1KNJA

Co-crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase (ispf) from e. coli involved in mevalonate-independent isoprenoid biosynthesis, complexed with cmp/mecdp/mn2+
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
156
structure length
156
Chain Sequence
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structure and mechanism of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase. An enzyme in the mevalonate-independent isoprenoid biosynthetic pathway.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 37
structure length 156
sequence length 156
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1knjA00
1IV1A 1GX1A 1KNJA 3IKEA 3K14A 3F0EA 3K2XA 1U3LA 3FPIA 1KNKA 3IEWA 3F6MA 1VH8A 1U40A 1H48A 1H47A 2PMPA 1U3PA 2AMTA 3B6NA 3F0FA 3T80A 1W55A 3ESJA 3ERNA 4C8IA 1YQNA 1JY8A 3JVHA 3MBMA 1JN1A 3IEQA 3Q8HA 1VHAA 4C8GA 1T0AA 3EORA 3ELCA 4C8EA 3F0DA 2UZHA 3RE3A 3IKFA 2GZLA 3GHZA 4C81A 1IV4A 3P10A 3FBAA 5B8FA 3KE1A 1W57A 4C82A 1IV3A 3QHDA 1U43A 3P0ZA 3F0GA 1IV2A
chains in the Genus database with same CATH superfamily
4I55A 1TVKB 4BT2A 4X1KB 2HS0A 3F0EA 3K2XA 1Q82H 5G4UC 3IEWA 1GO1A 3F6MA 2RHLA 5CA0A 4BT5A 5EIBC 1XV2A 3JARB 5LXTA 2R751 2HVYD 3Q8HA 1DT9A 1ODEA 2UYNA 4O4IA 2ZVYA 3ZP7A 1VQLF 2LCAA 4O4HB 4X20A 1W3EX 4EB6A 4X1IA 3WJRA 3CCLF 2I6DA 3UT5A 2ZAUA 3GYQA 4U3JB 4B5CA 1IV3A 3HKDB 1NMUB 3LDTA 3WPWA 1YI2F 4G88A 5CB4B 4YJ3A 5KMGB 2AMTA 4HNAA 1JFFA 3ERNA 2HS3A 3MBMA 3JALA 1OAPA 1PXWA 2Q1XA 3N2GA 4M8IA 1T0AA 3J80M 3ELCA 1VQ8F 4ZOLB 2VAPA 2R6R1 1VQ6F 3C9UA 2CHSA 1KQSF 4C81A 3NMUC 2KG4A 1GZ0A 1Q81H 5JVDA 1VQVA 4YJ2B 4O2AB 2HRYA 3VOAA 4FFBA 1K8AH 1M1KH 1VQ5F 2FGYA 3LWRC 3G71F 4IHJA 1H7MA 1UI9A 3C9TA 5ITZA 3N2KA 5GONB 1H48A 3N4ZA 4TZZA 5EZYB 1TVKA 3BYQA 2G9IA 1YQNA 3R0PA 3WJPA 4BW0B 2FC3A 3VIUA 3S0YA 1Z5WA 2HP0B 5MN6A 3ZO8A 4O2BB 3CYQA 2ALEA 3JARA 5GAPK 5GIOC 1YJ9F 3IKFA 3CD6F 5FLXM 3RA6A 3KE1A 2CZWA 4ZHVA 1QVGF 3MCQA 3K12A 3SIUA 5CA1B 1KNKA 5HY1A 2CW4A 5JCOC 5G4VC 3HKDA 2PMPA 3HJWC 5EYPB 3CMAF 2K1SA 4DRXB 3ESJA 3JAKA 3WGMA 1JN1A 5IJ9B 3S03A 1VHAA 3E22B 5CB4A 2OTMA 2LBTA 4ZI7A 3JCMM 2RHHA 3CCQF 1YHQF 3J7AR 2LBWA 2N48A 3I55F 1QU9A 3S0WA 4BVSA 3VOBA 5JCOA 3IR9A 5HY4A 3P0ZA 5LOVB 2UYJA 4IIJA 3WJQA 4O2AA 1FNJA 1Z5VA 3CYPB 2RB9A 3AGKA 3NVKE 5JH7B 4BVRA 3OW2F 1X7PA 2Z01A 2CWJA 1VQ9F 1FSZA 2RHJA 3EORA 5GONA 4BT6A 1YJNF 2BTUA 3D00A 2BO1A 2JNBA 3N4YA 3RYHB 4LCKA 4BY9D 2OHWA 2HP0A 2Z1EA 3TD3A 2IAFA 1U43A 5MN4A 5GINC 1GO0A 1JJ2F 4I50B 1U3LA 1K73H 1RLUA 2QTPA 2ZF8A 2QEXF 5CA1A 5LP6B 1W59A 3VCZA 3RYCA 3CC2F 2VXYA 4I4TB 4BT7A 2HX0A 1IV4A 4G4VA 3JAWB 3KJKA 1FFXA 1W5AA 3I3FA 3P4EA 3DDNA 1R1MA 1QVFF 3VO8A 2IQQA 4U39A 3F0GA 3M1XA 4TV9B 1IV1A 1GX1A 3IMPA 3TD4A 5EB1B 3WXMB 3FPIA 3CCJF 3VMFB 1ONIA 3HKCB 4RHAA 2KTUA 2VAMA 5LOVA 3CPWF 3CC4F 3LWVC 1SA0A 3HKEA 2B33A 4DXDA 1JD1A 1T0KB 2EWCA 3FBAA 3VYUC 5BMVB 1W40A 5EIBD 3JATB 4EI8A 3V4DA 1W5EA 3RYHA 3GTZA 4B45A 3CMEF 4O4JB 1OFUA 4WBNA 5GIPC 4RQOA 4X1KA 3I56F 5FJ4C 5GANK 3CPQA 5DCVA 1COMA 1YITF 1VQNF 1X7OA 2UZHA 1XRGA 5EB0A 4TUYB 1NQ3A 3ZOPA 3HAXD 3LWOC 3KJJA 1QAHA 4O4HA 3JAWA 3GHZA 2ZOVA 1IV2A 3IKEA 1RLGA 4NUTA 5A2QM 4U3JA 1Q7YH 1VH8A 4X3MA 2F9ZC 2Z1TA 3C8LA 2WALA 3JASB 3VYTC 1XBIA 3MCAB 5LA6B 5KMGA 3F0DA 3FD5A 4TV8B 5FNVB 3S02A 2Z1FA 2L26A 5LYJB 1DBFA 3LYBA 5B8FA 4C82A 4ZOLA 5CA0B 5JQGB 2AIFA 3LMEA 2OTJF 3O85A 2HRUA 2CSLA 4O4LB 5KX5B 5BMVA 5LXTB 4YJ2A 3JATA 3QTYA 1YIJF 3CCVF 5HXUA 2UYNB 4O4IB 5EO3A 1TUBB 3T80A 1VQKF 4C8IA 4EB6B 4X1IB 2HP3A 3HTNA 5IYZB 3JAMM 4NQ3A 3UT5B 1RQ2A 3D54A 4C8EA 5EZYA 1ZWZA 4X1YB 3G6EF 4NWOB 1YJWF 1XHOA 1SZQA 3WPXA 2H8CA 4O2BA 2OTLF 4YJ3B 3QHDA 3E1YA 4HNAB 4ZHYB 4KWEA 5HY2A 5IJ0B 4F6RB 1H47A 1U3PA 1W55A 1IPAA 3S0HA 3JVHA 3K0TA 1S72F 1W41A 1VK3A 1X52A 5JVDB 1UFYA 2P6YA 3CC7F 4G4WA 2CHTA 4FFBB 2HQSC 5EYPA 4DRXA 2GZLA 3NK6A 5IJ9A 3D01A 1KC8H 3E22A 3M84A 5LA6A 4IHJB 3V7EA 3N2KB 4BVQA 5FNVA 2QA4F 2UYKA 5LYJA 3K14A 3RYIB 4G4XA 3FD6A 3WGJA 3VYSC 5JQGA 4O4LA 1U40A 2VGNA 5KX5A 3CB2A 3MQWA 2RHOA 1E7KA 2KGWA 1TUBA 2VGMA 4XCQA 5IYZA 3NK7A 4EI7A 5AVMA 5JH7A 3OBWA 4LNUB 2MQEA 1X25A 1VQPF 3CXCF 2ZVZA 3ZP4A 3CG6A 4X1YA 3OONA 3PLAC 5LP6C 2OZBA 2H6LA 3JAKB 4C4WC 3VTIC 4ZHQB 2DYYA 4ZI7B 2BTOA 3B6NA 2NMUA 5J2UB 1VQ7F 4ERHA 3MDOA 2V9YA 2QI2A 5HWEA 3V3TA 4I50A 5IJ0A 3IEQA 3LWPC 4C8GA 4F6RA 1W2BF 1Q8RA 2I6RA 1J7HA 4G4YA 1RQ7A 2KTVA 3G4SF 2YYEA 3V7QA 5C8YB 2W8BC 5LP6A 4IIJB 2IG8A 4PWTA 5J2TB 1M90H 1W57A 5HP7A 2LBXA 4I4TA 5MN5A 1N8RH 2BTQB 3J81M 5HXZA 1QD9A 1W5FA 5IT9M 2PHNA 2AIZP 3RYFB 4B62A 3E20B 1VQ4F 2CVLA 1VQOF 4X3LA 3CCUF 3RYIA 4TV9A 1SDSA 2Q1YA 2GVIA 3WGNA 3HKBB 3DC2A 3HKCA 4BVTA 1PF5A 3L7QA 3RE3A 4B46A 3QUWA 3SIVA 4I55B 3RA5A 3KHNA 4LNUA 3P10A 4ZK7A 1KNJA 2YXZA 1VQMF 2H8EA 3NVIB 3M4SA 3CCMF 4E6EA 3RYCB 3F0FA 3FFMA 5EWRA 1JY8A 4X20B 4O4JA 2UYPA 1FFXB 4ZHQA 3OBYA 5J2UA 5HP8A 3CCRF 3C9SA 3I7TA 5EAZA 3CCSF 1FNKA 2DT4A 3HWUA 1W5BA 4ZHWA 1CN7A 2Z1UA 3U0OA 1CK2A 5C8YA 1KD1H 3LFOA 5J2TA 4BT3A 1JFFB 1YGYA 3KIZA 4TUYA 3JALB 1SA0B 4G4ZA 3HKEB 1W581 3N2GB 3LWQC 3S06A 1NJIH 3VI6A 5HY0A 3RYFA 2VAWA 1Q86H 3CCEF 1CLIA 3WGKA 4R40B 2ZODA 2HS4A 3C9RA 3HKBA 4EI9A 1W42A 1RA4A 3JASA 2GLZA 3TD5A 3PAFA 4BT4A 3WGLA 3ON1A 5ITZB 4WBNB 1K9MH 4TV8A
chains in the Genus database with same CATH topology
1IV1A 1GX1A 1KNJA 3IKEA 3K14A 3F0EA 3K2XA 1U3LA 3FPIA 1KNKA 3IEWA 3F6MA 1VH8A 1U40A 1H48A 1H47A 2PMPA 1U3PA 2AMTA 3B6NA 3F0FA 3T80A 1W55A 3ESJA 3ERNA 4C8IA 1YQNA 1JY8A 3JVHA 3MBMA 1JN1A 3IEQA 3Q8HA 1VHAA 4C8GA 1T0AA 3EORA 3ELCA 4C8EA 3F0DA 2UZHA 3RE3A 3IKFA 2GZLA 3GHZA 4C81A 1IV4A 3P10A 3FBAA 5B8FA 3KE1A 1W57A 4C82A 1IV3A 3QHDA 1U43A 3P0ZA 3F0GA 1IV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV1 A;  1GX1 A;  1KNJ A;  3IKE A;  3K14 A;  3F0E A;  3K2X A;  1U3L A;  3FPI A;  1KNK A;  3IEW A;  3F6M A;  1VH8 A;  1U40 A;  1H48 A;  1H47 A;  2PMP A;  1U3P A;  2AMT A;  3B6N A;  3F0F A;  3T80 A;  1W55 A;  3ESJ A;  3ERN A;  4C8I A;  1YQN A;  1JY8 A;  3JVH A;  3MBM A;  1JN1 A;  3IEQ A;  3Q8H A;  1VHA A;  4C8G A;  1T0A A;  3EOR A;  3ELC A;  4C8E A;  3F0D A;  2UZH A;  3RE3 A;  3IKF A;  2GZL A;  3GHZ A;  4C81 A;  1IV4 A;  3P10 A;  3FBA A;  5B8F A;  3KE1 A;  1W57 A;  4C82 A;  1IV3 A;  3QHD A;  1U43 A;  3P0Z A;  3F0G A;  1IV2 A; 
#chains in the Genus database with same CATH topology
 4I55 A;  1TVK B;  4BT2 A;  4X1K B;  2HS0 A;  3F0E A;  3K2X A;  1Q82 H;  5G4U C;  3IEW A;  1GO1 A;  3F6M A;  2RHL A;  5CA0 A;  4BT5 A;  5EIB C;  1XV2 A;  3JAR B;  5LXT A;  2R75 1;  2HVY D;  3Q8H A;  1DT9 A;  1ODE A;  2UYN A;  4O4I A;  2ZVY A;  3ZP7 A;  1VQL F;  2LCA A;  4O4H B;  4X20 A;  1W3E X;  4EB6 A;  4X1I A;  3WJR A;  3CCL F;  2I6D A;  3UT5 A;  2ZAU A;  3GYQ A;  4U3J B;  4B5C A;  1IV3 A;  3HKD B;  1NMU B;  3LDT A;  3WPW A;  1YI2 F;  4G88 A;  5CB4 B;  4YJ3 A;  5KMG B;  2AMT A;  4HNA A;  1JFF A;  3ERN A;  2HS3 A;  3MBM A;  3JAL A;  1OAP A;  1PXW A;  2Q1X A;  3N2G A;  4M8I A;  1T0A A;  3J80 M;  3ELC A;  1VQ8 F;  4ZOL B;  2VAP A;  2R6R 1;  1VQ6 F;  3C9U A;  2CHS A;  1KQS F;  4C81 A;  3NMU C;  2KG4 A;  1GZ0 A;  1Q81 H;  5JVD A;  1VQV A;  4YJ2 B;  4O2A B;  2HRY A;  3VOA A;  4FFB A;  1K8A H;  1M1K H;  1VQ5 F;  2FGY A;  3LWR C;  3G71 F;  4IHJ A;  1H7M A;  1UI9 A;  3C9T A;  5ITZ A;  3N2K A;  5GON B;  1H48 A;  3N4Z A;  4TZZ A;  5EZY B;  1TVK A;  3BYQ A;  2G9I A;  1YQN A;  3R0P A;  3WJP A;  4BW0 B;  2FC3 A;  3VIU A;  3S0Y A;  1Z5W A;  2HP0 B;  5MN6 A;  3ZO8 A;  4O2B B;  3CYQ A;  2ALE A;  3JAR A;  5GAP K;  5GIO C;  1YJ9 F;  3IKF A;  3CD6 F;  5FLX M;  3RA6 A;  3KE1 A;  2CZW A;  4ZHV A;  1QVG F;  3MCQ A;  3K12 A;  3SIU A;  5CA1 B;  1KNK A;  5HY1 A;  2CW4 A;  5JCO C;  5G4V C;  3HKD A;  2PMP A;  3HJW C;  5EYP B;  3CMA F;  2K1S A;  4DRX B;  3ESJ A;  3JAK A;  3WGM A;  1JN1 A;  5IJ9 B;  3S03 A;  1VHA A;  3E22 B;  5CB4 A;  2OTM A;  2LBT A;  4ZI7 A;  3JCM M;  2RHH A;  3CCQ F;  1YHQ F;  3J7A R;  2LBW A;  2N48 A;  3I55 F;  1QU9 A;  3S0W A;  4BVS A;  3VOB A;  5JCO A;  3IR9 A;  5HY4 A;  3P0Z A;  5LOV B;  2UYJ A;  4IIJ A;  3WJQ A;  4O2A A;  1FNJ A;  1Z5V A;  3CYP B;  2RB9 A;  3AGK A;  3NVK E;  5JH7 B;  4BVR A;  3OW2 F;  1X7P A;  2Z01 A;  2CWJ A;  1VQ9 F;  1FSZ A;  2RHJ A;  3EOR A;  5GON A;  4BT6 A;  1YJN F;  2BTU A;  3D00 A;  2BO1 A;  2JNB A;  3N4Y A;  3RYH B;  4LCK A;  4BY9 D;  2OHW A;  2HP0 A;  2Z1E A;  3TD3 A;  2IAF A;  1U43 A;  5MN4 A;  5GIN C;  1GO0 A;  1JJ2 F;  4I50 B;  1U3L A;  1K73 H;  1RLU A;  2QTP A;  2ZF8 A;  2QEX F;  5CA1 A;  5LP6 B;  1W59 A;  3VCZ A;  3RYC A;  3CC2 F;  2VXY A;  4I4T B;  4BT7 A;  2HX0 A;  1IV4 A;  4G4V A;  3JAW B;  3KJK A;  1FFX A;  1W5A A;  3I3F A;  3P4E A;  3DDN A;  1R1M A;  1QVF F;  3VO8 A;  2IQQ A;  4U39 A;  3F0G A;  3M1X A;  4TV9 B;  1IV1 A;  1GX1 A;  3IMP A;  3TD4 A;  5EB1 B;  3WXM B;  3FPI A;  3CCJ F;  3VMF B;  1ONI A;  3HKC B;  4RHA A;  2KTU A;  2VAM A;  5LOV A;  3CPW F;  3CC4 F;  3LWV C;  1SA0 A;  3HKE A;  2B33 A;  4DXD A;  1JD1 A;  1T0K B;  2EWC A;  3FBA A;  3VYU C;  5BMV B;  1W40 A;  5EIB D;  3JAT B;  4EI8 A;  3V4D A;  1W5E A;  3RYH A;  3GTZ A;  4B45 A;  3CME F;  4O4J B;  1OFU A;  4WBN A;  5GIP C;  4RQO A;  4X1K A;  3I56 F;  5FJ4 C;  5GAN K;  3CPQ A;  5DCV A;  1COM A;  1YIT F;  1VQN F;  1X7O A;  2UZH A;  1XRG A;  5EB0 A;  4TUY B;  1NQ3 A;  3ZOP A;  3HAX D;  3LWO C;  3KJJ A;  1QAH A;  4O4H A;  3JAW A;  3GHZ A;  2ZOV A;  1IV2 A;  3IKE A;  1RLG A;  4NUT A;  5A2Q M;  4U3J A;  1Q7Y H;  1VH8 A;  4X3M A;  2F9Z C;  2Z1T A;  3C8L A;  2WAL A;  3JAS B;  3VYT C;  1XBI A;  3MCA B;  5LA6 B;  5KMG A;  3F0D A;  3FD5 A;  4TV8 B;  5FNV B;  3S02 A;  2Z1F A;  2L26 A;  5LYJ B;  1DBF A;  3LYB A;  5B8F A;  4C82 A;  4ZOL A;  5CA0 B;  5JQG B;  2AIF A;  3LME A;  2OTJ F;  3O85 A;  2HRU A;  2CSL A;  4O4L B;  5KX5 B;  5BMV A;  5LXT B;  4YJ2 A;  3JAT A;  3QTY A;  1YIJ F;  3CCV F;  5HXU A;  2UYN B;  4O4I B;  5EO3 A;  1TUB B;  3T80 A;  1VQK F;  4C8I A;  4EB6 B;  4X1I B;  2HP3 A;  3HTN A;  5IYZ B;  3JAM M;  4NQ3 A;  3UT5 B;  1RQ2 A;  3D54 A;  4C8E A;  5EZY A;  1ZWZ A;  4X1Y B;  3G6E F;  4NWO B;  1YJW F;  1XHO A;  1SZQ A;  3WPX A;  2H8C A;  4O2B A;  2OTL F;  4YJ3 B;  3QHD A;  3E1Y A;  4HNA B;  4ZHY B;  4KWE A;  5HY2 A;  5IJ0 B;  4F6R B;  1H47 A;  1U3P A;  1W55 A;  1IPA A;  3S0H A;  3JVH A;  3K0T A;  1S72 F;  1W41 A;  1VK3 A;  1X52 A;  5JVD B;  1UFY A;  2P6Y A;  3CC7 F;  4G4W A;  2CHT A;  4FFB B;  2HQS C;  5EYP A;  4DRX A;  2GZL A;  3NK6 A;  5IJ9 A;  3D01 A;  1KC8 H;  3E22 A;  3M84 A;  5LA6 A;  4IHJ B;  3V7E A;  3N2K B;  4BVQ A;  5FNV A;  2QA4 F;  2UYK A;  5LYJ A;  3K14 A;  3RYI B;  4G4X A;  3FD6 A;  3WGJ A;  3VYS C;  5JQG A;  4O4L A;  1U40 A;  2VGN A;  5KX5 A;  3CB2 A;  3MQW A;  2RHO A;  1E7K A;  2KGW A;  1TUB A;  2VGM A;  4XCQ A;  5IYZ A;  3NK7 A;  4EI7 A;  5AVM A;  5JH7 A;  3OBW A;  4LNU B;  2MQE A;  1X25 A;  1VQP F;  3CXC F;  2ZVZ A;  3ZP4 A;  3CG6 A;  4X1Y A;  3OON A;  3PLA C;  5LP6 C;  2OZB A;  2H6L A;  3JAK B;  4C4W C;  3VTI C;  4ZHQ B;  2DYY A;  4ZI7 B;  2BTO A;  3B6N A;  2NMU A;  5J2U B;  1VQ7 F;  4ERH A;  3MDO A;  2V9Y A;  2QI2 A;  5HWE A;  3V3T A;  4I50 A;  5IJ0 A;  3IEQ A;  3LWP C;  4C8G A;  4F6R A;  1W2B F;  1Q8R A;  2I6R A;  1J7H A;  4G4Y A;  1RQ7 A;  2KTV A;  3G4S F;  2YYE A;  3V7Q A;  5C8Y B;  2W8B C;  5LP6 A;  4IIJ B;  2IG8 A;  4PWT A;  5J2T B;  1M90 H;  1W57 A;  5HP7 A;  2LBX A;  4I4T A;  5MN5 A;  1N8R H;  2BTQ B;  3J81 M;  5HXZ A;  1QD9 A;  1W5F A;  5IT9 M;  2PHN A;  2AIZ P;  3RYF B;  4B62 A;  3E20 B;  1VQ4 F;  2CVL A;  1VQO F;  4X3L A;  3CCU F;  3RYI A;  4TV9 A;  1SDS A;  2Q1Y A;  2GVI A;  3WGN A;  3HKB B;  3DC2 A;  3HKC A;  4BVT A;  1PF5 A;  3L7Q A;  3RE3 A;  4B46 A;  3QUW A;  3SIV A;  4I55 B;  3RA5 A;  3KHN A;  4LNU A;  3P10 A;  4ZK7 A;  1KNJ A;  2YXZ A;  1VQM F;  2H8E A;  3NVI B;  3M4S A;  3CCM F;  4E6E A;  3RYC B;  3F0F A;  3FFM A;  5EWR A;  1JY8 A;  4X20 B;  4O4J A;  2UYP A;  1FFX B;  4ZHQ A;  3OBY A;  5J2U A;  5HP8 A;  3CCR F;  3C9S A;  3I7T A;  5EAZ A;  3CCS F;  1FNK A;  2DT4 A;  3HWU A;  1W5B A;  4ZHW A;  1CN7 A;  2Z1U A;  3U0O A;  1CK2 A;  5C8Y A;  1KD1 H;  3LFO A;  5J2T A;  4BT3 A;  1JFF B;  1YGY A;  3KIZ A;  4TUY A;  3JAL B;  1SA0 B;  4G4Z A;  3HKE B;  1W58 1;  3N2G B;  3LWQ C;  3S06 A;  1NJI H;  3VI6 A;  5HY0 A;  3RYF A;  2VAW A;  1Q86 H;  3CCE F;  1CLI A;  3WGK A;  4R40 B;  2ZOD A;  2HS4 A;  3C9R A;  3HKB A;  4EI9 A;  1W42 A;  1RA4 A;  3JAS A;  2GLZ A;  3TD5 A;  3PAF A;  4BT4 A;  3WGL A;  3ON1 A;  5ITZ B;  4WBN B;  1K9M H;  4TV8 A; 
#chains in the Genus database with same CATH homology
 1IV1 A;  1GX1 A;  1KNJ A;  3IKE A;  3K14 A;  3F0E A;  3K2X A;  1U3L A;  3FPI A;  1KNK A;  3IEW A;  3F6M A;  1VH8 A;  1U40 A;  1H48 A;  1H47 A;  2PMP A;  1U3P A;  2AMT A;  3B6N A;  3F0F A;  3T80 A;  1W55 A;  3ESJ A;  3ERN A;  4C8I A;  1YQN A;  1JY8 A;  3JVH A;  3MBM A;  1JN1 A;  3IEQ A;  3Q8H A;  1VHA A;  4C8G A;  1T0A A;  3EOR A;  3ELC A;  4C8E A;  3F0D A;  2UZH A;  3RE3 A;  3IKF A;  2GZL A;  3GHZ A;  4C81 A;  1IV4 A;  3P10 A;  3FBA A;  5B8F A;  3KE1 A;  1W57 A;  4C82 A;  1IV3 A;  3QHD A;  1U43 A;  3P0Z A;  3F0G A;  1IV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...