1KNJA

Co-crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase (ispf) from e. coli involved in mevalonate-independent isoprenoid biosynthesis, complexed with cmp/mecdp/mn2+
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
156
structure length
156
Chain Sequence
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structure and mechanism of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase. An enzyme in the mevalonate-independent isoprenoid biosynthetic pathway.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 37
structure length 156
sequence length 156
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1knjA00
3MBMA 1U3PA 4C82A 1JY8A 3IEQA 2AMTA 1GX1A 5B8FA 1JN1A 3GHZA 1VHAA 3F0DA 1VH8A 3P0ZA 1W55A 3IEWA 3JVHA 3EORA 3K14A 1W57A 1KNKA 3FPIA 3KE1A 4C8EA 1U43A 3ESJA 4C8GA 1H47A 2PMPA 1U40A 2UZHA 3IKFA 1IV1A 3F0EA 4C81A 1IV4A 3T80A 1U3LA 1YQNA 3ELCA 1KNJA 1H48A 3FBAA 3P10A 3QHDA 3RE3A 1T0AA 3IKEA 3F6MA 3F0FA 3B6NA 1IV2A 1IV3A 3Q8HA 3ERNA 3K2XA 2GZLA 3F0GA 4C8IA
chains in the Genus database with same CATH superfamily
1VQLF 5IYZA 3I3FA 2JNBA 4X3MA 1VQPF 1VH8A 3KIZA 3JALB 3RYCA 3WJRA 1PXWA 3JAKB 3V7QA 4XCQA 3JARA 2IG8A 4X1KA 1Q7YH 5LYJA 3E22A 1VQ8F 2FGYA 3HTNA 2RHJA 3UT5B 3CCJF 2IQQA 3NK7A 4YJ3A 3JAMM 2HQSC 1T0KB 5C8YB 5FJ4C 1KNJA 3LDTA 1S72F 2HS3A 1VQMF 1H7MA 2B33A 3FD5A 1SA0A 3RYFB 4B46A 1RLUA 4TV8A 1QU9A 5EZYB 5GIPC 3CCQF 5ITZB 3C9TA 5JH7A 5GIOC 5A2QM 3CPWF 2BTQB 4EI7A 3NVKE 1XBIA 1VQOF 3VCZA 5HP8A 4TZZA 3AGKA 5CB4A 3NVIB 5KMGB 3C8LA 2VAWA 3QTYA 3C9UA 3HKEB 2ZF8A 3CMEF 3RYIB 3CC2F 1RQ2A 4BVTA 5J2TB 5C8YA 3JAWB 1JD1A 1JY8A 1COMA 2HP3A 3R0PA 1YJ9F 2Q1XA 3ZP4A 3I7TA 3RYFA 3HKCB 3FPIA 3ESJA 1H47A 2NMUA 3RYHB 4ZHQB 3LWRC 1CLIA 1M1KH 1ODEA 2H6LA 3VMFB 1DT9A 1VQ4F 3N2GB 3ON1A 1QD9A 2RHOA 5IT9M 2Z01A 3F0FA 3CMAF 3TD3A 3Q8HA 1VQ7F 2HS0A 3VOAA 3J81M 2HS4A 3GTZA 5EAZA 4PWTA 5LA6B 1X7OA 4X20A 3TD4A 5GAPK 3LFOA 3RYIA 3F0DA 4DRXB 1ONIA 3M84A 4BT4A 2HP0B 1KD1H 5JQGA 3CCVF 4O4HB 3HKDA 3HKCA 4B45A 2CW4A 2LBTA 1Z5WA 4TUYA 3LWPC 2V9YA 1DBFA 2KG4A 3CG6A 3IR9A 3F6MA 3WJQA 1W59A 4ZHQA 1YI2F 3OBYA 4U3JB 2Z1EA 2UYNB 4FFBA 5LOVA 3WPWA 5EO3A 3S06A 4BVQA 4BY9D 2VGNA 1Q82H 2EWCA 5HY1A 4C4WC 3CXCF 2I6DA 2P6YA 2F9ZC 4ZHYB 5BMVA 3FBAA 2LCAA 1TUBB 3VTIC 1VQ5F 4YJ2A 3CYPB 4LNUA 1Z5VA 2CZWA 4O4HA 5JVDB 4I50B 3I56F 5HY4A 2OHWA 2VAPA 2FC3A 4WBNA 4G4XA 4TV9A 4O4IB 1W55A 2CWJA 4ZI7B 2L26A 2R6R1 1OFUA 3V7EA 2PMPA 5CA1B 3IKFA 5CA0B 3WJPA 5FLXM 1NQ3A 3VYTC 3GYQA 4NWOB 5HXUA 4I4TB 5FNVA 4ZHVA 1SZQA 3PAFA 5KX5A 2CHTA 4G4YA 4ZOLB 1YGYA 3MQWA 3LWOC 5IJ9B 2QEXF 5EWRA 5J2UB 4C8IA 5HY0A 3MBMA 1U3PA 2CSLA 5B8FA 1TUBA 3JATB 4HNAA 4BW0B 2PHNA 3K0TA 3G6EF 5LXTA 4BVRA 2ZODA 1W57A 4O2AB 2RHLA 4I50A 5AVMA 1YIJF 4BT7A 1VQ6F 1IV1A 5MN4A 1JFFB 4BT2A 3WGKA 1U3LA 3JALA 3O85A 3JAKA 3CCLF 1YJNF 3E1YA 1T0AA 1X7PA 3BYQA 5GINC 1ZWZA 5HY2A 3WPXA 1IV3A 3WGJA 3UT5A 3KJJA 3LWVC 1VQKF 3F0GA 4IHJB 5HXZA 4ZK7A 1R1MA 1OAPA 2BO1A 4F6RB 4IIJB 2Q1YA 3EORA 3MCAB 3MDOA 4O2BB 3FFMA 4C8GA 5EZYA 1XHOA 2VAMA 5ITZA 1VK3A 1KQSF 5GONB 2RHHA 1X25A 2ZAUA 5MN5A 1GO1A 3CC4F 2WALA 3J7AR 5GANK 3LYBA 4X1IB 1JFFA 3G71F 2W8BC 3CCUF 4O4JB 5KMGA 1W581 5IJ0B 2YXZA 2ZVYA 3HKEA 1CN7A 4O4LB 3CC7F 3D01A 3ZP7A 1FFXB 1W3EX 5J2TA 3JAWA 5G4VC 1RA4A 3D54A 2CVLA 1W41A 2AIFA 2I6RA 1RQ7A 3PLAC 3VYSC 2GLZA 3RYHA 5LP6B 3VI6A 1UFYA 3K2XA 1Q8RA 3L7QA 1YITF 1VQ9F 1KC8H 4G4WA 3N4YA 5JCOC 3KJKA 3N2GA 3GHZA 4X1IA 5DCVA 4X1YB 3P0ZA 2HRYA 4EB6B 1U43A 3CCEF 3DDNA 4G4VA 3M4SA 3HKBB 5LA6A 1E7KA 5JCOA 4BT6A 2QTPA 5IYZB 3P10A 2HVYD 4DRXA 3S0YA 2HP0A 3RYCB 2HX0A 4NQ3A 2GZLA 3JARB 5G4UC 4X1KB 1Q86H 3E22B 4C82A 3OW2F 3M1XA 1NMUB 1X52A 4YJ3B 1QAHA 4B62A 4U3JA 3DC2A 3VO8A 3CD6F 3CYQA 2UYNA 3VOBA 3ZO8A 1Q81H 1SA0B 1K73H 4EI8A 4TV8B 3KHNA 1VQNF 4ZHWA 1YQNA 3LWQC 3WGNA 1J7HA 1H48A 5JH7B 5EB1B 1FNJA 3HKBA 3ERNA 2IAFA 1W5AA 3S0WA 1N8RH 1M90H 2VXYA 3P4EA 2K1SA 4U39A 2BTOA 1CK2A 5CB4B 1JJ2F 3IEWA 1FNKA 3HWUA 2YYEA 4E6EA 5JVDA 3K12A 3HJWC 1W42A 1UI9A 2OTJF 2AIZP 4O4IA 1NJIH 4ZI7A 1QVGF 3RE3A 2QI2A 3IKEA 3NMUC 3N4ZA 3FD6A 5CA1A 3CCMF 2LBXA 2ZOVA 1IV2A 5CA0A 3WXMB 3RA6A 4DXDA 5EB0A 4I4TA 2BTUA 3S02A 1W40A 3WGLA 1XRGA 4ZOLA 3OONA 3K14A 1KNKA 5IJ9A 4C8EA 3S0HA 2RB9A 5HWEA 3U0OA 5J2UA 4BT3A 1U40A 2UZHA 3F0EA 5MN6A 2UYPA 3JATA 1RLGA 4ERHA 4I55B 2G9IA 3QHDA 4O2AA 4X20B 1XV2A 3B6NA 3C9RA 4R40B 3G4SF 4NUTA 3ZOPA 5JQGB 3C9SA 2AMTA 5EYPB 2ALEA 4BT5A 3J80M 3HKDB 3OBWA 1VHAA 2H8CA 3IMPA 1YHQF 3JVHA 3D00A 4TUYB 5HP7A 2OTLF 2Z1UA 2UYJA 4IHJA 3SIUA 1GZ0A 1SDSA 4RQOA 4M8IA 3HAXD 1W5BA 1TVKB 4C81A 1IV4A 4RHAA 4FFBB 3T80A 3JASB 4F6RA 4IIJA 5LOVB 3CB2A 4O2BA 4G4ZA 1K9MH 2VGMA 3N2KB 2LBWA 3MCQA 3LMEA 4I55A 5GONA 3TD5A 3IEQA 3SIVA 1JN1A 3VIUA 3JCMM 1GO0A 3CCRF 3E20B 3V4DA 5BMVB 3VYUC 3QUWA 4O4JA 4YJ2B 5EYPA 1W2BF 4LNUB 5IJ0A 4O4LA 4B5CA 3V3TA 2MQEA 4WBNB 1FFXA 2QA4F 1YJWF 4TV9B 2CHSA 1TVKA 5LP6C 2H8EA 3JASA 2UYKA 1W5EA 2DT4A 2GVIA 5LYJB 1GX1A 4G88A 2R751 2KTVA 3NK6A 4EI9A 3N2KA 4LCKA 5FNVB 5LP6A 3KE1A 3WGMA 3I55F 5KX5B 2Z1TA 1K8AH 5EIBC 4KWEA 5EIBD 3RA5A 2KTUA 4BVSA 2OZBA 2DYYA 2OTMA 2ZVZA 2HRUA 1FSZA 1PF5A 4X1YA 3ELCA 4EB6A 4HNAB 1VQVA 2Z1FA 3CCSF 2N48A 5LXTB 3S03A 1IPAA 1W5FA 1QVFF 3CPQA 2KGWA 4X3LA
chains in the Genus database with same CATH topology
3MBMA 1U3PA 4C82A 1JY8A 3IEQA 2AMTA 1GX1A 5B8FA 1JN1A 3GHZA 1VHAA 3F0DA 1VH8A 3P0ZA 1W55A 3IEWA 3JVHA 3EORA 3K14A 1W57A 1KNKA 3FPIA 3KE1A 4C8EA 1U43A 3ESJA 4C8GA 1H47A 2PMPA 1U40A 2UZHA 3IKFA 1IV1A 3F0EA 4C81A 1IV4A 3T80A 1U3LA 1YQNA 3ELCA 1KNJA 1H48A 3FBAA 3P10A 3QHDA 3RE3A 1T0AA 3IKEA 3F6MA 3F0FA 3B6NA 1IV2A 1IV3A 3Q8HA 3ERNA 3K2XA 2GZLA 3F0GA 4C8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MBM A;  1U3P A;  4C82 A;  1JY8 A;  3IEQ A;  2AMT A;  1GX1 A;  5B8F A;  1JN1 A;  3GHZ A;  1VHA A;  3F0D A;  1VH8 A;  3P0Z A;  1W55 A;  3IEW A;  3JVH A;  3EOR A;  3K14 A;  1W57 A;  1KNK A;  3FPI A;  3KE1 A;  4C8E A;  1U43 A;  3ESJ A;  4C8G A;  1H47 A;  2PMP A;  1U40 A;  2UZH A;  3IKF A;  1IV1 A;  3F0E A;  4C81 A;  1IV4 A;  3T80 A;  1U3L A;  1YQN A;  3ELC A;  1KNJ A;  1H48 A;  3FBA A;  3P10 A;  3QHD A;  3RE3 A;  1T0A A;  3IKE A;  3F6M A;  3F0F A;  3B6N A;  1IV2 A;  1IV3 A;  3Q8H A;  3ERN A;  3K2X A;  2GZL A;  3F0G A;  4C8I A; 
#chains in the Genus database with same CATH topology
 1VQL F;  5IYZ A;  3I3F A;  2JNB A;  4X3M A;  1VQP F;  1VH8 A;  3KIZ A;  3JAL B;  3RYC A;  3WJR A;  1PXW A;  3JAK B;  3V7Q A;  4XCQ A;  3JAR A;  2IG8 A;  4X1K A;  1Q7Y H;  5LYJ A;  3E22 A;  1VQ8 F;  2FGY A;  3HTN A;  2RHJ A;  3UT5 B;  3CCJ F;  2IQQ A;  3NK7 A;  4YJ3 A;  3JAM M;  2HQS C;  1T0K B;  5C8Y B;  5FJ4 C;  1KNJ A;  3LDT A;  1S72 F;  2HS3 A;  1VQM F;  1H7M A;  2B33 A;  3FD5 A;  1SA0 A;  3RYF B;  4B46 A;  1RLU A;  4TV8 A;  1QU9 A;  5EZY B;  5GIP C;  3CCQ F;  5ITZ B;  3C9T A;  5JH7 A;  5GIO C;  5A2Q M;  3CPW F;  2BTQ B;  4EI7 A;  3NVK E;  1XBI A;  1VQO F;  3VCZ A;  5HP8 A;  4TZZ A;  3AGK A;  5CB4 A;  3NVI B;  5KMG B;  3C8L A;  2VAW A;  3QTY A;  3C9U A;  3HKE B;  2ZF8 A;  3CME F;  3RYI B;  3CC2 F;  1RQ2 A;  4BVT A;  5J2T B;  5C8Y A;  3JAW B;  1JD1 A;  1JY8 A;  1COM A;  2HP3 A;  3R0P A;  1YJ9 F;  2Q1X A;  3ZP4 A;  3I7T A;  3RYF A;  3HKC B;  3FPI A;  3ESJ A;  1H47 A;  2NMU A;  3RYH B;  4ZHQ B;  3LWR C;  1CLI A;  1M1K H;  1ODE A;  2H6L A;  3VMF B;  1DT9 A;  1VQ4 F;  3N2G B;  3ON1 A;  1QD9 A;  2RHO A;  5IT9 M;  2Z01 A;  3F0F A;  3CMA F;  3TD3 A;  3Q8H A;  1VQ7 F;  2HS0 A;  3VOA A;  3J81 M;  2HS4 A;  3GTZ A;  5EAZ A;  4PWT A;  5LA6 B;  1X7O A;  4X20 A;  3TD4 A;  5GAP K;  3LFO A;  3RYI A;  3F0D A;  4DRX B;  1ONI A;  3M84 A;  4BT4 A;  2HP0 B;  1KD1 H;  5JQG A;  3CCV F;  4O4H B;  3HKD A;  3HKC A;  4B45 A;  2CW4 A;  2LBT A;  1Z5W A;  4TUY A;  3LWP C;  2V9Y A;  1DBF A;  2KG4 A;  3CG6 A;  3IR9 A;  3F6M A;  3WJQ A;  1W59 A;  4ZHQ A;  1YI2 F;  3OBY A;  4U3J B;  2Z1E A;  2UYN B;  4FFB A;  5LOV A;  3WPW A;  5EO3 A;  3S06 A;  4BVQ A;  4BY9 D;  2VGN A;  1Q82 H;  2EWC A;  5HY1 A;  4C4W C;  3CXC F;  2I6D A;  2P6Y A;  2F9Z C;  4ZHY B;  5BMV A;  3FBA A;  2LCA A;  1TUB B;  3VTI C;  1VQ5 F;  4YJ2 A;  3CYP B;  4LNU A;  1Z5V A;  2CZW A;  4O4H A;  5JVD B;  4I50 B;  3I56 F;  5HY4 A;  2OHW A;  2VAP A;  2FC3 A;  4WBN A;  4G4X A;  4TV9 A;  4O4I B;  1W55 A;  2CWJ A;  4ZI7 B;  2L26 A;  2R6R 1;  1OFU A;  3V7E A;  2PMP A;  5CA1 B;  3IKF A;  5CA0 B;  3WJP A;  5FLX M;  1NQ3 A;  3VYT C;  3GYQ A;  4NWO B;  5HXU A;  4I4T B;  5FNV A;  4ZHV A;  1SZQ A;  3PAF A;  5KX5 A;  2CHT A;  4G4Y A;  4ZOL B;  1YGY A;  3MQW A;  3LWO C;  5IJ9 B;  2QEX F;  5EWR A;  5J2U B;  4C8I A;  5HY0 A;  3MBM A;  1U3P A;  2CSL A;  5B8F A;  1TUB A;  3JAT B;  4HNA A;  4BW0 B;  2PHN A;  3K0T A;  3G6E F;  5LXT A;  4BVR A;  2ZOD A;  1W57 A;  4O2A B;  2RHL A;  4I50 A;  5AVM A;  1YIJ F;  4BT7 A;  1VQ6 F;  1IV1 A;  5MN4 A;  1JFF B;  4BT2 A;  3WGK A;  1U3L A;  3JAL A;  3O85 A;  3JAK A;  3CCL F;  1YJN F;  3E1Y A;  1T0A A;  1X7P A;  3BYQ A;  5GIN C;  1ZWZ A;  5HY2 A;  3WPX A;  1IV3 A;  3WGJ A;  3UT5 A;  3KJJ A;  3LWV C;  1VQK F;  3F0G A;  4IHJ B;  5HXZ A;  4ZK7 A;  1R1M A;  1OAP A;  2BO1 A;  4F6R B;  4IIJ B;  2Q1Y A;  3EOR A;  3MCA B;  3MDO A;  4O2B B;  3FFM A;  4C8G A;  5EZY A;  1XHO A;  2VAM A;  5ITZ A;  1VK3 A;  1KQS F;  5GON B;  2RHH A;  1X25 A;  2ZAU A;  5MN5 A;  1GO1 A;  3CC4 F;  2WAL A;  3J7A R;  5GAN K;  3LYB A;  4X1I B;  1JFF A;  3G71 F;  2W8B C;  3CCU F;  4O4J B;  5KMG A;  1W58 1;  5IJ0 B;  2YXZ A;  2ZVY A;  3HKE A;  1CN7 A;  4O4L B;  3CC7 F;  3D01 A;  3ZP7 A;  1FFX B;  1W3E X;  5J2T A;  3JAW A;  5G4V C;  1RA4 A;  3D54 A;  2CVL A;  1W41 A;  2AIF A;  2I6R A;  1RQ7 A;  3PLA C;  3VYS C;  2GLZ A;  3RYH A;  5LP6 B;  3VI6 A;  1UFY A;  3K2X A;  1Q8R A;  3L7Q A;  1YIT F;  1VQ9 F;  1KC8 H;  4G4W A;  3N4Y A;  5JCO C;  3KJK A;  3N2G A;  3GHZ A;  4X1I A;  5DCV A;  4X1Y B;  3P0Z A;  2HRY A;  4EB6 B;  1U43 A;  3CCE F;  3DDN A;  4G4V A;  3M4S A;  3HKB B;  5LA6 A;  1E7K A;  5JCO A;  4BT6 A;  2QTP A;  5IYZ B;  3P10 A;  2HVY D;  4DRX A;  3S0Y A;  2HP0 A;  3RYC B;  2HX0 A;  4NQ3 A;  2GZL A;  3JAR B;  5G4U C;  4X1K B;  1Q86 H;  3E22 B;  4C82 A;  3OW2 F;  3M1X A;  1NMU B;  1X52 A;  4YJ3 B;  1QAH A;  4B62 A;  4U3J A;  3DC2 A;  3VO8 A;  3CD6 F;  3CYQ A;  2UYN A;  3VOB A;  3ZO8 A;  1Q81 H;  1SA0 B;  1K73 H;  4EI8 A;  4TV8 B;  3KHN A;  1VQN F;  4ZHW A;  1YQN A;  3LWQ C;  3WGN A;  1J7H A;  1H48 A;  5JH7 B;  5EB1 B;  1FNJ A;  3HKB A;  3ERN A;  2IAF A;  1W5A A;  3S0W A;  1N8R H;  1M90 H;  2VXY A;  3P4E A;  2K1S A;  4U39 A;  2BTO A;  1CK2 A;  5CB4 B;  1JJ2 F;  3IEW A;  1FNK A;  3HWU A;  2YYE A;  4E6E A;  5JVD A;  3K12 A;  3HJW C;  1W42 A;  1UI9 A;  2OTJ F;  2AIZ P;  4O4I A;  1NJI H;  4ZI7 A;  1QVG F;  3RE3 A;  2QI2 A;  3IKE A;  3NMU C;  3N4Z A;  3FD6 A;  5CA1 A;  3CCM F;  2LBX A;  2ZOV A;  1IV2 A;  5CA0 A;  3WXM B;  3RA6 A;  4DXD A;  5EB0 A;  4I4T A;  2BTU A;  3S02 A;  1W40 A;  3WGL A;  1XRG A;  4ZOL A;  3OON A;  3K14 A;  1KNK A;  5IJ9 A;  4C8E A;  3S0H A;  2RB9 A;  5HWE A;  3U0O A;  5J2U A;  4BT3 A;  1U40 A;  2UZH A;  3F0E A;  5MN6 A;  2UYP A;  3JAT A;  1RLG A;  4ERH A;  4I55 B;  2G9I A;  3QHD A;  4O2A A;  4X20 B;  1XV2 A;  3B6N A;  3C9R A;  4R40 B;  3G4S F;  4NUT A;  3ZOP A;  5JQG B;  3C9S A;  2AMT A;  5EYP B;  2ALE A;  4BT5 A;  3J80 M;  3HKD B;  3OBW A;  1VHA A;  2H8C A;  3IMP A;  1YHQ F;  3JVH A;  3D00 A;  4TUY B;  5HP7 A;  2OTL F;  2Z1U A;  2UYJ A;  4IHJ A;  3SIU A;  1GZ0 A;  1SDS A;  4RQO A;  4M8I A;  3HAX D;  1W5B A;  1TVK B;  4C81 A;  1IV4 A;  4RHA A;  4FFB B;  3T80 A;  3JAS B;  4F6R A;  4IIJ A;  5LOV B;  3CB2 A;  4O2B A;  4G4Z A;  1K9M H;  2VGM A;  3N2K B;  2LBW A;  3MCQ A;  3LME A;  4I55 A;  5GON A;  3TD5 A;  3IEQ A;  3SIV A;  1JN1 A;  3VIU A;  3JCM M;  1GO0 A;  3CCR F;  3E20 B;  3V4D A;  5BMV B;  3VYU C;  3QUW A;  4O4J A;  4YJ2 B;  5EYP A;  1W2B F;  4LNU B;  5IJ0 A;  4O4L A;  4B5C A;  3V3T A;  2MQE A;  4WBN B;  1FFX A;  2QA4 F;  1YJW F;  4TV9 B;  2CHS A;  1TVK A;  5LP6 C;  2H8E A;  3JAS A;  2UYK A;  1W5E A;  2DT4 A;  2GVI A;  5LYJ B;  1GX1 A;  4G88 A;  2R75 1;  2KTV A;  3NK6 A;  4EI9 A;  3N2K A;  4LCK A;  5FNV B;  5LP6 A;  3KE1 A;  3WGM A;  3I55 F;  5KX5 B;  2Z1T A;  1K8A H;  5EIB C;  4KWE A;  5EIB D;  3RA5 A;  2KTU A;  4BVS A;  2OZB A;  2DYY A;  2OTM A;  2ZVZ A;  2HRU A;  1FSZ A;  1PF5 A;  4X1Y A;  3ELC A;  4EB6 A;  4HNA B;  1VQV A;  2Z1F A;  3CCS F;  2N48 A;  5LXT B;  3S03 A;  1IPA A;  1W5F A;  1QVF F;  3CPQ A;  2KGW A;  4X3L A; 
#chains in the Genus database with same CATH homology
 3MBM A;  1U3P A;  4C82 A;  1JY8 A;  3IEQ A;  2AMT A;  1GX1 A;  5B8F A;  1JN1 A;  3GHZ A;  1VHA A;  3F0D A;  1VH8 A;  3P0Z A;  1W55 A;  3IEW A;  3JVH A;  3EOR A;  3K14 A;  1W57 A;  1KNK A;  3FPI A;  3KE1 A;  4C8E A;  1U43 A;  3ESJ A;  4C8G A;  1H47 A;  2PMP A;  1U40 A;  2UZH A;  3IKF A;  1IV1 A;  3F0E A;  4C81 A;  1IV4 A;  3T80 A;  1U3L A;  1YQN A;  3ELC A;  1KNJ A;  1H48 A;  3FBA A;  3P10 A;  3QHD A;  3RE3 A;  1T0A A;  3IKE A;  3F6M A;  3F0F A;  3B6N A;  1IV2 A;  1IV3 A;  3Q8H A;  3ERN A;  3K2X A;  2GZL A;  3F0G A;  4C8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...