2BFDA 5JAMA 3D8HA 3L82B 4OLHA 1W85A 1EWYA 4ZT7A 4JBGA 3OFNA 3Q12A 1GNVA 1Y1PA 3FJOA 4P6VF 3WNDA 3LQ4A 1BH6A 2IS2A 3R5TA 4DSAA 1TVEA 2BGKA 3Q3GE 4BLSA 1QQ5A 3CZ5A 3KYCB 4AT1A 1HL7A 3LC1O 3SC4A 1B8VA 1W96A 1GGJA 3VYSB 2FPPB 3KFLA 4QBFA 2C07A 5CG2A 4RC9A 4KP4A 3WE7A 2EX4A 1RI1A 2P4HX 5JNVA 1QGED 4J0KA 3GG2A 3UT6A 4NYJQ 1TFUA 4CM5A 1OX5A 1P1IA 3AIOA 1WDKA 3DZDA 3MQ2A 4Y2RA 1TJPB 4LVCA 3DLIA 3S1SA 2QSAA 5A4JA 2E5FA 5L3QB 1XZDA 4JL5A 4E5PA 1FXUA 2P1DA 1YI2F 2YWHA 3B70A 4FYYA 4WFKA 2HB6A 4EPTA 4MKXA 5EIWA 5LDDC 3ZDEA 3JVVA 2XOXA 4FHCA 3T0GA 1MAVA 2IH2A 4DJ5X 4UVAA 2ZBUA 2F66C 1W0JG 1CBUA 1MW9X 5MGBA 4DMUB 3E6AA 3U39A 4FHEA 3CCJF 1Y33E 2PGAA 1W0KA 2HA0A 3NS7A 4P4SB 2QMUA 4CCYB 4ZN6A 1UBUS 3YASA 4CUKA 5FFFA 3WJ1A 3TZQA 4RWEA 2OPBA 2BAGA 3WC4A 4TVOA 4UUOA 4NCNA 3W78A 2QM7A 1DSSG 1WUKS 1LWNA 1X1SA 2CBGA 5IE9A 3ORYA 3L7OA 3OEHG 4QECA 2QENA 2GLZA 1H93A 1PR6A 3E86A 2YXDA 1UIMA 4LEIA 4PZAA 5CLQA 3FSRA 3ZGVA 1OBHA 4DKXA 2G9ZA 2CLEB 4M0PA 1GGHA 3H05A 2UYCA 2WJGA 1QDUA 3PC6A 3WB2A 1VKZA 1F8FA 4U6QA 4E33A 1I6LA 4MVJE 2F4VB 5CBPA 1XHOA 4RQFA 3AESA 4HMOA 2NU9A 3ZWDA 3BFRA 4BNUA 5B3KA 3ZI4A 2GF9A 2AZTA 2GNPA 2YMMA 4KIUA 4KSYA 2WWHA 4MHOA 2HAEA 5FHQA 1UOPA 4OFBA 4BX0A 1QO7A 3LO8A 4XQ0A 1BDMA 3IUMA 3QTLA 3ZOPA 4OQLA 4XDZA 1XMXA 1XRMA 2B6NA 2W22A 2DMXA 3G9XA 3R5XA 4JDPA 3EDYA 1OBFO 4M8SA 1T0KB 3O03A 2IE8A 5EIFA 1SZCA 5BSEA 2YIDA 1GAJA 1CZRA 1HTTA 1VTKA 2MU1A 1IQRA 2VT7A 1HYGA 5F1YA 2PTMA 4BBJA 3ZGZA 2VUSA 3WWPA 4CMEC 4ZCMA 2ZB4A 3L8GA 2ISSD 4EA8A 2V4UA 2Q73A 2E6KA 2PWPA 3BN3A 4PONA 4EG5A 5FNZA 3KZ1E 4WX2B 5IARA 2PKXA 3DSQA 2WZDA 3COWA 3FRHA 1XNQB 5JS7A 3H6GA 2VI5A 3UB3A 3OH8A 3PLAE 3ZXUB 4DYVA 1XMOB 3EB9A 1ZUNA 1UIRA 3CQ9A 4P98A 1BE6A 3B1WA 4OGFA 1OFUX 4LF8O 1ETHA 2I6DA 3CPJB 4E2ZA 2B9VA 2GYUA 1MFPA 4WNAA 2FRVA 4Y9DA 3WBFA 4F92B 4OVKA 2ZP1A 3H5RA 3WHPA 4YLEA 1PR4A 4YRDA 3R9XB 4HZUA 2CHSA 5KHOC 1J7HA 2HPZA 1T1JA 1C7QA 5KYWB 4DCUA 2H06A 1MIOA 3SXUA 3QRWA 4QFDA 1DQSA 3AG2B 1E2KA 1T2CA 1ENYA 3K0TA 1HYBA 5K51A 1O0CA 5IYZB 2ZRNA 3AR9A 1YS7A 4LJAA 4TTVA 2C29D 2P5YA 3O75A 4NZPA 1VA4A 3NVDA 3PUVA 2CF6A 2QPLA 2GS9A 1P60A 3RABA 5FR2A 3W6NA 3SMQA 2OZBA 4QIWF 1MEEA 1SM4A 2O4UX 3ELWA 4GLLA 4MNTA 2FEPA 2H4ZA 4IIJA 2I7DA 3TIVA 1Y8RB 3ESCA 3NHRA 3ADBA 3LSSA 3IJPA 1D2AA 3TJZA 2QTRA 1B43A 2Q5LA 2ZPTX 3S2SA 3LO5A 2B34A 4K05A 1D3AA 4C21A 4MDFA 3R8FA 3QVGB 1DFGA 5H9VA 2NACA 3NM4A 4ZVNA 5TMPA 1DO2A 1R6NA 1WXIA 2AI2A 4L16A 3CS5A 2E0IA 2YI9A 1TT5A 3EVEA 1R4MA 2JI4A 1OLUB 2DLCX 3ZBQA 4YUWA 4RIGA 3AW8A 2ZIZA 4UHEA 2E4AA 2GN4A 2LBTA 4F5YA 1Z0IA 3N2KB 4BNFA 2PX5A 1Q0PA 4LECA 2YWGA 1PEKE 3FPSA 3G2LA 5EYPA 2CB9A 3LTEA 5TF0A 3ZX4A 3IJRA 4ZTBA 2H9IA 3H97A 1COWG 1QJCA 4MWSA 1E20A 5EINA 2PZMA 1I13A 3KQYA 5JXIA 3ZCRA 3TD3A 1CWUA 1E1MA 2A33A 1SVLA 2GD2A 3I45A 1N9GA 4X1KB 3ESAA 4HNAB 5DCVA 1SXJE 2KB0A 3LM8A 3BK2A 4FDLA 4WJKB 5KQLA 2A1UB 3EHBB 3SPIA 1ZM9A 2QRUA 3EARA 1DCMA 1TGVA 1C0LA 1MRZA 3X2FA 4A6DA 3H9EO 1NVUQ 3FETA 1B74A 3B6IA 4QYWA 3T52A 2ONKA 5FLXA 4IT5A 3GPIA 1HT3A 2BDEA 2QUKA 3QHAA 4LF6B 3W79A 4AY4A 3L4JA 1YL7A 3SVLA 1ZMXA 4G9BA 2VA9A 1P7VA 3JXEA 3LY9A 5HFMA 1XJ5A 3GZNB 3QIAA 2JGJA 2Q7XA 4MJ3A 4FP9A 1YS2X 4X97A 2WJZB 3IEKA 3OZCA 4I4TA 3CPSA 1P1FA 4DLTA 4D25A 2AMYA 3ELUA 1PNRA 2YEVA 1A8IA 4JI6O 3WNVA 1D5CA 1DHTA 1DKRA 3MJVA 4A27A 2YY5A 3U7JA 4Q9JA 3EQ2A 3RK4A 2HM7A 2G7ZA 1CXZB 3THXB 3SKXA 3AVPA 4FMBB 3GOHA 2CYAA 4UMEA 3I83A 4JJAA 4HVAA 4RVCA 4TS4A 3RVDA 4BNLA 2Y27A 1YVUA 3W7WA 3VBEA 1Z38A 3IHWA 2OB1A 5H80A 3SSNA 4E4TA 2O20A 2WU1A 3UPDA 4FFKA 1GEEA 5CVTA 3I9KA 5DBFA 2Z57A 3JAWB 3KL4A 4MV4A 3RUAA 2IQ5A 1H3EA 2QL5A 2ADOA 5LOVF 3H1FA 1BWRA 3I53A 2NPIA 4JUDX 1XBIA 1TQHA 2RHTA 2AIFA 1EM1A 2BMDA 3GFGA 221PA 1G17A 3QUCA 3B6JA 1XL4A 2AD5A 2JEZA 1Y81A 3AONB 1KJQA 2HMUA 3JQ8B 2WSMA 4OIFA 4XI9A 3D1LA 1BEEA 3Q2KA 5CNMA 5EP2A 5FO0A 1CP9A 2ZYGA 1IDSA 4FM0A 4FMDB 5J2UA 2B25A 3WJ7A 4XZ3A 4EKDA 1Z68A 1SUWA 4MV1A 4RF2A 2E9SA 4IUYA 3K0BA 5FUVA 3H13A 3P19A 3SHTA 3GF4A 3I52A 3VI4B 3ZV6A 2P0YA 4NTXA 3QVUA 4DV4O 5KHJA 5HX7A 1G9SA 4G88A 2BEVA 1JKIA 2O59A 1REQB 1GV1A 2HF8A 3VM6A 3HV2A 3W2HA 1I8TA 2ZWMA 4Q16A 1FFHA 3FD5A 3X3HA 1BX0A 4X1YA 3G82C 4ZVUA 5K3SA 5IKEA 1KPIA 1OIXA 1YR9A 3DKIA 1SUPA 3DVSX 3D2BA 3F78A 4I5GA 2IJJA 1GO2A 1KDPA 1SUIA 3QVGA 1Y7LA 2P2ZA 5P8WA 4DR7B 5DP2A 5KAMA 1HT0A 3HJBA 5KVCA 3BMQA 1FDUA 4KXRA 1Y1KE 2A9PA 2BI7A 3C3DA 4TTJA 3HDHA 2EV9A 2XDAA 2GCNA 1IHUA 2AF4C 4U6NA 2H08A 2CH7A 3LDHA 2K2WA 3VQXA 3GHHA 3L07A 4HX2A 1R1DA 4BQOA 4DC0A 1WNSA 1HUQA 4BB9A 5HKOA 1VP7A 1J8FA 1L4FA 1TYEB 4MROA 1IURA 4A6PA 4N18A 4EG7A 3FH0A 2MDTA 4M99A 3E8FA 2VAPA 2CNNA 3FGOA 3V8EA 2QK4A 4DQKA 3NATA 3P0EA 1SXJB 4NULA 5CT5A 4MWDA 1DK1A 3RA5A 1O54A 3EXHC 3WWCA 3A8TA 2VFAA 4WFHA 5JBQA 4X95A 4EYKA 3C7CB 3K92A 3NHJA 5KYNA 2W4IA 3KJHA 5JDIA 2E89A 2HX1A 1QZZA 2AFHB 1XCOA 2IYYA 3JAWA 1HR0O 1W48A 2FUEA 2VZ0A 3AHGA 3GLRA 4UVHA 5EPOA 5FL7A 1JHZA 3S0WA 3D3WB 2IS4A 1L8DA 3TXAA 5CH3A 3HJGA 1LEHA 1W8DA 3LZDA 2IIBA 3FDZA 3ZCPA 1I0IA 1GM7A 4F06A 1ISIA 3FTQA 1GMGA 1M4UA 2VXYA 4J7UA 2XAGA 5G40A 1GLNA 4E5MA 4BVAA 2Q3BA 1OCCC 2V3VA 3G9TA 2WP8J 4L3VA 1Z6TA 1E3LA 1F12A 2Z2ZA 1PJ3A 1PT5A 1B15A 3OETA 3B2NA 3OO1A 3VZDA 1A04A 5B5SA 1U9YA 3R7AA 2RH4A 3N4YA 5B1AB 2XUJA 3H5IA 2H8KA 2GPBA 2JIMA 3E9NA 5A5GA 5IXSA 1Y82A 2JRCA 5DGTA 2IV3A 2CGNA 4GLBA 2XMPA 3KVYA 2JZOA 1MCZA 2Q5OA 4M89A 2BW0A 3DBIA 3DMTC 4X64B 3HFJA 4XPIB 1A9YA 4CQMA 1VRWA 5BV8A 1PQUA 2D5LA 1Y8CA 4I0XA 4IUBS 2IY9A 4HL6A 2G1JA 3IQGX 1ULAA 1YHZA 4WNYA 3UF0A 3O0TA 1OC2A 3T9AA 3KCYA 2WF9A 3VNQA 3ESDA 1D2NA 1J7JA 5IH7A 1IXZA 1NMUB 2HQOA 4IS3A 4OBEA 5HBGA 2O05A 1Q81H 3ASOC 4HATA 5ER9A 5ABPA 3ILYA 1J9EA 3MAJA 3OTHA 2W6JD 5HWEA 2OGUA 3DUFB 4ZQCB 3CRVA 2BN4A 3VZBA 4C0JA 4O3FA 4Y1RB 2Q69A 4I9UA 1J99A 1KRHA 3OI7A 1NTZH 2P90A 3SXJA 2EW8A 1P2UA 5ALGA 3G2NA 4N48A 3NAQA 4RDXA 4FX5A 4LBWA 4AMYA 2YXZA 2F2TA 3PPWA 4PPFA 4EJ0A 1PEAA 4YBZA 4M7RA 2OGSA 3WHIA 1EE9A 3G71F 1K5HA 1KQSF 1KVUA 1UM8A 4GWKA 5EUCA 3OFNG 1QHHB 3O7WA 3R9WA 2O5CA 2SNIE 3VSCA 3D3WA 5E2BA 2JVDA 4C0XA 1CJCA 2ZJFA 2C8JA 4NJOA 4CIBA 3AYZB 1IQUA 3A9VA 4BJHB 5BQ3A 4IIJB 1Y76A 1UXIA 4IVQA 3C6BA 4KXLA 1JNXX 1E7SA 1RXIA 1U3DA 1KAOA 5HUHA 2GTPA 2YRWA 3BC1A 3VPDA 2YVAA 1JKXA 3MSXA 3EOBI 1O94A 3HBMA 5AKJA 3UNXA 4QSMA 1U6JA 3LBIA 3F8TA 4CV2A 5BVGB 1LCIA 3ABSB 1TTPB 3DMNA 3Q9NA 1IL0A 1KERA 1NXOA 2Q6VA 4GBMA 3KKOA 4RHUA 1EUCB 2HJRA 5AXAA 4X60A 2IJKA 5EMHA 2BKXA 3PF8A 2EDCA 3FXAA 4J1TC 4IR7A 4PRYA 2G36A 5DSXA 4EQ6B 2P06A 5EWRA 3QBVA 4RHYA 3ZWOA 3K6RA 3BAFA 3TOVA 5B1IA 3I3FA 4PSAA 1FYXA 5AO9A 2Z3ZA 3ICPA 4BX2A 1Y5MA 4B3HA 1NVPD 1ZVQA 2SICE 2VC2B 4OLFA 4EDFA 3M5PA 1VQKV 2QSUA 2NVUB 3AG5A 3VBBA 2KTUA 5ICSA 5ITZA 4DV0B 2ZTMA 2ZATA 3GRAA 3EH2A 3O3NB 5E6RA 5JBIA 3DUWA 4UNNA 1E5VA 3CCMF 1UAAA 4CQJA 2QAGB 3EN0A 4IDNA 4FCWA 3M6FA 1CY1A 3R7WB 5LYJF 1Z45A 2IYWA 1RWBA 1Q7YH 1B6RA 1O8CA 2QPAA 2ZIUB 2ZSHA 1E7MA 1J56A 3R3WA 4N7MA 4W6QA 4XQGA 1R0BA 2FFRA 1H2FA 3TIGA 5K20A 1GFWA 3GLHA 4IDCA 4YP5A 3QW4B 1K98A 4TMKA 3GGPA 4P84A 3SM9A 1AKYA 3MXTA 3PD1A 1ZK1A 3D3QA 2HA7A 3P9IA 3QKTA 5CP8A 1WV1A 2WHQA 1AKWA 3H2JA 1MPXA 2IF0A 3FCOA 4ER3A 5JZBA 4IZHA 4D45A 1RHQA 5JW6A 4MVZA 4RESA 1EEHA 4E7OA 3VNRA 3WIBA 1Z7EA 2Z6UA 1KA9H 2KLBA 4RAIA 5AK6A 5J47A 3NASA 3F73A 2IJHA 3JVIA 4WCFB 3DEZA 4U2BA 1E4VA 3I6QA 2YZNA 3AC0A 3RVNA 1FSSA 4CG1A 3QOFA 1G59A 1EWRA 3JVHA 3KOMA 4MR7A 1V9SA 1IXMA 1GRCA 3JWGA 3R6LA 4UULA 1CY7A 3CMAV 4RF5A 1YF3A 2Z6AA 3BB1A 4G8JA 4BC0A 5AI4A 1Z5VA 1T1RA 4P7GA 4LF4O 1OXTA 2ZI4A 1SVUA 5EWLA 4EHKA 3NORA 3RWMB 1ZD4A 4HEA6 1VIDA 1NX9A 2OQVA 1ZBDA 3WL8A 1CEXA 4ESOA 2JVJA 5L40A 1MH9A 4YPVA 1EP2B 3SHQA 2D13A 2CSUA 2GK7A 1DLBA 2FW1A 2HREA 2QM3A 2X2EA 3A1VA 2EBOA 1JDUA 1RRGA 2BC9A 2GKSA 2H2GA 5EMNA 5F1PA 4AFNA 1YRAA 4QUBA 4YHHO 4BOYA 5AW3A 3OAAD 2BFDB 4AJEA 3F6BX 3OY2A 1PUXA 1ORHA 1JLMA 5J4YA 3K9AA 4MQ5A 3Q9SA 2GVDC 3QIVA 3BRQA 4IDBA 4G9EA 3MMSA 1S0VA 4D99A 2V1DA 2J30A 1GVNB 2XYGA 4LCUC 1W59A 2WB4A 2GVNA 3A4LA 5TT0A 1UQTA 1QYXA 2I67A 3KYDA 4GXNA 1MO5A 4Q4JA 1MH1A 1BQ0A 2YHIA 2YXLA 2HBZA 2YEVB 1ESZA 1H8HD 1VKJA 3C3KA 3DMDA 3KC2A 2XUZA 4I8IA 3ZQ6A 5SYNA 5IU6A 3G79A 3QA3E 4FGUA 3S2IA 3AO0B 5A9RA 4TT3G 3ILHA 3MBOA 3ABOB 3QVMA 1U3GA 4QGHA 1JFTA 1RKBA 4EQ6A 1HQYE 2NU8A 4D44A 4QICA 3VYUB 3Q11A 5EZYF 1GCIA 4ZDWA 2YJZA 1TA0A 1S5PA 4QYXA 2B4QA 3DZFA 4TLAA 4B43A 1AQIA 1KZ6A 2JFQA 3ZRVA 2FX5A 2YWRA 4I1VA 4LC9A 4ETWA 1MQSA 4QQFA 3LIIA 5K3EA 4NG5A 1CJSA 5J58A 2WMDA 4CM6A 1TL7C 2KJQA 3A2MA 4NG4A 1OJLA 1OTYA 4ZZ3A 4NFLA 3QWHA 4PAMA 2WM8A 1MTZA 3PRYA 4Z4IA 5I3ZA 4OQ4A 5EIAA 4QBTA 2C7RA 3DDHA 2RBKA 3VX3A 1VSVA 2J9FB 4L6CA 1Z47A 5A62A 1R0KA 1A9PA 1KQNA 3LXUX 1VJ5A 1R18A 4I4CA 2WF5A 2GCPA 4GH5A 4WKPA 5G4KB 2GYWA 1QU9A 1QR2A 2V6MA 4Q02A 2BVNA 5JSUA 3BCHA 1V11A 2NV0A 2I91A 2CK3G 2AC2A 1BQEA 3F7VC 1EVYA 3LUCA 1S3IA 3F0DA 4MQFB 1GM8A 1VARA 3TD4A 2YMPA 1QG4A 1MOQA 2EFEB 5A4IS 3FKSG 3Q2OA 3EOZA 3M34A 3V1TC 1G42A 2Z2XA 3DDUA 5ICMA 1QRRA 3S03A 4HLNA 5JNSA 1CKEA 2ZAIA 4L76A 2A92A 5ECYA 4DV1O 1TXGA 1VIMA 5I5GA 5JCJD 2KBEA 3E8GA 4L9RA 3CJTA 4OQQA 2QWPB 4D92A 1UH5A 3GDOA 4OHZA 4KREA 1VL6A 5GIOE 3JATA 1EM8A 2GKOA 2PQ2A 2RKBA 1Y4MA 2E49A 2XNDA 1IZ7A 1YAJA 3KCNA 3P4YA 4I0XB 4CETA 2BSAA 3MHSC 2J4DA 4MW2A 1RFLA 2A1TS 3CUKA 4DZRA 2ZSUA 4FCVA 3PC7A 1QK3A 4MLCA 1VKHA 4PBSA 1NMYA 2YDYA 3RKRA 2HSWA 1Q0QA 5AW5A 1I51A 3ESXA 3ZE0B 1X0VA 2Z3WA 1ELOA 2YVUA 2CAZC 3B9BA 3IP9A 3U4AA 1FVFA 3X2EA 2GEVA 3SEZA 3QITA 1SCKA 5AUNB 2P6NA 3WSWA 2F8SA 2G7MC 3H5TA 4P4NA 1I9CA 5C1PA 1QDLB 4TS3A 2WV9A 3EBPA 3ZGYA 1HE8B 4OBBA 2D62A 4PAGA 5KX5A 1BDHA 5JO0A 2NXEA 3GMIA 2FGJA 3DW3X 1J42A 1DDIA 1U0LA 1SU4A 1ZD1A 3KT6A 1DIRA 4WMLA 3RIXA 1BA2A 3EEBA 4IUDS 3GCXA 4IM7A 3R6GA 4JJGA 1GT6A 4MYSA 2OA0A 4B4VA 3NB0A 1JIUA 4DPLA 4MS1A 4QJ3A 1JZQA 3TXYA 5FWNA 2GJKA 1FFWA 2H4YA 3FDZB 1T6XA 3PX3A 3CMEV 4R9VA 5ENVA 5FTWA 3N8KA 4CL0A 4C7XA 5ADUS 2A8YA 2ZYHA 4BUCA 1DF4A 3U48A 5GWXA 2PH7A 3IEMA 1EA5A 2FQXA 1FUEA 3F49S 4KLRA 2ZJ5A 3RUHA 2C5HA 2PN1A 2SBTA 2IKQA 3FYEB 4URFA 2BDTA 1ACLA 5C80A 1A96A 4NPCA 4Y1EA 4GC5A 4AJ2A 3ROPA 5FXMA 3IUSA 4LZOA 3K70B 4QPJC 4QJBA 4PYJA 5ICGA 2L18A 1C0EA 4PZYA 4BJ5A 5BSRA 1AKQA 1SQBH 3H01A 2PHZA 4HMPA 3T7CA 3DB2A 1XRQA 1RADA 3FBGA 4XE5A 4G27B 5FOXA 3OPXA 4OBWA 1UT6A 2F1JA 3JQRA 1J24A 2R72A 1ZGHA 4Q66C 4G5HA 3RBAA 1T8SA 2CTPA 2DGDA 4KXXA 3KJKA 2B5OA 4UU0A 2Q5JA 1HR0B 4QRHA 3B89A 1V1JA 3G2KA 4ZI7A 1A2BA 2V9PA 4GVPA 3CUWA 4L8WB 3KNZA 3BH6A 5F77A 3N53A 2GBLC 4QUHA 2CDBA 4EF5A 1GKLA 2XAUA 3D02A 3KLMX 3HBNA 2DPHA 3VR0A 2BFBB 1AXRA 4MV0A 1JECA 3WYGA 1JVNA 2AW9A 2ICAA 3C6YA 1F38A 1Z5UA 2C9CA 3MA0A 4QDJA 4I19A 3D5QA 3KQTA 1BCRA 3HO6A 4O8CA 4DIBA 1M2NA 2Q5HA 1D2GA 3GIWA 3AERA 3OKFA 4LJ6A 4I9FA 5BSHA 3QBJA 2I0FA 2Q0HA 1KETA 4ABYA 1PZHA 1F7VA 3A1WA 2X19A 2NO4A 3BWEA 2DT8A 5IYZA 4YMWA 2PGXA 2NADA 4TMTA 5IKPA 1SQSA 4QDKA 3UUFA 1OHHD 5JQGF 1LTHR 4U6SA 3WB9A 2V74B 4OXIA 4QOSA 2J6BA 1UODA 4EHBA 2E3CA 4X3LA 1XJWA 2FPGB 5ELLA 2WJ4A 2FSHA 3VUFA 2ENWA 3CX3A 4HQ6A 3H6KA 4LX8A 1HLFA 1W47A 4WBSA 1LUWA 3RSQA 1KU6A 1SQFA 4XWOA 3U56A 4BW0B 3OTOB 4XCQA 4NESA 3ULKA 3L8DA 3UHOA 3U9LA 5JCZA 3PSAA 3VCZA 2NO0A 1AHNA 3D4IA 4M9ZA 5TS3A 3PUHA 4BQRA 1YHQF 4FFDA 4KYIB 1KD1W 3CMCO 2YUAA 5D5PA 2UZ0A 4JZYA 4RK1A 4IMPA 4MQEB 3KXPA 1PNVA 1QANA 1QVZA 1NKDA 1HG1A 3AJRA 3FPCA 4UUNA 3WBKA 1X7XB 3U3KA 3JQCA 4F4HA 2BCEA 7AT1A 4FSHA 5K7SA 2ZJBA 5EJ9A 1NJSA 3O6VA 3O85A 1QIDA 1R0ZA 4RJJA 3UA4A 1AKTA 4FOOA 2F7SA 4MMXB 1KZ1A 4N0PA 1DAGA 1F48A 3FR8A 3JW8A 3SIRA 1MUUA 2M98A 3OIVA 4DUGA 1B3BA 2QRVA 3KEGA 4KNVA 3I01M 2OPHA 3U4QB 1Z63A 3LV8A 1SKMA 1LDGA 3QTCA 2OBBA 3R3XA 4MAFA 2DCMA 2GAOA 1B6GA 1MVOA 1OJHA 1WRBA 2IFTA 2LD4A 1EIZA 2VDWB 1SU8A 2FSIA 3TCXB 2XZDA 2X6AA 4Z7NB 2POQX 3MT9A 1ISPA 4J7ZA 1W87A 1P0QA 2CTRA 1P6UA 2ID9A 2LNDA 4RU1A 3DTVA 4DRZA 3OT5A 2FMXA 4N0DA 1F60A 4O2BF 2W2QA 2WJVA 3AK2A 1ZOPA 2XUFA 3GVCA 4I6JA 1PEYA 1VDZA 2DFKB 2WM3A 2YIVX 3EJWA 3QVOA 3QU9A 1PWZA 2R96A 4WOCA 5AHOA 1GTVA 3U4HA 2I8AA 4NK5A 3PWSA 4B6SA 2QVBA 2FEKA 3GVXA 3LVRE 2FN3A 4MVJH 3WAGA 2B7BA 3E7DA 2IWHA 4MUFA 5CCBA 1ACMA 1F2DA 3VPSA 2DPMA 3W5CA 1GT91 2VSYA 2JRLA 1TPZA 3GLGB 2FCRA 5FWXA 5L6LB 1S1CA 1KOFA 2PNJA 4Y2QA 2FVYA 4EPVA 2EIMB 2WSSG 1ZVKA 4QU9A 4AQDA 3G0HA 4PJ0Z 3KOZA 4JSRA 1QHIA 4BT7A 2Q49A 4DBZA 3MRTA 4IDFA 2VQFB 1GTL1 1PTJC 3B52X 4S1PA 3L49A 1ID8A 1QD9A 4RPGA 2CVFA 4N5IX 1U7OA 2CNKA 3G0DA 4HF7A 2PUJA 4S1VA 1JEYB 2AMTA 1XDCA 1RYHA 3AY6A 4NE9A 1G6KA 1OLOA 3GJ8A 4G5RA 4F0JA 5K09A 5FNVB 1ZNZA 2J8ZA 4IO0A 4JP3A 5B12A 3I58A 5JC8A 5F3WB 3QFTA 4CZZA 3RVJA 1CUIA 3K9QO 3RAJA 4AMBA 1F4NA 3GG9A 4DRXA 5TX7A 3GEMA 4B09A 1XNHA 3I9OA 4FDMA 3I1YA 4M9UA 3AF2A 2A4KA 3DXRA 2Z98A 2F3QA 5HBRA 5T6BA 3RANA 1E89A 4DY6A 4OIMA 3FUTA 3L72H 2GRJA 4XGNA 4DCJA 4JCCA 2ZE5A 5DMXA 3RC8A 1CNFA 4WNAB 5AQEA 1NJIH 4M0MA 1V4VA 2EP8A 3L8YA 4S35A 2W42A 1BQ3A 3RNLA 2ALJA 1KKCA 5SV2A 4TLBA 1EVLA 2EBHX 2JJ8A 2Q3FA 3UBTA 4B17A 2IPNA 2WY2D 5KOYA 3HUEA 3ACBA 2YNMA 2W8BC 2N04A 3GW8A 3VR5D 4FYKA 3I9FA 1T1EA 2WA2A 4C6HA 4Z4GA 3HS3A 4IGKA 3RHZA 1PM9A 4BAGA 4NE7A 1I1OA 3P26A 3CCQF 3RGBA 3QKIA 3J81N 2ROQA 2W5UA 1F9AA 3LWOC 2PNFA 3F98A 3EYWA 3FVTA 4YI3A 1RMTA 3RUIA 3VHRA 2CVOA 2GK6A 4H3SA 2CW5A 1L4EA 1Z6GA 2HJHA 3ZTWA 3ERCA 1QK5A 2AXQA 2D2VA 4HRXA 1SQXH 5DM2A 1HNXO 4EKGA 2P3OA 4FB5A 5FYQA 5DJ5A 3TTWA 3OM3B 1GRQA 2IT1A 2RHGB 3IELA 4KXYA 4UV8A 2PUEA 4DV7B 1UP7A 2DUMA 2AFHE 3KB8A 3KUXA 3S2ZA 3MLEA 4QTXA 1B73A 1SK8A 2XB6A 3CX6A 1MA3A 4AG5A 3ZD7A 1NNLA 4TGLA 1AN0A 4H7DA 1XAGA 4ILKA 3FOFC 3U7HB 1WP9A 3BMNB 5JJIA 3WOVA 1TEXA 2KWIA 5AXCA 4F4IA 1KYTA 2WSBA 4JB2A 5ALJA 3JYQA 4DRYA 3HDYA 1LY1A 4NYMQ 4MB2A 1ZGGA 1R64A 3EULA 3P5BA 5HCNA 4AL4A 2CE7A 1R00A 3DAFA 2ZSJA 4OGGA 1I5XA 4YJDA 4C8IA 4Q3CA 2N3ZA 1M7GA 1UKAA 4AHCA 2PVSA 4MRRA 2CHGA 3KRTA 4PFJA 4E2YA 3QNEA 5EJ4A 3QUTA 3ECAA 3EVAA 1NTMH 2LBXA 2DSTA 3JY6A 3H9JA 5EKUA 3NC0C 3ROKA 2CV2A 4BLOA 2C9ZA 3CC7V 2QE7A 2VDOB 4FFWA 5C8YF 1U9IC 1JLHA 1S77D 1VL0A 4DR6B 2QN3A 4HLCA 2H52A 2NO9A 4IO1A 2HUPA 1LW7A 1P17A 4R1PA 4NOJA 5KAFZ 4HMQA 4Y2UA 3ZNOA 4PQYA 1WB9A 3ZC3A 1WW2A 1U2GA 1TUBB 3H75A 5I8ZA 3W2EA 2VRCD 1N1EA 2WYHA 3EG5A 1JEJA 2EJTA 2E4YA 4XQCA 1PD0A 5A3SA 2ILTA 4AYTA 2YASA 3ZK8A 4BTLA 2IDKA 3AFOA 5KO2A 4TL6A 3QSYA 4YLYA 4XB6B 5KNCH 5GW7A 1MGPA 4AZ0A 1UC8A 1KI6A 4FC7A 4U39A 4FFBA 5DRTA 2Z5LA 2HXSA 4YP6A 3JCUZ 2REXB 4MVWA 4MW9A 3ASNC 3NRBA 3BHIA 3EC7A 4R98A 4A5SA 1R4NB 3NBKA 2VT6A 3BTUA 4HWTA 2RC6A 1EJ0A 3KT0A 2H9AA 3SJCC 3HZOA 1Q0SA 1MIHA 1ZL2A 1YXBA 1Y3HA 1XK7A 1F2VA 4MUKA 5CAEB 1H8EA 4HEJA 5C1DA 4BGDA 1CVRA 2H1WA 1PEDA 4P35A 1QPGA 3T3OA 1PT9A 4S1OA 1G8GA 1JHDA 2UXDO 2B1JA 3C1TA 2FY8A 3K8QA 2IZ1A 3TD5A 5BXQC 5JFGA 3LT4A 2XAFA 4PINA 1KY2A 2H4FA 2VHVA 4J7KA 4UBLA 5I4KA 3AVWA 2XQJA 3PNBA 4AKTA 4KXVA 3WZ2A 4UCWA 1FLVA 2Q4BA 3T7AA 4FKZA 4BVJA 3K3WA 2AZ4A 1G8MA 2VKQA 1Q1ZA 4XUDA 5J4LA 1UADA 1C3JA 5E4TA 2QP4A 3QWBA 1LGYA 1TVCA 1U3FA 3DZGA 3TRIA 4ZI3A 3U37A 5B58C 2NNWB 5AW2A 3MUNA 1E0DA 2C59A 5AKGA 1QYVA 3CZQA 3AHEA 2K5UA 3HXTA 4MTXA 2Z5GA 4QATA 4D7TA 1FVHA 1NAIA 3CNHA 3K09C 5CT6A 3VTZA 1WG8A 4QBKA 1VQLV 2IYRA 1B04A 3TLMA 5KDOA 2PMWB 2HT1A 3WGHA 1I1HA 4CTNA 2VPIA 1LZLA 3OPVA 4UUBA 1XNGA 3RD5A 4UTRA 2QL7A 5JD6A 1XGKA 1ZD8A 2KM1A 3EZGA 3SFZA 2R65A 5KREA 3SX4A 3PD7A 1LX7A 1O6BA 1QG0A 1HE2A 2AFIB 4AUMA 3N6XA 3NHAA 4PW0A 3C2QA 4DLSA 1U5BA 1AA6A 1TZKA 4KNWA 4OQEA 3CCCA 2ZIGA 3AXTA 3RAEC 4D4KA 2I34A 5LQDA 2UYOA 4UXHA 3S3WA 1A97A 1OF1A 3EIFA 3ZU5A 2Q9UA 4FLFA 4O8ZA 5A2GA 2QKAA 2CJXA 4HPXB 4FJCC 4IWYA 1UK8A 3VU9B 1PG5A 1FUIA 1EP3B 1SOWA 1BS9A 4BEVA 3U4QA 2PL1A 2Q4DA 3H4MA 4OJKA 2BFNA 2VCEA 4G89A 4IBOA 3GJZA 5TC4A 3C43A 1R7RA 3GH1A 3RVZA 1AKMA 4N3GA 4B5KA 4D57A 3R23A 4ONEA 3R0JA 3E15A 3TOCA 1ACJA 3SBXA 3THWB 2QMYA 2HJFC 3KAKA 5CLHA 1W4CA 3MUFA 4BIIA 1ANKA 3UJBA 3SF0A 3DQQA 5CA0A 2ZIXB 3VZPA 3CRMA 4RFLA 1URFA 4M1QA 1PNQA 4C6RA 2W0XA 1FF9A 3KUDA 3RWOA 4AO8A 2ZITA 4B3RO 1J95A 4BW5A 4C8GA 1B26A 1GL3A 3QPBA 4BTEA 2XZOA 1NMQA 5BSGA 6ADHA 3LTNC 3LDFA 5JH7A 2JA2A 3A9CA 4MAMA 3BXXA 3OF5A 3U4MA 3E2IA 4IQGA 4HR7A 5GIOC 2O3SA 1A9OA 1U4NA 2FSVA 3T1YO 3CZAA 4NYIQ 4E3WA 1EFRG 4AKIA 4QXOA 1L4UA 1N9ZA 2ETVA 1VLZA 3AEXA 2ZBFA 3PJDA 4QWWA 3CCSF 3PFNA 2JGFA 2QD2A 3VU3A 1RWXA 2OAQ1 4UNIA 3LL7A 3X0DA 2JFHA 2M2IA 3NDJA 3V46A 4LXHA 4MS3B 1T2UA 2XTAA 1D04A 2GFQA 1BXRA 1KPGA 2XOKG 3C7DB 3IGFA 4RDIA 5LDHA 3LX6A 3T1QA 4MRMA 2PJUA 1BMTA 4OKSA 4BXOA 2G5PA 1SAYA 2L35A 5GONB 5MF6A 1JIIA 1Q14A 4HZUB 4XW2A 4RA6B 4DV3O 1ZGBA 5G4KA 1W36D 3DF9A 2FP4A 1YK1A 2Y4OA 4I81A 2XMSA 4B3BA 4AMZA 3QLEA 4OX9O 5B7NA 4WKBA 5U9CA 1EGAA 3ITEA 4JWTA 1U0BB 4B2LA 5A02A 3RI3A 3AESB 4O4HB 2REQB 4PSKA 4UBOA 5JT1A 1E7QA 3DTVD 2DWQA 4RGVA 2KKWA 2A9JA 2VPYA 2RG7A 3RVYA 2X7JA 4E22A 3RHFA 1L7OA 4OJNA 1MO6A 2PRZA 5F5NA 2QQFA 4PGFA 3WHLA 1YA6A 2QUZA 5D6NA 4MO9A 3FLBA 4EFEA 3OESA 4ZK7A 3VQWA 1SQVH 5H2FZ 1ISJA 2GESA 2GZMA 2VP5A 5JATA 3SC6A 1X80B 2I9PA 3HBLA 3EPLA 2BGGA 4O4JB 2GZ1A 3CD6V 2HNBA 2IW1A 3A32A 4DUPA 1E7KA 3BD8A 1IY2A 4I8DA 5E7IA 3DMGA 5NULA 4AB1A 3AU9A 4B6FA 3ZWXA 5H16A 1KY3A 4E4RA 4RD4A 4XGQA 5F1KA 4LSGA 3WLOA 2ZWPA 2AJDA 3EE6A 4D0NA 4DV2O 1IU9A 1V2HE 2ODAA 2VVTA 3D0KA 5EWLB 3OIGA 1JA1A 3VKVA 4KMOA 3A0RB 4BVTA 3NRJA 4OQZA 1APBA 1RHMA 5I51A 2UAGA 4KTVE 3T9DA 4WY5A 4G81A 3OZFA 2EW2A 2RGDA 2ADMA 1XDWA 2FB5A 2FG6C 3DF7A 3EEIA 1XL1A 3VU0A 1TKCA 2CGEA 2WKSA 2WLNA 3UJHA 4RKQA 2QZPA 2VDNB 3JALB 3S8EA 1T8UA 4JYZA 2OEPA 1I4WA 3DEAA 5HY0A 1QVVA 3VU9A 5IANA 2E4XA 1CY2A 5KX5F 4V0OA 3CNOA 5BV1A 4P4LA 4B87A 4AN1A 3RV3A 1J4AA 3ABTA 2I62A 2FPPA 3BB3A 3CNNA 3PKJA 1Y8QA 4MKFA 2GLXA 5AWFC 2J08A 2RDCA 1XREA 3V97A 3CP1A 3ZXSA 1FSZA 2O3TA 1HNZO 4HBNA 5HWSA 2I4OA 1KO5A 1ZS9A 1NYQA 1QCEA 3GYBA 1L5SA 5FTNA 3PHGA 3KD2A 5I9IA 1QE5A 1FUKA 2P35A 3VR6D 3W3ZB 5KA5A 1Z2OX 2O8VA 4AM8A 3SMVA 5JFTA 2FMIA 3PE4A 4Q4HA 1YMVA 2VS0A 2D5CA 2KLHA 4MVJG 2L69A 3LY7A 5B3AA 1I5EA 5SY9A 3PXEA 2W9XA 5CVEA 2FDCA 3C16C 1IZYA 5GIPC 2B33A 1C3LA 1CUHA 3DBOB 3GD5A 4RZSA 1G7TA 1A50B 3C7TA 4ARIA 5MHTA 1V5GA 1F0YA 2A14A 3SGIA 2Z09A 2ZR8A 3AEZA 4IEIA 3E9YA 1QC5A 1V2GA 1L4GA 2J3QA 4OMDA 3CKKA 4LZLA 3CZRA 2XZPA 3ZHVA 4M1YA 4M2LA 2D0IA 3HZHA 5F35A 1MOSA 3UQ8A 1BX1A 2QTVA 3GNSA 4Q6BA 1ENPA 4QARA 4EZEA 2QVXX 3H2BA 4EWLA 2DPLA 3RC7A 4UARA 4DR5B 3RC3A 5CCXA 2I2AA 3LH5A 1YL6A 4OQFA 4GNRA 1RIFA 5IDYA 5EJAA 2YWCA 5KTPA 1QHXA 5A2QM 1YQUA 3OT1B 3QW2A 4TWAA 3AFHA 1UDAA 1K3EA 1CK2A 1A32A 1N3LA 1MMMA 3LWVC 4L74A 4LC0A 1VPVA 3D7SA 2FPXA 4LH6A 1J70A 1L1FA 4LBEC 2D1RA 4JC4A 3BRCA 1X7PA 3IBYA 3QENA 5TQ2B 3WRVA 4FBLA 4A1FA 3OZVA 5HZHA 1PLJA 1NOKA 2JI7A 5IFKA 2CE2X 2G0NA 4KPFC 3C70A 5FOTA 4RJLA 1FYEA 2W2LD 1AB6A 3E3LA 4AXXA 3ANNA 4PS1A 3WKEA 3AV0B 3IIMA 4TZZA 2ZRFA 2ZRGA 4DA9A 3FWYA 3DZJA 4C0AC 3QKSA 4QRIA 2JIZD 3T3NA 2BOBC 1RJWA 3N2YA 1DAOA 3TPFA 1JJOA 2C7QA 2PLNA 4R1MA 3H65A 4XUCA 1Y6XA 3G6EF 4ND4A 5DM70 2ZUDA 2QGFA 4P3XA 4QPPA 1RPZA 2L42A 1H2SB 1V7CA 1ZQ9A 3PNMA 1VH8A 1VE7A 2WSLA 5FBZA 5JROA 1NVWQ 2GARA 4E70A 1XRJA 3QWAA 3MCQA 2D1SA 3CLTC 5A6SA 2FVXA 1NJ5A 1YIOA 1JYSA 4LJ4A 2GEKA 4UEKA 1O9GA 3AP1A 1XO1A 3QLVC 2CE4A 1RFGE 3DEHA 1HMYA 2D4HA 1AQUA 1SZQA 1OVMA 3B6ZA 3I2HA 4LJLA 3BPSA 3C1OA 1EEXB 3DWGA 3GRCA 5HS6A 2FK7A 2Q2WA 3F7MA 2W2TA 2V3CC 3LGSA 1LI7A 3K2QA 5FPOA 3UWMA 1F7YA 3G49A 3W34A 3R66A 5SYMA 1WN7A 1D6SA 2Q5ZA 1E4OA 5HEKA 3RT3C 3G9ZA 5K1ZA 4PAQA 1A88A 1PX2A 3U19A 1IWPB 1E6LA 1JDJA 3CC2V 1X7ZB 1XDGA 4EFDA 3W2FA 1KEPA 1XJCA 1YR6A 4V0SA 1LBQA 2BF4A 1NTOA 3AG4C 3MDOA 1BZYA 3J7AU 2F43B 2QJFA 2C8VA 3DO5A 1Q6ZA 3IVCA 3LPCA 4KN6A 3H1KH 2GEUA 2XAAA 4L9AA 1W42A 5BNFA 2NQ8A 3TL2A 4HHEA 4YAWA 1RVV1 1E2LA 5F2KA 1PLKA 2FB9A 4TN5A 4Z8YA 5HF6A 1VL2A 4B6QA 1FSGA 1GEGA 2KPOA 4YAIA 2QR4A 1FS4A 4MWTA 4YDQA 1ORVA 3DHVA 4MRMB 4N5HX 2C2YA 4WCDA 1M0EA 5AVXA 1X7OA 1QZTA 1QIJA 2YV5A 4MUHA 4MI3A 1RCUA 1CB0A 4R83A 5K8IA 3U7FB 1IHOA 2H1HA 3O94A 3EX7C 2CEAA 3HNPA 3LVBA 4OUKX 4JROA 4KTTE 3BEOA 3BQNB 3JSAA 1Q83A 1GU0A 3W3AH 5AFSA 1DMSA 5KWJA 4UVDA 3ZKWA 3TBHA 5FTLA 1X7WA 1MQ9A 3WJ2A 4H2DA 2PT6A 2BSKA 4ITRC 5IHXA 4TKVA 2C0QA 3O9VA 1OI2A 3CXCU 1XCMA 2PFSA 3R77A 4HQOA 4YP9A 5TPZA 2GZ2A 4ODIA 1RYYA 2WLHA 1ZSVA 3CM0A 3HPQA 3NOOA 4GUAA 3I0ZA 4ERNA 5GAJA 3DM9B 1FNCA 5GJWC 1S5HC 4BFXA 1W93A 1G21A 3S81A 2UXDB 4HEHA 4U63A 1Q17A 1YJBA 1D5NA 2IX3A 3MCAB 3EZLA 3SI7A 3F6YA 1DEKA 3AQIA 2IOQA 4UM8B 3OHSX 2NT4A 2J5BA 4TMWA 4XARA 4MHTA 1A2KC 1UZNA 2HOQA 2VHWA 1MJGA 2R6HA 1H5UA 4L5IA 1RJDA 4UUQA 1VG0B 3PWZA 4LRTB 1RZVA 5CNKA 2QTPA 5COQA 4EMSA 3D01A 2EAUA 1AURA 1P7YA 2Q29A 4LQCA 4AUEA 3A28A 2XMDA 4TV8F 4EG1A 1GQQA 3BT7A 4ED9A 3LLSA 4DSUA 4YRKA 1Q0HA 3TLAA 2WIDA 4QXAA 4ZU3A 1VCHA 4EKIA 5AW4A 4P9PA 1SG9A 2G1AA 3UV6A 3RBVA 1RWQA 3EGDB 5B1YA 5C8VA 3OGIB 1VQPF 3BQ9A 3Q72A 1M1YA 2Q8NA 5JCJA 3MGKA 1CQXA 4AS3A 3PNQA 1V8FA 5LMUO 3BQMB 3VJKA 1S72F 3ZNNA 4OHKA 4LMBA 2X4LA 2QL9A 1FXVA 4JP8A 3VNVA 1B8PA 4LHZA 4CMHA 4QVIA 1SKAA 4MIOA 1W88A 4ZHSA 2Q41A 3AMVA 1NI8A 4AZVA 2XQVA 4BV9A 3RA6A 1HNWB 1Z34A 1BFDA 1DTSA 1H2LA 1OWMA 2LO1A 1VB5A 2FUNB 5JJJB 3HL0A 4R51A 4RLSA 4TZTA 1V0JA 2H3EA 4YONB 1T25A 4UUMA 3ZZMA 4A2CA 1X94A 2HJVA 3T3MB 4UHJA 1L5WA 3F5DA 2APJA 2UZIR 3UUWA 1DAFA 4WBNF 4RLHA 2VQFO 2PYJA 2EOAA 2PR2A 4G0UA 2R6GA 1NZJA 4QGAA 1YJ9F 2GPTA 1W46A 3A4TA 3ZY3A 4Q21A 4WN3A 4XTRA 4NBSA 3RAFC 1DKPA 1U3LA 1EDZA 1HDEA 1T0HB 1FJGB 3S1AA 1L4BA 2AR7A 3COPA 2IPXA 1AF7A 4OF4A 3F1LA 3IKJA 3EIHA 3W4IA 2QL6A 2EQAA 4UJ3A 3JYCA 4GL2A 5JJEB 1QHYA 4O2BA 5J5CA 1A5ZA 1E59A 4CFSA 3AB7A 3FFQA 4RZUA 5CYGA 3ZJTA 1H1DA 1ZA2A 3R1IA 1K7YA 2X1MA 3HACA 3ZHUA 1N8SA 4QOHA 5FORA 2YL2A 1W0KD 2LGWA 1QH1B 2WHRA 2YYEA 3E1KA 3OIDA 1E9SA 3L05A 4ND7A 4F4DA 5ECGC 4YAKA 4DG8A 4RTQA 3ZIUA 3D0QA 1NW3A 1U31A 1YDGA 3O8QB 3A26A 4KUGA 1H8HA 3TE7A 5FH9A 1W1WA 3DLHA 4H37A 1BX3A 3K94A 1S8AA 4MICA 3RVBA 3WFIA 5IXYA 1PV0A 3OBBA 1IQPA 2FLKA 2HJGA 2P91A 3H04A 3IILA 4CIWA 2ZSBA 1E3QA 2JCXA 2WLSA 3AUKA 4IQ0A 4ZDJA 3CCMV 4N0MA 1KMQA 3HY3A 3PEUA 3V2GA 1SKYE 4GPD1 4K2HA 1FXKA 3GPDG 4QEKA 2BT4A 1AROP 1PQPA 4YV0A 1YRLA 1XFDA 5TMDA 4CTOA 2PZBA 2GWHA 3FI9A 3UJ8A 5K01A 2G28A 3FRJA 1DJMA 1HNXB 4CKWB 4LJKA 2Y1XA 3UWOA 1QFJA 4ENTA 3TNFA 4AMUA 4FLZA 4JLNA 2ZE8A 4MR9B 3ENKA 5G3YA 4JBYA 3EK2A 3FYSA 4Q4DA 1BFKA 1WUIS 1O97D 1W1UA 3BFJA 4Z7JA 2CJPA 3F6RA 1FYJA 1QMPA 1V3QE 3DVRX 3GPCA 4H0FA 2ZR0A 1U8UA 1X7XA 2R60A 2JGEA 4U3JA 4AN4A 2WQ6A 3HAXD 1R8JA 2QE7G 3ZRSA 1TYCA 2WTBA 1B8UA 2JJMA 1VQ9V 1XYGA 2PJZA 2PA0A 9ABPA 5CFQA 1NVDA 4TYQA 2Y6VA 1KF0A 3FY4A 1K4CC 2CW4A 2H1CA 2PTHA 5E95A 5K0NA 1Y8ZA 2JFXA 4YIPA 2PSFA 4WDQA 4UC0A 3CYOA 1R66A 3LDDA 1DO8A 2X0KA 2OQ2A 4R3NA 3ZHYA 5C1OA 4TQFA 1KDZA 5IMSA 1OFGA 2ZROA 4AZ3A 1CYDA 2OSBA 2NZWA 1RXSA 4KN8A 4BO5A 3A14A 4MLDA 5IJZA 3GYQA 3E3NA 4K6GA 3SDZA 5LMCA 4D98A 2ZUVA 3N0WA 3ZMZA 1P2VA 4KDCA 4UCFA 4FHGA 2Y0CA 3SC2A 3UG7A 3QVTA 3TE6A 4E15A 1KQFA 1AILA 4FZ3A 5F33A 1YB2A 3PC8A 4EHIA 3K1TA 4JNCA 4Q1BA 5EXDA 4LOJA 2JI9A 3L8ZA 2WIAA 4P0PB 2ZYWX 2QN6A 5HJ2A 2I9KA 2R84A 1A71A 1IV1A 1J0BA 2DFTA 3BREA 3NP9A 3IBGA 4MW1A 3SOPA 2X9QA 3FW1A 2QUAA 4Z1VA 1M2OB 5BV0A 2ZPUA 1SXIA 4XASA 1SDSA 3C87A 2X8JB 4U7FA 3TSAA 5IY5B 3KQQA 5FWAA 4PGGA 2IM9A 2Y1LA 3RFRA 2BCGY 3PXBA 2ZSAA 4NWIA 1QVRA 3R3ZA 5G0SA 1CDOA 1PUJA 3LK7A 3A36A 2DOKA 3Q7QA 3NHYA 1YUNA 3K8OE 4TQAA 4Z1MD 5JNWA 1DVRA 1T9BA 4Q9AA 4YT2A 1H47A 5ULLA 3MQWA 1EX1A 1UBOS 1X1EA 5ALPA 4YCBA 5KZMB 1CY4A 2XB4A 1FJ2A 4JHLA 4JI1O 4YO7A 3RW0A 3OGCC 1PL6A 3LDTA 3DC5A 4GL4A 3TRHA 3IAM1 5GIPE 1XXHB 1E9AA 5BO5A 3BF8A 1USWA 3IBTA 4KE9A 2XQKA 4EVIA 4MPJA 1P4SA 1SKUA 2PX0A 3OX4A 1O0BA 2OV8A 2P6RA 2V0CA 1SVIA 1P0MA 1PFUA 3CZCA 4LJ5A 4EATA 5AW6A 3R0PA 1JKFA 2WLJA 1TLTA 2YDXA 4DMHA 2GVZC 3W1EA 2P11A 1X3LA 2VJLA 3HHPA 1Z26A 3T9BA 1PGJA 4EJ6A 2ZKLA 4EJFA 5JNTA 2ZVYA 4M3NA 5T4EA 2LTAA 3EMVA 1J7KA 1UT8A 2I6UA 3CWZA 2BEKA 3JRXA 1PL4A 4W5HA 3NW9A 1DADA 1GPMA 1GL7A 1OYWA 1S3FA 4FN4A 4ZO9A 5CBPB 2HFEC 2ZBEA 4GX5A 1WUHS 3K32A 4KL8S 1CRWG 4NMMA 5CVUA 5KSZA 4MV9A 3RHSA 4DE5A 2HQ1A 1OYYA 2ZJ1A 3FCUB 4Q1FA 4IINA 2Q1TA 1WMAA 4D02A 1QLNA 1HDRA 2R9RB 1IOVA 1XLWA 2GN2A 1IEVA 1L7PA 2QUBA 3JYHA 1EESA 5BZBA 5GINC 4JOSA 1QBZA 1TCVA 2X42A 3KCQA 2DWCA 3IH5A 1M34E 2I76A 3WLQA 2K9PA 3VU1A 4DRXB 4HNQA 4BX3A 3OD4A 1QYDA 5U4QA 4GYCB 4RF3A 2ARKA 3DCYA 4GP7A 4NJMA 3S8MA 3U0ZA 4ZYWA 2OZEA 3HXQA 2PGOA 1G2QA 3WA6A 4X3MA 1NQTA 3QHPA 2C98A 4XR9A 4EFNA 2XIQA 5AM2A 3BA6A 4JX8A 4W5TA 3ORFA 4NR0A 2IEDA 4U8HA 3NHUA 5HIAA 3LCRA 3O8CA 1FTNA 2HDHA 3RVPA 3GGDA 3PGXA 5CB6A 2WA4A 1XQ1A 1NN1A 2J3JA 2V6IA 3DBRA 4HWKA 1YQDA 5B2ZA 3B3FA 4FMCB 3B6EA 1G1AA 4JEIA 3MWKA 1U2SA 4LHVA 3DEYX 3VXKA 2W0MA 2JGNA 1X19A 2P8JA 3NLLA 2V7QG 3CRQA 4OO3A 5K8CA 1EJ2A 5LMNO 3GLHB 2ZRBA 6GPBA 5KTSA 1GCOA 4WJLA 2E3JA 1YTLA 3IPLA 4JLMA 4P22A 2CXNA 1KFCB 2K2QB 3LUPA 1PGNA 1BD3A 2KHZA 5TGTA 3FI0A 1YB1A 1DBPA 1P62B 1CQJB 1Y1LA 1IEWA 4YIHA 3NANA 3GAMA 1I3KA 4B73A 2OHIA 2ZOVA 3P0ZA 2H0QA 2IXTA 4WN9A 4ETNA 3GU3A 3P96A 4W7HA 1JHYA 1Z82A 4FJ0A 3IMFA 4ESVA 1TT7A 2A58A 1VPTA 3CIFA 3FNQA 1ZAYA 3LSYA 2V97A 4H16A 4HG2A 3WLKX 4D46A 1U0TA 3I5XA 1O5OA 3W0LB 1CQPA 1FP2A 5K3CA 2I4LA 2Y1OA 4CDMA 3NRCA 5H9WA 1UXHA 3ZHBA 5HPYB 2EZPA 1K6XA 5G02A 1YU9A 3GRZA 4NBKA 3ZE6A 1OVGA 3QTTA 4JJ6A 1C0KA 1H8EG 1EAYA 1E2EA 1SWWA 3UWDA 3E7FA 2PR7A 3NXKA 3TM5A 1UM9A 3B1JA 2P65A 2AK3A 2GDZA 3ONEA 3OU7A 3RS5A 4AVYA 2CLCX 1MHTA 3DL4A 1PDWA 3L0DA 4IEFB 5FIUA 1SO8A 3IP5A 4HTFB 3TUZC 1ZKDA 1EWQA 1E3MA 2OV1A 2QBYB 4URXR 3ZJUA 1Z2EA 4X44A 2PVPA 4Z9FA 1B4DA 2P7HA 3KHUA 4XQ9A 2B21A 3TOXA 3QOYA 5CU7A 3NMUC 3DHWC 6CHYA 4B47A 2IITA 5KOIA 1AI7A 3RFXA 2VTVA 5JXHA 1QWSA 2C2MA 2XNJA 3MS7A 1XD2A 2ZDQA 4FNMA 5ANRB 5HP7A 1AJPA 5EN4A 5EQFA 1GZ4A 4Y9SA 4JJIA 1V45E 3OMNB 1N36B 2OHXA 3K2IA 4NKRA 5HE9A 3OOSA 3AF4A 4UU7A 3IMKA 2YC2C 2VRCA 4OYYA 4RE5A 3X1DA 1WBBA 2V55B 1NT4A 3W9BA 4C5AA 1E1RA 3LQFA 1X9IA 2J1LA 1EGMB 3EFBA 3S0JA 2OCCB 2CCJA 2CUZA 1JHRA 3HSKA 4ID9A 4W9NC 2XD9A 3C5CA 4I5IA 3NWJA 3X2SA 3F4LA 4XXHA 5BYKA 2I3GA 4JOBA 2IS1A 4EVRA 5KWVA 4K9QA 3R40A 4E0BA 4O4IA 2E5LB 4DWWA 2ZZKA 2HA2A 3KJQA 2JGLA 5FUXA 3VOTA 3ANMA 5D86A 1G6UA 1LJUA 2JHPA 3IAEA 3T3PB 3GVHA 3LG2A 1JDZA 5JXWA 1Q0ZA 5KCMA 1SRYA 2R8ZA 1UJNA 3BWVA 3R7WA 1XF1A 4IXWA 4X1IB 3TTUA 4R81A 1UBJS 3USES 4X93A 5AKZA 2F9MA 4YB8A 4ZI7B 2Y1WA 2Z3VA 3D64A 3G02A 3WYFA 1TJ3A 1VPEA 4YPFA 3IR9A 2E76B 1J2EA 3HABA 5C52B 1MA0A 4Q20A 1GO1A 3K4PA 4DIUA 2VBIA 2OESA 3I4CA 3P2JA 2ZJ0A 4BC1A 2SKCA 2E18A 2BYTA 4O2AA 1JUDA 2A3NA 4QFCA 1Y37A 5HFNA 4AKEA 3SY8A 5HXUA 5AQ1A 3R0ZA 4GZ6A 3ZLUA 3CW9A 4ZQGA 1PNMA 2VF8A 2NMUA 3IB3A 1LZKA 3M4ZA 3OFKA 4LVNA 2JDID 2OFPA 4WQMA 5T8KA 1SJ9A 5LP1A 1YI2V 1YKFA 3TRDA 2QE6A 5J1TB 3RTGA 4AYWA 5EHZA 2BGJA 3T0IA 1HDGO 2P5TB 1Z4OA 1WB8A 1R8XA 2BBSA 3F3KA 2HSDA 3I8SA 4X66O 5FAKA 2PD4A 4JFAA 2M6YA 5FDFA 4LWOA 1QU7A 4ZAFA 1YZ3A 3B6NA 1G5TA 4E6EA 2XRZA 3L7QA 4GMGA 4JY7A 4DUYB 1VP3A 1GLGA 1G21E 4ZOLA 4RJ2A 2IZ5A 2DEUA 3RSLA 3EFOB 4AP5A 2PXAA 3NEAA 3GYGA 4UAVA 1S5LZ 1K7FB 4HWRA 1OIWA 1F20A 1ZJYA 4ND3A 2QT0A 5BP7A 4NEGA 1I24A 4HGQA 4HN4B 2Z2YA 1QVGF 1H2YA 3PJFA 3CE2A 1GTG1 1RI5A 3PXUA 3V6MA 1IXYA 3W06A 5TNXA 5EEGA 5CFNA 3BL6A 3M1IA 3QZUA 1XNRO 1M2JA 4CKBA 1SA0A 2A3QA 4C4WC 1XD8A 3D00A 2DFPA 3IMEA 1GUZA 4HK4A 2A5GA 2WJHA 4RQTA 4KUEA 2CH7B 1YCDA 1VE5A 1ZXLA 1N57A 1U65A 2MMGA 4AECA 1FFYA 3AYXB 3QYFA 1N0NA 1HKUA 3GARA 5IW8A 3TQFA 7ABPA 4X20A 3UJDA 4HNUA 3OX2A 1IUPA 1H2WA 2R3SA 2XQGA 3CMEF 3I5AA 3PUKA 3VZSA 2JLVA 1E98A 3C24A 4A7PA 1PF5A 1NYLA 2XOEA 3OQ6A 4MJXA 3W7AA 4FEGA 4UMDA 4GHWA 3PNLA 2W2KB 1P2GA 4QGBA 4B7EA 3ELCA 1T0IA 1KR2A 2JD1A 4WAUA 4P2ZA 4F3CA 4HBGA 3I76A 5HDQA 2HIMA 3UYKA 3WTBA 1A4XA 3RSOA 4ZMSA 1BD4A 1IBLB 1UBLS 2IXEA 2W6ZA 3EGWA 4HVTA 4QQNA