1KNJA

Co-crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase (ispf) from e. coli involved in mevalonate-independent isoprenoid biosynthesis, complexed with cmp/mecdp/mn2+
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
156
structure length
156
Chain Sequence
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase. An enzyme in the mevalonate-independent isoprenoid biosynthetic pathway.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 37
structure length 156
sequence length 156
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1knjA00
1KNKA 1W55A 3IKEA 3K14A 3RE3A 3EORA 3JVHA 3F0GA 2PMPA 2UZHA 1KNJA 3F0FA 1H48A 1U43A 3QHDA 3F0DA 1IV4A 1IV1A 1U40A 3F0EA 1T0AA 4C8EA 3K2XA 2AMTA 1W57A 1YQNA 3F6MA 3IKFA 3P0ZA 4C8GA 3MBMA 4C8IA 1JN1A 1VHAA 4C82A 3Q8HA 3IEWA 1U3PA 1GX1A 1JY8A 3ESJA 3FPIA 3GHZA 3IEQA 3T80A 5B8FA 3ERNA 1IV2A 3FBAA 1U3LA 1H47A 3B6NA 4C81A 3KE1A 3P10A 3ELCA 1IV3A 2GZLA 1VH8A
chains in the Genus database with same CATH superfamily
1W55A 3JARA 5IYZB 4F6RA 2RHOA 4BVRA 4BVSA 3LWQC 3CPWF 5J2TA 1FNKA 3JAWB 3N2KA 3NK6A 3RYHB 1CN7A 3P4EA 1XBIA 4B45A 2Z01A 1XHOA 3N2KB 3LWVC 3VYUC 5G4UC 4LNUA 2QEXF 3HAXD 4ZOLA 3MDOA 1VHAA 5EZYA 1W5BA 3Q8HA 4ERHA 1ODEA 1QD9A 3NK7A 4F6RB 1PF5A 3NVIB 3GHZA 4X1YA 1UI9A 2HP0B 4TV8A 1OFUA 1YGYA 2QI2A 2ZODA 2CWJA 4I55B 1COMA 5LYJA 4O4LB 1W40A 3EORA 4LCKA 3VOBA 3VIUA 2PMPA 1RLUA 5EZYB 2Q1XA 3VCZA 4I50A 1X52A 3SIUA 1M90H 3F0EA 2WALA 1T0AA 5LXTB 3CCSF 4U3JB 5BMVA 3V7QA 4I4TB 3IKFA 3M1XA 4C8GA 1R1MA 3RYHA 3LWRC 1Q7YH 5CA1B 1W42A 3FFMA 2IAFA 3O85A 3NVKE 2RHHA 2BTOA 1VQVA 1W5AA 4HNAA 1JFFA 2RB9A 3QHDA 3RA6A 5JH7A 1RQ7A 1KNKA 2VGNA 3CC2F 2CHSA 3JVHA 5C8YB 3N4YA 4ZHQA 5KX5B 3JAMM 3TD5A 2AIFA 4C8EA 2HRYA 1FSZA 3C9UA 2VGMA 4YJ2B 3P0ZA 3ZP4A 3V3TA 1YITF 2L26A 3LDTA 3S03A 4FFBA 2CVLA 3HKEA 1H47A 1JFFB 3CCRF 3OBYA 1KC8H 1ONIA 2RHJA 1GO1A 1TUBB 3HKBB 3CCVF 5GANK 1H48A 3C9TA 1Q86H 3E1YA 1CLIA 1FNJA 3M84A 4BT7A 4EI9A 3HTNA 3F6MA 2ZAUA 1NQ3A 1YHQF 2YXZA 1W59A 3TD4A 1TUBA 4IHJB 4I55A 5LYJB 3OONA 5AVMA 3WJQA 5IJ0B 5LA6A 5HY0A 1VQNF 4TV8B 5A2QM 5HP8A 5HY1A 4RQOA 4G4WA 3CCUF 3VMFB 4X1IB 4B5CA 3WPWA 1VQ5F 1YQNA 3PAFA 4PWTA 5C8YA 1Q81H 2OZBA 1GZ0A 1KQSF 3JATA 2HS4A 3M4SA 1GO0A 1GX1A 2YYEA 5JH7B 5MN4A 2VXYA 2ZVZA 3CB2A 3L7QA 4G4ZA 2LBWA 3S02A 4R40B 2UYPA 4BVQA 2LBXA 5DCVA 1VQOF 1TVKB 4X20A 3LFOA 1VQKF 5LOVB 3JAKA 4DXDA 5LXTA 3F0DA 3S06A 5HWEA 4TV9B 4TUYB 3RYFB 3WPXA 3J80M 2HQSC 4O4LA 4BW0B 4TZZA 3LWOC 3ESJA 5EB0A 4O4HA 3I55F 4RHAA 1VQMF 3J7AR 1W5FA 3CPQA 5LA6B 1DT9A 3WGNA 1K73H 3VO8A 2QTPA 3HKDA 4NQ3A 3K0TA 5EAZA 3S0HA 3RE3A 3HKCA 4ZOLB 2ZOVA 1VQ8F 4B62A 3LYBA 1XV2A 2Q1YA 3GTZA 2VAWA 5CB4B 5FLXM 1SA0A 5CA0A 1YJNF 2IG8A 3QUWA 5LP6C 3MCQA 1JN1A 4C82A 4EB6B 3K12A 4YJ3A 3S0YA 3CCEF 1U3PA 5KMGA 4E6EA 2ZF8A 3IEQA 5B8FA 3T80A 3C8LA 2UYNA 4M8IA 3KE1A 3P10A 2N48A 4FFBB 2H8EA 3G71F 1IPAA 1VQ4F 1YJWF 3V4DA 1NJIH 1NMUB 2OHWA 1X7OA 2KG4A 3CCJF 3CD6F 4DRXA 3VI6A 3WXMB 5HXZA 1ZWZA 4X1IA 3WGKA 1YJ9F 1Q82H 4X3LA 2Z1TA 1FFXA 3ON1A 2FGYA 2I6RA 5FNVA 2RHLA 4C4WC 1W2BF 2EWCA 1W3EX 4O2AB 2K1SA 2GVIA 2JNBA 3B6NA 3D01A 3E22B 1E7KA 4O4JB 5GONB 2R6R1 5CA1A 3DC2A 3HJWC 2UZHA 4I4TA 2LCAA 3IR9A 4U3JA 3RYIA 1SDSA 3JALB 3D54A 4WBNA 4U39A 3KHNA 2QA4F 5GINC 3OW2F 3IEWA 3FPIA 2OTLF 4NUTA 3ERNA 1YI2F 3E22A 3WJPA 2HP3A 1OAPA 2R751 5LP6B 3WGJA 3CMEF 5JVDB 4BT4A 2OTMA 1FFXB 5EO3A 4BT2A 3WJRA 2VAPA 2AIZP 1IV4A 3AGKA 2CZWA 1PXWA 4WBNB 4EI8A 5J2TB 1W57A 2FC3A 1JD1A 3RYIB 4ZI7A 1QU9A 3CCLF 1VQ7F 2B33A 3CC7F 3KIZA 5FJ4C 3DDNA 4ZHVA 3FBAA 4X1KB 4C81A 2BTUA 3VYTC 3CYQA 5ITZA 2G9IA 4G4XA 4ZK7A 3CG6A 3F0GA 4ZI7B 3UT5A 3KJJA 1SA0B 5CA0B 3V7EA 3C9RA 5IJ9A 5BMVB 3I3FA 1VK3A 3RYCA 5IT9M 1QAHA 3BYQA 1UFYA 4DRXB 1K8AH 5IJ9B 4I50B 4X3MA 5MN6A 3QTYA 1CK2A 1RA4A 4IIJA 5EIBC 3PLAC 5GIOC 2IQQA 4B46A 1QVFF 3C9SA 3ELCA 1VQ6F 1W5EA 5J2UB 4O4HB 1VH8A 2KGWA 3E20B 3J81M 1X25A 4BT3A 3FD5A 3OBWA 4EB6A 4LNUB 5CB4A 4BT5A 3K2XA 3G6EF 4O4IA 2AMTA 4X20B 4G4YA 1TVKA 5HY4A 3CCQF 5EYPB 3MQWA 3CMAF 3HKBA 4G88A 2BTQB 5JVDA 1XRGA 4O4JA 1IV2A 1YIJF 5HY2A 4XCQA 2GLZA 4IIJB 3IKEA 2UYKA 2H6LA 2HRUA 3K14A 5FNVB 2PHNA 3GYQA 3LWPC 4NWOB 1KD1H 4EI7A 2P6YA 1VQPF 2UYJA 2CSLA 4TUYA 2ZVYA 1J7HA 4TV9A 1U40A 2DYYA 1VQ9F 3CC4F 2W8BC 3D00A 3UT5B 3JASA 1VQLF 2Z1UA 3ZOPA 1T0KB 1X7PA 3WGMA 3ZO8A 4ZHQB 1W581 2ALEA 1DBFA 1N8RH 5ITZB 3VYSC 1SZQA 5GONA 2UYNB 3IMPA 2GZLA 4O2BA 5GIPC 3N2GA 3HWUA 2HS0A 1W41A 5HP7A 3JATB 4BT6A 1U43A 5EB1B 3I7TA 4ZHWA 3G4SF 2KTVA 2CW4A 2F9ZC 3HKCB 2CHTA 4C8IA 5EIBD 3NMUC 2OTJF 3TD3A 5LP6A 2VAMA 3RA5A 5GAPK 2HX0A 1Q8RA 1Z5WA 3U0OA 1K9MH 3VOAA 3HKEB 5IJ0A 3MCAB 1IV3A 3WGLA 2HP0A 3I56F 4X1YB 5EYPA 3CYPB 2I6DA 5KMGB 4BY9D 3LMEA 4YJ3B 3RYFA 5G4VC 4KWEA 4ZHYB 4O4IB 3F0FA 4YJ2A 1M1KH 1IV1A 3R0PA 3SIVA 3JALA 2HVYD 4BVTA 2BO1A 5MN5A 3JAKB 3N4ZA 3CXCF 3JAWA 3S0WA 3N2GB 4O2BB 5J2UA 1H7MA 2NMUA 3JARB 4G4VA 5IYZA 3HKDB 4HNAB 2KTUA 1Z5VA 5JQGA 4O2AA 3JCMM 3KJKA 3ZP7A 5HXUA 3FD6A 2MQEA 2LBTA 2Z1EA 2H8CA 1KNJA 2V9YA 3JASB 2DT4A 3RYCB 2Z1FA 1RLGA 5KX5A 5LOVA 3MBMA 1S72F 3VTIC 5JCOA 5JCOC 1JY8A 1U3LA 4X1KA 5JQGB 1RQ2A 2HS3A 5EWRA 4IHJA 1QVGF 1JJ2F 3CCMF
chains in the Genus database with same CATH topology
1KNKA 1W55A 3IKEA 3K14A 3RE3A 3EORA 3JVHA 3F0GA 2PMPA 2UZHA 1KNJA 3F0FA 1H48A 1U43A 3QHDA 3F0DA 1IV4A 1IV1A 1U40A 3F0EA 1T0AA 4C8EA 3K2XA 2AMTA 1W57A 1YQNA 3F6MA 3IKFA 3P0ZA 4C8GA 3MBMA 4C8IA 1JN1A 1VHAA 4C82A 3Q8HA 3IEWA 1U3PA 1GX1A 1JY8A 3ESJA 3FPIA 3GHZA 3IEQA 3T80A 5B8FA 3ERNA 1IV2A 3FBAA 1U3LA 1H47A 3B6NA 4C81A 3KE1A 3P10A 3ELCA 1IV3A 2GZLA 1VH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KNK A;  1W55 A;  3IKE A;  3K14 A;  3RE3 A;  3EOR A;  3JVH A;  3F0G A;  2PMP A;  2UZH A;  1KNJ A;  3F0F A;  1H48 A;  1U43 A;  3QHD A;  3F0D A;  1IV4 A;  1IV1 A;  1U40 A;  3F0E A;  1T0A A;  4C8E A;  3K2X A;  2AMT A;  1W57 A;  1YQN A;  3F6M A;  3IKF A;  3P0Z A;  4C8G A;  3MBM A;  4C8I A;  1JN1 A;  1VHA A;  4C82 A;  3Q8H A;  3IEW A;  1U3P A;  1GX1 A;  1JY8 A;  3ESJ A;  3FPI A;  3GHZ A;  3IEQ A;  3T80 A;  5B8F A;  3ERN A;  1IV2 A;  3FBA A;  1U3L A;  1H47 A;  3B6N A;  4C81 A;  3KE1 A;  3P10 A;  3ELC A;  1IV3 A;  2GZL A;  1VH8 A; 
#chains in the Genus database with same CATH topology
 1W55 A;  3JAR A;  5IYZ B;  4F6R A;  2RHO A;  4BVR A;  4BVS A;  3LWQ C;  3CPW F;  5J2T A;  1FNK A;  3JAW B;  3N2K A;  3NK6 A;  3RYH B;  1CN7 A;  3P4E A;  1XBI A;  4B45 A;  2Z01 A;  1XHO A;  3N2K B;  3LWV C;  3VYU C;  5G4U C;  4LNU A;  2QEX F;  3HAX D;  4ZOL A;  3MDO A;  1VHA A;  5EZY A;  1W5B A;  3Q8H A;  4ERH A;  1ODE A;  1QD9 A;  3NK7 A;  4F6R B;  1PF5 A;  3NVI B;  3GHZ A;  4X1Y A;  1UI9 A;  2HP0 B;  4TV8 A;  1OFU A;  1YGY A;  2QI2 A;  2ZOD A;  2CWJ A;  4I55 B;  1COM A;  5LYJ A;  4O4L B;  1W40 A;  3EOR A;  4LCK A;  3VOB A;  3VIU A;  2PMP A;  1RLU A;  5EZY B;  2Q1X A;  3VCZ A;  4I50 A;  1X52 A;  3SIU A;  1M90 H;  3F0E A;  2WAL A;  1T0A A;  5LXT B;  3CCS F;  4U3J B;  5BMV A;  3V7Q A;  4I4T B;  3IKF A;  3M1X A;  4C8G A;  1R1M A;  3RYH A;  3LWR C;  1Q7Y H;  5CA1 B;  1W42 A;  3FFM A;  2IAF A;  3O85 A;  3NVK E;  2RHH A;  2BTO A;  1VQV A;  1W5A A;  4HNA A;  1JFF A;  2RB9 A;  3QHD A;  3RA6 A;  5JH7 A;  1RQ7 A;  1KNK A;  2VGN A;  3CC2 F;  2CHS A;  3JVH A;  5C8Y B;  3N4Y A;  4ZHQ A;  5KX5 B;  3JAM M;  3TD5 A;  2AIF A;  4C8E A;  2HRY A;  1FSZ A;  3C9U A;  2VGM A;  4YJ2 B;  3P0Z A;  3ZP4 A;  3V3T A;  1YIT F;  2L26 A;  3LDT A;  3S03 A;  4FFB A;  2CVL A;  3HKE A;  1H47 A;  1JFF B;  3CCR F;  3OBY A;  1KC8 H;  1ONI A;  2RHJ A;  1GO1 A;  1TUB B;  3HKB B;  3CCV F;  5GAN K;  1H48 A;  3C9T A;  1Q86 H;  3E1Y A;  1CLI A;  1FNJ A;  3M84 A;  4BT7 A;  4EI9 A;  3HTN A;  3F6M A;  2ZAU A;  1NQ3 A;  1YHQ F;  2YXZ A;  1W59 A;  3TD4 A;  1TUB A;  4IHJ B;  4I55 A;  5LYJ B;  3OON A;  5AVM A;  3WJQ A;  5IJ0 B;  5LA6 A;  5HY0 A;  1VQN F;  4TV8 B;  5A2Q M;  5HP8 A;  5HY1 A;  4RQO A;  4G4W A;  3CCU F;  3VMF B;  4X1I B;  4B5C A;  3WPW A;  1VQ5 F;  1YQN A;  3PAF A;  4PWT A;  5C8Y A;  1Q81 H;  2OZB A;  1GZ0 A;  1KQS F;  3JAT A;  2HS4 A;  3M4S A;  1GO0 A;  1GX1 A;  2YYE A;  5JH7 B;  5MN4 A;  2VXY A;  2ZVZ A;  3CB2 A;  3L7Q A;  4G4Z A;  2LBW A;  3S02 A;  4R40 B;  2UYP A;  4BVQ A;  2LBX A;  5DCV A;  1VQO F;  1TVK B;  4X20 A;  3LFO A;  1VQK F;  5LOV B;  3JAK A;  4DXD A;  5LXT A;  3F0D A;  3S06 A;  5HWE A;  4TV9 B;  4TUY B;  3RYF B;  3WPX A;  3J80 M;  2HQS C;  4O4L A;  4BW0 B;  4TZZ A;  3LWO C;  3ESJ A;  5EB0 A;  4O4H A;  3I55 F;  4RHA A;  1VQM F;  3J7A R;  1W5F A;  3CPQ A;  5LA6 B;  1DT9 A;  3WGN A;  1K73 H;  3VO8 A;  2QTP A;  3HKD A;  4NQ3 A;  3K0T A;  5EAZ A;  3S0H A;  3RE3 A;  3HKC A;  4ZOL B;  2ZOV A;  1VQ8 F;  4B62 A;  3LYB A;  1XV2 A;  2Q1Y A;  3GTZ A;  2VAW A;  5CB4 B;  5FLX M;  1SA0 A;  5CA0 A;  1YJN F;  2IG8 A;  3QUW A;  5LP6 C;  3MCQ A;  1JN1 A;  4C82 A;  4EB6 B;  3K12 A;  4YJ3 A;  3S0Y A;  3CCE F;  1U3P A;  5KMG A;  4E6E A;  2ZF8 A;  3IEQ A;  5B8F A;  3T80 A;  3C8L A;  2UYN A;  4M8I A;  3KE1 A;  3P10 A;  2N48 A;  4FFB B;  2H8E A;  3G71 F;  1IPA A;  1VQ4 F;  1YJW F;  3V4D A;  1NJI H;  1NMU B;  2OHW A;  1X7O A;  2KG4 A;  3CCJ F;  3CD6 F;  4DRX A;  3VI6 A;  3WXM B;  5HXZ A;  1ZWZ A;  4X1I A;  3WGK A;  1YJ9 F;  1Q82 H;  4X3L A;  2Z1T A;  1FFX A;  3ON1 A;  2FGY A;  2I6R A;  5FNV A;  2RHL A;  4C4W C;  1W2B F;  2EWC A;  1W3E X;  4O2A B;  2K1S A;  2GVI A;  2JNB A;  3B6N A;  3D01 A;  3E22 B;  1E7K A;  4O4J B;  5GON B;  2R6R 1;  5CA1 A;  3DC2 A;  3HJW C;  2UZH A;  4I4T A;  2LCA A;  3IR9 A;  4U3J A;  3RYI A;  1SDS A;  3JAL B;  3D54 A;  4WBN A;  4U39 A;  3KHN A;  2QA4 F;  5GIN C;  3OW2 F;  3IEW A;  3FPI A;  2OTL F;  4NUT A;  3ERN A;  1YI2 F;  3E22 A;  3WJP A;  2HP3 A;  1OAP A;  2R75 1;  5LP6 B;  3WGJ A;  3CME F;  5JVD B;  4BT4 A;  2OTM A;  1FFX B;  5EO3 A;  4BT2 A;  3WJR A;  2VAP A;  2AIZ P;  1IV4 A;  3AGK A;  2CZW A;  1PXW A;  4WBN B;  4EI8 A;  5J2T B;  1W57 A;  2FC3 A;  1JD1 A;  3RYI B;  4ZI7 A;  1QU9 A;  3CCL F;  1VQ7 F;  2B33 A;  3CC7 F;  3KIZ A;  5FJ4 C;  3DDN A;  4ZHV A;  3FBA A;  4X1K B;  4C81 A;  2BTU A;  3VYT C;  3CYQ A;  5ITZ A;  2G9I A;  4G4X A;  4ZK7 A;  3CG6 A;  3F0G A;  4ZI7 B;  3UT5 A;  3KJJ A;  1SA0 B;  5CA0 B;  3V7E A;  3C9R A;  5IJ9 A;  5BMV B;  3I3F A;  1VK3 A;  3RYC A;  5IT9 M;  1QAH A;  3BYQ A;  1UFY A;  4DRX B;  1K8A H;  5IJ9 B;  4I50 B;  4X3M A;  5MN6 A;  3QTY A;  1CK2 A;  1RA4 A;  4IIJ A;  5EIB C;  3PLA C;  5GIO C;  2IQQ A;  4B46 A;  1QVF F;  3C9S A;  3ELC A;  1VQ6 F;  1W5E A;  5J2U B;  4O4H B;  1VH8 A;  2KGW A;  3E20 B;  3J81 M;  1X25 A;  4BT3 A;  3FD5 A;  3OBW A;  4EB6 A;  4LNU B;  5CB4 A;  4BT5 A;  3K2X A;  3G6E F;  4O4I A;  2AMT A;  4X20 B;  4G4Y A;  1TVK A;  5HY4 A;  3CCQ F;  5EYP B;  3MQW A;  3CMA F;  3HKB A;  4G88 A;  2BTQ B;  5JVD A;  1XRG A;  4O4J A;  1IV2 A;  1YIJ F;  5HY2 A;  4XCQ A;  2GLZ A;  4IIJ B;  3IKE A;  2UYK A;  2H6L A;  2HRU A;  3K14 A;  5FNV B;  2PHN A;  3GYQ A;  3LWP C;  4NWO B;  1KD1 H;  4EI7 A;  2P6Y A;  1VQP F;  2UYJ A;  2CSL A;  4TUY A;  2ZVY A;  1J7H A;  4TV9 A;  1U40 A;  2DYY A;  1VQ9 F;  3CC4 F;  2W8B C;  3D00 A;  3UT5 B;  3JAS A;  1VQL F;  2Z1U A;  3ZOP A;  1T0K B;  1X7P A;  3WGM A;  3ZO8 A;  4ZHQ B;  1W58 1;  2ALE A;  1DBF A;  1N8R H;  5ITZ B;  3VYS C;  1SZQ A;  5GON A;  2UYN B;  3IMP A;  2GZL A;  4O2B A;  5GIP C;  3N2G A;  3HWU A;  2HS0 A;  1W41 A;  5HP7 A;  3JAT B;  4BT6 A;  1U43 A;  5EB1 B;  3I7T A;  4ZHW A;  3G4S F;  2KTV A;  2CW4 A;  2F9Z C;  3HKC B;  2CHT A;  4C8I A;  5EIB D;  3NMU C;  2OTJ F;  3TD3 A;  5LP6 A;  2VAM A;  3RA5 A;  5GAP K;  2HX0 A;  1Q8R A;  1Z5W A;  3U0O A;  1K9M H;  3VOA A;  3HKE B;  5IJ0 A;  3MCA B;  1IV3 A;  3WGL A;  2HP0 A;  3I56 F;  4X1Y B;  5EYP A;  3CYP B;  2I6D A;  5KMG B;  4BY9 D;  3LME A;  4YJ3 B;  3RYF A;  5G4V C;  4KWE A;  4ZHY B;  4O4I B;  3F0F A;  4YJ2 A;  1M1K H;  1IV1 A;  3R0P A;  3SIV A;  3JAL A;  2HVY D;  4BVT A;  2BO1 A;  5MN5 A;  3JAK B;  3N4Z A;  3CXC F;  3JAW A;  3S0W A;  3N2G B;  4O2B B;  5J2U A;  1H7M A;  2NMU A;  3JAR B;  4G4V A;  5IYZ A;  3HKD B;  4HNA B;  2KTU A;  1Z5V A;  5JQG A;  4O2A A;  3JCM M;  3KJK A;  3ZP7 A;  5HXU A;  3FD6 A;  2MQE A;  2LBT A;  2Z1E A;  2H8C A;  1KNJ A;  2V9Y A;  3JAS B;  2DT4 A;  3RYC B;  2Z1F A;  1RLG A;  5KX5 A;  5LOV A;  3MBM A;  1S72 F;  3VTI C;  5JCO A;  5JCO C;  1JY8 A;  1U3L A;  4X1K A;  5JQG B;  1RQ2 A;  2HS3 A;  5EWR A;  4IHJ A;  1QVG F;  1JJ2 F;  3CCM F; 
#chains in the Genus database with same CATH homology
 1KNK A;  1W55 A;  3IKE A;  3K14 A;  3RE3 A;  3EOR A;  3JVH A;  3F0G A;  2PMP A;  2UZH A;  1KNJ A;  3F0F A;  1H48 A;  1U43 A;  3QHD A;  3F0D A;  1IV4 A;  1IV1 A;  1U40 A;  3F0E A;  1T0A A;  4C8E A;  3K2X A;  2AMT A;  1W57 A;  1YQN A;  3F6M A;  3IKF A;  3P0Z A;  4C8G A;  3MBM A;  4C8I A;  1JN1 A;  1VHA A;  4C82 A;  3Q8H A;  3IEW A;  1U3P A;  1GX1 A;  1JY8 A;  3ESJ A;  3FPI A;  3GHZ A;  3IEQ A;  3T80 A;  5B8F A;  3ERN A;  1IV2 A;  3FBA A;  1U3L A;  1H47 A;  3B6N A;  4C81 A;  3KE1 A;  3P10 A;  3ELC A;  1IV3 A;  2GZL A;  1VH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...