1KNJA

Co-crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase (ispf) from e. coli involved in mevalonate-independent isoprenoid biosynthesis, complexed with cmp/mecdp/mn2+
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
156
structure length
156
Chain Sequence
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase. An enzyme in the mevalonate-independent isoprenoid biosynthetic pathway.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 37
structure length 156
sequence length 156
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1knjA00
1IV2A 3K14A 1U3PA 3IKEA 1KNJA 1IV3A 3ERNA 2GZLA 3K2XA 1T0AA 3B6NA 3P0ZA 3ESJA 3F0GA 3JVHA 3ELCA 3FPIA 1IV4A 1U3LA 1KNKA 1VH8A 3P10A 3EORA 2UZHA 3IEWA 1H48A 1H47A 2PMPA 3F6MA 4C8EA 4C8GA 3RE3A 2AMTA 1U43A 1JY8A 3Q8HA 1GX1A 4C81A 3QHDA 3FBAA 3F0FA 3GHZA 1IV1A 3IKFA 1W57A 1W55A 4C82A 3T80A 1VHAA 3KE1A 1JN1A 4C8IA 5B8FA 3MBMA 1YQNA 3F0DA 3F0EA 3IEQA 1U40A
chains in the Genus database with same CATH superfamily
4ZHQA 4O4HA 5GIPC 4O2BA 4TZZA 2RHLA 2HS3A 4BVRA 3ELCA 1JJ2F 5CA1B 2BTUA 5GAPK 1Q82H 5EIBC 4ZK7A 4E6EA 4ZHYB 4C8GA 3J80M 3G4SF 4TUYB 1GX1A 1GO0A 3HKEA 3HKDA 3FBAA 4ZHVA 3WGLA 2CZWA 2HP0A 5CB4A 1R1MA 4BW0B 2P6YA 2IQQA 3D54A 3RA6A 3MBMA 3JAMM 3F0DA 4X3MA 4BT7A 3LWOC 2QTPA 2H8CA 5IJ9A 4G88A 4U39A 3S03A 5JVDB 1S72F 2CHTA 2L26A 4O4IA 1VQPF 4C8EA 2HVYD 1RA4A 1YJ9F 3V7QA 3GTZA 5CB4B 1IV1A 1W57A 3CPWF 2G9IA 3N4YA 1FNKA 4BVSA 5LXTB 1JN1A 3C9UA 5CA1A 3HAXD 3LMEA 2WALA 4IIJA 1U40A 2Q1XA 2B33A 4TV8B 5LYJB 4B62A 3M84A 3RYFB 2ZF8A 3JAKA 3LDTA 1U3LA 2QI2A 1VQOF 3OBYA 3F6MA 2HS4A 2Z01A 2ZODA 1T0KB 3HJWC 3VTIC 3Q8HA 3VYTC 4I50A 3U0OA 3K12A 4RHAA 3KIZA 2F9ZC 2Z1TA 2QEXF 2KTUA 1E7KA 1VQ6F 4NUTA 2OTLF 1YQNA 5A2QM 2HX0A 3JATB 5LYJA 1UFYA 5JQGA 1QVFF 1IV3A 3IMPA 5AVMA 5HXUA 1YJNF 1Q81H 3F0GA 2Z1UA 4NQ3A 4BY9D 2HQSC 5IJ0B 1KQSF 2LBTA 5JH7B 3LYBA 3V4DA 3I7TA 2CSLA 2GVIA 4F6RB 3QHDA 5KX5B 4O4JA 1YHQF 5EO3A 1UI9A 4I55A 5HY2A 1J7HA 3V7EA 1W581 5IYZB 4EI7A 1X7OA 3K14A 3JARA 5LA6B 3CCJF 1KNJA 1SA0A 2Z1EA 2UYKA 3HWUA 3CCQF 1Q8RA 4G4ZA 4IHJB 4U3JB 4RQOA 2MQEA 4BT6A 1FSZA 2CWJA 1NQ3A 3VYSC 4X3LA 1W5FA 5JVDA 4IHJA 3NVIB 4I4TA 3IR9A 3S02A 5B8FA 1QVGF 1M90H 3HKBA 2UYPA 3S06A 3VI6A 1RLUA 5HY1A 1RLGA 3N4ZA 5HY0A 1W5AA 2LCAA 1QD9A 3C9TA 2DYYA 1IV4A 1H7MA 3FFMA 2R6R1 3G6EF 3CCMF 5ITZA 1PF5A 4KWEA 3WGMA 2QA4F 3JAKB 3N2GA 2VGMA 3OONA 3SIUA 4X1YA 1W55A 2R751 4C82A 5GINC 4X1KA 3WGJA 2VAMA 4ERHA 1NJIH 2IG8A 3HKCB 3VCZA 5HXZA 3GYQA 5IYZA 3CD6F 2VGNA 1U3PA 4LNUB 3S0YA 3JARB 5LA6A 1GO1A 1VQ5F 4LCKA 1XRGA 4O2AB 3S0WA 3O85A 4EB6B 5LP6A 3N2GB 3NK6A 5EB1B 4BT4A 2CW4A 1GZ0A 1XV2A 3J7AR 3R0PA 2HRUA 3VO8A 4ZOLB 1W59A 2VAPA 4FFBA 2ZOVA 3PLAC 3MCQA 3E22B 1VQVA 3WGKA 2Z1FA 4X1YB 4BT5A 3NVKE 1FNJA 4O2AA 2ZVZA 1XHOA 2BTOA 1W5BA 2K1SA 3IEWA 4BT2A 2YXZA 3JATA 3MDOA 4G4VA 3RE3A 3NMUC 3WJPA 5GONB 1Q86H 3T80A 4U3JA 5EYPB 3WPXA 4I55B 1TUBB 2CVLA 5EZYA 3CCUF 3HKCA 3QTYA 1SDSA 3LWRC 2GLZA 3L7QA 4ZI7B 1OAPA 4EI8A 4G4WA 1RQ7A 2FGYA 3ESJA 5HY4A 4O4IB 4PWTA 1FFXA 3CB2A 3VYUC 2IAFA 2LBXA 1JY8A 4FFBB 4X1IB 4EB6A 3F0FA 1RQ2A 5HP7A 1JFFA 4I4TB 2OHWA 1VK3A 5ITZB 1VQ9F 2KTVA 2CHSA 3WPWA 3WJQA 4ZI7A 1M1KH 3TD5A 3CC7F 1KD1H 4O4HB 2FC3A 3LWQC 3P0ZA 1YITF 3NK7A 1FFXB 3ZP7A 2OTJF 2AIZP 4BT3A 1N8RH 1X52A 3OW2F 3HKBB 5FJ4C 5EZYB 3JAWA 4WBNB 3G71F 5BMVB 4G4YA 3I56F 2EWCA 1YGYA 1VQLF 3RYCB 4O4LB 3LWVC 3UT5B 2RHOA 4X1KB 5LOVA 4C8IA 1K73H 4M8IA 4HNAA 3LFOA 3IEQA 1TUBA 3KJKA 3CC2F 2RHHA 2ZAUA 4LNUA 3N2KB 5EWRA 3DDNA 2GZLA 4ZHWA 1OFUA 3RA5A 1JFFB 4R40B 4ZOLA 2HS0A 5JCOA 3VOBA 3JASB 1TVKB 4YJ3B 1X25A 1YI2F 2HRYA 5G4VC 3PAFA 3TD3A 3EORA 2UZHA 1Z5WA 1W2BF 4DXDA 2AMTA 1U43A 3E22A 4XCQA 3TD4A 1ONIA 4F6RA 3ZP4A 3LWPC 5CA0B 4O4LA 3JASA 4YJ3A 3CCLF 3JALB 1ZWZA 1VQKF 1Z5VA 3MQWA 4YJ2A 3F0EA 2ALEA 3VOAA 1IV2A 2H8EA 3C8LA 5LP6B 3CXCF 5FNVA 3RYFA 3HTNA 5MN5A 4X20A 1K9MH 2H6LA 4YJ2B 1KC8H 5FLXM 3M4SA 3UT5A 3KHNA 3KJJA 2I6DA 3WGNA 2BTQB 4TV9A 1XBIA 3RYIA 3D00A 4G4XA 1PXWA 2RHJA 3CC4F 3MCAB 5CA0A 4BVTA 5G4UC 4I50B 3ZO8A 5J2TA 1VQMF 4O2BB 3ON1A 5GONA 3I3FA 5EYPA 5KMGA 2UYNA 2W8BC 2HP3A 3V3TA 1COMA 5J2TB 3FD5A 3CPQA 3K0TA 5GIOC 3ERNA 2Q1YA 2HP0B 3C9RA 2BO1A 3CYPB 3CCEF 2UYNB 3JVHA 3P10A 3E20B 1H47A 1H48A 3CG6A 5EAZA 3CYQA 5C8YA 3JCMM 2N48A 1W3EX 4C81A 1VQ4F 1VHAA 3VIUA 2AIFA 4B46A 3JAWB 4WBNA 4EI9A 5IT9M 1IPAA 3WJRA 2ZVYA 3P4EA 3IKEA 5IJ9B 3K2XA 2UYJA 3DC2A 3B6NA 3CCRF 3WXMB 2OZBA 4HNAB 3M1XA 3QUWA 1NMUB 1YIJF 4DRXA 1DBFA 1VH8A 1VQNF 3I55F 1YJWF 1W40A 2KG4A 3FD6A 4TV8A 1Q7YH 1QAHA 4B5CA 1K8AH 5MN6A 1QU9A 2V9YA 4B45A 1CK2A 1CN7A 3RYCA 1JD1A 5HP8A 5JCOC 5LXTA 1SZQA 4IIJB 3SIVA 3N2KA 5BMVA 5MN4A 3JALA 3CMEF 1VQ7F 3J81M 3RYHA 2YYEA 1KNKA 5LOVB 5GANK 3BYQA 5FNVB 2I6RA 5C8YB 4NWOB 5DCVA 3OBWA 5HWEA 4X20B 2OTMA 3GHZA 2RB9A 3VMFB 3CCVF 2LBWA 4BVQA 4TV9B 3RYIB 3AGKA 1CLIA 1TVKA 5LP6C 5IJ0A 4DRXB 5J2UB 1ODEA 2KGWA 3D01A 2PHNA 3E1YA 3HKDB 3HKEB 5JQGB 4ZHQB 2NMUA 1X7PA 3CCSF 1T0AA 3RYHB 2VAWA 4O4JB 1DT9A 5J2UA 1W41A 3FPIA 1W42A 2JNBA 5EB0A 2PMPA 2VXYA 4C4WC 5JH7A 1SA0B 5EIBD 4X1IA 3C9SA 4TUYA 3IKFA 5KX5A 2DT4A 3CMAF 3KE1A 5KMGB 1VQ8F 1W5EA 3S0HA 3ZOPA
chains in the Genus database with same CATH topology
1IV2A 3K14A 1U3PA 3IKEA 1KNJA 1IV3A 3ERNA 2GZLA 3K2XA 1T0AA 3B6NA 3P0ZA 3ESJA 3F0GA 3JVHA 3ELCA 3FPIA 1IV4A 1U3LA 1KNKA 1VH8A 3P10A 3EORA 2UZHA 3IEWA 1H48A 1H47A 2PMPA 3F6MA 4C8EA 4C8GA 3RE3A 2AMTA 1U43A 1JY8A 3Q8HA 1GX1A 4C81A 3QHDA 3FBAA 3F0FA 3GHZA 1IV1A 3IKFA 1W57A 1W55A 4C82A 3T80A 1VHAA 3KE1A 1JN1A 4C8IA 5B8FA 3MBMA 1YQNA 3F0DA 3F0EA 3IEQA 1U40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV2 A;  3K14 A;  1U3P A;  3IKE A;  1KNJ A;  1IV3 A;  3ERN A;  2GZL A;  3K2X A;  1T0A A;  3B6N A;  3P0Z A;  3ESJ A;  3F0G A;  3JVH A;  3ELC A;  3FPI A;  1IV4 A;  1U3L A;  1KNK A;  1VH8 A;  3P10 A;  3EOR A;  2UZH A;  3IEW A;  1H48 A;  1H47 A;  2PMP A;  3F6M A;  4C8E A;  4C8G A;  3RE3 A;  2AMT A;  1U43 A;  1JY8 A;  3Q8H A;  1GX1 A;  4C81 A;  3QHD A;  3FBA A;  3F0F A;  3GHZ A;  1IV1 A;  3IKF A;  1W57 A;  1W55 A;  4C82 A;  3T80 A;  1VHA A;  3KE1 A;  1JN1 A;  4C8I A;  5B8F A;  3MBM A;  1YQN A;  3F0D A;  3F0E A;  3IEQ A;  1U40 A; 
#chains in the Genus database with same CATH topology
 4ZHQ A;  4O4H A;  5GIP C;  4O2B A;  4TZZ A;  2RHL A;  2HS3 A;  4BVR A;  3ELC A;  1JJ2 F;  5CA1 B;  2BTU A;  5GAP K;  1Q82 H;  5EIB C;  4ZK7 A;  4E6E A;  4ZHY B;  4C8G A;  3J80 M;  3G4S F;  4TUY B;  1GX1 A;  1GO0 A;  3HKE A;  3HKD A;  3FBA A;  4ZHV A;  3WGL A;  2CZW A;  2HP0 A;  5CB4 A;  1R1M A;  4BW0 B;  2P6Y A;  2IQQ A;  3D54 A;  3RA6 A;  3MBM A;  3JAM M;  3F0D A;  4X3M A;  4BT7 A;  3LWO C;  2QTP A;  2H8C A;  5IJ9 A;  4G88 A;  4U39 A;  3S03 A;  5JVD B;  1S72 F;  2CHT A;  2L26 A;  4O4I A;  1VQP F;  4C8E A;  2HVY D;  1RA4 A;  1YJ9 F;  3V7Q A;  3GTZ A;  5CB4 B;  1IV1 A;  1W57 A;  3CPW F;  2G9I A;  3N4Y A;  1FNK A;  4BVS A;  5LXT B;  1JN1 A;  3C9U A;  5CA1 A;  3HAX D;  3LME A;  2WAL A;  4IIJ A;  1U40 A;  2Q1X A;  2B33 A;  4TV8 B;  5LYJ B;  4B62 A;  3M84 A;  3RYF B;  2ZF8 A;  3JAK A;  3LDT A;  1U3L A;  2QI2 A;  1VQO F;  3OBY A;  3F6M A;  2HS4 A;  2Z01 A;  2ZOD A;  1T0K B;  3HJW C;  3VTI C;  3Q8H A;  3VYT C;  4I50 A;  3U0O A;  3K12 A;  4RHA A;  3KIZ A;  2F9Z C;  2Z1T A;  2QEX F;  2KTU A;  1E7K A;  1VQ6 F;  4NUT A;  2OTL F;  1YQN A;  5A2Q M;  2HX0 A;  3JAT B;  5LYJ A;  1UFY A;  5JQG A;  1QVF F;  1IV3 A;  3IMP A;  5AVM A;  5HXU A;  1YJN F;  1Q81 H;  3F0G A;  2Z1U A;  4NQ3 A;  4BY9 D;  2HQS C;  5IJ0 B;  1KQS F;  2LBT A;  5JH7 B;  3LYB A;  3V4D A;  3I7T A;  2CSL A;  2GVI A;  4F6R B;  3QHD A;  5KX5 B;  4O4J A;  1YHQ F;  5EO3 A;  1UI9 A;  4I55 A;  5HY2 A;  1J7H A;  3V7E A;  1W58 1;  5IYZ B;  4EI7 A;  1X7O A;  3K14 A;  3JAR A;  5LA6 B;  3CCJ F;  1KNJ A;  1SA0 A;  2Z1E A;  2UYK A;  3HWU A;  3CCQ F;  1Q8R A;  4G4Z A;  4IHJ B;  4U3J B;  4RQO A;  2MQE A;  4BT6 A;  1FSZ A;  2CWJ A;  1NQ3 A;  3VYS C;  4X3L A;  1W5F A;  5JVD A;  4IHJ A;  3NVI B;  4I4T A;  3IR9 A;  3S02 A;  5B8F A;  1QVG F;  1M90 H;  3HKB A;  2UYP A;  3S06 A;  3VI6 A;  1RLU A;  5HY1 A;  1RLG A;  3N4Z A;  5HY0 A;  1W5A A;  2LCA A;  1QD9 A;  3C9T A;  2DYY A;  1IV4 A;  1H7M A;  3FFM A;  2R6R 1;  3G6E F;  3CCM F;  5ITZ A;  1PF5 A;  4KWE A;  3WGM A;  2QA4 F;  3JAK B;  3N2G A;  2VGM A;  3OON A;  3SIU A;  4X1Y A;  1W55 A;  2R75 1;  4C82 A;  5GIN C;  4X1K A;  3WGJ A;  2VAM A;  4ERH A;  1NJI H;  2IG8 A;  3HKC B;  3VCZ A;  5HXZ A;  3GYQ A;  5IYZ A;  3CD6 F;  2VGN A;  1U3P A;  4LNU B;  3S0Y A;  3JAR B;  5LA6 A;  1GO1 A;  1VQ5 F;  4LCK A;  1XRG A;  4O2A B;  3S0W A;  3O85 A;  4EB6 B;  5LP6 A;  3N2G B;  3NK6 A;  5EB1 B;  4BT4 A;  2CW4 A;  1GZ0 A;  1XV2 A;  3J7A R;  3R0P A;  2HRU A;  3VO8 A;  4ZOL B;  1W59 A;  2VAP A;  4FFB A;  2ZOV A;  3PLA C;  3MCQ A;  3E22 B;  1VQV A;  3WGK A;  2Z1F A;  4X1Y B;  4BT5 A;  3NVK E;  1FNJ A;  4O2A A;  2ZVZ A;  1XHO A;  2BTO A;  1W5B A;  2K1S A;  3IEW A;  4BT2 A;  2YXZ A;  3JAT A;  3MDO A;  4G4V A;  3RE3 A;  3NMU C;  3WJP A;  5GON B;  1Q86 H;  3T80 A;  4U3J A;  5EYP B;  3WPX A;  4I55 B;  1TUB B;  2CVL A;  5EZY A;  3CCU F;  3HKC A;  3QTY A;  1SDS A;  3LWR C;  2GLZ A;  3L7Q A;  4ZI7 B;  1OAP A;  4EI8 A;  4G4W A;  1RQ7 A;  2FGY A;  3ESJ A;  5HY4 A;  4O4I B;  4PWT A;  1FFX A;  3CB2 A;  3VYU C;  2IAF A;  2LBX A;  1JY8 A;  4FFB B;  4X1I B;  4EB6 A;  3F0F A;  1RQ2 A;  5HP7 A;  1JFF A;  4I4T B;  2OHW A;  1VK3 A;  5ITZ B;  1VQ9 F;  2KTV A;  2CHS A;  3WPW A;  3WJQ A;  4ZI7 A;  1M1K H;  3TD5 A;  3CC7 F;  1KD1 H;  4O4H B;  2FC3 A;  3LWQ C;  3P0Z A;  1YIT F;  3NK7 A;  1FFX B;  3ZP7 A;  2OTJ F;  2AIZ P;  4BT3 A;  1N8R H;  1X52 A;  3OW2 F;  3HKB B;  5FJ4 C;  5EZY B;  3JAW A;  4WBN B;  3G71 F;  5BMV B;  4G4Y A;  3I56 F;  2EWC A;  1YGY A;  1VQL F;  3RYC B;  4O4L B;  3LWV C;  3UT5 B;  2RHO A;  4X1K B;  5LOV A;  4C8I A;  1K73 H;  4M8I A;  4HNA A;  3LFO A;  3IEQ A;  1TUB A;  3KJK A;  3CC2 F;  2RHH A;  2ZAU A;  4LNU A;  3N2K B;  5EWR A;  3DDN A;  2GZL A;  4ZHW A;  1OFU A;  3RA5 A;  1JFF B;  4R40 B;  4ZOL A;  2HS0 A;  5JCO A;  3VOB A;  3JAS B;  1TVK B;  4YJ3 B;  1X25 A;  1YI2 F;  2HRY A;  5G4V C;  3PAF A;  3TD3 A;  3EOR A;  2UZH A;  1Z5W A;  1W2B F;  4DXD A;  2AMT A;  1U43 A;  3E22 A;  4XCQ A;  3TD4 A;  1ONI A;  4F6R A;  3ZP4 A;  3LWP C;  5CA0 B;  4O4L A;  3JAS A;  4YJ3 A;  3CCL F;  3JAL B;  1ZWZ A;  1VQK F;  1Z5V A;  3MQW A;  4YJ2 A;  3F0E A;  2ALE A;  3VOA A;  1IV2 A;  2H8E A;  3C8L A;  5LP6 B;  3CXC F;  5FNV A;  3RYF A;  3HTN A;  5MN5 A;  4X20 A;  1K9M H;  2H6L A;  4YJ2 B;  1KC8 H;  5FLX M;  3M4S A;  3UT5 A;  3KHN A;  3KJJ A;  2I6D A;  3WGN A;  2BTQ B;  4TV9 A;  1XBI A;  3RYI A;  3D00 A;  4G4X A;  1PXW A;  2RHJ A;  3CC4 F;  3MCA B;  5CA0 A;  4BVT A;  5G4U C;  4I50 B;  3ZO8 A;  5J2T A;  1VQM F;  4O2B B;  3ON1 A;  5GON A;  3I3F A;  5EYP A;  5KMG A;  2UYN A;  2W8B C;  2HP3 A;  3V3T A;  1COM A;  5J2T B;  3FD5 A;  3CPQ A;  3K0T A;  5GIO C;  3ERN A;  2Q1Y A;  2HP0 B;  3C9R A;  2BO1 A;  3CYP B;  3CCE F;  2UYN B;  3JVH A;  3P10 A;  3E20 B;  1H47 A;  1H48 A;  3CG6 A;  5EAZ A;  3CYQ A;  5C8Y A;  3JCM M;  2N48 A;  1W3E X;  4C81 A;  1VQ4 F;  1VHA A;  3VIU A;  2AIF A;  4B46 A;  3JAW B;  4WBN A;  4EI9 A;  5IT9 M;  1IPA A;  3WJR A;  2ZVY A;  3P4E A;  3IKE A;  5IJ9 B;  3K2X A;  2UYJ A;  3DC2 A;  3B6N A;  3CCR F;  3WXM B;  2OZB A;  4HNA B;  3M1X A;  3QUW A;  1NMU B;  1YIJ F;  4DRX A;  1DBF A;  1VH8 A;  1VQN F;  3I55 F;  1YJW F;  1W40 A;  2KG4 A;  3FD6 A;  4TV8 A;  1Q7Y H;  1QAH A;  4B5C A;  1K8A H;  5MN6 A;  1QU9 A;  2V9Y A;  4B45 A;  1CK2 A;  1CN7 A;  3RYC A;  1JD1 A;  5HP8 A;  5JCO C;  5LXT A;  1SZQ A;  4IIJ B;  3SIV A;  3N2K A;  5BMV A;  5MN4 A;  3JAL A;  3CME F;  1VQ7 F;  3J81 M;  3RYH A;  2YYE A;  1KNK A;  5LOV B;  5GAN K;  3BYQ A;  5FNV B;  2I6R A;  5C8Y B;  4NWO B;  5DCV A;  3OBW A;  5HWE A;  4X20 B;  2OTM A;  3GHZ A;  2RB9 A;  3VMF B;  3CCV F;  2LBW A;  4BVQ A;  4TV9 B;  3RYI B;  3AGK A;  1CLI A;  1TVK A;  5LP6 C;  5IJ0 A;  4DRX B;  5J2U B;  1ODE A;  2KGW A;  3D01 A;  2PHN A;  3E1Y A;  3HKD B;  3HKE B;  5JQG B;  4ZHQ B;  2NMU A;  1X7P A;  3CCS F;  1T0A A;  3RYH B;  2VAW A;  4O4J B;  1DT9 A;  5J2U A;  1W41 A;  3FPI A;  1W42 A;  2JNB A;  5EB0 A;  2PMP A;  2VXY A;  4C4W C;  5JH7 A;  1SA0 B;  5EIB D;  4X1I A;  3C9S A;  4TUY A;  3IKF A;  5KX5 A;  2DT4 A;  3CMA F;  3KE1 A;  5KMG B;  1VQ8 F;  1W5E A;  3S0H A;  3ZOP A; 
#chains in the Genus database with same CATH homology
 1IV2 A;  3K14 A;  1U3P A;  3IKE A;  1KNJ A;  1IV3 A;  3ERN A;  2GZL A;  3K2X A;  1T0A A;  3B6N A;  3P0Z A;  3ESJ A;  3F0G A;  3JVH A;  3ELC A;  3FPI A;  1IV4 A;  1U3L A;  1KNK A;  1VH8 A;  3P10 A;  3EOR A;  2UZH A;  3IEW A;  1H48 A;  1H47 A;  2PMP A;  3F6M A;  4C8E A;  4C8G A;  3RE3 A;  2AMT A;  1U43 A;  1JY8 A;  3Q8H A;  1GX1 A;  4C81 A;  3QHD A;  3FBA A;  3F0F A;  3GHZ A;  1IV1 A;  3IKF A;  1W57 A;  1W55 A;  4C82 A;  3T80 A;  1VHA A;  3KE1 A;  1JN1 A;  4C8I A;  5B8F A;  3MBM A;  1YQN A;  3F0D A;  3F0E A;  3IEQ A;  1U40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...