1KNJA

Co-crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase (ispf) from e. coli involved in mevalonate-independent isoprenoid biosynthesis, complexed with cmp/mecdp/mn2+
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
156
structure length
156
Chain Sequence
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structure and mechanism of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase. An enzyme in the mevalonate-independent isoprenoid biosynthetic pathway.
pubmed doi rcsb
source organism Escherichia coli
total genus 37
structure length 156
sequence length 156
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1knjA00
3GHZA 4C81A 3K2XA 3JVHA 1U3LA 3F0EA 1VH8A 3FBAA 3IEWA 1JN1A 3F0GA 3F0DA 3IKEA 3P10A 5B8FA 3T80A 1U43A 3IEQA 2AMTA 1GX1A 3KE1A 3F6MA 1YQNA 1IV3A 1W57A 3ERNA 3P0ZA 1IV4A 1U40A 1U3PA 1KNJA 3MBMA 3ESJA 1IV2A 3ELCA 3K14A 3FPIA 1JY8A 4C8GA 3Q8HA 1W55A 1VHAA 3F0FA 4C82A 4C8EA 1IV1A 2PMPA 4C8IA 1H48A 2UZHA 1H47A 2GZLA 3B6NA 3RE3A 1T0AA 1KNKA 3IKFA 3QHDA 3EORA
chains in the Genus database with same CATH superfamily
2UYPA 2ZVYA 4BY9D 2QI2A 3F0EA 3N4YA 1VH8A 1GO0A 3CCQF 2L26A 3RYHA 2KG4A 2Z1TA 4R40B 2UYNA 1W40A 2UYJA 4X20A 3V4DA 1XBIA 3OBWA 5C8YB 1SZQA 3ERNA 1YHQF 2KTVA 3NVIB 1M1KH 4BVQA 2ZAUA 4B45A 5HP8A 1OAPA 1N8RH 1QAHA 3L7QA 1KQSF 3TD3A 4HNAA 3MCQA 4X1IA 2BTOA 5HY1A 3PAFA 5EB0A 1TUBA 3P10A 1JN1A 3F0GA 1DBFA 5ITZA 1E7KA 3J81M 3ON1A 3ZO8A 3IMPA 4I4TB 3WJPA 1R1MA 5HWEA 3C9RA 4BT7A 3DDNA 3K12A 3RYFA 4BVRA 3LWRC 5LP6A 1RQ2A 2CHSA 5GONB 3N2KB 1XRGA 3NVKE 3CCUF 2AIZP 1JFFA 3U0OA 1YITF 3UT5A 5G4VC 1RQ7A 1KNKA 2CHTA 4BT3A 3LWVC 1VQ5F 3E22B 2I6RA 3IEWA 3HKCB 2HX0A 3JAKB 3JATA 4O4JB 5EIBD 4E6EA 1QVFF 1W3EX 3T80A 3ZP4A 3E20B 3RYCA 3PLAC 1GX1A 1VQPF 1W41A 3CPWF 1K8AH 1OFUA 1DT9A 1U3PA 5CA1B 5EZYB 4KWEA 1X7PA 4X1KA 2VXYA 2F9ZC 1TVKA 3CYQA 1GO1A 1Z5WA 1IPAA 3WGNA 4ZOLA 5GIPC 4IHJB 1SA0B 5KX5B 4G88A 3JVHA 1YGYA 1Q81H 3FBAA 4PWTA 1COMA 2QA4F 1NMUB 2QTPA 5HY4A 4U3JB 1YJ9F 3O85A 3HKBB 1VK3A 5CB4B 2LBXA 1YI2F 4X1YB 2HQSC 3N4ZA 3M1XA 2BO1A 2OZBA 4ZHQA 1YIJF 3HKDB 2AIFA 4YJ3B 4BT6A 1H48A 3P4EA 4F6RB 2CSLA 5BMVB 1K9MH 5EIBC 5LXTA 3QHDA 4BT2A 1Q7YH 3D54A 1VQ8F 4I55B 3ZOPA 3FFMA 4IIJA 1VQ6F 4O4IB 4FFBA 4XCQA 3HKEB 3G6EF 4TV8A 5B8FA 1S72F 1J7HA 5AVMA 2MQEA 2P6YA 3G71F 2VAWA 1VQKF 3S06A 1KNJA 3ESJA 3JALA 3HJWC 3GTZA 3CPQA 5IJ9A 1YJNF 4EI9A 2Q1YA 4U39A 4O2BA 4O4HA 1H47A 3B6NA 3WJQA 5J2TA 3LDTA 4G4ZA 3IKFA 4ZI7A 2Z1UA 2QEXF 3CMAF 2UYNB 4NQ3A 4TUYB 1KD1H 5FLXM 4X3LA 3S0WA 3VTIC 3M84A 4BVTA 3MQWA 1W5FA 1W57A 3SIVA 1Q8RA 3CCVF 2OTJF 1IV2A 3ELCA 1W5EA 2IQQA 5LYJA 4WBNA 3RYIB 4LNUA 3ZP7A 3CD6F 3VCZA 3QUWA 1CLIA 3CXCF 2HRYA 2UZHA 4I50B 3TD4A 4YJ2A 3CCRF 1VQOF 3EORA 5LP6C 5JQGA 5LA6B 1CN7A 4G4VA 1FNKA 2CWJA 2H8CA 4B5CA 3RA5A 3N2GA 3I56F 3S03A 3RYFB 5G4UC 5LP6B 1CK2A 1PF5A 3OW2F 3CC4F 2CVLA 2HP0A 4LCKA 2IG8A 1JFFB 4G4WA 3UT5B 2NMUA 2DT4A 5A2QM 3JAWA 3C9SA 1JY8A 5EYPB 1W42A 2EWCA 5HXUA 5EO3A 1XHOA 1K73H 4O2AA 1GZ0A 3JATB 4DXDA 3GHZA 4C81A 3CYPB 3E1YA 3WXMB 2VGMA 1X25A 3F0DA 2G9IA 3JASB 3CCJF 4X1KB 3KJKA 3V7EA 2RHOA 2CZWA 5MN4A 2W8BC 4I4TA 5FNVA 3S0YA 1NJIH 3JARA 5JH7A 2BTQB 2FC3A 5GONA 3N2KA 4ZHYB 3OONA 2PHNA 5JCOA 3LWPC 2LCAA 1FFXA 3TD5A 4DRXB 5IYZA 1W5AA 3DC2A 3C9TA 3E22A 3HAXD 3JAKA 1RLUA 2YXZA 3CMEF 2ZODA 3LWOC 4TV9B 1YQNA 2BTUA 3NK7A 1IV4A 4ZHQB 3J7AR 4O4LB 3J80M 2Q1XA 5CA1A 2B33A 2Z01A 4C8IA 5HY2A 3VMFB 2HS3A 2RB9A 3D00A 5CA0B 5GAPK 1U3LA 5IJ0B 5KMGB 2VAPA 1T0KB 4IHJA 5J2UB 3LWQC 1SA0A 5KX5A 3V3TA 1VQNF 3JAMM 3JALB 2R751 3CG6A 3MCAB 3JCMM 5IJ9B 1U40A 4O2BB 3C9UA 1UI9A 4EB6A 2H8EA 1ODEA 5J2TB 3RA6A 4ZI7B 3F0FA 3KHNA 2LBTA 3I3FA 4X1YA 2ALEA 3G4SF 2HP3A 2JNBA 2V9YA 5LOVA 2UYKA 3HKDA 3RYHB 3QTYA 4F6RA 4ZHVA 4X20B 4I55A 2H6LA 1RA4A 5HP7A 3VI6A 4BVSA 1YJWF 5LYJB 1JJ2F 4C4WC 1Z5VA 3KJJA 2K1SA 3VYTC 5JVDA 1VQ9F 3OBYA 5GINC 3WGJA 3K14A 4HNAB 1PXWA 1UFYA 4YJ2B 3CCEF 1VHAA 1ZWZA 4X1IB 3FD6A 1W59A 1TUBB 2WALA 5ITZB 2OHWA 3N2GB 4M8IA 3WPXA 3BYQA 2HP0B 4BT4A 4TUYA 4RHAA 5EB1B 3JAWB 3P0ZA 2ZVZA 4NWOB 3MDOA 4EI8A 4O2AB 4EI7A 5C8YA 2HS4A 4C8EA 3K0TA 3S02A 1NQ3A 3RYIA 4ZK7A 4X3MA 4BW0B 1FSZA 4I50A 4RQOA 1VQ7F 1ONIA 3WGLA 3RYCB 2OTMA 5DCVA 5LA6A 3C8LA 5HY0A 2AMTA 1H7MA 3KE1A 2ZF8A 5FNVB 1IV3A 1VQVA 5JCOC 3JARB 5JH7B 3VOAA 3S0HA 5MN6A 1Q86H 1TVKB 2RHHA 2VAMA 4ZOLB 2Z1FA 3FD5A 4C82A 1IV1A 4TZZA 3RE3A 2RHLA 3WGKA 1FFXB 5IYZB 5EYPA 1SDSA 3WPWA 1W2BF 4B62A 3I7TA 4B46A 3CB2A 3VO8A 3CCMF 5GANK 3CC2F 4ERHA 1M90H 3VYSC 3HKCA 2LBWA 4O4JA 4ZHWA 2VGNA 3LMEA 1W5BA 2YYEA 5GIOC 3JASA 3VOBA 3WGMA 2R6R1 3Q8HA 2HS0A 5LXTB 2I6DA 5EZYA 4IIJB 1VQ4F 2GZLA 4FFBB 3VIUA 4C8GA 2OTLF 4TV8B 5MN5A 3IKEA 1FNJA 2ZOVA 3SIUA 4BT5A 2N48A 4DRXA 3CCSF 1JD1A 4EB6B 2CW4A 2GVIA 3VYUC 2Z1EA 4TV9A 4O4HB 3HWUA 4U3JA 5LOVB 3FPIA 3HKBA 1QD9A 3KIZA 3NK6A 1W55A 4O4LA 2HVYD 2PMPA 5CB4A 5IT9M 1QU9A 4NUTA 2HRUA 3I55F 3IR9A 4G4XA 3AGKA 2KGWA 3HTNA 3NMUC 4YJ3A 3K2XA 1X52A 5BMVA 1KC8H 5CA0A 1U43A 1X7OA 3IEQA 5JVDB 4O4IA 2RHJA 3WJRA 5IJ0A 5KMGA 2IAFA 5FJ4C 2GLZA 3LYBA 5J2UA 3CC7F 3F6MA 3HKEA 3R0PA 1Q82H 2KTUA 4WBNB 3MBMA 2FGYA 4LNUB 5HXZA 1VQLF 3D01A 1W581 3GYQA 2DYYA 5EAZA 3V7QA 5JQGB 3M4SA 1QVGF 1VQMF 1T0AA 5EWRA 4G4YA 3CCLF 1XV2A 3LFOA 1RLGA
chains in the Genus database with same CATH topology
3GHZA 4C81A 3K2XA 3JVHA 1U3LA 3F0EA 1VH8A 3FBAA 3IEWA 1JN1A 3F0GA 3F0DA 3IKEA 3P10A 5B8FA 3T80A 1U43A 3IEQA 2AMTA 1GX1A 3KE1A 3F6MA 1YQNA 1IV3A 1W57A 3ERNA 3P0ZA 1IV4A 1U40A 1U3PA 1KNJA 3MBMA 3ESJA 1IV2A 3ELCA 3K14A 3FPIA 1JY8A 4C8GA 3Q8HA 1W55A 1VHAA 3F0FA 4C82A 4C8EA 1IV1A 2PMPA 4C8IA 1H48A 2UZHA 1H47A 2GZLA 3B6NA 3RE3A 1T0AA 1KNKA 3IKFA 3QHDA 3EORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GHZ A;  4C81 A;  3K2X A;  3JVH A;  1U3L A;  3F0E A;  1VH8 A;  3FBA A;  3IEW A;  1JN1 A;  3F0G A;  3F0D A;  3IKE A;  3P10 A;  5B8F A;  3T80 A;  1U43 A;  3IEQ A;  2AMT A;  1GX1 A;  3KE1 A;  3F6M A;  1YQN A;  1IV3 A;  1W57 A;  3ERN A;  3P0Z A;  1IV4 A;  1U40 A;  1U3P A;  1KNJ A;  3MBM A;  3ESJ A;  1IV2 A;  3ELC A;  3K14 A;  3FPI A;  1JY8 A;  4C8G A;  3Q8H A;  1W55 A;  1VHA A;  3F0F A;  4C82 A;  4C8E A;  1IV1 A;  2PMP A;  4C8I A;  1H48 A;  2UZH A;  1H47 A;  2GZL A;  3B6N A;  3RE3 A;  1T0A A;  1KNK A;  3IKF A;  3QHD A;  3EOR A; 
#chains in the Genus database with same CATH topology
 2UYP A;  2ZVY A;  4BY9 D;  2QI2 A;  3F0E A;  3N4Y A;  1VH8 A;  1GO0 A;  3CCQ F;  2L26 A;  3RYH A;  2KG4 A;  2Z1T A;  4R40 B;  2UYN A;  1W40 A;  2UYJ A;  4X20 A;  3V4D A;  1XBI A;  3OBW A;  5C8Y B;  1SZQ A;  3ERN A;  1YHQ F;  2KTV A;  3NVI B;  1M1K H;  4BVQ A;  2ZAU A;  4B45 A;  5HP8 A;  1OAP A;  1N8R H;  1QAH A;  3L7Q A;  1KQS F;  3TD3 A;  4HNA A;  3MCQ A;  4X1I A;  2BTO A;  5HY1 A;  3PAF A;  5EB0 A;  1TUB A;  3P10 A;  1JN1 A;  3F0G A;  1DBF A;  5ITZ A;  1E7K A;  3J81 M;  3ON1 A;  3ZO8 A;  3IMP A;  4I4T B;  3WJP A;  1R1M A;  5HWE A;  3C9R A;  4BT7 A;  3DDN A;  3K12 A;  3RYF A;  4BVR A;  3LWR C;  5LP6 A;  1RQ2 A;  2CHS A;  5GON B;  3N2K B;  1XRG A;  3NVK E;  3CCU F;  2AIZ P;  1JFF A;  3U0O A;  1YIT F;  3UT5 A;  5G4V C;  1RQ7 A;  1KNK A;  2CHT A;  4BT3 A;  3LWV C;  1VQ5 F;  3E22 B;  2I6R A;  3IEW A;  3HKC B;  2HX0 A;  3JAK B;  3JAT A;  4O4J B;  5EIB D;  4E6E A;  1QVF F;  1W3E X;  3T80 A;  3ZP4 A;  3E20 B;  3RYC A;  3PLA C;  1GX1 A;  1VQP F;  1W41 A;  3CPW F;  1K8A H;  1OFU A;  1DT9 A;  1U3P A;  5CA1 B;  5EZY B;  4KWE A;  1X7P A;  4X1K A;  2VXY A;  2F9Z C;  1TVK A;  3CYQ A;  1GO1 A;  1Z5W A;  1IPA A;  3WGN A;  4ZOL A;  5GIP C;  4IHJ B;  1SA0 B;  5KX5 B;  4G88 A;  3JVH A;  1YGY A;  1Q81 H;  3FBA A;  4PWT A;  1COM A;  2QA4 F;  1NMU B;  2QTP A;  5HY4 A;  4U3J B;  1YJ9 F;  3O85 A;  3HKB B;  1VK3 A;  5CB4 B;  2LBX A;  1YI2 F;  4X1Y B;  2HQS C;  3N4Z A;  3M1X A;  2BO1 A;  2OZB A;  4ZHQ A;  1YIJ F;  3HKD B;  2AIF A;  4YJ3 B;  4BT6 A;  1H48 A;  3P4E A;  4F6R B;  2CSL A;  5BMV B;  1K9M H;  5EIB C;  5LXT A;  3QHD A;  4BT2 A;  1Q7Y H;  3D54 A;  1VQ8 F;  4I55 B;  3ZOP A;  3FFM A;  4IIJ A;  1VQ6 F;  4O4I B;  4FFB A;  4XCQ A;  3HKE B;  3G6E F;  4TV8 A;  5B8F A;  1S72 F;  1J7H A;  5AVM A;  2MQE A;  2P6Y A;  3G71 F;  2VAW A;  1VQK F;  3S06 A;  1KNJ A;  3ESJ A;  3JAL A;  3HJW C;  3GTZ A;  3CPQ A;  5IJ9 A;  1YJN F;  4EI9 A;  2Q1Y A;  4U39 A;  4O2B A;  4O4H A;  1H47 A;  3B6N A;  3WJQ A;  5J2T A;  3LDT A;  4G4Z A;  3IKF A;  4ZI7 A;  2Z1U A;  2QEX F;  3CMA F;  2UYN B;  4NQ3 A;  4TUY B;  1KD1 H;  5FLX M;  4X3L A;  3S0W A;  3VTI C;  3M84 A;  4BVT A;  3MQW A;  1W5F A;  1W57 A;  3SIV A;  1Q8R A;  3CCV F;  2OTJ F;  1IV2 A;  3ELC A;  1W5E A;  2IQQ A;  5LYJ A;  4WBN A;  3RYI B;  4LNU A;  3ZP7 A;  3CD6 F;  3VCZ A;  3QUW A;  1CLI A;  3CXC F;  2HRY A;  2UZH A;  4I50 B;  3TD4 A;  4YJ2 A;  3CCR F;  1VQO F;  3EOR A;  5LP6 C;  5JQG A;  5LA6 B;  1CN7 A;  4G4V A;  1FNK A;  2CWJ A;  2H8C A;  4B5C A;  3RA5 A;  3N2G A;  3I56 F;  3S03 A;  3RYF B;  5G4U C;  5LP6 B;  1CK2 A;  1PF5 A;  3OW2 F;  3CC4 F;  2CVL A;  2HP0 A;  4LCK A;  2IG8 A;  1JFF B;  4G4W A;  3UT5 B;  2NMU A;  2DT4 A;  5A2Q M;  3JAW A;  3C9S A;  1JY8 A;  5EYP B;  1W42 A;  2EWC A;  5HXU A;  5EO3 A;  1XHO A;  1K73 H;  4O2A A;  1GZ0 A;  3JAT B;  4DXD A;  3GHZ A;  4C81 A;  3CYP B;  3E1Y A;  3WXM B;  2VGM A;  1X25 A;  3F0D A;  2G9I A;  3JAS B;  3CCJ F;  4X1K B;  3KJK A;  3V7E A;  2RHO A;  2CZW A;  5MN4 A;  2W8B C;  4I4T A;  5FNV A;  3S0Y A;  1NJI H;  3JAR A;  5JH7 A;  2BTQ B;  2FC3 A;  5GON A;  3N2K A;  4ZHY B;  3OON A;  2PHN A;  5JCO A;  3LWP C;  2LCA A;  1FFX A;  3TD5 A;  4DRX B;  5IYZ A;  1W5A A;  3DC2 A;  3C9T A;  3E22 A;  3HAX D;  3JAK A;  1RLU A;  2YXZ A;  3CME F;  2ZOD A;  3LWO C;  4TV9 B;  1YQN A;  2BTU A;  3NK7 A;  1IV4 A;  4ZHQ B;  3J7A R;  4O4L B;  3J80 M;  2Q1X A;  5CA1 A;  2B33 A;  2Z01 A;  4C8I A;  5HY2 A;  3VMF B;  2HS3 A;  2RB9 A;  3D00 A;  5CA0 B;  5GAP K;  1U3L A;  5IJ0 B;  5KMG B;  2VAP A;  1T0K B;  4IHJ A;  5J2U B;  3LWQ C;  1SA0 A;  5KX5 A;  3V3T A;  1VQN F;  3JAM M;  3JAL B;  2R75 1;  3CG6 A;  3MCA B;  3JCM M;  5IJ9 B;  1U40 A;  4O2B B;  3C9U A;  1UI9 A;  4EB6 A;  2H8E A;  1ODE A;  5J2T B;  3RA6 A;  4ZI7 B;  3F0F A;  3KHN A;  2LBT A;  3I3F A;  4X1Y A;  2ALE A;  3G4S F;  2HP3 A;  2JNB A;  2V9Y A;  5LOV A;  2UYK A;  3HKD A;  3RYH B;  3QTY A;  4F6R A;  4ZHV A;  4X20 B;  4I55 A;  2H6L A;  1RA4 A;  5HP7 A;  3VI6 A;  4BVS A;  1YJW F;  5LYJ B;  1JJ2 F;  4C4W C;  1Z5V A;  3KJJ A;  2K1S A;  3VYT C;  5JVD A;  1VQ9 F;  3OBY A;  5GIN C;  3WGJ A;  3K14 A;  4HNA B;  1PXW A;  1UFY A;  4YJ2 B;  3CCE F;  1VHA A;  1ZWZ A;  4X1I B;  3FD6 A;  1W59 A;  1TUB B;  2WAL A;  5ITZ B;  2OHW A;  3N2G B;  4M8I A;  3WPX A;  3BYQ A;  2HP0 B;  4BT4 A;  4TUY A;  4RHA A;  5EB1 B;  3JAW B;  3P0Z A;  2ZVZ A;  4NWO B;  3MDO A;  4EI8 A;  4O2A B;  4EI7 A;  5C8Y A;  2HS4 A;  4C8E A;  3K0T A;  3S02 A;  1NQ3 A;  3RYI A;  4ZK7 A;  4X3M A;  4BW0 B;  1FSZ A;  4I50 A;  4RQO A;  1VQ7 F;  1ONI A;  3WGL A;  3RYC B;  2OTM A;  5DCV A;  5LA6 A;  3C8L A;  5HY0 A;  2AMT A;  1H7M A;  3KE1 A;  2ZF8 A;  5FNV B;  1IV3 A;  1VQV A;  5JCO C;  3JAR B;  5JH7 B;  3VOA A;  3S0H A;  5MN6 A;  1Q86 H;  1TVK B;  2RHH A;  2VAM A;  4ZOL B;  2Z1F A;  3FD5 A;  4C82 A;  1IV1 A;  4TZZ A;  3RE3 A;  2RHL A;  3WGK A;  1FFX B;  5IYZ B;  5EYP A;  1SDS A;  3WPW A;  1W2B F;  4B62 A;  3I7T A;  4B46 A;  3CB2 A;  3VO8 A;  3CCM F;  5GAN K;  3CC2 F;  4ERH A;  1M90 H;  3VYS C;  3HKC A;  2LBW A;  4O4J A;  4ZHW A;  2VGN A;  3LME A;  1W5B A;  2YYE A;  5GIO C;  3JAS A;  3VOB A;  3WGM A;  2R6R 1;  3Q8H A;  2HS0 A;  5LXT B;  2I6D A;  5EZY A;  4IIJ B;  1VQ4 F;  2GZL A;  4FFB B;  3VIU A;  4C8G A;  2OTL F;  4TV8 B;  5MN5 A;  3IKE A;  1FNJ A;  2ZOV A;  3SIU A;  4BT5 A;  2N48 A;  4DRX A;  3CCS F;  1JD1 A;  4EB6 B;  2CW4 A;  2GVI A;  3VYU C;  2Z1E A;  4TV9 A;  4O4H B;  3HWU A;  4U3J A;  5LOV B;  3FPI A;  3HKB A;  1QD9 A;  3KIZ A;  3NK6 A;  1W55 A;  4O4L A;  2HVY D;  2PMP A;  5CB4 A;  5IT9 M;  1QU9 A;  4NUT A;  2HRU A;  3I55 F;  3IR9 A;  4G4X A;  3AGK A;  2KGW A;  3HTN A;  3NMU C;  4YJ3 A;  3K2X A;  1X52 A;  5BMV A;  1KC8 H;  5CA0 A;  1U43 A;  1X7O A;  3IEQ A;  5JVD B;  4O4I A;  2RHJ A;  3WJR A;  5IJ0 A;  5KMG A;  2IAF A;  5FJ4 C;  2GLZ A;  3LYB A;  5J2U A;  3CC7 F;  3F6M A;  3HKE A;  3R0P A;  1Q82 H;  2KTU A;  4WBN B;  3MBM A;  2FGY A;  4LNU B;  5HXZ A;  1VQL F;  3D01 A;  1W58 1;  3GYQ A;  2DYY A;  5EAZ A;  3V7Q A;  5JQG B;  3M4S A;  1QVG F;  1VQM F;  1T0A A;  5EWR A;  4G4Y A;  3CCL F;  1XV2 A;  3LFO A;  1RLG A; 
#chains in the Genus database with same CATH homology
 3GHZ A;  4C81 A;  3K2X A;  3JVH A;  1U3L A;  3F0E A;  1VH8 A;  3FBA A;  3IEW A;  1JN1 A;  3F0G A;  3F0D A;  3IKE A;  3P10 A;  5B8F A;  3T80 A;  1U43 A;  3IEQ A;  2AMT A;  1GX1 A;  3KE1 A;  3F6M A;  1YQN A;  1IV3 A;  1W57 A;  3ERN A;  3P0Z A;  1IV4 A;  1U40 A;  1U3P A;  1KNJ A;  3MBM A;  3ESJ A;  1IV2 A;  3ELC A;  3K14 A;  3FPI A;  1JY8 A;  4C8G A;  3Q8H A;  1W55 A;  1VHA A;  3F0F A;  4C82 A;  4C8E A;  1IV1 A;  2PMP A;  4C8I A;  1H48 A;  2UZH A;  1H47 A;  2GZL A;  3B6N A;  3RE3 A;  1T0A A;  1KNK A;  3IKF A;  3QHD A;  3EOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...