1KNJA

Co-crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase (ispf) from e. coli involved in mevalonate-independent isoprenoid biosynthesis, complexed with cmp/mecdp/mn2+
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
156
structure length
156
Chain Sequence
b'MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
molecule tags Metal binding protein
source organism Escherichia coli
publication title Structure and mechanism of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase. An enzyme in the mevalonate-independent isoprenoid biosynthetic pathway.
pubmed doi rcsb
total genus 37
structure length 156
sequence length 156
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1knjA00
1JY8A 3GHZA 1U3PA 3RE3A 1T0AA 1W55A 3EORA 3IEWA 1IV4A 3FPIA 1U40A 3F0EA 1H47A 4C8EA 3F6MA 3IKEA 1IV2A 1KNKA 3MBMA 3B6NA 1W57A 4C82A 1KNJA 3P0ZA 3QHDA 3ESJA 1U43A 2AMTA 3F0GA 1YQNA 1IV1A 3IKFA 3P10A 1JN1A 1VH8A 4C8IA 3ELCA 1GX1A 1VHAA 2UZHA 3F0FA 4C81A 5B8FA 3ERNA 3KE1A 1H48A 4C8GA 3K2XA 3F0DA 3K14A 3T80A 3FBAA 1U3LA 3IEQA 1IV3A 3Q8HA 3JVHA 2PMPA 2GZLA
chains in the Genus database with same CATH superfamily
2Z1EA 5JH7B 5CA0B 5LOVA 2FGYA 3LYBA 1JJ2F 3CG6A 3RYHB 3NK6A 1VQVA 1Z5VA 4ZHVA 2L26A 4LNUA 4XCQA 3WGJA 3B6NA 1GO0A 2ZVYA 4C82A 1YITF 5FJ4C 3C8LA 2W8BC 1SDSA 3PLAC 1VH8A 1KC8H 3V7EA 5CA1B 2AIZP 4HNAB 1Q86H 5J2UA 2Z01A 2UYPA 3RA5A 1W59A 3FD6A 3LWOC 5J2UB 1XHOA 4NWOB 3VOBA 5MN5A 3IEQA 2RHLA 3ESJA 1FNKA 5LP6C 3OBYA 1PXWA 5EO3A 2HP0A 2KGWA 4B62A 5CA0A 1QAHA 3K12A 3CPQA 3CMEF 5KX5B 3RYHA 4G4XA 1JFFA 3CC7F 3LMEA 3KJKA 1KNJA 1U43A 5EYPB 4WBNA 5IT9M 1QU9A 2IAFA 5LP6B 3S03A 5ITZB 3CCEF 3UT5A 3DDNA 1FFXA 5FNVA 1FFXB 2Z1UA 3LFOA 3TD3A 3M84A 1U40A 2VGMA 4O4IB 3JATA 3CCJF 5EIBC 3P0ZA 5G4UC 1CN7A 1JFFB 5EIBD 3NVIB 2UYNA 1QVGF 3F0FA 2Z1FA 2HQSC 2HS4A 5LOVB 1K73H 2OTJF 1H48A 3CPWF 2GLZA 3JATB 3VO8A 5GIOC 4YJ2A 2H8EA 3CXCF 2MQEA 1H7MA 3CC2F 2QTPA 1XRGA 5HY2A 1NJIH 2EWCA 2HRYA 1SA0A 3MDOA 4I55A 3WGNA 3I55F 1YHQF 2VGNA 1W3EX 2YYEA 1VQ9F 3MBMA 1M1KH 4X20B 2CSLA 2HP3A 4EI7A 3QHDA 5J2TB 5GIPC 3RA6A 3JAKB 3P10A 3MCQA 2CW4A 1YI2F 1DBFA 2OTLF 5IJ0B 4BT4A 1VQMF 5CB4B 4O4LB 4X1IB 3O85A 1W5FA 5LYJA 3J80M 5C8YA 3BYQA 1Q82H 3ON1A 2Z1TA 4O2BB 3JCMM 3DC2A 5JH7A 2DT4A 3JALB 1IV4A 4ZHYB 2HS3A 4U39A 1M90H 3QTYA 3LWQC 1R1MA 3JASA 2AMTA 3CCLF 3ELCA 1GX1A 3LWRC 5CA1A 3JAWA 3M4SA 1VQ7F 4BVSA 2N48A 2P6YA 4C8GA 4O4JA 3PAFA 3G71F 2JNBA 1NQ3A 3LDTA 2V9YA 2KTVA 4BT2A 2QA4F 4EI9A 5HY4A 2ZF8A 2LCAA 5BMVA 1YJ9F 3RYCB 5HXUA 4ZHWA 1IV2A 1X7PA 3S02A 5GINC 1TVKB 5HP7A 3LWVC 4TV8B 3E20B 2I6DA 3CCUF 1JN1A 3JASB 5HY1A 5EWRA 4G4YA 3VYSC 3D01A 4I4TA 4KWEA 5FNVB 4BY9D 1GZ0A 5EZYB 2HRUA 3IR9A 1UI9A 3TD5A 3N2GA 1YGYA 3VMFB 3AGKA 4O2AA 2ZAUA 2DYYA 3CMAF 5JVDA 3NK7A 1H47A 3GTZA 3HKBB 4TUYB 1OFUA 4B46A 5HXZA 2AIFA 4IHJB 1W57A 4X1IA 2R751 4IHJA 3HTNA 4RHAA 4EI8A 4F6RB 3D54A 3CCVF 4C8IA 2HP0B 2UZHA 3E22A 4YJ3B 3HKCB 3V4DA 5JCOC 4ZOLB 2KTUA 3T80A 1VQ4F 2ZODA 4X1KB 4B45A 1E7KA 3S0WA 3UT5B 5A2QM 3MCAB 2PMPA 3JALA 1W5AA 3HKCA 5GAPK 3HKDB 3WJPA 1KD1H 5MN4A 2HS0A 5CB4A 4BVQA 2F9ZC 1TUBA 2HX0A 4G88A 4X1YA 3C9RA 3G6EF 2LBWA 3VIUA 1VQ8F 5LXTA 1PF5A 4BT7A 5EB1B 3HWUA 4O4LA 3HJWC 4PWTA 1Q7YH 5LA6B 2BO1A 3SIUA 3JAKA 1W2BF 2ZOVA 5IJ9A 4TV9A 1W41A 4ZOLA 1VQLF 4YJ2B 2H6LA 5ITZA 5LA6A 1VQNF 1VQKF 2LBXA 1VQ6F 4NUTA 3CC4F 3J81M 4FFBA 3CCRF 3N2KA 3ERNA 4X3LA 3FD5A 3JARA 5GANK 5KX5A 2RB9A 2UYJA 3D00A 4O4HA 2CHTA 1YJNF 2R6R1 2NMUA 2QI2A 3IMPA 3CCMF 2UYKA 1QVFF 1Q8RA 1YJWF 2G9IA 3J7AR 1X52A 2FC3A 3N4YA 4C4WC 1FNJA 2VAPA 5EAZA 5EZYA 5IJ9B 2IQQA 4G4WA 3ZP4A 1RLGA 4WBNB 2K1SA 3CCQF 1SA0B 2OTMA 4BT3A 4U3JA 2VAMA 4LCKA 3MQWA 4RQOA 4ZHQB 1T0KB 2OZBA 3Q8HA 2KG4A 2RHJA 1VQPF 1ODEA 3VTIC 4BT6A 2QEXF 3N2KB 3P4EA 3LWPC 3S06A 3CYQA 1X7OA 4TUYA 3F0EA 4I4TB 4BVTA 3L7QA 3OONA 1N8RH 4X1KA 3OBWA 3ZP7A 2CHSA 3RYIB 3RYIA 1VK3A 2IG8A 1XBIA 3E22B 4TZZA 4ZK7A 5BMVB 3ZOPA 2ALEA 3FBAA 4TV8A 2GZLA 5LP6A 3HKEA 4E6EA 1U3PA 1X25A 5LXTB 3IEWA 1ONIA 3CYPB 4IIJA 4O2AB 3FPIA 5IJ0A 4O4JB 3V7QA 1CK2A 5IYZA 4I50B 1KNKA 4X1YB 2VXYA 2RHHA 5LYJB 5G4VC 5HP8A 1VQ5F 3K0TA 3I3FA 1VHAA 1Z5WA 1GO1A 1K8AH 3KE1A 4EB6B 4ZI7B 1K9MH 3RYFB 1UFYA 3VOAA 1ZWZA 3WGMA 2BTOA 5AVMA 1U3LA 2I6RA 1IV3A 3ZO8A 4TV9B 1S72F 2PHNA 1JY8A 3CCSF 3GHZA 4G4VA 4YJ3A 1T0AA 1W55A 3U0OA 1QD9A 4BT5A 3RYCA 4LNUB 5HY0A 5IYZB 2B33A 3I7TA 3IKFA 3WJQA 5J2TA 2CVLA 5JCOA 4C81A 3NVKE 3VCZA 5B8FA 3JAMM 2HVYD 1W5BA 4DXDA 2CWJA 4X20A 5HWEA 1TUBB 3TD4A 5MN6A 3V3TA 2Q1YA 4DRXB 3I56F 3WJRA 1RQ2A 3WXMB 5GONB 3RE3A 3WGKA 2H8CA 5EB0A 1NMUB 4O2BA 3HAXD 3N4ZA 1TVKA 4F6RA 2CZWA 3M1XA 2UYNB 1IV1A 3R0PA 1W40A 4FFBB 4ERHA 4B5CA 5JQGB 1RQ7A 3K14A 1IPAA 3HKBA 5JQGA 3JARB 3CD6F 2ZVZA 3S0YA 1CLIA 4X3MA 1YIJF 3CB2A 3G4SF 1RA4A 5JVDB 1RLUA 3JAWB 3GYQA 3EORA 3HKDA 2BTQB 1FSZA 3FFMA 5GONA 3VYTC 4HNAA 4M8IA 2RHOA 3QUWA 1KQSF 3WPWA 3IKEA 1OAPA 3C9TA 1W581 2Q1XA 4G4ZA 3NMUC 1COMA 2WALA 3VI6A 1VQOF 1W42A 2GVIA 3RYFA 4R40B 3WPXA 5KMGB 1SZQA 3K2XA 3F0DA 1J7HA 4BW0B 1JD1A 3HKEB 4ZHQA 3N2GB 3VYUC 5KMGA 4U3JB 1DT9A 3SIVA 1W5EA 4C8EA 3F6MA 4IIJB 3OW2F 2VAWA 3KHNA 1XV2A 5FLXM 4O4IA 1Q81H 5DCVA 3C9SA 3F0GA 1YQNA 2LBTA 2BTUA 4EB6A 4I55B 3WGLA 4NQ3A 2YXZA 3C9UA 4I50A 4ZI7A 3KJJA 4DRXA 4BVRA 3KIZA 5C8YB 3E1YA 4O4HB 5EYPA 3S0HA 3JVHA 2OHWA
chains in the Genus database with same CATH topology
1JY8A 3GHZA 1U3PA 3RE3A 1T0AA 1W55A 3EORA 3IEWA 1IV4A 3FPIA 1U40A 3F0EA 1H47A 4C8EA 3F6MA 3IKEA 1IV2A 1KNKA 3MBMA 3B6NA 1W57A 4C82A 1KNJA 3P0ZA 3QHDA 3ESJA 1U43A 2AMTA 3F0GA 1YQNA 1IV1A 3IKFA 3P10A 1JN1A 1VH8A 4C8IA 3ELCA 1GX1A 1VHAA 2UZHA 3F0FA 4C81A 5B8FA 3ERNA 3KE1A 1H48A 4C8GA 3K2XA 3F0DA 3K14A 3T80A 3FBAA 1U3LA 3IEQA 1IV3A 3Q8HA 3JVHA 2PMPA 2GZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY8 A;  3GHZ A;  1U3P A;  3RE3 A;  1T0A A;  1W55 A;  3EOR A;  3IEW A;  1IV4 A;  3FPI A;  1U40 A;  3F0E A;  1H47 A;  4C8E A;  3F6M A;  3IKE A;  1IV2 A;  1KNK A;  3MBM A;  3B6N A;  1W57 A;  4C82 A;  1KNJ A;  3P0Z A;  3QHD A;  3ESJ A;  1U43 A;  2AMT A;  3F0G A;  1YQN A;  1IV1 A;  3IKF A;  3P10 A;  1JN1 A;  1VH8 A;  4C8I A;  3ELC A;  1GX1 A;  1VHA A;  2UZH A;  3F0F A;  4C81 A;  5B8F A;  3ERN A;  3KE1 A;  1H48 A;  4C8G A;  3K2X A;  3F0D A;  3K14 A;  3T80 A;  3FBA A;  1U3L A;  3IEQ A;  1IV3 A;  3Q8H A;  3JVH A;  2PMP A;  2GZL A; 
#chains in the Genus database with same CATH topology
 2Z1E A;  5JH7 B;  5CA0 B;  5LOV A;  2FGY A;  3LYB A;  1JJ2 F;  3CG6 A;  3RYH B;  3NK6 A;  1VQV A;  1Z5V A;  4ZHV A;  2L26 A;  4LNU A;  4XCQ A;  3WGJ A;  3B6N A;  1GO0 A;  2ZVY A;  4C82 A;  1YIT F;  5FJ4 C;  3C8L A;  2W8B C;  1SDS A;  3PLA C;  1VH8 A;  1KC8 H;  3V7E A;  5CA1 B;  2AIZ P;  4HNA B;  1Q86 H;  5J2U A;  2Z01 A;  2UYP A;  3RA5 A;  1W59 A;  3FD6 A;  3LWO C;  5J2U B;  1XHO A;  4NWO B;  3VOB A;  5MN5 A;  3IEQ A;  2RHL A;  3ESJ A;  1FNK A;  5LP6 C;  3OBY A;  1PXW A;  5EO3 A;  2HP0 A;  2KGW A;  4B62 A;  5CA0 A;  1QAH A;  3K12 A;  3CPQ A;  3CME F;  5KX5 B;  3RYH A;  4G4X A;  1JFF A;  3CC7 F;  3LME A;  3KJK A;  1KNJ A;  1U43 A;  5EYP B;  4WBN A;  5IT9 M;  1QU9 A;  2IAF A;  5LP6 B;  3S03 A;  5ITZ B;  3CCE F;  3UT5 A;  3DDN A;  1FFX A;  5FNV A;  1FFX B;  2Z1U A;  3LFO A;  3TD3 A;  3M84 A;  1U40 A;  2VGM A;  4O4I B;  3JAT A;  3CCJ F;  5EIB C;  3P0Z A;  5G4U C;  1CN7 A;  1JFF B;  5EIB D;  3NVI B;  2UYN A;  1QVG F;  3F0F A;  2Z1F A;  2HQS C;  2HS4 A;  5LOV B;  1K73 H;  2OTJ F;  1H48 A;  3CPW F;  2GLZ A;  3JAT B;  3VO8 A;  5GIO C;  4YJ2 A;  2H8E A;  3CXC F;  2MQE A;  1H7M A;  3CC2 F;  2QTP A;  1XRG A;  5HY2 A;  1NJI H;  2EWC A;  2HRY A;  1SA0 A;  3MDO A;  4I55 A;  3WGN A;  3I55 F;  1YHQ F;  2VGN A;  1W3E X;  2YYE A;  1VQ9 F;  3MBM A;  1M1K H;  4X20 B;  2CSL A;  2HP3 A;  4EI7 A;  3QHD A;  5J2T B;  5GIP C;  3RA6 A;  3JAK B;  3P10 A;  3MCQ A;  2CW4 A;  1YI2 F;  1DBF A;  2OTL F;  5IJ0 B;  4BT4 A;  1VQM F;  5CB4 B;  4O4L B;  4X1I B;  3O85 A;  1W5F A;  5LYJ A;  3J80 M;  5C8Y A;  3BYQ A;  1Q82 H;  3ON1 A;  2Z1T A;  4O2B B;  3JCM M;  3DC2 A;  5JH7 A;  2DT4 A;  3JAL B;  1IV4 A;  4ZHY B;  2HS3 A;  4U39 A;  1M90 H;  3QTY A;  3LWQ C;  1R1M A;  3JAS A;  2AMT A;  3CCL F;  3ELC A;  1GX1 A;  3LWR C;  5CA1 A;  3JAW A;  3M4S A;  1VQ7 F;  4BVS A;  2N48 A;  2P6Y A;  4C8G A;  4O4J A;  3PAF A;  3G71 F;  2JNB A;  1NQ3 A;  3LDT A;  2V9Y A;  2KTV A;  4BT2 A;  2QA4 F;  4EI9 A;  5HY4 A;  2ZF8 A;  2LCA A;  5BMV A;  1YJ9 F;  3RYC B;  5HXU A;  4ZHW A;  1IV2 A;  1X7P A;  3S02 A;  5GIN C;  1TVK B;  5HP7 A;  3LWV C;  4TV8 B;  3E20 B;  2I6D A;  3CCU F;  1JN1 A;  3JAS B;  5HY1 A;  5EWR A;  4G4Y A;  3VYS C;  3D01 A;  4I4T A;  4KWE A;  5FNV B;  4BY9 D;  1GZ0 A;  5EZY B;  2HRU A;  3IR9 A;  1UI9 A;  3TD5 A;  3N2G A;  1YGY A;  3VMF B;  3AGK A;  4O2A A;  2ZAU A;  2DYY A;  3CMA F;  5JVD A;  3NK7 A;  1H47 A;  3GTZ A;  3HKB B;  4TUY B;  1OFU A;  4B46 A;  5HXZ A;  2AIF A;  4IHJ B;  1W57 A;  4X1I A;  2R75 1;  4IHJ A;  3HTN A;  4RHA A;  4EI8 A;  4F6R B;  3D54 A;  3CCV F;  4C8I A;  2HP0 B;  2UZH A;  3E22 A;  4YJ3 B;  3HKC B;  3V4D A;  5JCO C;  4ZOL B;  2KTU A;  3T80 A;  1VQ4 F;  2ZOD A;  4X1K B;  4B45 A;  1E7K A;  3S0W A;  3UT5 B;  5A2Q M;  3MCA B;  2PMP A;  3JAL A;  1W5A A;  3HKC A;  5GAP K;  3HKD B;  3WJP A;  1KD1 H;  5MN4 A;  2HS0 A;  5CB4 A;  4BVQ A;  2F9Z C;  1TUB A;  2HX0 A;  4G88 A;  4X1Y A;  3C9R A;  3G6E F;  2LBW A;  3VIU A;  1VQ8 F;  5LXT A;  1PF5 A;  4BT7 A;  5EB1 B;  3HWU A;  4O4L A;  3HJW C;  4PWT A;  1Q7Y H;  5LA6 B;  2BO1 A;  3SIU A;  3JAK A;  1W2B F;  2ZOV A;  5IJ9 A;  4TV9 A;  1W41 A;  4ZOL A;  1VQL F;  4YJ2 B;  2H6L A;  5ITZ A;  5LA6 A;  1VQN F;  1VQK F;  2LBX A;  1VQ6 F;  4NUT A;  3CC4 F;  3J81 M;  4FFB A;  3CCR F;  3N2K A;  3ERN A;  4X3L A;  3FD5 A;  3JAR A;  5GAN K;  5KX5 A;  2RB9 A;  2UYJ A;  3D00 A;  4O4H A;  2CHT A;  1YJN F;  2R6R 1;  2NMU A;  2QI2 A;  3IMP A;  3CCM F;  2UYK A;  1QVF F;  1Q8R A;  1YJW F;  2G9I A;  3J7A R;  1X52 A;  2FC3 A;  3N4Y A;  4C4W C;  1FNJ A;  2VAP A;  5EAZ A;  5EZY A;  5IJ9 B;  2IQQ A;  4G4W A;  3ZP4 A;  1RLG A;  4WBN B;  2K1S A;  3CCQ F;  1SA0 B;  2OTM A;  4BT3 A;  4U3J A;  2VAM A;  4LCK A;  3MQW A;  4RQO A;  4ZHQ B;  1T0K B;  2OZB A;  3Q8H A;  2KG4 A;  2RHJ A;  1VQP F;  1ODE A;  3VTI C;  4BT6 A;  2QEX F;  3N2K B;  3P4E A;  3LWP C;  3S06 A;  3CYQ A;  1X7O A;  4TUY A;  3F0E A;  4I4T B;  4BVT A;  3L7Q A;  3OON A;  1N8R H;  4X1K A;  3OBW A;  3ZP7 A;  2CHS A;  3RYI B;  3RYI A;  1VK3 A;  2IG8 A;  1XBI A;  3E22 B;  4TZZ A;  4ZK7 A;  5BMV B;  3ZOP A;  2ALE A;  3FBA A;  4TV8 A;  2GZL A;  5LP6 A;  3HKE A;  4E6E A;  1U3P A;  1X25 A;  5LXT B;  3IEW A;  1ONI A;  3CYP B;  4IIJ A;  4O2A B;  3FPI A;  5IJ0 A;  4O4J B;  3V7Q A;  1CK2 A;  5IYZ A;  4I50 B;  1KNK A;  4X1Y B;  2VXY A;  2RHH A;  5LYJ B;  5G4V C;  5HP8 A;  1VQ5 F;  3K0T A;  3I3F A;  1VHA A;  1Z5W A;  1GO1 A;  1K8A H;  3KE1 A;  4EB6 B;  4ZI7 B;  1K9M H;  3RYF B;  1UFY A;  3VOA A;  1ZWZ A;  3WGM A;  2BTO A;  5AVM A;  1U3L A;  2I6R A;  1IV3 A;  3ZO8 A;  4TV9 B;  1S72 F;  2PHN A;  1JY8 A;  3CCS F;  3GHZ A;  4G4V A;  4YJ3 A;  1T0A A;  1W55 A;  3U0O A;  1QD9 A;  4BT5 A;  3RYC A;  4LNU B;  5HY0 A;  5IYZ B;  2B33 A;  3I7T A;  3IKF A;  3WJQ A;  5J2T A;  2CVL A;  5JCO A;  4C81 A;  3NVK E;  3VCZ A;  5B8F A;  3JAM M;  2HVY D;  1W5B A;  4DXD A;  2CWJ A;  4X20 A;  5HWE A;  1TUB B;  3TD4 A;  5MN6 A;  3V3T A;  2Q1Y A;  4DRX B;  3I56 F;  3WJR A;  1RQ2 A;  3WXM B;  5GON B;  3RE3 A;  3WGK A;  2H8C A;  5EB0 A;  1NMU B;  4O2B A;  3HAX D;  3N4Z A;  1TVK A;  4F6R A;  2CZW A;  3M1X A;  2UYN B;  1IV1 A;  3R0P A;  1W40 A;  4FFB B;  4ERH A;  4B5C A;  5JQG B;  1RQ7 A;  3K14 A;  1IPA A;  3HKB A;  5JQG A;  3JAR B;  3CD6 F;  2ZVZ A;  3S0Y A;  1CLI A;  4X3M A;  1YIJ F;  3CB2 A;  3G4S F;  1RA4 A;  5JVD B;  1RLU A;  3JAW B;  3GYQ A;  3EOR A;  3HKD A;  2BTQ B;  1FSZ A;  3FFM A;  5GON A;  3VYT C;  4HNA A;  4M8I A;  2RHO A;  3QUW A;  1KQS F;  3WPW A;  3IKE A;  1OAP A;  3C9T A;  1W58 1;  2Q1X A;  4G4Z A;  3NMU C;  1COM A;  2WAL A;  3VI6 A;  1VQO F;  1W42 A;  2GVI A;  3RYF A;  4R40 B;  3WPX A;  5KMG B;  1SZQ A;  3K2X A;  3F0D A;  1J7H A;  4BW0 B;  1JD1 A;  3HKE B;  4ZHQ A;  3N2G B;  3VYU C;  5KMG A;  4U3J B;  1DT9 A;  3SIV A;  1W5E A;  4C8E A;  3F6M A;  4IIJ B;  3OW2 F;  2VAW A;  3KHN A;  1XV2 A;  5FLX M;  4O4I A;  1Q81 H;  5DCV A;  3C9S A;  3F0G A;  1YQN A;  2LBT A;  2BTU A;  4EB6 A;  4I55 B;  3WGL A;  4NQ3 A;  2YXZ A;  3C9U A;  4I50 A;  4ZI7 A;  3KJJ A;  4DRX A;  4BVR A;  3KIZ A;  5C8Y B;  3E1Y A;  4O4H B;  5EYP A;  3S0H A;  3JVH A;  2OHW A; 
#chains in the Genus database with same CATH homology
 1JY8 A;  3GHZ A;  1U3P A;  3RE3 A;  1T0A A;  1W55 A;  3EOR A;  3IEW A;  1IV4 A;  3FPI A;  1U40 A;  3F0E A;  1H47 A;  4C8E A;  3F6M A;  3IKE A;  1IV2 A;  1KNK A;  3MBM A;  3B6N A;  1W57 A;  4C82 A;  1KNJ A;  3P0Z A;  3QHD A;  3ESJ A;  1U43 A;  2AMT A;  3F0G A;  1YQN A;  1IV1 A;  3IKF A;  3P10 A;  1JN1 A;  1VH8 A;  4C8I A;  3ELC A;  1GX1 A;  1VHA A;  2UZH A;  3F0F A;  4C81 A;  5B8F A;  3ERN A;  3KE1 A;  1H48 A;  4C8G A;  3K2X A;  3F0D A;  3K14 A;  3T80 A;  3FBA A;  1U3L A;  3IEQ A;  1IV3 A;  3Q8H A;  3JVH A;  2PMP A;  2GZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...