1FFXB

Tubulin:stathmin-like domain complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
427
structure length
410
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TUBULIN)
publication title The 4 A X-ray structure of a tubulin:stathmin-like domain complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 65
structure length 410
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1ffxB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1ffxB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1ffxB01
3CB2A 5JH7A 4TUYB 3RYFA 5BMVA 3VO9A 5C8YB 3RYHB 3JARA 5IYZB 4O4IA 4ZHQB 3WGNA 4O2BB 5IJ0B 4O4HA 4X20A 5LA6B 5EIBC 3HKBA 1FFXA 3ZBPA 1SA0A 4EB6B 4KWEA 1W5EA 5JVDA 1TVKA 5JQGA 1W59A 3JAWB 3V3TA 3ZBQA 4X1KA 3VOBA 5LYJB 4O4IB 4X1YB 5C8YA 3RYHA 3JASB 5IYZA 2VAMA 4ZHQA 4O4LB 3ZIDA 4O2BA 2RHOA 3RB8A 4DRXB 2RHJA 5LA6A 4YJ2B 1Z5WA 5MN4A 4EB6A 5M7EA 5MN5A 2XKBA 5EYPB 3JAKB 4ZI7B 3JAWA 5LOVA 5JVDB 5LYJA 4O4JB 3VOAA 4X1YA 3VPAA 3JASA 5IJ9B 3WGLA 3HKEA 3HKCA 4O4LA 5GONB 1W5AA 5JCOC 4DRXA 5EZYB 5JQGB 2Q1YA 5KMGB 4YJ2A 5J2TB 2VAWA 1RLUA 4TV8B 5LOVB 5CB4B 3HKDB 4YJ3B 3JAKA 5EYPA 4ZI7A 4X1IB 4EI8A 3HKEB 4IIJB 4O4JA 3VO8A 4E6EA 3HKCB 5IJ9A 3N2KB 5GONA 3UT5B 5EZYA 3N2GB 2VAPA 5KMGA 5LP6C 5J2TA 4EI9A 5LP6B 2XKAA 3E22B 4TV8A 5CB4A 4F6RB 3HKDA 1JFFB 4YJ3A 3RYCA 4IHJB 3JALB 4LNUB 4X1IA 4IIJA 4HNAB 2R751 4FFBB 2BTQB 1RQ2A 2Q1XA 5ITZB 1W581 3N2KA 4EI7A 4O2AB 4ZOLB 3UT5A 5CA1B 1Z5VA 5LXTB 3JATB 4U3JB 3N2GA 3RYCB 4WBNB 5LP6A 1W5FA 3E22A 5J2UB 4F6RA 3RYIB 1JFFA 2GVIA 3WGKA 4IHJA 3JALA 4LNUA 5EIBD 3R4VA 3C8LA 1FSZA 4HNAA 1OFUA 2VXYA 4FFBA 4TV9B 2BTQA 5ITZA 4I4TA 5FNVB 5JCOA 4I50B 4O2AA 4ZOLA 5CA1A 2RHLA 5LXTA 3M8KA 3JATA 4U3JA 5CA0B 5KX5B 4WBNA 3M89A 1TUBB 5J2UA 4I55B 3RYIA 2RHHA 5JH7B 4B45A 3RYFB 5BMVB 4I4TB 3JARB 3WGMA 4TUYA 4TV9A 5FNVA 2R6R1 4I50A 5MN6A 4B46A 4XCQA 5IJ0A 4O4HB 4X20B 4M8IA 3HKBB 1FFXB 5CA0A 5KX5A 4U39A 1SA0B 2BTOA 1RQ7A 1W5BA 3WGJA 4DXDA 1TUBA 1TVKB 4I55A 4X1KB
chains in the Genus database with same CATH superfamily
2E5WA 2PKQP 3NM5A 2X1HA 4J80A 2BOCC 1AKWA 1FX0B 3EYWA 1ZINA 2ZOVA 2OCAA 1E6EA 1VARA 4KHPO 5GADl 5BW6B 2EDAA 2VNIA 2VKQA 2ZJ4A 1U4NA 2BEUB 2C8VA 1UBNA 2RI1A 3GRRA 1GM9A 1DKMA 1P5JA 4JVMA 5B2ZA 5AVMA 1R9NA 1OLSA 1ESNA 4XX0A 3TZKA 4EYSA 2NZWA 1JSZA 3V1NA 4WOBA 4B9EA 4LF9B 5JJBA 4PLHA 1AGYA 5A62A 1PS9A 1K5GA 3A4NA 2GZAA 4IUYA 4B87A 4RXTA 1QHSA 3QKRB 4ZYZA 4YUXA 4IDQA 3KLBA 1DHTA 2OMEA 2ZVQX 3M84A 4UDYX 3KJIA 1USWA 4OQNA 4TM8A 1RHRA 2MQEA 2IXAA 4OAPA 4EA7A 2FXIA 3WK6A 2DWEC 2IH4A 2WNSA 4RAIA 2QMHA 4LHVA 1JHYA 5AVWA 2QTZA 4R6WA 3AINA 3VXKA 1EDOA 3ZJTA 4MUGA 4IHQA 1E61A 1BU8A 4LWPA 4JLMA 2I2CA 2WKRA 4OCZA 2CDAA 5ELLA 3AOEA 4H4DA 2QRHA 2O7RA 4DCMA 4HNTA 5D3ZA 1NLFA 4JELA 1GZ6A 3M83A 4Q3EA 5G0VA 2GJ8A 4IGGA 1C9MA 1WNTA 4R1QA 1T6YA 5D00A 4GWGA 3BD8A 3MWYW 5C53B 3GHZA 3OQIB 3DEHA 1KHHA 3BTSA 4Q3NA 3L49A 2UUOA 3SPXA 2JDIG 1ADCA 2C4UA 3GJXC 1PNKA 3W05A 4AHCA 3LLSA 1GN2A 4EY8A 2NSJA 3VHXB 2HMTA 1LC3A 1RRGA 1M57C 1A82A 1JEYA 4CCYB 4YNBA 3VGPA 2Z0AA 3X1DA 4M38A 3I9OA 1MXFA 3HCDA 2OA0A 2GSWA 3K1AA 5GOZA 2J9XB 3EIFA 3HHPA 4PPFA 3VFDA 3I6BA 4L8YA 5ELXA 4JASB 2YWFA 2OQ2A 2IHUA 1G20A 2JRLA 3AZPA 4RZUA 4XYMA 5M5BA 5IG2A 2QLTA 4TZZA 2H57A 1FMCA 2CHGA 3PQCA 3W6PA 1FD9A 4O4LA 4WADA 3DLHA 2FYTA 4UFOA 4F06A 4QELA 3R0ZA 4BO2A 4B3JA 2GMWA 4PIVA 2W0FC 2J6CA 1D1TA 4O8CA 1VP3A 3MRSA 2YS6A 2CYBA 1ZESA 1H6AA 1KO7A 5AKEA 4EITA 5E3IA 3ICCA 3BFVA 5EQJB 4ZT4A 4WD3A 1MO2A 3ICQB 2IEIA 4XIFA 5B2FA 4RTQA 2C83A 2XAUA 2X2OA 3RSFA 1DV2A 5JXGA 2N47A 1OJLA 4DUGA 1CWUA 2HJGA 1PWEA 4V0MA 2BONA 1MQAA 3E70C 4NABA 5JMOA 3TQFA 3RSZA 5K0BA 2P9ZA 2ZIGA 3L7YA 1UZAA 3PRYA 4RFLA 1D04A 4GI7A 2ZR0A 4MDFA 3LQ4A 4G4YA 4KFTA 4RLSA 4K6CA 5EJ2A 2XUIA 3F47A 1QNMA 3HQ4O 1U99A 1VJ5A 3H3FA 1UBGA 1Y6RA 5ICSA 2WPDG 4CR7A 3UBTA 2W2MA 3TLZA 1D1PA 3JAMA 3H9UA 5IDWA 1WV1A 2CVLA 1V5WA 2QM8A 4WNAB 5AI9A 4GYKA 2HJHA 3FFBA 2ZDHA 4X44A 4RPGA 3L8GA 4X66O 3S40A 5KCZA 2FUG1 1ZMOA 2J08A 5BYBA 2LDXA 3Q3VA 1CG6A 1YS2X 5CT8A 1FAFA 4ND4A 2VNSA 1PF7E 2YOGA 4BJ5A 2GJAA 4CVNA 4MW8A 4MVJG 4RORA 1YDFA 4Y0AA 4AECA 1E6LA 1BEUB 3LQQA 1ZVMA 3RS2A 3SLRA 1U9ZA 1XJ0A 4EEKA 1V3TA 2GZ2A 3G6EV 3CCEV 2H5EA 1YZ3A 2C1XA 4C7XA 1B3RA 1F38A 1TKRA 2YVAA 1QYIA 5KHAA 4F4UA 4ASUD 1D2EA 4PI2A 1T8SA 5HWSA 4X9QA 2D0IA 4UARA 2CH7A 2EQAA 3OTOO 5K8UA 2CHSA 3HGTA 2JFBA 1NVGA 4KE8A 5A7HA 1IHDA 3N53A 3VUFA 1BS3A 2VPYA 2VGMA 3FFXA 2JK0A 4BAZA 1AA9A 2NVUA 1ZUIA 5CXQA 4PA4A 2Y2UA 1XVAA 3SBOA 2PX6A 3OT5A 1UJMA 4EHBA 5DGHA 5EERA 3KKKA 4DAOA 3PEWA 3OM0A 1KY2A 4B47A 1N8KA 2WTBA 1KEZA 1YU9A 4YXFA 2X6AA 4BKMA 4E2XA 4BWVA 4OHPA 4E7OA 3DR5A 1WY5A 2J0QA 3IP1A 1YC2A 3IJEB 3I39X 2FY8A 4Y6OA 1IJEA 1OPXA 4M9CA 4I3GA 4CMIA 2DH5A 4E03A 4U7PB 3F3YA 3QK7A 1A72A 1QANA 1E2FA 4YCAA 1Q11A 3B8EA 1XEAA 4BNHA 2BDEA 3TEFA 1TNDA 3KLOA 3I61A 1OXTA 3S0JA 3S44A 3V7FA 2FEXA 1OIVA 1LSUA 4ARVA 4E5UA 4GKJO 1TZJA 4WBSA 4Q3KA 3NGMA 2ZT8A 4Q01A 3S2FA 4AL4A 3GCGA 1QGYA 2ERCA 3JU3A 5DLPA 3RVMA 1PLKA 4RD3A 1XG5A 3DDHA 5FFNA 3RKRA 4XQEA 3UT5B 4DV2O 4QODA 2E4VA 2P6YA 1CR0A 1XDZA 1U31A 2UYKA 5JC1A 1MB0A 4JYMA 1T8WA 2FE1A 4RENA 2IBSA 5F9MA 2PZ8A 2WT4A 2G9NA 4XAQA 2ACEA 1NY5A 2ZZKA 4X97A 5BYAA 2BW0A 3SLGA 4IVPA 2VFAA 4ON9A 3U4HA 2QX9A 1GJRA 3A4LA 1E3LA 3NOVA 1ZAYA 3K9FC 2JFOA 4M1EA 3ED5A 5IKEA 3HPLC 4ZVVA 2R1VB 3AG4B 1JT9A 4Z6KA 2ACKA 3CRCA 3IVGA 3OOSA 1X80B 5ER9A 1NXTA 1LTKA 5KQSA 3WZLA 2YMLA 4LF6B 1VQMF 4TMZA 2G38A 4C7BA 7REQB 4LF8B 4K9MA 1U8AA 3P0EA 5G4LA 1E1KA 1UFRA 2W5UA 2IYTA 3LDCA 2XUPA 4V39A 2HRRA 3O5AA 1RJ9B 1PYDA 4YAIA 2R4TA 1NWCA 2CW5A 5L3SB 1SULA 4GD3Q 2Y68A 4BN5A 4G9GA 1URPA 1H0KA 3LC7O 3A14A 1QF9A 3VZQA 2H4JA 4RLQA 2GJ9A 3ZE0B 3JALA 4EGFA 3I9NA 3DDUA 1L0BA 4IH9A 1SHZA 4II2A 2C7PA 3PQ4A 4ZZ0A 3WJ1A 1U0SY 3IKLA 3S0HA 3JSAA 4XI9A 3KUUA 2PV0A 1SNYA 3RJ9A 5JATA 4ZOQI 2VKTA 2XRZA 3UQ8A 4KUMA 4L6IA 3JVHA 4X8AA 5B1SA 1Q2XA 5IH7A 5DLQC 2FPRA 4JYPA 2Y9PB 4QGGA 3UO2A 2P91A 3GT0A 3T99A 3FGPA 2EBOA 5G3ZA 4P5PA 1CY2A 3VI3B 1MENA 3K0AB 5BSKA 3CYFA 3PWTA 5JS6A 1RQPA 3W34A 4B7UA 5B3LA 4YACA 4XB2A 2ZRLA 2VPPA 2R6JA 4J76A 3VYRB 1EP9A 4LGMA 4DY4A 1J95A 2BCCH 2W0SA 3MS7A 3K03A 4BO3A 4IDFA 3QLEA 2UU9B 5KOJA 5KOIA 2OCKA 2GTPA 2I3ZA 4BKPA 4R1LA 2JFNA 3T6KA 1CVRA 4HYOA 2ZXWB 2JFVA 1NTMH 1KYTA 1ESZA 4D43A 1FCJA 4JUDX 3IV7A 5AKLA 2QRQA 4UTPA 1UDAA 3PFIA 1RPRA 3RWBA 3OE7A 1NMZA 4IFBA 2VF2A 1N2JA 4IVRA 3CYQA 1KRWA 1H2SB 3WIUA 3HWRA 3GVIA 1NNUA 2ZIXA 3RYFA 5ALJA 1ZD5A 3QJ5A 5J5CA 3WOHA 2BFAA 1BFKA 4ATNA 4EHFA 3W5JA 3MQ4A 2IVFA 1ZH4A 1DUVG 4WK0B 1RLMA 1TCUA 1X7OA 5JCOC 5JO0A 5CHYA 5K9ZA 5ENZA 1V5IA 1H23A 1ZGAA 5DU2A 1TIBA 1S1CA 3G2OA 3K1JA 4J42A 2XTMA 3K6KA 5DBFA 4KUHA 2F67A 3CWBH 1SD5A 1XVTA 2HHCA 3BD7A 3G5AA 4JI7O 4C78A 2XUKA 3EEQA 1Z8DA 2NTJA 2EJCA 4OJQA 4RF2A 4I9UA 3G17A 1E1RG 1UFKA 4I55B 3H9CA 1DAIA 3RDPA 2CUTA 4GKAA 2OGSA 3SEAA 4JP2A 4GI1A 3DE6X 4BIIA 4WINA 4P7KA 3ZBHA 3I34X 1KWGA 4QU5A 5EA2A 3ZHUA 3N70A 2BSAA 5K6AA 1AUPA 1Q15A 4BRZA 1ST3A 2BR3A 4LMPA 3FHJA 3AR3A 2RHJA 1R9JA 4MUBA 3TVDA 4N1AA 3MDOA 4YJHA 1U0RA 3MT9A 2D3TA 3KR2A 3ZVKA 1Z68A 1XL0A 3L75H 3KJNA 4X8LA 4B0PA 1RJDA 3E03A 1VE5A 4DG5A 2OIGA 1YGYA 3R6GA 3U6BA 5DB4A 4NYJR 1OAPA 4UNRA 3LC1O 3DZ8A 4JJEA 5E7QA 4DCPA 1H6CA 1MHTA 1E79D 2DERA 1ABBA 1SQFA 1P4AA 2CEKA 1Q91A 1VKRA 4C87A 2JAOA 3F6PA 3T1OA 2FK7A 2I3DA 1UIRA 3RTEA 2XUQA 4HB4A 3RSQA 3Q0IA 1L1FA 3JD0A 1DBSA 4PFSA 1LPSA 4FYYA 2WZQA 3DAHA 2Y6VA 1A69A 4PN7A 3OZXA 3RADC 4K05A 4NE2A 3S7TA 3PC3A 4CLDA 4KH0A 3UYLA 2EWCA 3PPXA 4RK7A 3K31A 2EFHB 4WN9A 2HVJC 1PQYA 3LJKA 2ZJ0A 5MHTA 4ECAA 3GCXA 4J3NA 1OGYA 1HMYA 1M1XB 3MUFA 3GFRA 2V3CC 3KYBA 3L0BA 4BMXA 3NTVA 5BPFA 3WAGA 1KFBB 4B6FA 3RASA 1NLUA 3E7WA 3RGBA 1UT6A 1SAYA 3M3DA 2BJVA 3ZNPA 4LECA 1TIKA 3MWJA 1RAIA 1W5TA 3P0IA 3OZDA 1EX7A 2QI9F 2EIMC 1G1XB 1PS8A 5HQ3B 6ADHA 1KK0A 3I37X 3PUWA 4DPKA 1PQ4A 4WBNA 4BMOB 1Q6ZA 2FWJA 1XKXA 3DXXA 4DGSA 5AM3A 3DTYA 4GG1A 3ACDA 3MD9A 1F4PA 4BR6A 3U13A 3AXTA 4QOIA 1ETHA 1Q3HA 2HFKA 1SC9A 4G5YA 3USES 1XUOA 4MVUA 5EY5B 1JHDA 1A5SB 1CY4A 4L02A 5KAMA 1X1AA 1FE8A 1SVIA 1U8UA 3H6GA 3PHJA 2XZDA 3L0PA 1SUCA 2B6NA 1ZCZA 4HX5A 5IAOA 4JLDA 4GRAA 4FFRA 1WZNA 4MUAA 5JWHA 3OETA 3N1UA 1GL9B 4CKEB 4DV3B 3WYBA 4QBGB 4PQFA 2FW8A 5AKYA 5FEMA 3O9OA 1VSTA 3EZ2A 4OG2A 4RPJA 5IT4A 1GVNB 4JDPA 3CF2A 1PJTA 4WXPA 3FHOA 5EKUA 5LUAA 2J9FB 3I56F 4YY3B 4R5MA 2XAAA 2J6IA 4KN6A 4XJTA 1ILEA 3GVCA 4WGFA 3HRHA 1HFKA 3FCOA 4ZEWA 3C8UA 4WOCA 4BMDA 3CYOA 2YUAA 2OCLA 4JVOA 3SS7X 5SYAA 2ZI3A 1Q0RA 5T57A 1HE4A 1W59A 4DLSA 3KR1A 4D9IA 2FSGA 2XBMA 3SKYA 3D54D 4NJOA 4DA9A 3OVMA 3PD0A 3W5DA 2QWPB 1X15A 3PGXA 3NJ4A 4G36A 1S8OA 2W00A 1QR9A 1TCAA 1NE2A 1JQDA 4G1UC 1RM1C 1U63A 2RH9B 2YN0A 2P1RA 1YE3A 3K4QA 1FSSA 1KS9A 4BFLA 4BUJA 2FZ5A 3DSQA 3BC1A 2QAGA 2N1MA 2GM5A 3Q4GA 2QPOA 2R1UA 3VPDA 2VRZA 2XXJA 5A5DA 3ERCA 3HMQA 2ZIMA 4NFLA 2P9BA 4ZHVA 4JP3A 2LUOA 1F48A 5LBIA 1JV2B 2AL7A 2GXAA 3S2GA 2EZUA 3RO7A 4GX2A 3FSRA 1V5FA 2JHCA 1BKSB 4DEVA 4DB2A 5F5LA 1SRRA 3E84A 1ID1A 2AMVA 2C7QA 1YR9A 1PYOA 3H1LH 4QUHA 4BJ3A 3RE1A 2GBLC 4EGQA 1Z36A 2IHBA 1NF8A 2G9ZA 3TPZA 3SR0A 3Q7EA 1Y82A 3AEQA 1R66A 1ZD3A 2DN9A 2HPZA 5ESDA 3MZ0A 2NNWB 4B3BA 3KLNA 3P2MA 2PH5A 2ZETA 5TF4A 2WAMA 3OE1A 2FMTA 2C4TA 2P9CA 4U02A 3GA5A 1XFDA 4YS6A 5ALVA 3GGJA 2QVZX 5FPTA 4AN0A 1I6KA 4PTLA 3DBOB 1XZFA 2BGKA 4FFBB 5HZMA 3OQBA 4YHHB 5TMDA 1BYUA 3ESAA 3DUWA 2Q5OA 4H3VA 4MW9A 4JUFA 1DMRA 4OMFG 1MJFA 5DWQA 1WWKA 5KYGA 1HQDA 4ZREA 1RM0A 2H0AA 5DFAA 1MB2A 1C3VA 3KSRA 1VCHA 5M3BA 3M1AA 3M6IA 2RHGB 3LFOA 2FUEA 2G4CA 1BCRB 3IL2A 5JQGA 4F60A 3BUSA 5AW0A 3LYLA 3TDNA 1U8YA 3D8RA 4U6SA 1M2HA 4QU9A 4L76A 4E11A 3AM4A 2UXCO 4IGFA 1BCSA 3VOSA 3O7WA 4A0QA 5LWQA 2PRKA 1NH2B 1ZJJA 2IEZA 3FYEB 2H31A 3MS2A 1JQEA 2V0CA 2BGRA 2YJ6A 4NK4A 4DF3A 4HZGA 3W8NA 5B3JA 2GBPA 2ZM5A 1HLPA 5ALPA 4CF3A 2XCRB 1GL6A 2QXUA 1JU3A 4KQEA 3KTFA 3FRHA 3RF6A 3ZRVA 2PU7A 2VBIA 2QTOA 3UHAA 2BFCB 4B45A 4I9QA 3ETDA 1Y33E 2HLHA 1CJKC 3M1IA 1IAVA 4HLCA 1VIMA 2QMEA 4FGKA 1NJ5A 1R8XA 5DYTA 3G2PA 1DCFA 3H1HH 1N9KA 4WZAB 1C7IA 2E7ZA 2X7RB 4V2IA 4FMCB 2IXEA 4ICGA 3L04A 4KIWA 4MAAA 3LQKA 2JKYA 4ENTA 3G8BA 4HAVA 4O3FA 4M60A 1T9AA 1GAQA 2JPDA 3WYNA 2VUSA 4QDJA 2XMQA 3VUEA 1CP3A 4C4PA 4NBUA 2XE7A 2H4YA 3G1WA 1T1JA 5J23A 3DEFA 2BP7A 3AHGA 1N75A 3VCZA 1Z2EA 3C3KA 4DR2B 1COMA 2W90A 4H0NA 1CK4A 1J24A 3U49A 1C0IA 3O1LA 4CG1A 2L19A 3E61A 4XGKA 5JLJA 3M33A 1I2MA 3MIIA 5ECDA 4V24A 5EPOA 3G79A 4EFKA 1K2WA 3OZRA 1MA1A 3Q3HA 2G0NA 1FNMA 3LA6A 1IV1A 4WHMA 2J45A 1M8GA 4CMJA 3WYFA 3DFZA 4D0GA 5LA6B 3MWEB 2IGTA 1OTXA 4LOIA 4IY1A 4UTOA 5K3FB 4BJHB 3FTQA 3SQDA 1NT2B 4W6ZA 1SKVA 1QDLB 4J4TA 5HZGA 1JJAA 1JWBB 3DLPX 4D57A 3H9JA 4UDXX 3M7IA 1SKYB 1DJQA 1WB7A 5IM4F 2Q5HA 4TMWA 4WZ6A 4D4KA 1K8XB 2BM0A 1C0KA 4I8XA 2UVQA 3TIVA 4MTXA 2ZYWX 1QG0A 4H1UA 4KBFA 3HJNA 1PL6A 1JEQB 4KXLA 5LLSA 1OAOC 2X76A 1OI4A 2ZROA 3PQ6A 3EMVA 5DGXA 4C0HA 5AVYA 5KA5A 4PPGA 1NTOA 2CD9A 1MFPA 5JYBA 4E5MA 2F9ZC 3C6YA 4EFMA 2FOXA 5AQ1A 1SB8A 1HKUA 1C1DA 2HWWA 3HU1A 3TIIA 4RKYA 2Z4SA 4D9JA 1X8LA 4K88A 3L06A 3PQEA 3WLFA 3H16A 2XTAA 1A2BA 3O4GA 5DYIA 1ZYUA 4TT3A 2H85A 3C3TA 1Z3CA 3D59A 4ZTBA 3MSCA 1MCZA 4CEJA 2E48A 1VL6A 5LYJA 5KTPA 4B7XA 4DUGD 3SDSA 1H7MA 2AG5A 4EY4A 3U1TA 2P30A 1DOAA 4JI6B 2OHJA 4AMVA 4AY4A 4KL1A 2VDJA 4B2IA 3JVEA 1B14A 1A9PA 3IV6A 4CF4A 4OHCA 3FKJA 2ZWOA 2YVUA 3JR7A 3ANLA 3T7TA 3I76A 2DPGA 4W6QA 1MABA 4V0OA 2PBFA 4HMPA 2XT9A 4BFTA 3RK4A 4RQBA 2WK1A 3DZCA 3BGIA 4CF5A 3MJVA 3QXXA 2PVPA 1SUSA 3JQFA 1I4EB 2B5WA 3TZHA 1P1KA 1F8UA 1AJPA 1KERA 4KX3A 2XODA 4ERXA 1ZMXA 3IKMB 5C9ZA 2IYLD 5ICGA 4D41A 4ABYA 1XOUA 1IULA 2Q8VA 3VNSA 1AQNA 2QMQA 1DIOB 2IUTA 3RYTC 2KGWA 4GIBA 2X1LA 1YVUA 4LJSA 2DKNA 1ONIA 3ROQA 4OJKA 3KJJA 2E4UA 5I8PA 2FCAA 1AKRA 3IEIA 1W5AA 1U40A 3L8FA 2XWQA 2PU5A 1AQ6A 3MJ4A 5AVVA 1P4RA 3GRCA 4E6EA 2QWNB 3E18A 3GFBA 2PF4E 2BYTA 4P31A 3X1JA 4R0NA 1DO0A 3SHQA 4QDXA 2C5EA 5JARA 4RPCA 1E3JA 3ZIUA 3V2HA 1KPGA 2HMWA 4V0KA 1NE7A 1T5HX 2V1DA 1N2HA 3OM9A 2N48A 3ONDA 3T7SA 4YR7A 3L74H 2P0YA 2KQXA 2YFHA 4RK4A 2GRUA 4P2BA 2GYUA 4F92B 4FX2A 3KOWA 2HVYD 4PLGA 5IHPA 1HR0O 4S12A 1C50A 3BIFA 4IW3B 1QTIA 2NU9B 2YSUB 4BTVA 4GVXA 1ZRNA 2MU1A 1D1QA 2OBNA 2PFGA 4BV9A 5DSZA 1QAMA 1NV8A 3ILHA 4E31A 3G49A 4JGBA 1BE1A 2A4KA 2VJBA 4P22A 1T9BA 4MPDA 1GNPA 4RKQA 5TLSA 1SIBE 4QOHA 4EZBA 4IXTA 3MS4A 1XNRB 5DH9A 5CEEA 1RLUA 1XV5A 1EUCA 5FUXA 3FTEA 1E3WB 3CCJF 2QP4A 3N28A 4HUQB 3FYCA 2R6AA 2MHCA 1W9MA 1JAYA 3A3PA 2XB9A 5B1BB 4AJJA 4AKSA 1I5OA 3CBGA 3K04A 2E18A 4S1PA 1KVQA 1VQ9V 1Z2DA 4LRYA 4KK4A 4XR4A 3EDCA 5T4BA 5KX5B 5JSKA 3R3UA 4KEAA 1PZNA 3C6QA 3NJ8A 2QB5A 2I71A 3B8MA 3MGGA 3EPJA 1DX4A 1F06A 1Y66A 4V0SA 2B1RA 3Q7PA 1XCBA 1TAGA 4G01B 3C16C 4DLAA 3QFHA 4KXUA 3G7NA 4IOKA 1TTTA 3P20A 4FFNA 4HRVA 4UPDA 3TD3A 1PP4A 1VE9A 1Q95A 2GWRA 2ORWA 5GMOA 2BZGA 3MA0A 3KRTA 2PFSA 3MMPA 5FWNA 3E9QA 1R0KA 4F4DA 2ASEA 4B09A 4AXBA 1YZYA 1TMKA 4UUQA 4L57A 5C5IA 5E9WA 2R87A 1KFCB 4X5OA 2QM7A 4I7ZB 5IBRA 1V3VA 1S8NA 3UICA 3WBJA 3OLXA 1VLZA 1E6UA 16PKA 4QQNA 5MGNA 1TAEA 3QYAA 2ZVYA 2J46A 3NAZA 4JWTA 1PZXA 1DMSA 4UM8B 4ARSA 5KLVH 1E98A 4YUWA 2YIDA 4KI7A 3OQMA 1GUZA 2PX5A 2M98A 1R50A 2BE3A 3IR5A 1AJQA 5CTJA 4YP7A 3AFGA 1O87A 1FXUA 4QC2A 2IIVA 4Y2GA 4FONA 4KE7A 2XUZA 2ZKIA 3SIPA 1ODFA 1NYQA 1RACA 4NYIQ 1J1UA 4XCVA 3NXKA 2Y4NA 1XNQB 1G3UA 4F97A 4KDFA 1Q22A 2QG9A 2WM9B 5FD8A 4D3XA 3PCTA 3VV3A 3I1IA 5MFZA 4F9TA 1BG6A 2IYNA 3AR9A 3RVNA 1JIXA 3HKDA 1CY1A 3LUDA 2BLLA 1KQSF 4FXOA 4K0RA 2C8KA 3DXRA 1JSLA 5IT5A 2FEMA 4UEOA 4XGIA 5FLYA 1C1HA 4XJVA 1JAHA 2HA4A 2G1PA 1H94A 3NCHA 4LWZA 1SO8A 4DLPA 4FNAA 2EZ9A 2Y1EA 5ANRB 1TT5B 3KTDA 1QVVA 1WCIA 2WB2A 3JTMA 3LVFO 2P9HA 4ARIA 3DBLB 1Y76A 1YZUA 3UM9A 1ZNXA 2NG1A 3SJ7A 3T5MA 1Z62A 3GAAA 5BQ3A 3FWKA 1I36A 3HC7A 5CAEB 3K0BA 3QVGB 5J5VA 3T7JA 3SVLA 1R0YA 4WIAA 3E8GA 2E55A 3GDOA 2VSFA 4BP1A 5EE3A 4N0EA 2RHOA 4JDUA 4YC7A 1O3YA 2REQB 1QIGA 3QV2A 4JF3A 2G5PA 1SG9A 3OE7D 4CFSA 4KR0A 5TE9A 4H1TA 5H3CA 1ZK3A 2UYQA 3KE1A 3EXFA 3RSOA 2IEGA 4KQ2A 5F3RA 1CRZA 3T5BA 2HF7A 4NZMA 3E5HA 4N5LA 4P7FA 2O2ZA 1AZLA 4RD1A 5LHIA 2PT6A 3LGXA 3KJKA 3TDKA 2Q8QA 1AN0A 1J09A 3IHTA 1APBA 4HGZA 1T24A 3AWDA 2N74A 5E9AA 1D6MA 1Y6QA 1C3EA 1MO6A 1WM1A 3G2KA 1BVYF 3Q7RA 4NAUA 5IDYA 1J8FA 4RQTA 3FB5C 3W04A 4BVHA 2L6LA 4FQ7A 4NCXA 1HZJA 2PGIA 1TUEB 2A88A 4BXOA 1TB4A 4RV9A 3PFFA 4QSHA 2YINC 1QRRA 2GF0A 4FHGA 1VLVA 5J2TF 4NOMA 2GYVA 5BWNA 1T5TA 1K6JA 3C3YA 3ZLUA 5TPWA 4N8EA 2I6XA 2F3QA 4K8XA 5HIJA 2FKXA 4NBWA 3EF0A 2WLLB 1B04A 5FWYB 2O8CA 1Y5MA 5HY1A 3OEHD 4N65A 5E6RA 4UM9D 3HB5X 4CKWA 4TS1A 3SZOA 3WL4A 2OCXA 3Q88A 4ZI2A 3FDJA 1BHQ1 4QM6A 4KBGA 3OURA 2P3LA 1E3DA 4HEHA 4Q1BA 2ZVDA 3HY6A 4IRMA 1CHNA 5DEIA 2G1AA 2D2CB 3RRYA 5AR1A 5FLXM 1B0ZA 1A1VA 4X7PA 3OMNB 5LHGA 1UKBA 1RAGA 1CTQA 3P9PA 3OOYA 1LDYA 3KJHA 1TUBB 1EJ6A 5CB0A 1DWOA 2G0TA 4AJHA 4YT4A 3R7WA 3AUXA 3K73O 4QPNA 1TIPA 3ZCVA 4KR9A 1A5AB 4B62A 7AT1A 1MJGM 5ETJA 1KH2A 2A9VA 3DZKA 4DYDA 1LD3A 4ACAA 3PKJA 4MCHA 4IYIA 4F8JA 3VYVA 1ABFA 1AVTA 3GGSA 3O8RA 4TLMB 3B3QA 1L7BA 3ZDYB 1X7XA 1JMKC 1X38A 4BLSA 4F85A 4ZIRB 2IX9A 3D3KA 4MRAA 2G67A 2WE8A 1IXZA 3WRWA 1VIAA 1S76D 1ULSA 3TNFA 4ONEA 3I3SR 5EJ9A 4FKBA 4YPOA 1UR5A 3PB3A 1Q6YA 3O95A 1FFTB 3DV9A 3ESRA 1U2DC 4UUAA 5EJGA 4G1EB 1JHUA 3RSSA 3OHMA 4LOAA 2AEJA 2Q6TA 1DRWA 3HR7A 3C3XA 4AO7A 3LO8A 6YASA 2BBWA 4M8IA 3RJMA 1ACJA 5FB3A 3VSAA 1XQ6A 3W6OA 4DBLE 4M7OA 4HFRA 2ZUCA 1XTBA 3ABZA 5CFMA 1NBWB 2Q21A 2P06A 4Q03A 1AV7A 3CNHA 4JQSA 4LX8A 2O1WA 4AUMA 3CUTA 3L4BC 3KXLA 3T3GA 1KBQA 4X7MA 2IYZA 1M4UA 3RWOA 1HNWO 4CV1A 5JJNB 3OX4A 2OCCB 5GIPC 1G3IA 2HFJA 4JJFA 1X70A 2A86A 2QTBA 4B80A 2VN8A 3K09A 1CJMA 2CBXA 3AR5A 5AI6A 5E4JA 4FGSA 1CUSA 3MNFA 1L7RA 3GJ4A 3PDWA 1C7JA 1NZDA 3ZY2A 5B5EZ 4R7TA 4G5FA 3PL5A 4IDCA 1ENPA 4MVJH 3FPSA 4EL0A 3QNWA 2O1XA 1RHQA 1H3EA 2AMLA 4CM6A 1UBOS 4V1CI 2LE0A 2HRZA 2WJ3A 4FI3F 4RDHA 4XIYA 1W2BU 2WOOA 4M7WA 2WSSA 2GWHA 5BT8A 4OOEA 3MWKA 5EXSA 3U4GA 3ORHA 2DQ3A 4G26A 3UUEA 1TJNA 1FOEB 1MTOA 3H11A 1TMOA 2Q62A 3AWIA 4RHYA 1W6RA 4AD8A 3E9YA 5HGXA 4MJ7A 3UATA 4AICA 1ENVA 2Q3HA 3AF1A 1CNMA 1C8BA 3K9QO 2IDKA 1ORQC 1B23P 3L4EA 3VYSB 4JY7A 1JQ5A 2C95A 4KC0A 1ZWZA 1M5IA 3ZK8A 3Q11A 1OWMA 5FRDA 3NKFA 4G56A 5LJLA 1V45E 4QRDA 4HADA 4Q6WA 1XTUA 4ZBMA 1YS4A 2QRNA 3CC2F 3PLAE 3DTNA 1Y8ZA 1HY3A 1KI8A 4W7IA 3D36A 3D6AA 3DMHA 1DQZA 1Q1AA 3AFHA 3ZU3A 2DY1A 3JQ8B 1N2IA 4IJ5A 1F3OA 3SYOA 3ZWKA 5K6TA 4EJ0A 2DKOA 2YMQA 1Q7CA 4HZUA 1PW7A 4QFBA 3PXCX 4E70A 2GM4A 3A6JA 5HOQA 4EJSA 3KPYA 5TF0A 3MTJA 2Z1DA 1JDBB 1LDMA 4IJMA 2WC1A 1HYQA 3OKCA 3WQRA 1S89A 4FPPA 3SXJA 1W4CA 2R5FA 1HYHA 3ER8A 2ZRFA 4J7ZA 3DFFA 4M9ZA 2XKBA 2LD4A 1HC7A 4KBYA 1XCPA 4WX2B 3NVIB 1DQSA 1GUBA 5CUQA 2EJUA 4L74A 3FWPA 5F33A 4WTOA 4O4JA 4EENA 4C6TB 1M6VA 3V34A 1IJFA 1KOGA 5JH7F 4I2VA 2AZ0A 5CVUA 1KYQA 3TWOA 3QMWA 3QJGA 3U7QA 1AQYA 1TU4A 1X4TA 3SF0A 3P7MA 3SIVA 4EX6A 2VQFO 3NHFA 2P9JA 1AOXA 2Z9BA 5BNFA 3QE9Y 2C9ZA 4PBTA 4JKOA 3LXRA 4M1WA 1YQDA 3C7DB 4YJ2F 3CSXA 5BXQC 2VSQA 4X1KB 3V7UA 1ZXBA 1ADFA 3JQ9C 1L5YA 4K8ZA 1N57A 3E81A 3B89A 1BAPA 2YFQA 3EVFA 4IWNA 2CDBA 5B5SA 2VYFA 4C1NA 3FIJA 1XKTA 4S0XA 2JK5C 3I92A 1XYGA 3LCCA 1F4VA 3NTLA 4S05A 2B25A 4M3NA 2POQX 3R3VA 1T6ZA 4LF4O 1DC4A 2VZ9A 2WTMA 4RSHA 5H9VA 5A6SB 3D2BA 3EZLA 3KT6A 4EQZA 2UZ4A 3KLMX 5LP6B 3D5TA 1V25A 2EU8A 1H2GA 1VMAA 4M0MA 4R1OA 1W5FA 3IPRA 3QFSA 1HLDA 4WVFA 5IYZF 1LPOA 3LWPC 3T0IA 3QOFA 4XQGA 2VOJA 1WLEA 2V4MA 5JDCA 3WKBA 1IN8A 4FDVA 1N6KA 1UBLS 1X8JA 5DNAA 1ZUNA 4UB6Z 3MCAB 1R3DA 3L7IA 4E4TA 1R1DA 2FSHA 1ZOLA 4X3LA 3TRKA 4D4IA 3AEUB 4JITA 2WUGA 4JC5A 4EFBA 1BDBA 1HSZA 3AEYA 5CBFA 4A9AA 5B2EA 4MNTA 1U5BA 5J4YA 4DA6A 9LDBA 1S3JA 2Z5UA 1AKVA 4C4XA 4Z4QA 3QEBZ 4CF7A 4BNYA 1H1LA 3T95A 1UP7A 3R0VA 3PK0A 3RS3A 4ZVOA 5EL0A 2Y27A 2JLRA 3GQBB 2H1HA 4D96A 3K14A 4RZIA 4N47A 4DV5O 3L07A 4RXMA 1RI3A 5LDGA 4FHFA 3H75A 2HG5C 4JHXA 3WLHA 4OH7A 3H8SA 5JQWA 4JQCA 1WCV1 2QU8A 2CL6X 2I4IA 4GWKA 3FAKA 1CUJA 2VZEA 4LY9A 3THSA 1SBCA 2FCRA 4ZU1X 3LO5A 4V0NA 5FUVA 3H19A 1QYRA 3IUBA 1MV8A 5AKGA 2GR9A 4ZVNA 2YV4A 4IH4A 2FNAA 1I4OA 3HSKA 4B44A 1N2CB 3ZRSA 1AXRA 4TYPA 3X2SA 3OONA 4JBYA 2P11A 4R6XA 4YAUA 1GM5A 4MQEA 5JD6A 2QE7A 3DKKA 4R1SA 3C43A 4ZKDA 1K4YA 3QO8A 4EG7A 4FE4A 1Y4ZA 3LZCA 4EPWA 1XZIA 2Q4DA 4F9EA 1XDSA 2ECPA 1RJEA 3OEEA 3CCQV 5F2OA 1L4HA 5TVKA 1WDTA 2BRUC 1J49A 1N6IA 1UKCA 4L9RA 5DTEA 5T5QA 3Q7QA 2EVWX 1R5OA 1CXZA 1EGQA 3E22B 2I2WA 2FN7A 3QGMA 3TO5A 2CJWB 1EVKA 1KJZA 4K9PA 3CCVV 3IQIX 2DBZA 3TI7A 1UBFA 3M9LA 4C88A 1XN4A 1XDUA 5BRNA 5IZCC 5AXAA 3GZ4A 2A79B 1C5KA 2NM0A 4RTKA 2QUIA 2FL4A 1BDIA 3GLRA 4GZ3A 3AG6A 4ZYVA 1KSFX 1UFIA 3B53X 4QE9A 1YA4A 3THXB 4TQFA 4CDMA 2H0RA 4RANA 3NUZA 4UB8Z 4L9WA 1VBMA 2FPXA 5KHOC 1W8IA 2HS0A 3B78A 4ZANA 3LCMA 2D2XA 3HUEA 4GM4A 4OQDA 1V41E 2N3ZA 2H1CA 2ANCA 3DBHB 4X65B 4BMYA 4PC6A 1Z3IX 4TYMA 1QIEA 3HACA 5LLDA 2AEFA 4TQDA 2OIEA 3HLTA 4LAFA 4LJ4A 2AFHA 3FSJX 3F6RA 4D8UA 3P9KA 4RTMA 1C9NA 4JJ8A 4MXDA 2WWVD 3AL3A 2BFDA 2Q69A 2G28A 3E2IA 3FOZA 2R1ZA 4GNKA 4PDLA 4TT3D 2CHQA 3WWPA 1EXDA 1M1YE 1GTRA 4YIOA 1I0IA 4DLLA 5DZSA 2VJAA 3FUCA 5CRIA 5JSHA 3ABRB 4D99A 4FLVA 3TETA 2Q50A 4RV5A 4LJKA 3BY6A 1KH3A 1FYWA 1RWXA 1E7MA 4MUJA 1J0XO 1D7OA 3LCUA 3S1AB 3WHKA 3ZN2A 3RK1A 3FD9A 3MMXA 3PI6A 2Y0DA 3NIBA 4F3RA 3QVLA 1GSHA 2G9IA 1GGFA 3E3MA 3G7UA 3HJAA 1CS0B 3IIEA 4M6WB 2QL5A 4ER7A 4M4SA 1ACLA 1YH3A 2YRXA 1YDWA 3IVXA 4MJXA 3THYB 3JCUZ 3ZZ1A 1VIDA 1KC3A 3CNBA 3BCHA 2WWTA 2BJWA 2J9RA 1ISRA 4U2KA 1XHEA 1USGA 1O95A 1NVPD 2AFIB 1M83A 1VOTA 4WF9V 1LX7A 1KMCA 1UBCA 5BP7A 2AGAA 3PJDA 1EZZA 4NICA 1JVBA 3IESA 1CF9A 5TSDA 1HYGA 1L1EA 2ZYDA 2GJ4A 4RQAA 2COEA 2ZYUX 2VJLA 4RFSB 1N4DA 4QATA 5GINE 1S5PA 5JE8A 1FB5A 4E13A 1GTL1 4PAWA 4PZ0A 3FPJA 4DDMA 4OUDB 2X0LA 1DLBA 2F1OA 5FNVF 2XW6A 3I4FA 1VP7A 2GBIA 4H7EA 5IWCA 2G76A 1TM4E 3ZZNA 1DRKA 3E9CA 3B9BA 2CK3A 3HXLA 4QIHA 2YZKA 4KHPB 1OCOC 1YCFA 2ZYVX 2HJSA 2RGWA 1HG0A 2OZBA 4MZXA 1D9XA 1DI0A 5HQTA 1NBOA 3OFJA 5B4UA 4YRAA 5HRAA 4IUBS 4HX9A 2ZIUB 5B36A 5K0EA 1H2RS 4TYQA 2BUAA 3AKZA 2CSXA 4RYDA 2LNDA 3ZZMA 4GU5A 2A0YA 3IT1A 8MHTA 1E9FA 1YDEA 5CB4F 4IHAA 3LL4A 1R7RA 4LOHA 2GESA 4DEYA 2ZE6A 1NQUA 4M8LA 4NHEA 1SHLA 3LKBA 2JD2A 3WGVA 2XE4A 4L3VA 4N6NA 4YCNA 2J9YB 2H5JA 4M83A 2W6ZA 5TIIA 4JJZA 1I3OA 4B4DA 2WLKA 2NZUG 1PNLA 5K4GA 4B31A 2JC3A 2DPXA 3S6JA 1E1LA 3ELWA 3L1VA 3EQ2A 4TSFA 3D8NA 2B61A 3HYCA 3LFUA 1NSFA 2IRWA 4BNUA 3WI7A 4JKYA 5HCUA 1HKHA 1AM4D 3HB0A 5J4LA 5IF9A 3CCMF 2HMAA 2VPXA 5A2QM 3VKUA 1P3JA 3EIWA 1VQ6V 3FMPB 5DDIP 3ZWVA 5CH3A 1LSOA 3IQDB 2RJZA 4GPEA 5I3ZA 2XUGA 4CRWB 3AP1A 2BSQA 3WPXA 1N36O 3O4FA 4EA9A 3K71B 4Q20A 4P93A 1KEUA 2Y1FA 4HDRB 1YEWA 2VP5A 2B4RO 4DQDA 3ZQUA 3KKZA 1Z5WA 3QO5A 1SZQA 2YX1A 2W2LA 5GONB 1KQPA 4JAVA 3RUDA 1XXLA 1DLJA 4FYPA 3T1TA 4AM8A 2DFLA 2IJHA 1YJ9V 3MJEA 4HC4A 5IJZA 1O0BA 2XOKG 5BY2A 3WYDA 2OO7A 3CVOA 4JT2A 4Q3OA 4PN3A 3OEHA 4FYKA 3S2UA 4QOGA 3QNUA 2PL1A 1XNGA 3EVEA 2H2HA 5G1OA 1ZX3A 2CAZC 2LDBA 4WZBB 2GX6A 4P4SB 1KC8W 2PO7A 3Q2IA 2YASA 5CVDA 4XZ3A 3OQVA 3BJEA 3QLVC 4JP8A 4EK9A 3O2JA 3GGCA 4XUEA 4D3FA 5EWJA 1ZJZA 5CDFA 2ZAMA 5FPKA 1SCUB 3DONA 3N05A 3W7WA 4X41A 1BOOA 3KQSA 4DM3A 1WNSA 3ECAA 3JASB 1DKOA 3AM3A 2DHEA 2VHEA 4HGRA 1F2TA 4KWIA 3DNFA 1PEDA 2QA4V 4KE6A 2DRIA 2VH2A 4RA6A 5BQXA 3ZS8A 2H29A 4HXYA 5F12A 3D01A 1TLFA 2DHQA 3O47A 2C8LA 3AB8A 3T5AA 2PXHA 2Z6UA 3NT4A 4H1VA 4MYUA 4JQOA 4FQ8A 2WJIA 3UMYA 3UXHA 4CU2A 3VHLB 4JOSA 2ZLBA 5EE9A 1NASA 5FWDA 4O2AB 5DSTA 2ZR7A 4HGPA 1EVQA 3E5NA 3ESDA 4LBZA 3SC2A 4JWKA 2AZDA 4OJYA 1VI5A 3B9QA 2JGDB 4KQFA 5EMNA 4P58A 3LUFA 3P3PA 4X66B 4X20B 4B75A 5J3JA 3ZMSA 2C54A 4A2WA 4LQ4A 3VSBA 1W1IA 4ZTZB 5B3KA 4KYIB 4MVJM 5ERXA 1LRLA 3VPHA 3UUGA 4PYOA 3PFBA 2CLIB 1NBHA 3ADDA 1ZZEA 1VCIA 3OU6A 2PTGA 2AN1A 1EFCA 3KC2A 4EG5A 1P0CA 2IE0A 1K88A 2G5GX 3VR4A 1JLRA 4KP4A 5NULA 2IKQA 3B52X 3PQ2A 4WKOA 4HLUA 4ES6A 4EPXA 2OBXA 3L5KA 4FYXA 4CUKA 2ISSD 4OFXA 1I8TA 4MWDA 4FNOA 1M8PA 4YWHA 3FSEA 4IF4A 3SEFA 1PRYA 1FBTA 3OPYA 4HNHA 2O3RA 4E3WA 1G2IA 1ZN9A 3M3PA 3CWQA 3FROA 3OTOB 3GP8A 1WZIA 4MAFA 1XL4A 1OLUB 4Q1DA 5KJ1A 1G16A 2Q2NA 4NPAA 3RAFC 3CEAA 1DX9A 2B5OA 5CX4A 2HDNB 3OZVA 1X3SA 2XDQB 3WGMA 2Z2YA 5FYQA 1C7QA 1NTZH 5I47A 5ECYA 5KINB 4NV1A 4W7SA 4O3MA 1BSMA 4DJDC 2X8WA 4DSOA 3TGLA 3DL2A 4C0SA 4PZ9A 1DT9A 5P8WA 1EFUA 1SHKA 3ZTYA 4HDSB 4F2WA 3ZJUA 1N0UA 2Q8PA 4U2FA 2GEKA 2Q5CA 2JJ2G 3GNQA 4PXSA 1JDSA 2IDMA 4ETWA 2GUZA 4EHDA 1FJXA 3DYVA 3MTIA 3HKCA 5DHPA 1SVLA 4LZWA 3TLGA 3J7AR 1G9TA 4ZZ3A 3LK7A 3HU3A 1NTKH 4P2ZA 1N1GA 1U43A 4BDTA 2XYPA 4DLYA 2NUPA 4TWBA 3OTHA 1FW6A 2Y1DA 4GKJB 5J2UB 1KJ9A 4DHEA 3FLAA 2NPFA 4LC1A 2QM3A 4UC0A 4XB1A 5GINC 2BD0A 1MVLA 2V7PA 1WDKA 4YV1A 3DLTA 2OYCA 3RI3A 5DBHX 1OZ0A 4DV2B 1RPOA 4KNWA 3HCWA 4LDQA 1DQRA 4Z0TA 3NDBB 4FSXA 4CUJA 4KQGA 4B43A 5CFZA 2DYKA 4U7TB 1BU5A 5ALFA 1YRAA 3HJHA 4AYWA 3OTGA 1SRQA 4IOLA 3TSAA 4BVRA 1N8SA 3NFRA 3T1CA 1OI7A 3LWZA 3MT0A 1CD5A 1JFLA 3WJ7A 4FZ3A 3T0GA 1JQLB 3KKQA 2D2IA 2V9PA 1QX4A 2OD7A 4IIJB 1BOFA 4GFDA 4I50F 1IH8A 2KG4A 3R3JA 2AA3A 2UXXA 1BIFA 1F3LA 5A9SB 4KAXA 4M1TA 4JA0A 4JBXA 1E3TA 3COYA 1KVTA 4YT2A 4UDOA 4RFVA 2PSJA 3R44A 1D5CA 1W4ZA 3KWJA 1RHMA 1FDOA 3VR1A 4FJ0A 2II6A 3R3SA 4G24A 4DMFA 3CJHA 1M73E 4KPUA 4G88A 5BN4A 1XU9A 2GI4A 5BV7A 2IV3A 5SZJA 3VO9A 1CQXA 4HAOA 4LCJA 5DULA 1A2KC 1SXHA 4CQLA 1K75A 4F4CA 1ECLA 2FPGA 4AZ3A 2Y0PA 1PNMA 4WCFC 5AHOA 1GRRA 1ECFA 4FK8A 1L5OA 3FPHA 4TZ6A 2AQ8A 2Y69B 2QUHA 2I7VA 1GN3A 1II8B 4UOZA 5LMZA 2WSSD 3BIWA 2O6HA 4C20A 4JLJA 1CY6A 1D8AA 3E89A 3AI1A 5G0WA 4DA7A 3UMMA 3GPDG 4H1WA 1QRTA 1E5LA 1KMHB 3ZV7A 3STZC 1GL7A 1KO8A 3E3NA 5FHRA 5E38A 1OXKB 2XNHA 2X3FA 2H8GA 1UT8A 4F11A 4JK3A 1QPBA 1MGPA 3RK0A 1DIGA 1YDGA 2HWUA 4U39A 3QU7A 1OI3A 2VJMB 3MQWA 5C1DA 1KKDA 2CFCA 2DPHA 2BEWA 3R0XA 3K4HA 1XMIA 4EY7A 4GUAA 1PJLA 4QO8A 1CUZA 5BW4A 3OF2A 3T3IA 4OY3A 3EXEB 3SHFA 4JR1A 2UZ0A 1NI8A 3FBAA 2C4VA 4IMJB 3U4CA 4Z4IA 2ZCJA 4YJ3B 3TG8A 1Q0QA 1ULTA 2BMDA 4PIMA 2XMCA 3Q3IA 4OQQA 4BFXA 2IYYA 5KQGA 4IEIA 5LNK6 5CK4A 2B3TA 1J20A 1UPBA 3AESA 4PBSA 2BGMA 4CYMA 4JT9A 2F93B 4C6RA 1XZJA 3BMNA 3V9AA 1KSJA 4CH3A 3NJRA 3A7EA 3BD6A 4NATA 2MK3A 1PR5A 5KTMA 3JVDA 3WVNA 4BVEA 3NIFB 4GSYA 1S7GA 3A26A 3W2GA 3L6DA 2XB8A 3FSGA 1Z16A 3IMEA 1POXA 3D8SA 4RZSA 1WHSB 2BFFB 2Z4TA 3ITNA 4JI7B 3MJDA 4IIFA 3K6SA 2AOTB 2E49A 7ADHA 5TQVA 2A3NA 3JYLA 5GTDA 4E7PA 4ZV4A 4W4TA 3IA2A 1G5TA 3NHRA 1NOJA 3GRZA 2QLNA 4KK3A 1JNXX 2UV8A 3IDSA 5DHSA 1KD1H 4WEQA 2A1UB 1UWKA 2ITDC 3QE4A 4Q7JB 3RNLA 3VZBA 5IT9A 4IHJB 3THWB 1JE1A 4I8DA 3AHFA 2QK4A 3BREA 2OGTA 3SAJA 2I0FA 1AG9A 3PENA 2ZDIA 1PNVA 1Z5VA 3EUWA 1Z35A 5I9TA 2IH3C 3OBWA 1LW7A 1MOZA 1MZVA 3Q5GA 4EJ2A 2BGGA 1WCWA 5JXJA 5E4TA 2Y4UA 4TLCA 2FDRA 3HEMA 2PMDA 4G2TA 3G9QA 3IBFA 3EUFA 1YD7A 4AQDA 4PG4A 2RMKA 5G02A 4ZEOA 3GEMA 3OOHA 1THZA 4RETA 2W2NA 3QHQA 4EG3A 1E8NA 4D82A 4FT2A 3W3ZB 1EPUA 2AQHA 4GP6A 1L5RA 1HT2E 4PZEA 4RADA 1PVOA 4KAFA 2YXNA 3GIWA 3TQQA 5K09A 3TOVA 1IDSA 1RI5A 3S1SA 1QNLA 2ZS7A 3PLRA 4QNNA 3DOUA 1GCGA 1MAVA 3DBIA 3CQ9A 1ZHOA 4ZOAA 5L3ZA 1LCIA 1UXOA 4WLOA 3AETB 3OJFA 2CLEB 4K26A 1GN6A 4JTDB 1TCBA 1RJGA 1DNPA 3Q8WA 1T0IA 2OXRA 2WWHA 4IIVA 4MWSA 3SYQA 4IV0A 4RKWA 4QBTA 8ADHA 4PGAA 5I6DA 1YULA 1Z7WA 3CSUA 2GYWA 2CTPA 1KO4A 2XIQA 4Y7DA 1VMEA 2C9MA 1DBVO 5JVDB 1XLTA 3ETJA 1SKYE 3DJFA 3ED1A 4OXYA 2WLIA 2Y0EA 4WY8A 3UW3A 5FAKA 3PEVA 1HUQA 2CCKA 5CA3A 1O9BA 1YBMA 3L6UA 1GSIA 2OYSA 2P2LA 1GQ2A 3H5TA 3PIDA 4PWTA 2XADA 5G4UC 5AHWA 4MQ6A 2WIAA 1UC4B 4NLLA 2L18A 2Q3DA 3GBVA 1XZDA 3LRTA 5JG7A 2GHIA 1AKUA 3RIGA 3RUCA 4Y1EA 2B7BA 3ZN1A 2CZCA 2DBVO 2B8JA 1I32A 1OXBB 1NW6A 1SIOA 4WNCA 3LYAA 1X7DA 3R9WA 3JSLA 2QE7D 1CC1S 1D09A 4IGIA 5IVPA 2I4RA 5BT9A 3KZIZ 3UAXA 4PPYA 4LSZA 3OEED 2WY2D 1VHTA 3I3FA 1OMOA 4FKZA 4S1VA 3HUDA 4G81A 3VTZA 4F86A 3LWRC 1ZMBA 2BHTA 1GO0A 1ILWA 3ND8A 5DMHA 4BCDA 2EGGA 5E9QA 2AXNA 3CPQA 2NYVA 3TVTA 1G4UR 4U00A 1XMOO 3DFUA 2I29A 4JTAB 5AUOB 4TWZA 1P2DA 1I7QB 1QUFA 2B5VA 3VH1A 1S1MA 1B42A 1ORIA 4JV5O 3TEJA 1XRNA 5D87A 3ABLC 1YKSA 1HORA 4DM7A 1X8XA 5A5EA 4BNJA 3DCJA 5ULLA 1D1SA 1Z6GA 1BXRB 4RHXA 2MYPA 1DBPA 4BFZA 1T26A 4NDNE 4I9NA 2GN2A 2OTLV 3MGKA 1ZWIC 2Q6AA 4Q7KA 1ZEMA 3RT7A 3S8EA 4RVDA 2JEYA 4IYHA 3R5JA 1A50B 5E6UA 4B6SA 5AVRA 2OGZA 1TYDE 1H69A 4BVKA 3ANXA 2XQGA 3KQTA 2XE6A 4OXXA 1P8JA 4KP7A 1RM5A 1MEOA 1ZCJA 1YVRA 1W3EX 3LE8A 4RELA 4EJ6A 4KAAA 2FKNA 4QNRA 2OCYC 3FNFA 4DIFA 4U7GA 2XR1A 1AY0A 3VZDA 3CE6A 2Q7OE 1M0EA 1FRZA 3HKEA 3O85A 4A5UB 5TVGA 1ECGA 1UDWA 2WICA 1I4WA 1NAIA 1ZTEA 4UV8A 2R6CA 1X52A 3EEBA 3LY7A 4ZAWA 1TTQB 1VPDA 2OWEA 3H7AA 1DOHA 4PG5A 2Q4PA 4EVIA 1NR7A 2D5CA 3FYTA 2F17A 5K1PA 1GZ7A 1UDCA 1T25A 3TPCA 3O0DA 3STWA 1VE7A 5IM4A 2RHHA 1KAGA 3FAZA 1IV2A 4OI2A 2RIPA 1GO3F 3IDQA 1L9XA 2FWBA 2CZWA 4W5HA 4CIVA 1V26A 5BSHA 1K5PA 3CRNA 1CKEA 3OQPA 3AI3A 1NAHA 1XV2A 5E0OA 1FU7A 2GCOB 1COZA 2RI0A 2W6CX 1O95D 4ZV7A 2I22A 1R12A 4N18A 5CFRA 3R3YA 1P33A 2DYRB 1BS2A 2NGRA 3RVJA 4B32A 2J5QA 4MUYA 3PLNA 1NXOA 3Q5EA 5G41A 3L0ZA 2X0EA 1LR1A 1OX5A 2AT1A 3C90A 4RVNA 3GO4A 4JVLA 1NI3A 3OKPA 1D0VA 3W3AA 3CHYA 4ENSA 1JLLA 2H63A 3QM1A 4EW1A 1TVMA 4KQJA 1P31A 1OB2A 1T0PA 1T3LA 2UXCB 1NNEA 2NO5A 5H81A 3C98A 4LWSB 3GLIB 2YXPX 4Z3KA 1J8DA 2PSHA 1IJKA 1KIMA 1DTWB 2N42A 4WNYA 4NV0A 3OO1A 4FW9A 1MX3A 1G6OA 1RDFA 2CK3D 4B5LA 2WJJA 5KJEA 3FPEA 2XOXA 1PK7A 3A6FA 1FTSA 3NM4A 1R8JA 2EFJA 4KKVA 2ICAA 3G71V 3DEAA 4YAFA 3PQDA 4UAVA 4JBIA 1JKJA 1XL6A 1E9BA 4F2DA 1DJOA 4EKGA 3IPXA 4C8EA 5JJIA 5LCXA 5B1EA 1XTSA 2WWIA 1NSTA 2XF2A 1WQ1R 3I7TA 4RA9B 1T6NA 1JAIA 1EM1A 2FSFA 4UQLA 4YCLA 2BSKB 3A9UA 4RS3A 4TKVA 2GEBA 3INRA 3ORYA 3TRDA 2G77B 2WKPA 2RN9A 1ID8A 3R20A 5KA6A 3AFOA 3LPAA 1GSAA 2X3YA 5TDHA 1BHJA 3KXDA 3DE4X 3WKAA 4JKIA 4URZR 1WJZA 1AA6A 2AHYA 1YJWF 4BWFB 2YY5A 4UPVA 3NQ41 1Y8QA 2DWPA 2DW4A 4TSFD 3VU9B 2LCIA 4MQUA 4P53A 2ALJA 4K3VA 1R0ZA 5DIFA 1C3XA 1K92A 2XLBA 4QG3A 2AKYA 4DIKA 3CIFA 2C2XA 2P90A 3L7LA 3KKNA 3O4HA 4LZAA 1VLJA 3ABTA 3AYZB 1TC1A 2PWZA 2R7NA 3R0PA 3QEOA 5M04A 2Z8ZA 2CXTA 1VE6A 3M49A 4HUJA 3ET4A 2DP4E 3F97A 1Z39A 1XQYA 3UMGA 4UXHA 2HHLA 5K3BA 1RI4A 2IWHA 1UM9B 1JA0A 3DTVA 5KTNA 4B34A 2CXQA 5D5QA 1X1QA 1EFRG 2BE9A 4Z9FA 3L1HA 5LIPA 1H9CA 1YIOA 3Q15C 2W2LD 3OMWA 3BRCA 4PYIA 4YLEA 3ZCTA 2NT3A 3K32A 5FAXA 3R9KA 4EQ6B 3EGWA 2ACWA 4Z9YA 5DE3A 4EUKA 2GARA 3VSCA 4LDPA 1DQYA 2DJIA 4FMDF 4FDTA 3IT0A 3IDAA 5FTMA 1MOPA 1BH2A 1CJUC 3CZ5A 2EYUA 4WA8A 3R6DA 5JRJA 4X1YB 1FP4A 3J80N 1RXCA 1UBRS 5L7TA 4A1OA 3QELA 3STLC 1Z33A 5AIBA 4UEKA 3OT1B 5C5DA 3EC2A 4HHEA 1FDUA 4DYHA 3C7TA 3VOTA 4QJ3A 1M2JA 4ZK6A 2A9HA 2C82A 5EB1B 3MCTA 1W0KG 1CNEA 3O92A 4TYWA 1DFGA 4I5IA 2HRYA 3INGA 5EUBA 2OO3A 1KU0A 4Q3BA 4QARA 1KKUA 2VNJA 1QK3A 4DV4O 1TAUA 4QPCA 2FG5A 3PBKA 5AOVA 4L5CA 5CP8A 2P4VA 1S0UA 3VTAA 3H13A 1EHYA 3ESQA 1EYZA 3EXHA 3TL6A 2P7IA 2DR0A 2TMKA 2HLPA 4F46A 3UJ9A 2YIJA 5H59A 1EVLA 1EQAA 2VK2A 3CH5A 1PKEA 4NQRA 4KFCA 1QYXA 4Q05A 5BWMA 1QP4A 3W7BA 3VOUA 5JU6A 4OGKA 4O2LA 2EIJB 5AVUA 1EEHA 5DYGA 3LF2A 3H05A 4HATA 4NEGA 2DT5A 1OROA 2COKA 1F1JA 1ADBA 5TS2A 4BFCA 3HJGA 3PNOA 4MGYR 1NBMG 1TUGA 2F1MA 1M56C 4OREX 1WXGA 1AGRA 1RWPA 3I64A 4QEKA 1GUDA 1S3IA 5K05A 4JEHA 3VR4D 4QFCA 4QWWA 1STOA 3ICPA 4GVLA 5HS4A 4RPHA 5ILGA 4JL6A 3F1LA 5CIYA 3VYTC 2OCHA 4MQBA 3Q3GE 3CX5F 5BWOA 1UBJS 4K9RA 2EILC 1U8TA 4Y8VA 2GFHA 4ILEA 5TV2A 1ZQ1A 4KRYA 5IW8A 3R40A 4MTFA 1O5OA 2R6HA 2CLHB 4EP1A 4W9RA 2OCDA 3BEOA 1AR4A 3SR2C 2CDNA 4B3RO 2OKGA 1WTAA 4B3DA 3RGGA 5EI5A 5GIOE 3PV0A 4G5SA 2VAVA 4YCCA 1NVVR 3QF4A 3W2HA 4IPTA 3AF3A 4MVCA 3S5UA 4CLHA 1E94E 1C7FA 2V03A 3ABOB 1ACMA 4C4OA 2DFNA 5AKXA 3UBMA 4MVJE 1Q0LA 1WP8A 1PWYE 4N3CA 1T3ZA 5KNDA 3A6KA 1HLFA 3NVMB 4P80A 3F4LA 1DC7A 1ENZA 1FQJA 1YCIA 4Z1MG 2CB0A 2IUEA 3RKUA 3EIHA 3PC2A 3Q87B 3CTMA 4L07A 3DOHA 1IPAA 1H2FA 2POCA 4B7KA 2BUCA 3WGOA 4JN6B 5LQMA 1HOTA 2I4LA 3NW9A 4K8OA 4R7CA 3M5DA 2VHCA 4DHWA 4YPFA 2E75B 3DE5X 3BQ9A 2ZAYA 1CW2B 4KXVA 2E5LO 3GLFA 3DZJA 2O3TA 1GOTA 1YU6A 1QH1A 4KMOA 2IELA 1QBZA 4BN4A 4E1AA 1O77A 2Q9UA 4CKXA 1X7PA 1SPXA 3P9IA 2H1WA 5E7MA 3H65A 5F52A 5I9MA 3PDUA 3N8IA 3HDJA 2WLTA 5F7JA 1K7SN 3PAFA 3OKFA 5A0VA 1SXGA 4II7A 3WLMA 1YTFD 1IZ7A 4EJFA 5J2TA 2XQFA 4NMMA 3WQBA 4NECA 2VK8A 1RVV1 3NBXX 4LJ5A 2V59A 3TAUA 4PNPA 1XRQA 621PA 2QTPA 3N7TA 4CTNA 1RBMA 3X1XA 5DP1A 1F6WA 1RMYA 4NBTA 4RL6A 4ZXPA 2E3JA 4PSDA 3A28A 3MFQA 4BPBA 3O84A 1SELA 4DTIA 1TA4A 4C0KA 4I46A 3SYTA 3ZXXA 1RAFA 4Z4FA 3X2QB 5CB8A 3JYPA 3PYMA 4YDRA 4QTYA 5FX2A 2QZ9A 3ROMA 2HEGA 1N2BA 4Z4HA 3U4QB 1VI2A 1OAKA 3BWEA 2H94A 3EORA 2OYRA 3IUEA 2P2ZA 2HPVA 4IL6Z 2YJZA 2J30A 4IDAA 5L4SA 2QUJA 3I05A 2UZAA 3LX4A 2IUSA 2CKMA 1J0EA 2XGJA 5AUPB 3LBFA 2GSDA 2XKAA 4GNRA 3HAXD 1G41A 4UBIA 4JL8A 1B41A 2NXNA 3HXKA 3KB6A 3T61A 4AKHA 4R2JA 4J7JA 3VKGA 2WYVA 1VKHA 1HEYA 3K9CA 4KPEC 4CM1A 4G63A 5K2OA 3F67A 2PQ6A 2KX7A 1NVKA 4L9AA 3C3WA 3OCJA 1GGVA 1VH8A 4UVHA 1NFQA 3OW2F 2QT1A 1BEZA 2IH2A 3LYBA 1C1XA 4A8JC 2GKGA 2R66A 3LOQA 5K0JA 2ZW9A 3R0IA 5CJJA 3L7DA 5K03A 2V5VA 4KMRA 1A7AA 3T1HO 3F6BX 4R0MA 5TEWA 2A0XA 5A4JA 4CEHB 4X92A 1ZOIA 2JZOA 4DB4A 1MW8X 3DVLA 4W63A 2V4UA 4ZU6X 2BC9A 4NK5A 3FPCA 2NO6A 2F1RA 5CJ2A 3Q0EA 1CJCA 3RPEA 2XKJE 2PYDA 4F1JA 3O9ZA 3B2QA 3E9ZA 1P6UA 2OM6A 3DDSA 4O4HF 4WY5A 3NV9A 3BG5A 1Z6PA 2AZ4A 2H7XA 3ELBA 5LC1A 2WAOA 3D4NA 2ZRMA 2Z83A 5AUNB 3F7YC 2F43A 5LU9A 4LRXA 4NU5A 1PQWA 3GLHB 1U3DA 2QVBA 3VQTA 3OLCX 1VM6A 1W52X 4UM7A 5EWMB 5LVAA 3D6NB 1WW8A 1ZUHA 3ERNA 2CSUA 3PNKA 4R1TA 1I6MA 2QJ1A 1ZMRA 4MP6A 4IXMA 4LXUA 1N0JA 1PFUA 3Q98A 2HTEA 3VX3A 4BX0A 2ZBVA 4Q7EA 2EEZA 4XWGA 3LI2A 3TE6A 1QH0A 4CV0A 3DH0A 1U1FA 4B3CA 3WGLA 2GCGA 2EZ8A 3I2FA 2N04A 3CY6A 5IKPA 2WYOA 3FSGD 1LY1A 3N2KB 3VM6A 4CKBA 1GO2A 4PHZA 1YRYE 2LCQA 3NRCA 2Q7HA 3HA7A 1IN1A 2E3CA 4QPKA 1EAYA 4D9KA 4DMLA 2XZLA 1JIQA 3SMVA 5EIFA 5CX1B 3DXFA 1YHNA 1LV8A 5C34B 5KKNB 1FS5A 3W5VA 3RJZA 5JW6A 3KQQA 4M9UA 2NYUA 3EEFA 1DBWA 1UOQA 2HRQA 3F98A 3CCRV 1BGYH 3K9BA 2O0LA 2D1YA 3M2PA 3MXTA 4HDMB 2W11A 2ISCA 5IYCO 2WVAA 2P9QA 1S5HC 3ISTA 2VHJA 3P97A 3OI7A 1YR1A 2BGUA 3RYHA 1BD4A 3DV2A 1ULZA 4UU1A 3GPBA 5LIRA 1R2QA 5CLHA 1GO1A 3TSOA 3PT5A 4KO1S 2WF8A 4XQ9A 2FP4B 4YDHB 4AX8A 3MWFA 2V9ZA 5I9IA 2EINB 5EZYB 4DBLC 4BMVA 2PDAA 1Y7IA 1XMPA 1CDOA 2MYTA 3CVYA 4FGUA 3CV3A 2HA2A 2BKLA 1QFSA 1POWA 2ZJ1A 1D2HA 4K46A 1RQ2A 3QBJA 2IH5A 2XJ9A 4BBJA 1B8UA 1G8MA 1OZGA 3F2IA 5DX8A 1B43A 4KG7A 1DFIA 1GWNA 2HMVA 2MYNA 1ECPA 2ZVPX 4S35A 3BDAA 1HEIA 5AVTA 3KX2A 3A4TA 1CRLA 5KS2A 1KIAA 5JH7A 1SESA 5H5NA 4JU9A 4B3TO 3WJPA 4M88A 4R6ZA 2P68A 3HS3A 3N6VA 8OHMA 1SQ5A 3X3HA 2QR3A 3RTDA 3AIOA 4CM9A 4UUMA 4D46A 4NWIA 3WSTA 1M67A 4MQFA 5L3GA 2WKQA 4RZ2A 1UXJA 2I66A 2MSDB 3WJAA 3CLVA 4YJ2A 4BMSA 1G21A 3BMXA 4EFLA 1IC6A 2WINI 2ZSKA 4P4UA 5L3QB 2QIPA 3DVAA 2J5KA 1FSGA 5J9FA 1NJIW 3PQ5A 3PYXA 3TBFA 3DEYX 2E6KA 2YHIB 5IN4A 1HNWB 1VQLF 3DE2X 2PJRA 2Z1UA 2XITA 1AHIA 4HNAA 3G89A 4N3GA 4MVSA 5EZQA 2A5FA 2V7GA 3DZGA 1D5AA 3AY7A 4Q18A 4YDSA 3ME5A 1FFCA 4C5AA 3BMOB 1F51E 1BA2A 5EQDA 1U7WA 3NM6B 3PLAC 2VO1A 2YW9A 1ZISA 3H2JA 4ZVQA 4QYXA 1VPEA 1U8CB 2AYXA 1O6BA 5CFOA 3MBMA 3IP5A 5IYZA 2SECE 3HYTA 1OGJA 5AVQA 5EMHA 2PUSA 4NDAA 1KVUA 3RIHA 2UZ3A 1PP9H 3BYZA 1TK2A 3LUGA 3P4EA 2GBOA 3L8EA 1Q7EA 2C07A 5DM1A 1FXVA 4LYAA 1O6GA 5G3YA 3PX2A 3JVUA 1WXDA 3R09A 1V47A 2UAGA 3COPA 1TZKA 1B16A 3TS1A 3KFVA 4F72A 4D7SA 3SFTA 2AE2A 4F4HA 4RSRA 1GNQA 3HFSA 4X89A 2OHFA 2NXEA 3RAJA 1EDEA 4K28A 1QVGF 1KL7A 1K9MH 3ORRA 2FEPA 5GPBA 1V54C 2XF8A 4KQWA 4IM7A 2N1BA 3A2LA 2BFPA 1A9TA 5KYXB 2Q8NA 1Q6HA 3WLQA 5AHRA 4ZZ2A 1CEXA 2JGMA 2O8EA 3F6YA 4DSZA 3LY8A 2LGJA 4I6JA 4LSMA 1PU2A 4BVSA 1I3NA 1X2BA 4LJAA 1EM8B 1RWBA 5AJUA 4FZ1A 3K8ZA 1NS1A 1U3UA 4YPVA 2HBRA 2I3BA 4GYCB 3P2KA 3NHBA 4UTNA 1JDPA 3L72H 4M9QA 2CLDX 3K2BA 5EXXA 3SQXA 2QMOA 5FI3A 1VQKF 3WRYA 4NZZA 2B9EA 2Z30A 3K8QA 4IJWA 4ZV9A 2AFIE 4I0XA 3IKJA 5AP9A 1WPRA 5L3RA 1E7KA 1HYEA 4Z8YA 4AYTA 3NP7A 3WRVA 5FT9A 3VPSA 1MFZA 2UUCO 3R74A 3MN1A 3RFTA 3PUKA 3SN6A 1GYPA 5JEEA 4FBGA 1IN5A 3HB7A 2W7TA 1ORHA 3GLGA 3JYOA 3F6CA 1E2KA 1OX4A 3ZY3A 4D80A 5AK3A 1T4GA 4JGIA 1TM5E 4I5GA 1FDTA 2GYYA 1KPHA 5EHIA 2JI8A 3MGAA 1UKEA 4BO9A 3ZYCA 1T9GR 3BGWA 3QMVA 4M49A 3U2QA 2JAPA 1W36D 3OFNG 3VPBA 3KR0A 1V16A 1ZIYA 1SKBA 2VQFB 4QYIA 2F3TA 3T7AA 3ISJA 2HCTA 2OHHA 3A2KA 3OD5A 4W4KA 1U6KA 4H13B 4OHKA 2PG3A 4J0FA 4NU6A 4TLAA 3K0CA 3QYFA 2QMYA 2AYYA 5JD5A 2A9JA 2ZTVA 1IWPB 1LX6A 1U0TA 4J0HA 3HHEA 4G4IA 4BN0A 2YWHA 3IBCA 3PPWA 4RJLA 5IFKA 4LK2A 1GAJA 1GQRA 2IYUA 3WPWA 1RC8A 2JLCA 1UODA 1H2NA 3GJ8A 2MINA 3CZAA 3MOSA 1RFGE 3MCVA 5DX0A 4LF4B 2G8LA 5JS2A 3NETA 1R6TA 4BY9E 2YZMA 2SKEA 1SXJB 2FK8A 5I4CA 1ISPA 4M1MA 5F78A 5CDGA 3H5NA 3NHUA 4FYJA 5E6SA 5A02A 3OECA 3JD2A 3A1WA 4PCVA 1XMSA 5KJCA 3L43A 3W3AD 1YAHA 5DLDA 4GZRB 2PMEA 4HOYA 2BISA 3KWFA 1HMPA 1L7QA 3U4DA 2LIPA 3GPLA 3RS9A 2OZEA 1N8TA 3GMIA 2ZAGA 1XRMA 3A6HA 1RI1A 3RC7A 5BORA 5DYNA 2ZNJA 4L0CA 1QU3A 1T9DA 2PBZA 4QRIA 1I7PA 1Z73A 4MRMA 3AVTA 3K12A 4KQHA 4DCJA 2O0JA 3L9XA 2P6PA 3CCSF 5C4IA 2V0NA 2ES4A 3T3MB 1KJQA 1UWCA 1PV2A 3BHIA 3Q8HA 2VP2A 4HTFA 2L0XA 4JB8A 1I80A 1HE5A 3OPMA 1ZR4A 1F9AA 4TQUS 3TLXA 4AZ0B 1LK5A 3ZTWA 1G42A 4PHFA 3AF2A 1MH9A 3GUVA 1XQ1A 2BT4A 2IX3A 3ROXA 4DV5B 4JFAA 3G4SV 2OWDA 2DTXA 4FYIA 3RLIA 1ZK4A 1NR1A 1ZJ6A 4K40A 4MSUA 1S9HA 4Y1RB 1FFXA 3NONA 3OIWA 1W0JG 1RPTA 4NL4H 1V1MA 1T34A 1W34A 4U2EA 2A92A 4HL6A 4JT4A 3VPCA 1WBJB 2WU4A 4KU4A 4BZPA 4QSMA 3CRQA 4L08A 1UXGA 1S6YA 3SC6A 4WZBE 4WESA 1U1CA 1XF1A 5MF6A 3WGZA 2CXNA 1T1EA 3FN4A 2WA1A 2G25A 1W6UA 2WA4A 3E9RA 1NUTA 3K30A 2BTQB 2ZIEA 4FGWA 4MVRA 2OFFA 1VLMA 4TQAA 5H80A 1C0LA 1VQ8F 1FUYB 2ODPA 3VQWA 3IEPA 1MOSA 3RJ5A 4HB2A 5KYWA 3V8VA 3CF4A 2WAYA 2PX0A 1E3SA 1OCZB 3KEMA 2ADQB 1C4OA 4BP8A 5FNVA 1Y5NA 5JDIA 1H2MA 3KJZA 1JQ3A 4JLVA 4FZ5A 1CS4C 4EABA 1VMGA 4L7QA 3QX3A 1K8RA 2OZPA 3DTVD 1E3MA 1UXKA 5C31A 4YP5A 3QYPA 3D4LA 1IN7A 3DC6A 4YUVA 2SCUA 4UPEA 1KI6B 5KAIZ 4PZCA 2WTNA 2XNDG 1H6DA 4KGZA 2HJ9A 2UUPA 4Q4HB 2VXBA 3DF7A 3A1VA 5IT0A 4IEFB 3ZDDA 1SC3A 1PHRA 4BOYA 1S0VA 1KO1A 3C3CA 2ZWIA 2OZLB 1P1IA 4ASUG 1BMTA 1R18A 5BN5B 4F4FA 5CB4A 4DDHA 2AMYA 4Z4EA 2VP3A 5CG1A 3VBCA 5HSGA 2PT9A 4UXIA 4CIBA 3OD4A 4BMCA 1JG2A 3KB8A 2B37A 4NZYA 3KQKA 1Z25A 1EE9A 4C2AA 3IOBA 2DYSB 5D5PA 4QTUB 3EZ7A 2YH2A 2P8SA 4H18A 2Q5FA 1GPWB 4LMRA 3HBMA 1C3LA 1F2VA 1AURA 4Q16A 2XAQA 1OT3A 4P3OA 4CDNA 1IV3A 1QZZA 1ZL0A 3HCEA 2FZKA 1QF7A 1A7JA 1G291 3ZWOA 3DFKA 2Q5JA 2ZXUA 4ZQEA 1QIMA 1T35A 3UHJA 4ZDKA 1U1DA 1X74A 4J1SA 3OU7A 2TYSB 2PXCA 4MVJI 1L7NA 2QN8A 3T7DA 4O02B 1CDEA 1NONA 3C9RA 1A32A 3T7IA 3AUAA 4RHTA 4C0WA 2LTAA 1NMUB 3UJ8A 3EZYA 4B40A 3D8TA 5H6QA 3SC4A 3JPWA 4GXQA 4Z3DA 4NAVA 4MDHA 5EJFA 1V1RB 5K8VA 2C2AA 4QUGA 1SIWA 1F12A 2IEAA 2XIJA 1U6JA 3GUUA 4NTZA 2A67A 3P2IA 1QBGA 4R8KA 2AD5A 2PSFA 1I30A 3HYLA 2PUBA 5E9JA 3AG4C 1ECJA 4FIZA 3AERA 2JGLA 2X86A 3HR4A 4CM4A 4XCXA 3A36A 1T5SA 2AK2A 2PUJA 3DC2A 1VMIA 1LVHA 2XUDA 3PJRA 3COZA 4ENVA 5GW7A 4OHZA 4HQOA 3CN7A 4ZI7B 4XDZA 2VAXA 2NOAA 4BCBA 3CH4B 3IT3A 3ZMUA 3VSEA 4IFTA 3K20A 3BAFA 2YEVA 3HVRA 3K0FA 5HFNA 1I5YA 2D5BA 1EWRA 3I9MA 4PHCA 2Z3ZA 2BM1A 2RHDA 1WF3A 2EC5A 1VKJA 1PCXA 4JU8A 3LDGA 1QKJA 3PITA 3L1KA 3FMVA 1WVGA 1VIYA 3SU8A 3CZQA 3IB3A 3TFWA 1Y3CE 3SJAC 2QVXX 5JT1A 3H2KA 3UGTA 2XZTA 5EJ5A 3PRJA 3OCCA 5KTYA 4U3FH 5B1HA 4CT0A 1QHHB 3EGDB 1KE1A 1R0XA 3HBNA 5CH5A 2JS7A 4LZNA 4L0DA 5BR7A 2XY4A 4OI4A 3VAYA 1MRSA 2FFBA 4ZCQA 3AW9A 4P30A 3KQVA 2IHJA 3W7VA 3ABSB 1YIAA 4Q1EA 5BMOA 2A5GA 1UC5B 5KNDD 3ENZA 3VV2A 4FCWA 1DZ3A 4UBMA 2PJUA 4WXYB 4JJAA 4UHHA 5JFOA 5MN4A 2H1FA 4R3WA 6REQB 1Q84A 4HWRA 3VGJA 1SUBA 1L5HB 3FB8C 2O8FB 2IPXA 3I62A 3PUVA 3FYUA 2Q0SA 3AMVA 5H70A 4BV2A 1RCTE 3C41J 5K7SA 2OTJF 1DGSA 3D8CA 1PWZA 2WFLA 4K9SA 4NYKA 2B1IA 5AW9A 4QDUA 2O07A 1G0NA 3V8BA 1I6LA 3RC2A 3LVBA 4ZO9A 4TKZA 1JJOA 4CODB 3C7CB 1THGA 2OUKA 5KUTA 3K7EA 4R2IA 3FIUA 3L6BA 1QH8A 5FTLA 3K70D 1L7EA 3GP3A 4A6PA 1SZDA 2VWQA 4OMDA 4GMHA 3TOSA 2AMJA 2X6TA 1G2OA 1M74A 3PXXA 2QQGA 2HK8A 1C3OA 2QD1A 4J3JA 2HF2A 1SCJA 4K9KA 1T9HA 1WXWA 4Q9NA 2W2PA 3QUWA 2Q6KA 1JPJA 1TKCA 1N36B 5KMGA 1HOXA 4XPZA 3AJRA 2EZPA 3VVBA 4YRZA 4Q3CA 4L75A 1ADYA 4ND3A 3BILA 1US6A 2UXBO 2DH6A 4BX3A 3FUWA 1VQ4V 4N7MA 3L79A 3N9IA 3EHEA 3B3JA 5FTNA 1KMNA 1MC8A 4IZOA 1ISSA 1S72V 1W85A 3HCCA 5JJ5A 3ETQA 3KAKA 3A1SA 2IS6A 1X1SA 1YKGA 4BKUA 3KE8A 3L7NA 4LRUA 2ETXA 2OGUA 1E1QA 1PX2A 3GB9A 5JZMA 1KSGA 3U4MA 2F1HA 1QJ4A 2R48A 1AZSC 2G5TA 1JHXA 1NW3A 5HWEA 4OAOA 3OQ1A 5KHLB 5EB0A 5E4YA 5DGIA 2O5CA 1EFTA 3UF0A 4TMFA 3TSZA 5K99A 4D0RA 1BFDA 1ZONA 2QGFA 4R31A 2X5OA 2BE7A 9GPBA 1A0OA 2J3LA 3O8OA 4M98A 4Y2HA 1TK9A 4WZAE 3WWOA 4FMTA 1TAHA 1I5EA 3DMTA 5E1BA 1XOIA 1EUYA 3C7AA 3H2BA 1ZD8A 4QUKA 4YJDA 3PD7A 1WRBA 4QQKA 1P91A 4FFKA 4LVNA 3UIEA 4MJ3A 2I9PA 4O29A 1TL7C 5CYGA 4N9WA 3FJOA 4I9FA 4U7NA 2OE2A 3J7TA 4WH0A 4XRRA 4XTRA 1E79G 4I50A 3DHEA 3TLKA 2YKGA 1F2DA 1LQTA 3LWBA 5DECA 3LDHA 1PZGA 1JWLA 1BRMA 3PWZA 1RMTA 1E1CB 1N6NA 2A35A 1KB9F 2ZKLA 5COQA 3IGAC 3U9LA 1DDIA 2P22C 1UFQA 2L26A 1P19A 3NIDB 3X44A 3WMWA 4P82A 4LI3X 1LJLA 1BHO1 4WVLA 2ZE5A 2W8BA 2ZOSA 1FXSA 3HFGA 4CM8A 3HA2A 1X9HA 3VH4A 5HM6A 2XV1A 1E18A 1YF2A 2NXCA 3C5CA 5GVSA 3PHGA 3HXQA 2O9JA 3CTPA 2PD6A 5C7OO 1GDHA 3FJYA 1DCTA 3FPAA 3ONEA 3VH2A 2GH1A 1W96A 4NF2A 4O59O 1HG1A 4AJ4A 5C8YF 5JNSA 1Q20A 4KDCA 2FMXA 1B6TA 2EARA 3WO1A 1P9WA 1USKA 5A04A 3L01A 2EIXA 3PNYA 3LSYA 1OC4A 1DBQA 2Z5LA 3FLBA 3AUJB 3I28A 5D3KA 1J2RA 1NVWQ 5CJPA 2EFDB 2X6QA 1LRKA 3AB7A 2P77A 4EB6B 2P9FA 1CDDA 2HSZA 3KU4A 2GNAA 1F60A 2QBYA 4GLXA 3FPIA 3L18A 1GXSA 1JIJA 2IK8A 2CL0X 4N4AA 2RJNA 3TXXA 5B12A 1WABA 4QDTA 1CX9B 2WHEA 4TWJA 4C4TA 1SUFA 4DGQA 5KSPA 4B6JA 5JAIA 2PH1A 2VA8A 1BW9B 1EA5A 3EOBI 4LQDA 3PPVA 3BAAA 5B64A 2MR6A 2CTQA 4DCVA 4D3SA 2AIFA 4GMGA 2R7LA 1R4NB 4F6RA 2JRCA 4DMCA 1T9CA 2YWRA 3I2HA 4K9OA 2YXYA 3CYPB 4M9SA 5EWLA 1U3LA 1DEHA 2YNMA 1E4EB 1SB9A 1JHZA 4Q21A 1SU4A 4EPTA 5JSZA 3L8ZA 2J0EA 3CT6A 2UZIR 3TZQA 3PUHA 1W4AA 3EG9B 2WJHA 2EGUA 3KEGA 3GRUA 1R8QA 4A91A 1I9GA 3I6QA 3FF4A 1A76A 4R4JA 3KNZA 1LF5A 1FYEA 4PLVA 4PIPA 5FPPA 4G8BA 2XUAA 3WWDA 1Y74B 4OUKX 4MHSA 1J2UA 3E7PA 3MHTA 1CEYA 1IRIA 3G5TA 4BAYA 3IOEA 1QKIA 2F1JA 4RQFA 1E0JA 1T10A 3B6JA 5ARCA 4N5DA 3KWLA 2QZPA 1XTIA 4OQLA 3TNYA 4B7ZA 2OC4A 1U96A 1B3BA 3G2LA 4CM9D 1YFZA 3NX4A 1VQ1A 2PS3A 2Z09A 2HZBA 1LFAA 4TVOA 5JO9A 1OFUA 2RGNA 4US1R 1ZH8A 4L95C 1XQ8A 4NS1A 4RVHA 1RRPA 3ESJA 4L6AA 2E37A 4P32A 4XDLA 4OQPA 3A3KA 2UXDO 1JP7A 4YROA 1LK7A 1SKUA 5H3HA 3C2QA 3CB2A 1CUFA 2UVDA 3A70A 3JQAB 4JI1O 1M2FA 4O2BB 1LQ2A 4HYQA 2PS9A 1S02A 4LDJA 1DPFA 2PD3A 2O48X 2ZYAA 3AG1B 1QLHA 1NBIA 4JI4O 3QNMA 4BV8A 3CPSA 2DOSA 5SY9A 4N7JA 4OSEA 2QSAA 4P9OA 2IF2A 2W6PA 3GEDA 4LQCA 2GKSA 2A9RA 1BKYA 2R7MA 2FYUH 3GG9A 3HNRA 3JAKA 1B06A 2VDUE 2Z1NA 4LE0A 1S96A 4OP2A 2IW5A 3E35A 1EN4A 1SBNE 4F5EA 4JJGA 4DS3A 4DLWA 1TEXA 1ZI9A 3PQ8A 1L7OA 3KYDB 4JI2O 4HG2A 1ESCA 4Q9LA 4KXFB 3ZVRA 4UKDA 5L3DA 2CN1A 4ZO7A 4MARA 2HU7A 2VHVA