1FFXB

Tubulin:stathmin-like domain complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
427
structure length
410
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords PROTEIN (TUBULIN)
publication title The 4 A X-ray structure of a tubulin:stathmin-like domain complex.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 65
structure length 410
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1ffxB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1ffxB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1ffxB01
4I4TA 3HKBB 4O4IB 3RYFA 5LXTA 5JH7A 4TV9A 4ZOLB 5EIBD 1RLUA 5LOVB 4O4JA 4TUYB 4X1YB 1JFFA 5IYZB 4YJ2B 4EB6B 4I4TB 2VXYA 4EI8A 5LXTB 3M8KA 1W5AA 3WGLA 4ZI7B 3E22A 5CA1A 2RHLA 1Z5VA 2BTQA 4O2BA 2VAPA 3JARA 3RYIA 2Q1YA 2XKAA 2BTOA 3JASA 5JVDA 3WGNA 4X1KB 4O4LB 2RHOA 4DXDA 3VO8A 5ITZA 5CA1B 2VAWA 2BTQB 4O2BB 3JARB 3RYIB 5LP6A 2R751 3JASB 5JVDB 4I55B 3WGKA 1SA0A 1FSZA 5ITZB 4E6EA 4O2AA 3UT5A 3HKDA 5LP6B 3JAWA 4WBNA 3R4VA 3VPAA 4EI9A 3JAKA 3V3TA 4M8IA 4HNAA 4I50A 3JALA 3N2GA 3RYFB 4O2AB 5IJ0A 4TV9B 5JH7B 1W59A 3HKDB 4O4JB 3JAWB 1RQ7A 3JATA 4WBNB 5JCOC 1JFFB 3JAKB 3C8LA 3M89A 4O4HA 2GVIA 4B45A 5MN4A 3N2GB 2RHHA 4LNUA 5J2TA 4IIJA 3E22B 5IJ9A 1Z5WA 4KWEA 3ZBQA 4FFBA 5LYJA 5J2UA 4LNUB 5C8YA 4IIJB 4X20A 4DRXA 4XCQA 5KX5A 4F6RA 3HKEA 4FFBB 3HKCA 4U3JA 5LYJB 5LA6A 3CB2A 1W5EA 3ZBPA 4DRXB 1SA0B 5FNVA 2RHJA 5JCOA 5KX5B 3UT5B 3HKEB 3VOBA 4TV8A 1FFXA 4U3JB 3WGJA 5LA6B 4HNAB 4I50B 3JALB 5FNVB 3ZIDA 5IJ0B 5LOVA 5GONA 3RYHA 4IHJA 5MN6A 3JATB 2XKBA 5JQGA 4O4HB 5BMVA 3N2KA 5CB4A 4ZI7A 5J2TB 5EIBC 1W5BA 5GONB 3RYHB 4IHJB 5EZYA 5KMGA 4X1IA 1W5FA 2R6R1 3VOAA 3WGMA 1RQ2A 5IJ9B 5JQGB 4B46A 5BMVB 4EI7A 5EYPA 4ZHQA 3N2KB 5J2UB 2VAMA 5C8YB 5CB4B 4X1KA 4O4LA 4X20B 5CA0A 2Q1XA 4U39A 5MN5A 3VO9A 5EZYB 5KMGB 4X1IB 4YJ3A 1TUBA 4F6RB 1TVKA 5EYPB 3HKCB 4ZHQB 4I55A 5CA0B 3RYCA 3HKBA 4O4IA 4EB6A 4ZOLA 4YJ3B 1TUBB 4TUYA 3RB8A 1TVKB 4X1YA 4TV8B 1FFXB 1OFUA 1W581 5IYZA 5M7EA 4YJ2A 3RYCB 5LP6C
chains in the Genus database with same CATH superfamily
4XVQA 1JDNA 3ZNNA 5FYQA 2ZUEA 1UBMS 3E23A 4DR2O 4TRRA 3FPEA 2ONCA 1GN9A 1KC8W 3CO0S 2ZEJA 1WA5A 3JWJA 4WHMA 4ETIA 2DYRB 3HDQA 5K51A 1RYYA 3GJ0A 1TXGA 3EIEA 2JJ1A 1GGEA 1VHLA 4Q3LA 5ERGB 2PRSA 3ZD7A 2NU6A 3VKGA 1RWBA 1L4KA 3ZZ1A 1NF3A 3BA9A 1J90A 3DBLB 5C1IA 1DDGA 2QLMA 1TGOA 3NPAA 5FL7A 1EZJA 1WM1A 3BHNA 4XRGA 4A8TA 1NQ5A 3G17A 2O8FB 3N4YA 4JC0A 3KJKA 1RWPA 4J7CA 4P3OA 1B8UA 1L0LH 1T25A 1E6LA 4ZHQB 1RHMA 4MUHA 4Z7QB 1PKEA 3BJMA 5KNDD 3EFOB 5EVJA 3OMNB 4H59A 3SIUA 4L6CA 5AI5A 1AB3A 2O0LA 3CE2A 5HSGA 2JA1A 3KAPA 2FZLA 4Z9BA 1WCV1 3I52A 4CIVA 1Z8HA 4UTZA 2PUTA 1N6OA 4PLTA 3LLSA 1MAUA 2FP3A 3KR9A 4Y2XA 2DUJA 4KDFA 2I2CA 3SPIA 5BYKA 2YL2A 2ZWAA 2BFWA 4MRPA 3B9BA 4GYJA 1T1SA 2EZUA 4MVRA 4OVKA 721PA 3QU9A 4XPIB 2I33A 2VYQA 4G8CA 3WYNA 1VI6A 2WD7A 2JCBA 2XDAA 2CVQA 4JKIA 2DLDA 3TBFA 2DT8A 4JXJA 2QJOA 1QD9A 3ESZA 1VTKA 1JFSA 3HCAA 4ZVQA 3DYIA 5CGZA 1WTCA 4F1KA 1E2JA 4GWGA 4W5QA 2GUGA 3F7NA 4NG4A 2OP0A 5EJ7A 2FMKA 1B73A 3HKBA 3PRYA 1ZWLA 4EZBA 1JQ0A 3UIEA 3ZDEA 4YX9A 4AP9A 3SDSA 4H7DA 5EI5A 1W1WA 3ESJA 1W5AA 5IVKA 5EL0A 4R3WA 3R7FA 1V9PA 1FJ2A 1CY1A 2BGMA 3P9XA 2NP6A 1Y3AA 2WAOA 3HBNA 4YH1A 4FD2A 2I55A 5U1PA 3FMPB 1ZIYA 3DEYX 3VYTB 1UPBA 1J8QA 3D4NA 3ZOKA 1EN6A 1P3JA 2O2GA 4AX4A 5I9NA 1T2UA 3KWMA 2JJYA 4Z2AA 1DVRA 2B35A 3NYRA 2I6TA 5GTDA 1QIEA 2A7QA 4FBMA 2Z8XA 5K8IA 2WHYA 4D4KA 1UJ5A 1VCOA 3USZA 4TMVA 2E49A 1UM9B 3RV3A 1HQDA 1KZHA 4C7XA 2UZ1A 4DA6A 1QGYA 4DIDA 5K0TA 4Q9HA 3T80A 3R3UA 4LV8B 4RBNA 1I7NA 2OCDA 2IM9A 3CHXA 3RJZA 5IHPA 3UFBA 4DLWA 3QE4A 1AKNA 1CU1A 4D9HA 4A73A 4ZI2A 5CUQA 3KKEA 1VRWA 2XD4A 3ZXYA 4LAFA 4RMNA 2BUCA 3X2QC 4QYSA 3K0DA 4NDAA 4WKNA 4O2AF 4C2BA 2H0AA 4BW0B 2XNDA 2DGDA 3TLGA 3LSUA 2QUZA 5BT9A 3E9CA 2AHYA 4Y0AA 2R5WA 3K1AA 4DV4O 2JGLA 3CCSF 4J16C 5JROA 5DULA 4HDMA 1D4OA 4NVRA 1ST3A 4NZNA 4CIAA 4E4RA 3PZRA 2YVUA 4K9NA 1Z07A 2C31A 1RYNA 1YQDA 2BHLA 2ZNIA 1RU3A 2OZKA 3QXXA 1BW9A 3LIPA 1GYQA 2YV3A 3WXMA 4PDRA 3WY9A 4YAIA 2D3TA 1Z0SA 5AJWA 5DGHA 1ZK2A 4UEKA 4YP5A 5JS7A 3A3OA 1YB4A 3GR6A 1T8SA 1P18A 4C5BA 5K8TA 3DOCA 3VU1A 2ZUDA 1P1RA 1P2UA 3B52X 4YO7A 5AOVA 4KC0A 2PO5A 1BC5A 1F06A 3TMYA 1Z5NA 3I04A 4IVRA 1LJUA 1XLTA 2OV3A 3OJEA 3G6BA 2OC9A 2C57A 4HAUA 2X9QA 4NCHA 3HDJA 4MSUA 3CJQA 1F1BA 1LZKA 3JQEA 4NF2A 4A0SA 2PJRA 4BT4A 1UPTA 4IY1A 1C3JA 2WU4A 3D3WB 1M6HA 3RBAA 1IDSA 2MIIA 4JOBA 1UXHA 5DHRA 3WAGA 1C50A 2HMWA 4AJ1A 4D57A 4EUSA 2Z0AA 2MSCB 2IUFA 1UXKA 3EJ6A 2PVPA 1VI5A 4ZARA 5HYVA 2P9YA 4WNAB 5A9SB 3K79A 4GMDA 3WK9A 1XP5A 4GSLA 2X4GA 3O1HB 2Q7OE 5L6MB 2AL7A 2VWGA 2DFLA 1MOQA 4ABTA 2Z1NA 1FXUA 2P4SA 3K2XA 3P0JA 1I32A 2VJYA 1L3BA 3U60B 4Z3DA 1CUVA 2W8BB 2QTAA 3PR2B 2BEVA 5DP1A 3LZCA 3P0FA 1B8PA 5LHGA 4EF6A 2Y68A 2Q4PA 3E9NA 2Z5LA 5KOYA 5K99A 3VTAA 1KEUA 3S3TA 2CFIA 4W1PA 4B74A 1PFUA 3ORSA 3WISA 1AILA 3GMTA 3PNSA 1CS4C 4RD4A 5AW7A 1NPTO 1LPOA 5BYAA 1SY7A 3CPWF 2YHSA 2J4FA 4FHZA 2JDIA 2WSSA 1RHUA 4IFIA 4AP5A 3R6WA 2YXDA 3ZWBA 3IIIA 4F92B 1Z56C 3OMWA 2NG1A 1X1TA 4MRMB 3IAUA 2I6QA 2BP7A 1SXIA 3IVMA 4OHFA 5EGNA 3B3FA 1G19A 4V1CA 5KSOA 2HU2A 1ZMRA 3MJRA 2YHIA 3VR4A 4NFLA 3E22A 2FE1A 4FOPA 4DR7B 2VNIA 4X8AA 2IITA 3BE5A 3COWA 3STUA 1VG8A 5BR7A 1MJGM 2H63A 3CNHA 4QYIA 1RTTA 1ZISA 2ADPA 2Y1CA 3FKSA 2Q5JA 1BYUA 1UDBA 1DAEA 3G71F 4JASA 4C22A 4V39A 1P2GA 1T5TA 3B3AA 4NMLA 4XWKA 1GGFA 1RJDA 3W34A 1QYXA 3EVBA 2JGAA 2ZIWB 5LNK1 5JCXA 4RVFA 1HMPA 2Z3YA 3PX3A 4LK2A 2Z30A 2WFZA 1OAPA 1Y3FE 4ZT4A 1TM4E 3PRKE 3C6YA 5CB6A 4Q3EA 4O4IA 2P6NA 3MIZA 4Z2WA 1TVKB 3KUCA 5CBPA 1J09A 6LDHA 3MOIA 1TAQA 1DO2A 3C43A 4NYIQ 1T5HX 1H8HA 3RTAA 5E2BA 1E3WA 3VTZA 3R4CA 2X3FA 3AC0A 3IBCA 4ZYWA 1U80A 2YN0A 1WHTB 3CB4A 1NT2B 4MTOA 3SHOA 1Z47A 4K9KA 3GFVA 3OPYI 3ILSA 1Y5MA 1YJNF 1CUZA 5T3YA 4UBMA 3V4RA 3TINA 4BUCA 2MMCA 5I01A 4MS4A 3F0DA 4HEHA 4IV0A 5DTQA 2DWUA 1ZWZA 2C1XA 3EVKA 5EE1A 4YAUA 2G38A 4B84A 4MDYA 2OV8A 4GLOA 2OESA 1LNZA 4CMAA 2PIDA 5IFKA 2FDXA 3K12A 3VSBA 3GDGA 3FNFA 5J58A 3GBSA 3V1NA 4AS1A 3AV0B 1NQUA 1LV8A 1NDHA 3ABIA 1QCDA 2BHRA 3AU9A 1MH1A 1EGHA 3QPWA 1KYYA 3DMPA 3MRVA 4KP7A 2KBEA 3DYBA 1NU1H 3HWSA 2WLIB 2Q69A 1H8EA 5DXFA 2QRJA 4C08A 3MMNA 3ELYA 4BECA 4RZQA 3FHOA 1L5GB 5BPFA 4LP8A 1TTHA 4OF4A 3DFIA 3ZDFA 4L5BA 4KG7A 5JXWA 3WFIA 2GEUA 2BZ0A 2X9NA 1YS6A 1JHMA 4AG6A 5K2OA 2SICE 1BGYH 5E6SB 4BY9E 4U2DA 3OQPA 3WLIA 2X41A 1QDEA 2X0RA 4I9WA 1IY8A 1JUDA 1EX6A 3FYSA 1SB9A 1YWGO 4FLXA 2JD1A 1EFRA 1Y6QA 2PD6A 3IP3A 3MOGA 4F72A 4ZOAA 1GZDA 4BQSA 5IF9A 3C3WA 3W9SA 4YRRA 3U2QA 2JAPA 3UCFA 1P7YA 2YCLA 3DL0A 4IUCS 2H1LA 3ESRA 1LXCA 4A36A 4RLSA 4B7CA 4EUKA 1H2EA 3OF3A 2O8NA 3BMCB 1IZ7A 3ZRWB 1XVUA 1T3ZA 3F7OA 1N6RA 1XLVA 1U5AA 2C1EA 1EM6A 2EFEB 1F5NA 4Q93A 2F66C 3E53A 2ADQB 2WFMA 5KPJA 4U7TB 4NV1A 1K5PA 2WTNA 1TMKA 5EUQB 3EIFA 1QC5B 1BWPA 3H6HA 4Q3CA 5FLXM 3I2HA 6REQB 4PM4A 5EJ8A 1DWOA 3PITA 5JJ5A 4LDPA 4MH0R 3QY0A 1DBWA 4IJVA 1L5HB 2BBOA 4AY3A 3RT7A 2AXPA 1H3FA 2UZHA 3QKSB 1QO9A 3R5JA 2WYWA 3ENNA 3NC0C 3TKAA 2OXFA 3O85A 3S3XA 1G8PA 2QTGA 4C05A 3KOZA 4Q6BA 4X93A 2F4NA 1B0PA 3IDSA 3PHIA 3SBXA 1H2MA 4N49A 1YZGA 4FHDA 3RVRA 3JASA 1Y8QB 4I1VA 3LVBA 4AQ7A 1UFKA 2VA9A 3HABA 2ZETA 4CHTA 4QOGA 5BWOA 3MWYW 2JC3A 3INYA 3QPUA 3MLAA 2FEOA 1O96A 3KQOA 3WWDA 5EXTA 4BQOA 5ECGC 1JEOA 4CLOA 4ZBMA 3F3KA 5T7BA 3D6VA 4WF9V 4FZ1A 2M2IA 5D85A 1JR9A 4F1JA 4OATA 4R16A 1FSPA 2P9EA 2D5IA 5LGUA 1NR1A 4GAEA 3MUNA 4MXDA 3ZQ6A 1BWSA 5GGXA 1RQPA 1PWEA 4QBGB 3IALA 4XDZA 4AKSA 2QLLA 3T1OA 2P5TB 3QLVC 5JNSA 2ZI6A 4G1BA 3RV4A 1QH1B 5IKOA 4GZLA 3T4ZA 2O3QA 3Q9UA 1LDBA 1MIOA 3S8EA 3E5RA 4UUJC 3JTEA 3ZE8A 1EM1A 2J09A 1GT6A 2UU9B 1C2TA 2E1PA 1YNOA 4YWJA 3RE1A 1VGQA 3SXJA 4FEGA 1E66A 3MJHA 1VZ3A 1GG9A 3U3DA 3ZVRA 2GJ4A 1FTYA 5F64A 2RHDA 5FBRB 3BGDA 1VA4A 3E70C 3LCVB 1IHOA 5A4JA 3AL0C 1ZA2A 3HSSA 1RSOA 2X15A 1J0XO 1ZM3A 1GQOA 4OA8A 1UR5A 4H1UA 1Z3CA 3LY7A 3R40A 2RDMA 2G1KA 4QOFA 3MCUA 2WAYA 1Q1EA 5LYJB 2ODTX 3HUTA 2QYTA 1B2LA 2A9RA 1S2DA 2XA9A 2Y27A 1B93A 2V9YA 5CM9C 1XRGA 3LZDA 5TF4A 2NU6B 4BP3A 1WVGA 3LGSA 1E7SA 3EYWA 1MFPA 3ZHCA 4H7JA 1H47A 3PCXA 3IBYA 4Q4AB 1ZESA 1YHQF 2QN9A 4BCBA 3OJ0A 4BOYA 4BWFB 1G5RA 1FYVA 3MGKA 3DUFB 3QTCA 2H51A 4LVOA 1ZHFA 3OLXA 5I3ZA 4CV1A 3HP4A 4GUAA 3BEHA 4BX0A 5B2EA 2AJDA 4P36A 2IPXA 3PFKA 4WTOA 4CM9A 3NBMA 4JBNA 4DA8A 4EO7A 3UKJA 2IOYA 2PUHA 1YXMA 3JWHA 3INTA 3ZY6A 1Q16A 4YIOA 2EZTA 3HVHA 3BFKA 5ELXA 3T34A 2OYSA 1IN5A 3RVZA 2NM0A 1EVIA 3RU7A 4Q05A 4JBYA 4NBWA 3BMQA 3IMKA 1RZRA 4IMPA 3QJYA 2F1JA 4YMUA 3CCUF 4MLDA 3CQ9A 4P9OA 2PSFA 3EE6A 3TOCA 1I2ZA 4LWSB 1ZINA 2XAFA 5LXTA 1XZIA 1ZOLA 3P9IA 1PGOA 1WXFA 4NDZA 1C3EA 1LNQA 2O7VA 3UVEA 3C9RA 2C2XA 4RK0A 1FNBA 4MDHA 4DY6A 3SR2C 5KQRA 1ES9A 2EDCA 4B1FA 3X1YA 2C2ZA 3SEFA 4LGCA 3KQMA 1JJOA 3BMNB 2AWNA 2JGUA 3AP2A 4X1OA 2ZVYA 4F4FA 3DE2X 1UPFA 1AUVA 4CQNA 1EJ0A 3H2JA 2UXBO 4KP4A 1CVLA 1J70A 5THQA 4NDNE 2R7NA 4II2A 2V9ZA 4EHAA 5DU2A 1T5LA 4RYDA 2AN4A 3NAGA 5LU9A 3NXSA 5IH3A 3ZHUA 1E8NA 1KQSF 2VDJA 2WRZA 4X6LA 4WFIA 1C9MA 1OYWA 1E98A 3VH1A 3RAGA 3WZLA 1FNMA 3SVZA 3T1HO 4ALLA 3LFUA 3PDUA 1I01A 5AW1A 5DM0A 1OWMA 1G291 3LD9A 5ICEA 5BOSB 4N9QA 2O0HA 4NRDA 5F7JA 3D7RA 4PC3A 4B3HA 3DB1A 3GGDA 4D3DA 4W6ZA 1GTRA 1QV9A 3HJUA 2P9JA 4CDMA 2UZ1B 3M7IA 2PX3A 4EATA 1ECLA 3FJ1A 1QX4A 3AWIA 4YA6A 1T36B 2HRZA 4MMXB 1E64A 3FD9A 5H3CA 1QP8A 3S2SA 4AXXA 4ZYZA 5KNBH 3PSAA 2QMOA 5FO0A 1MX1A 3HDGA 2Z57A 4PX2A 3RSQA 4MDFA 3IHWA 2XQVA 5COAA 4NBVA 2E4XA 2FZ5A 2QXYA 3OJCA 4JGIA 2P2GA 3IEWA 3WGGA 5CW2A 2HU7A 4Q4LA 1JH8A 5BPHA 1QG2A 1N4CA 3R74A 4L4ZA 2FPWA 1ETHA 1Z4OA 3QX3A 1K6EA 4R9VA 2K6GA 1JU9A 1NMUB 3FM9A 3CXRA 4UU0A 2IBSA 3QWAA 2HFJA 2XAUA 2YI9A 1XU7A 2XRYA 5K8JB 1VL0A 2G1UA 1FBTA 1ZKMA 2FG7C 3HJWC 3AG3B 5D6NA 1CX9B 1URFA 3F1LA 4DV3O 4E5SA 1XUQA 2FVYA 1HNXB 2ZPUA 2BE9A 3PKJA 2ZE6A 4YAKA 5EWRA 4QDOA 3WXMB 1A72A 1Y5RA 4MVJI 1U3FA 1DIOB 2YDEA 1JDSA 5TQ2A 2D5CA 3ZWCA 1M1XB 1I80A 2IV2X 1BQ3A 4BVHA 2IRWA 1SEVA 3CCLV 4BJ5A 3O3NB 1NKSA 2EZPA 4U6SA 2G9IA 3FX7A 2ZBDA 4HQNA 1NP6A 1ZK4A 3JRXA 4ENWA 5BQ5A 3VH2A 3KX2A 3LRPA 1EFDN 1QLWA 1CZNA 2HJSA 3I8XA 3CCCA 1KZ4A 2FEPA 1TMGE 3W7SA 1FSGA 1JBKA 2VJDA 3G8YA 3AR8A 2JL1A 1SHLA 1JAXA 3DGEA 1E2QA 2XYPA 3EWSA 1U0HC 5HWEA 3TL6A 1XYVA 1Y6RA 3OLCX 3WGHA 3KBBA 5DCUA 4J90A 4OAQA 2UXNA 5HFMA 2YXZA 1T5SA 2GPYA 2HU8A 1UZUA 3QE0A 4R81A 5CFZA 4B3SO 4QYTA 2LIPA 1DDIA 3NDBB 3I8SA 3GBVA 3KKZA 1S8NA 1P5ZB 1XHXA 1MOFA 4TTQA 3W1WA 4CIDA 1UDXA 1G7SA 1P6QA 4BW5A 3WMXA 1AP5A 4UHDA 3HVKA 2OXRA 3JR7A 3DDUA 3FDXA 3TI7A 5KSYA 1HNNA 3V4SA 2VPWA 3WRVA 2HP0A 4KMRA 4LF5B 5IK2D 1V5EA 2BFCA 1Y6ZA 2WJ6A 2WZBA 3VU3A 3MW8A 4TT8A 3QM1A 3EAFA 1OASA 3PFCA 4HGQA 1R6KA 4H4EA 3NC1C 3GX1A 3PQCA 4GQIA 2NUBA 4Q4DA 2RN9A 2YHUA 4MZXA 2AOTA 5IKEA 2H85A 2YMMA 3ML0A 5CVJA 3KLNA 3UCXA 3JQ9C 5DTEA 3T15A 3ZE7A 3U11A 3FOBA 3IAS1 3O1LA 4RVNA 1DO0A 1CJMA 2WU8A 1QO0A 3P10A 3C87A 3DLPX 4BNKA 3D81A 4G4ZA 2IS4A 2XUJA 3ORFA 3CLRD 4WVFA 4CF5A 1X8JA 4BNJA 1FRZA 2HCBA 4I1SA 1J8VA 3UWDA 4MV5A 5AUPB 3LYHA 1XZFA 1GKKA 2EIJB 2BP7B 3AKZA 1U1EA 3APOA 2PBLA 2IJKA 2BEUA 3BTSA 3UKOA 1SK9A 1V1MB 1BE6A 3R24A 5BUQA 3PFHA 4L22A 1UT8A 3AP1A 3DLAA 4AS2A 4F5DA 3E22B 1N77A 2X9GA 4FFBA 2HT6A 2Q5ZA 3I37X 1R18A 3RG2A 3KT8A 4H0NA 1FDVA 2A79B 3H6GA 1X74A 1Z08A 2ISQA 5ITWA 5CLHA 1VYUA 2QN6A 1LLQA 5LWHA 1TCUA 4U2KA 1SU8A 1XL4A 2H59A 3G8CA 4JASB 1OIXA 4S1NA 3UJNA 2ERCA 3GFRA 4JT9A 3X44A 3LVFO 3DTNA 3RIEA 5ALNA 4GBJA 2Y1WA 3EFHA 5H5JA 3UQ8A 3WNVA 2J5KA 5C46F 1JNXX 3EISA 3AG5A 5IN5A 3UPDA 1JI0A 2C04A 4FLYA 4TLCA 5JFTA 3OQJA 2H0QA 3CH4B 3QU4A 1N2EA 1PJQA 2FZ4A 3O3CA 4BTLA 2BMJA 4AKGA 3LV8A 4FSXA 4NE2A 1U9IA 2G5PA 3O4FA 4BIMA 4E1BA 5FBHA 3K06A 5T4FA 5EO3A 4CHGA 2FR0A 2O59A 2H1HA 5FPHA 1E3WB 1Z4KA 3DFZA 4RFLA 3LNCA 3KOMA 4NYKA 4M88A 2G5GX 3T5DA 2ZT5A 5A4IS 2AK3A 1RKVA 4FYPA 2QD3A 4TLBA 3PE6A 1YKFA 2AW5A 2BC9A 4DQKA 3FPKA 1EFLA 1V1JA 4X95A 4Z54A 4YVFA 5JJNB 1CHDA 4RJLA 2C59A 2FR8A 4MUBA 2L0XA 3LFOA 4QPJA 2EJ7A 4QHSA 1YR3A 1YDFA 1JA1A 4NSNA 4EMBA 3CRRA 4B3MB 3E7XA 2RHWA 1KJ9A 3HXMA 1TU3A 3HCPA 2DR2A 3TW8B 2EYUA 1NR7A 5AHOA 3U3ZA 3EC7A 1LUWA 1VQ8V 2AEJA 1BROA 4AG3A 2J1LA 5CLFA 3ZHVA 2OCLA 1YIDA 1H6AA 4JJ8A 2V1DA 1TVEA 1RWNA 2PL3A 1ZD9A 1JYEA 5LD2B 3PEVA 1MT0A 1EEXB 3N3AC 4AROA 1R74A 1QLEC 2W98A 3BORA 5LA6F 4WESA 3NT2A 1GO2A 1IOLA 5KDDA 3TR6A 4XKJA 4MW0A 3U40A 1C8VB 5B2ZA 1NXSA 4EI2A 1PQ4A 4OY3A 1RBMA 3M6FA 3OTWA 2FPRA 3RVKA 1SVMA 4B6PA 5ULLA 1DEAA 1R4NA 1SAYA 4JP5A 3H8VA 5D5QA 1KBQA 4M55A 4O5AA 4EHNA 1J8MF 2JJ2D 4BJ1A 3DEFA 3H2GA 4R3NA 3TLAA 1OX5A 2FEKA 3AFMA 4KCGA 4DPKA 4X9XA 4BV2A 3PFBA 5DI3A 1S2NA 4DQVA 3HJCA 3R3XA 4KJXA 2CL5A 1M4UA 3AG7A 4F3CA 4U0JA 4GLBA 5MFZA 4O4HF 1PJBA 5HE9A 2V7EA 3CE9A 1E6KA 4QU5A 4LZOA 4AF8A 5AMXA 2O2EA 4D41A 3IJRA 3GHYA 4CNBA 4BASA 1XTVA 2A1UA 3DT8A 4TKMA 1GQ2A 3A26A 2VBGA 3HBJA 4GO1A 1GHTA 1AB5A 3F73A 5GINC 1RABA 4L6AA 4K40A 4LFCB 2WF7A 5EBWC 1FFXA 1G3UA 4US1R 3JAMN 3JY6A 1JEAA 3TQQA 4F93B 5KBYA 1E2NA 4G81A 4BE4A 4MO2A 4FS3A 2ZGVA 3NOQA 4Q1FA 3U48A 3MJ4A 1AH2A 1C1XB 1LLFA 3FYUA 221PA 2Q6IA 3C3CA 3P4XA 2WA4A 1JSXA 1YDWA 2FW7A 4G1MB 2I1QA 4YLEA 1FC0A 3IQZA 1RPTA 1G4YB 3ZZMA 4CFZA 5CA1A 2WINI 4TM8A 4UOQA 2CYBA 3L7MA 2UUPA 3W7TA 1D8TA 3QKWA 4K6HA 3K08A 1MMMA 1M1KH 1KHTA 3DWGA 4EA7A 3TN7A 1XTKA 3LA6A 2A4KA 1DG3A 1TIBA 2WEKA 5B3SC 1GPBA 5KHOC 4KE9A 2B3TA 1I33A 1G42A 4GZ3A 1Y37A 4TL8A 4M60A 1N7IA 1EA5A 3TRHA 4LFBO 1QVGF 4M1YA 3TLKA 3NS7A 1FLAA 2KQUA 3LWBA 3C9TA 5EJAA 2V7UA 1GGNA 2W37A 4DJTA 1BD3A 4ZAZA 1WQ4A 4B4WA 1OFUA 4FFSA 4FNGA 2DQ4A 3ZE6A 5K20A 4Q9KA 3C1OA 4J7UA 1MNQA 4N54A 5P21A 4I4TB 3AZOA 1HGXA 2G08A 5JCPA 1F6WA 1V43A 1SG6A 3BFXA 1JNYA 2JJ2G 1Q0ZA 3HV0A 3LX6A 5GJCA 5FPYA 1DAIA 2QL7A 2QQ5A 3HO1A 3AERA 3I92A 1THMA 4X6YA 3MJEA 1Y8CA 5KNCH 3PPWA 3TIVA 4NKRA 4MYTA 2HX1A 4AMUA 3I5MA 2VTEA 1Q3KA 4EHFA 4DPMA 1RZUA 3HFSA 1MJGA 3E9ZA 3HNRA 1T9HA 4LQCA 3O8NA 4IFTA 4DOMA 2IEYA 3D36C 1QFXA 4QDTA 1TYBE 4C43A 1R9MA 3F9IA 4UDXX 2Z0MA 2XCSB 1Z63A 1T8RA 3KEOA 1GO3F 1E2UA 1XQ8A 3F7VC 4X1YA 3H9BA 4Z4IA 5GIOC 2PUDA 3C15C 3UJDA 5K1ZA 4D97A 5HRAA 2F9ZC 3PA8A 2GZMA 4PRYA 2IVFA 8ABPA 3X3HA 1J2RA 2B7BA 1O8BA 1MJFA 5TGDA 4CU5A 1KZ1A 5HOEA 1SQQH 1VMKA 5TVKA 4BGUA 1Q22A 5TC4A 1NX6A 1XX6A 2W42A 1ECBA 4PLVA 3T61A 4QBKA 3A3KA 3AJ8A 2XVAA 1SHKA 3RYTC 2QJFA 1W5EA 3KPJA 1ISPA 5FP0A 3ZE9A 4BB6A 4X7RA 4IQ4A 1QFYA 2IW3A 2PL5A 4BFXA 5LOVA 4DR5O 4FB5A 1FNJA 3T3NA 1Q19A 1KEWA 3WJ7A 4KSCA 4NAHA 4I55F 3MBKA 1W49A 2V7GA 1U6IA 4WFBV 3GUCA 4M2LA 1YASA 3AUXA 2FSVA 2IY9A 3AMVA 3MAJA 1R4AA 4HG2A 3O6VA 3TZEA 3V1TC 1HE3A 1JLLA 3WNCA 3UV7A 4ZDWA 3VVLA 4ADSG 3TCXB 1GA4A 5KSWB 4DW1A 5JISA 4WZAE 3IXQA 1F1JA 1N6LA 4PZ0A 2WT4A 4JB2A 1GN4A 5CB4F 4LF9B 5FWYA 2OCCC 1KJ8A 2OHGA 3VZSA 5FL3A 1CP2A 3BVPA 3HMKA 4A8HA 4FUQA 2PLAA 2AC7A 3G80A 4H1WA 3G1WA 2CLMB 5KNLA 4J0JA 3U4MA 3M70A 1K34A 1T4GA 1KSHA 1KYOF 5BSVA 3OEHA 2I3ZA 1A77A 3TNLA 2JLYA 1IMJA 1G7TA 1ODTC 4GS5A 1U1IA 3Q5EA 3HM2A 2IF2A 4RO2A 5GZ3A 2EZ9A 3QVLA 3VYVA 1HDGO 4YV0A 4L6IA 1V3VA 4HV4A 1PL7A 1NI3A 3ASYA 2F55A 5REQB 3P0ZA 5A9TA 4JUDX 1P3Y1 1KQFA 2H5JA 1TC1A 1DIGA 3AG2C 3AUYA 3VHLB 5LP6A 1A50B 4GLJA 3WLMA 4ZVRA 2F4VO 1U3CA 2C9OA 3U13A 1QP7A 2VDQB 1YNSA 4I5IA 2LCQA 3ZWVA 2M7WA 1FYWA 3BFJA 5FJ4C 1JB1A 2PJUA 4N18A 2I2FA 4MMZB 2CXTA 5LQRA 1M73E 4ZIRA 2FSGA 3ANMA 1B74A 1WXQA 3CTMA 4RV5A 4F6RA 5HY1A 3WC4A 4E30A 4Q7KA 1M1NB 4ZQGA 2GF2A 1EB9A 4US0R 1WOYA 4YI5A 2OR3A 5L3QA 2QV0A 2HHAA 1E9SA 5JNLA 3WWPA 3J81N 3N2YA 4EPRA 2MSWA 1YAHA 3HRKA 5A4AA 3ORQA 2PS3A 4FCTA 3G9TA 4H0CA 3MM4A 3QF7A 1YMQA 5THKA 1T3LA 2Y1KA 2FEAA 3A1NA 3R75A 4S24A 3ICEA 2Y9PB 1LD3A 3IPYA 4CI0B 5AI0A 5FLXA 1WP8A 1ULUA 4PV7A 4I9HA 4BV9A 5B3AA 2J3HA 5FLKA 3K0AA 3F9CA 2C77A 3A6FA 4JLWA 2PZAA 4ISCA 5J23A 3GJQA 5HTKA 1X14A 2ROQA 2YBEA 1XI2A 5BY1A 2AFIE 5AICA 1HNZO 2O8BA 1WVIA 1F3OA 1S8OA 4UC0A 3ESXA 4IO0A 2I6GA 5TMDA 4DBVO 1SKVA 1SGWA 3LSQA 3ZD8A 1QG6A 3CLKA 5TQ2B 1QOPB 2Q9UA 2GOYA 4KTTE 3QX9A 5DO9A 2I6DA 2WR8A 1XZHA 3BGOS 1F2TA 1U1FA 4DLBA 1U0JA 4RD1A 2ADFA 2PKYX 3KEMA 3ROQA 3VOSA 2IIBA 3CCVV 3IR7A 2EL7A 5JZBA 4PZ9A 2IXDA 3DD1A 1E3SA 3OZXA 5IM4F 5F23A 2Q07A 1E7MA 3PQ8A 3R6LA 1XQWA 4XX1A 2HRRA 1E4EA 2HHJA 2VL7A 1D4FA 4DDWA 4LF6B 2OBMA 5KKAA 3FUXA 4BBJA 3C74A 4FR5A 5E9WA 5KCMA 2P9QA 5TQ0A 1I7LA 1MAHA 3FI0A 4RC9A 1V54C 2RB9A 4EO9A 3OC0A 2YZGA 3RC9A 1IIBA 3HKDB 2E3CA 5HGJA 4RQFA 5KVSA 4FM2A 4Y6QA 2FPLA 4HX2A 4IVNA 3F5WC 5A4MS 2FWAA 2ZIUB 1P72A 1AE1A 3PX2A 3NDJA 1NSFA 2YXLA 3MWEB 4YDQA 3FRHA 4D3SA 4EECA 4BR6A 5JG7A 2HP3A 4WECA 1OKKA 3CX8A 3KXDA 1X92A 2X2OA 2HWXA 1O9BA 4LJLA 3FJYA 5BW6B 4KVZA 4FWBA 1YVDA 2H1RA 1B1AA 4CH5A 4Y1FA 2NO0A 2VQFB 3KXKA 3OZCA 3Q3IA 1R66A 3IEUA 1QCEA 2QKYA 1IK6A 4YBZA 3WLPA 2ZSDA 2XCRB 3BGWA 5LIRA 3E1YA 5IJXA 3WOVA 1EFPA 1Z7GA 4A8JC 4F7DA 3GJTA 1GQRA 4ATNA 3H2ZA 3BA8A 1XDWA 1J24A 3WB9A 3Q8LA 4FOOA 4PYRA 5JSFA 4KHPO 5H3LA 2PEZA 4RJTA 1NXXA 2J48A 3RC3A 1YJWV 1IM8A 3ZK9A 3R77A 2GK3A 1LF0A 3OE5A 1N0WA 4FMDF 1U4NA 3FVWA 1RJWA 3MFQA 1JQ3A 3E3OA 1ORIA 4CC6A 1B43A 1GK9A 5LDHA 3W3AA 4JQZA 2XMZA 3DE7X 3FKQA 4G63A 4YAFA 2AEEA 5JBNA 1J2YA 5BT8A 1AG9A 4F9EA 2CLOB 1IBSA 3JSNA 5B1DA 1ZGGA 3OSUA 4AVYA 3TQTA 2JA2A 3TF5A 1YTFB 3IH5A 4DB4A 1J56A 3RYFA 3M9LA 3V1LA 5CNJA 1HR0B 3WRWA 3EY4A 5F4BA 4IJKA 2W90A 4R4JA 3WGLA 2PS1A 1GZ3A 2B1GA 1NWHA 2D5AA 3FCSB 1B06A 3I9MA 4L73A 2P91A 1T9DA 2NNUA 4S12A 1CR2A 3GLGE 5J59A 2RE8A 4QTZA 3AUFA 1BHO1 3LHFA 2IYYA 3ETJA 5K6RA 5DPMA 2HRBA 3EZYA 2WICA 2W83A 4ZCTA 5JBQA 5KVQA 3UMCA 4OD0A 3KPUA 4PAQA 4AZVA 4I3GA 2FPIB 4YONB 1BZKA 4DR4O 4RPIA 1I0ZA 2GETA 3FSGA 3K9QO 1R00A 5TGTA 2HS0A 5AKKA 4B33A 4C5CA 2GDZA 1DOZA 5HKAA 5AJYA 4QPDA 4BB0A 1V7PC 5DHQA 3JVUA 5A2QM 4BQPA 1UQUA 3PQ4A 4X65B 4C8EA 1DBPA 3EFBA 1SUBA 4IT5A 4EITA 5EIWA 2JZCA 3GDWA 5CN0A 4TSFD 3F74A 4R68A 3H1BA 3TYXA 2PUWA 1A97A 4MKXA 3X1XA 1CE8A 5JARA 1P5HA 4EW2A 2QKAA 4H0FA 4UTRA 4MVWA 1XZDA 4EG4A 2HSJA 3P9SA 2NU8A 3QF4B 2H1FA 1GARA 3IVRA 2AF4C 3LRXA 2BZ1A 4JAVC 1FL9A 2C2GA 2IYSA 3A6GA 1E3QA 4QNNA 1Z0ZA 3WICA 3GUUA 2VQ3A 4HUQA 1R0SA 4G5SA 5JNRA 3JQPA 4RQBA 3VX3A 2XJ9A 4V2IA 3MDSA 1C1DA 2E1RA 3KYBA 4EO4A 3G5MA 5A5VA 2QI9C 2EF1A 1E60A 2CTQA 4MPDA 1PPJH 1G2OA 1X52A 1TGYA 4HK4A 2NQ8A 1DWUA 1V7QA 5CCDA 3C98A 3DEHA 5AM1A 1YFZA 3BRQA 3EIQA 1H9CA 2BGIA 2NSJA 4HWPA 3AETA 1JKXA 4M0PA 5EMNA 4QD3A 5DGXA 3CN7A 1R4NB 2B61A 4ZHSA 3BXZA 2YQ4A 2R751 3NO4A 1H2FA 4PYJA 2Q2OA 2OTMA 1U8AA 2E5LB 1KKDA 5IDXA 2Z2ZA 2VRCD 5DTJA 4U7DA 1GUDA 5DGIA 4WZBE 2VJOA 3G8DA 4GX1A 2V4DA 4U9UA 1CQIB 4Q24A 1JDJA 1DEKA 2PMPA 1O97D 2C8LA 5KQSA 1AKEA 5HG0A 2Z04A 1SRQA 1ZEJA 4MQMA 3OIUA 2PUJA 5T57A 2AG6A 3LWQC 2W00A 4RHEA 2IHKA 2NO9A 1A4RA 3Q4HA 5FX2A 1ZW6A 4FDTA 3AIKA 5C7IO 1N2ZA 2A1UB 4ND8A 1W35A 3G7SA 4XRRA 1G8MA 3WHKA 4D98A 1NY5A 3E81A 1IHXA 1SULA 1RJGA 1TYZA 1IN4A 1FFXB 1YZQA 1X7OA 2JGDB 4CM1A 1OZHA 3UM7A 2XTNA 3QKTA 3RARA 3FW1A 3W78A 4LXGA 4JC4A 5DM4A 3KSRA 4BQIA 3LXMA 4BMZA 4L74A 1Y76A 3SP1A 2PX8A 4WFAV 5E7QA 1CSEE 1G21B 3ICQB 1GPMA 4TSFG 3PGVA 3EVDA 1NN0A 3W2IA 2HK7A 4MYCA 5ES3A 4BKMA 5TVGA 2I22A 3F98A 3FR7A 3UAYA 1AJPA 1N78A 2V98A 1ZRNA 1PJSA 1KL7A 4HH0A 2XTJA 4Y6OA 5BRAA 1UQTA 3TS1A 1NE2A 1TJYA 4D8TA 3K03A 2WSBA 2FOIA 2CBZA 2NQ2C 2HS4A 3KNZA 3AFGA 4D5EA 1WUIS 4C3ZA 1M93A 4Z7NB 2WJYA 4YASA 1VF5B 1P7PA 2P67A 3TE7A 1FPOA 2YUAA 5KINB 3CNBA 2QG4A 5B2FA 1ENZA 3IVGA 3L1VA 2H11A 3A4MA 4MVJH 2OIGA 4RDIA 2ANCA 1WUHS 2HR1A 2X1MA 2V0GA 2OE2A 3LT1A 3HBMA 3WGTA 2CJXA 1J5PA 3DEIA 4OHRA 1VJ5A 3OUTA 3NALA 4X88A 4D7AA 2ZYIA 4REOA 1T10A 3PGXA 1ZJJA 5J4KA 2P62A 1E79D 3WB1A 1CRPA 3AG4B 1EH5A 5CX1A 3Q2IA 2CB9A 3KSMA 5BRNA 2C2KA 2WB4A 1MABG 4XD7D 4X6XA 5CDHA 1VPDA 3MYYA 3NUGA 3DP9A 2HAEA 2FQXA 1BNCA 3VZCA 3ZVMA 2HSGA 5DCVA 4QA9A 3TNFA 5EMLA 3GAFA 3IODA 3U6BA 4KVFA 3E3AA 4DLRA 1G2IA 3O4HA 4EKEA 3A37A 5I8ZA 3AERB 3ZH2A 3WOHA 4S1OA 1PF7E 4JJKA 3EQZA 3H1GA 1BCCH 1RP3B 1HDRA 4KQGA 2ZUCA 2YWJA 2Z6AA 2ZIAA 4Y6RA 3R3JA 3KELA 4QTTB 3VVCA 1R0CA 4W4KA 2DQYA 1XYGA 4R1SA 1SMKA 1I3OA 4C21A 3EW7A 5B1AB 2C4UA 4KXYA 1KVUA 5J4HA 3MT8A 1BGWA 3I6QA 1JH9A 2ZXWB 2XUHA 2EHJA 2GRUA 3SIXA 2IZ7A 3DZIA 3DE1X 1YOVA 3ZCTA 3PD7A 3CD6V 1SCNE 3ABQB 1VKZA 3PUYA 4V3BA 5J3JA 3EXFA 3AIIA 2I1VB 3H9QA 2HA7A 4CU2A 3K16A 5I7SA 3KVYA 2AXQA 4EVIA 5SYNA 1N5LA 4DCVA 1JTEA 1U2DC 3EIXA 5EG5A 1Q0LA 3UB3A 4G85A 2P35A 2JFFA 1XOIA 4A5UB 5LMUB 3TUZC 2HM7A 5IULC 4IH9A 4RHFA 3OP4A 4N03A 1XHOA 4MRVA 2R25B 1C0PA 3BWVA 3C9SA 2X42A 2HIGA 4EJ6A 1XC7A 2I03A 2XIQA 3PHHA 3OHMA 4ZOLA 1GL7A 1XMSA 3A9VA 1FW6A 3CNNA 2GN4A 5LOVB 2CEKA 4HN4B 4JC5A 4DG9A 2ZDIA 3WKBA 2BEWA 2JAUA 1SQPH 1UKZA 3ZGYA 1KQNA 3OZSA 3NVMB 5K05A 4NJMA 1TA8A 3E9YA 4L08A 3EXEA 2W6JD 3GLQA 4HDCA 3LUDA 2WHRA 4E22A 3DO6A 4FGZA 4RMJA 1U7XA 3JQ8B 1J20A 2PMWB 3E1KA 4M7OA 3B82A 3A4VA 3LKDA 1CR4A 3K09A 5HRUA 4WEQA 5JY1A 5NLLA 4TT3D 4XJXA 4M37A 1F51A 1TPZA 4WLOA 2AQ8A 2GF0A 4H7KA 4B4VA 3BGVA 1E79G 2E5WA 2OCAA 3OHPA 2FL4A 4RNDB 3ICCA 1YI2F 4LBVA 2ASVA 3GPLA 3CO5A 3O4JA 3W79A 3B9PA 1E18A 4PZPA 2OVBA 2OUKA 3GLUA 2BR5A 3VR5H 1U8TA 3Q15C 4Y0VA 1DEHA 3U7RA 4UULA 4CKZA 3CX3A 1EGVB 4EP1A 1EWVA 1RRKA 4QTUB 3CCJV 1P2DA 2VHZA 4EY6A 4RA9A 2G82A 2K7FA 3GWKC 5T4BA 5BV8A 4QBTA 1Y7LA 1YITF 4LZLA 4E08A 4M1KA 4EB6B 1ZGJA 4F12A 5DCYA 4LTNA 3HM9A 1T3SA 2R6HA 2Q3MA 2VQEO 1V8DA 2QNBA 3EGOA 3UAXA 2AG8A 1MC8A 5ALUA 2BT4A 3BB4A 5H59A 1JZTA 3L0YA 4G0UA 1OLXA 5F33A 2VXCA 4QQNA 5CD9A 5E4JA 1VMGA 2PE5A 1LEHA 3HRIA 2R86A 4DREA 1G8SA 3FOZA 5HOQA 2ZITA 1PJTA 2R8BA 3IHKA 1PSDA 3ED5A 1R6DA 2AYYA 2XY4A 2Z5FA 1U94A 1JEJA 3CCMF 1O94A 4EVQA 4R6ZA 3FVRA 1V4VA 4WACA 3V34A 5JCZA 1XQYA 2XQFA 2YV4A 2YJZA 1W5BA 1XCLA 3EPJA 5IYZF 1OV6A 3I2GA 2HJGA 4Q12A 4E09A 1P7ZA 2BELA 2Q0HA 4L8YA 4F6RB 1PCXA 2PPLA 1OOEA 1P84F 1NNSA 1ELOA 4RUEA 1G66A 3V9AA 2V5AA 3HNOA 4AI6A 1QHEA 3IP6A 1X7WA 3FGNA 1N9GA 3VJLA 5BN1A 1P5RA 2YWEA 2ZJZA 3GJ6A 2DUWA 3WPXA 2AJ8A 1LWOA 1PFWA 4KGVA 5JANA 1NUPA 1LI7A 2V59A 4ID9A 3O94A 2XUIA 4IEIA 3HGQA 5E1OA 3NWPA 3K0AB 3VSDA 1T0HB 4I0XB 4AQDA 1HQKA 2Q62A 2PZKA 2AQIA 5A71A 4FYHA 2W6JG 4BTEA 4EBFA 3R7AA 5DXJA 1LFAA 2C4KA 3RWOA 1KSGA 1RHKA 3NIDB 4D0GA 3KOXA 4OQPA 2EJWA 4CUKA 2VUTA 4TT3G 2WDPA 3PC7A 5FO1A 4B3TO 3G4SF 2KGWA 4A0RA 2NUPB 1M34A 1F2TB 3GFQA 3RH0A 5AW2A 1VPWA 1DTSA 2WWWA 3J81M 2E3JA 4FLWA 5A0FA 2X1VA 1ZCBA 4MUXA 3SC2A 1QQBA 5CYPA 1USWA 2OHOA 2W48A 3SFTA 4EG1A 1XHLA 3OAAD 1JCHA 1E4EB 3D5QA 4R5MA 4RTJA 3TO5A 4IF4A 3I9JA 3LDUA 3HLYA 2P4VA 1VRVA 3D7SA 1TAGA 4EX7A 4INPA 4JXXA 2AG1A 3VZBA 5EESA 1QRSA 4P81A 4NOKA 1ONSA 4YQYA 2O20A 1GYRA 3HEBA 1D2NA 1XVLA 1SVOA 1TTQB 2IXGA 3PFNA 2EJRA 3TETA 1OAAA 2H06A 3H2SA 2OXEA 2FZEA 4JD5A 1JR3D 3T3HA 4KQFA 1PWZA 1D0VA 2BDUA 3HXPA 4POOA 1BFDA 4HNTA 1U0TA 2HK6A 3OLVA 2EJVA 3GEIA 1A8QA 3P2JA 1Q83A 3IL2A 1PWYE 3OR7C 2GA8A 3ZOPA 1CWUA 4KHZA 2XDWA 4G1VA 3QUBA 3FTFA 2F23A 1VQMV 1N92A 2P8SA 4I46A 4RE6A 3O65A 1FXWA 4IZOA 2JFUA 3MINA 3C5CA 1TF7A 4OJQA 1QAHA 4J6EA 3CCRF 1KAOA 4U00A 3FOFC 4UHFA 4ZQIA 3DF7A 3KETA 1AGYA 1Q1ZA 4ZJPA 3HZRA 2D2CB 3HB4X 5JAUA 5FB3A 4XLLA 4CTJA 2GUWA 1EFPB 2G6TA 5ALWA 2WD7B 2YDYA 1X8LA 2A35A 3MYRA 1N32O 1ZIPA 4W6QA 1GSHA 2FN4A 3C6ZA 3RRBA 3O8OA 1M72A 1KDVA 1YJ9F 4MITA 2R68A 3A2LA 4WZ6A 2A84A 2WIDA 3K31A 1RBQA 3EHDA 5E4YA 3D7LA 2M1ZA 2AHZA 2WIKA 2C8VA 2QMEA 3HKBB 4R40A 1JLSA 3D0QA 2XVMA 3DDHA 1YV9A 4J03A 2CE7A 1NI5A 4XUDA 4Y1RA 2Y48A 2QA4F 4NYJR 1MCZA 5DW0A 3UGTA 2PR2A 3PDCA 4HRXA 3RYFB 1IU9A 1GZSA 5F1YA 2BPOA 1PUXA 1E9RA 4WUVA 5LMNB 3ET5A 4FYVA 1J1ZA 1X9GA 1X1EA 1KFJB 4LG1A 5CU7A 3GG9A 2A9FA 1GAEO 2HLPA 4B8YA 2VHVA 2VAVA 4DN6A 2BRUA 3B48A 1K7EB 1NMQA 3L6DA 2N9UA 3R0IA 3OAAG 3KHTA 1M1ZA 4OK5A 5C5DA 5IXSA 2Q1XA 3RNLA 3LT0A 2ZE8A 3CYQA 3F2IA 4PHTA 1PLKA 1ESZA 4NESA 3VPHA 4YT4A 3E7PA 1R8YA 3F1KA 4PWTA 3ABSB 5G02A 3AJEA 5ED4A 2PXHA 1V35A 1PW5A 2RJNA 4KPUA 4DV6O 4ML3A 4L27A 4L3VA 4OBXA 1O95C 5IDJA 3VGJA 1SCKA 3TLGB 5K3FA 1NU8A 3EH1A 1KDTA 5DX0A 3UWMA 3DONA 3K1AB 2GLZA 3OT1A 3LE8A 4HS9A 2W9XA 4ZKIA 4N0MA 4TYNA 5LLTA 4TKUA 3IMCA 5KUMA 4K3UA 2JGJA 1BDHA 4AZSA 1NNI1 4HDMB 4O1MA 3MGBA 1U3PA 2YIDA 4HC4A 3ONEA 1KE2A 5CFLA 3OQBA 2HWWA 1VL1A 2FMFA 4Y1GA 2OV1A 2NU8B 3QXHA 1W46A 5EB1B 4WSOA 1BW9B 5L3VA 4RANA 2GN2A 5CPFA 1L8OA 4B3RO 1VBFA 2D0IA 4ZVKA 1Q7BA 2J08A 1E0KA 1S5PA 4TL9A 1MGPA 3AVVA 2DSNA 1LWNA 1ZU5A 4B2PA 4HUQB 2ATVA 4O4JA 4RHYA 3NHUA 5ESRA 1ULAA 1YC5A 3LW7A 4QRIA 4I8DA 2W2LD 5JHHB 2R87A 2EC5A 1Z0FA 2BAGA 2NADA 2UYHA 4DUGA 1NYQA 1RHRA 1PNTA 4R8LA 2V0CA 2ZIOA 2NGRA 5JPDA 4XQCA 3TAUA 3DSRA 3DEAA 5K8VA 1QDUA 3AHEA 3OQHA 4JL5A 1USGA 3H75A 3ETNA 5JASA 5HX7A 4XIYA 2XADA 4HNHA 1FP6A 1T1GA 5DISB 1IYZA 1YTUA 1VLZA 3U44A 4CCSA 2BBTA 5HIIA 3RROA 4ZA2A 4M1SA 1D8AA 3IAEA 5JNTA 5C1PA 4CR8A 5IASA 3CLTD 4A23A 3S2FA 1XEFA 6Q21A 2F3PA 1EHYA 3KS9A 3NHMA 4BO7A 1PZHA 1I10A 4P3KA 1G6Q1 5FAXA 3R9WA 2EX0A 1QVZA 3D8SA 3BJEA 1GTG1 2ZBFA 3NORA 1AQ6A 2EGGA 4M1TA 1PSZA 7ADHA 2VWPA 1RI3A 5HP4A 3MJCA 2RIRA 1EQUA 5CW1A 4JZGA 3GROA 121PA 1BHBA 2IYTA 4FBLA 5DVZA 4D3YA 1WY7A 1WMFA 4BMPB 2Q27A 5I7OA 2P2DA 1G3MA 2BEVB 4ZWNA 3TJTA 1CRQA 1KMQA 4LHVA 3B3JA 3NLLA 2GARA 2PFKA 1U7ZA 3OBWA 4D80A 3U26A 4UD2A 3QBJA 3NRBA 2AXTZ 2BCEA 1QB8A 4NNPA 4P2GA 1PF5A 2HWUA 4UTNA 3WLTA 2Y4OA 4E4TA 3MD9A 1YDMA 2K4MA 2JFVA 4HYOA 1J97A 3ZDXB 2MU1A 4C5AA 5TPZA 1SC6A 2TMGA 2I54A 1MVLA 1BCRA 3ZCPA 3ZMSA 2CXRA 1EINA 2FTKA 1BE8A 2PO7A 1ESEA 5TARA 3BABA 2HNKA 5I9SA 5GM1A 4V1CB 4HAVA 2ANBA 3DXYA 1AK1A 2YHIB 2HVJC 1CC1S 3U09A 4EKDA 5DHTA 2NTNA 1D2EA 3W5SA 1ACMA 1Q8RA 3KUDA 5CITA 3MHHC 4MIOA 2Y8EA 1ROPA 5JO0A 4EL0A 3QOWA 4Q47A 4BC1A 3D2BA 2OMKA 3TCUA 1BFKA 4WXRA 4QYIB 3V6LA 1QIMA 2UZAA 1T2CA 2FUKA 2A9HA 4MVJF 3SVLA 3W3ZB 1XD9A 5B6JA 5C8YA 3RU3A 3CMMA 3HKEA 1CY6A 5LZ9A 1L7XA 3DBHA 3BBPA 4A8PA 1S02A 4PONA 2CLIB 4AJHA 1FPMA 3TRJA 3LBIA 3QRWA 5A1TA 3FFXA 1KMIY 3QH4A 4B7KA 5G0VA 5JAPA 1WJGA 1G6OA 1JECA 2I2DA 1X3SA 1GAQA 1SBYA 2HJDA 4JVNA 2NXEA 1OX4A 4IYRA 3RVYA 3L43A 2QXTA 3ZDCA 3CJHA 5B55A 1XN1A 1M1YA 1Q6IA 4Z8XA 2WIFA 3IQEA 4O4IB 3TCKA 5CBPB 1ZUWA 4HAMA 3MVEA 1KP3A 2BISA 2ZUBA 4QWMA 2RGEA 2E4WA 1UFOA 2C3MA 1SHJA 5CB8A 3GEHA 1SFRA 5HY2A 2Q49A 2YH2A 4ZXPA 2BSQA 4CIXA 4Q03A 2EV9A 4ETNA 2G0NA 3MFYA 4BEJA 2ZR8A 3KOUA 3CMAF 2VS0A 4GR5A 3UWPA 3GA0A 3S0HA 3GXBA 4M0MA 2BM1A 4FX2A 1YOVB 3E7DA 4FZ5A 2PGXA 4RXTA 3ITEA 3ISVA 1BVRA 2ISSD 2QI9F 4Q4JA 3NKLA 4MS4B 1TMOA 2E37A 4AI8A 3CYPB 2AXNA 3UQZA 3N2KA 5J47A 1RFGE 4X90A 5AKLA 2X0NA 3QOXA 3VR6A 4FXOA 5C34B 1AIPA 5EIOA 4WFHA 1AI6A 4QQRA 2ZAYA 3LECA 4HDKA 1D4ZA 1K33A 2BJWA 1NVPB 5DLEA 4LOIA 3I34X 4PA9A 3DXRA 4MVYA 2OA0A 5D3ZA 4G9EA 3TXXA 3SF8A 1Q14A 1ORHA 5JW6A 3M3DA 4HYTA 5A2QA 2JK0A 1U3WA 4MIYA 1J2EA 5EHIA 4BRWA 3NK7A 1Q86H 3U1VA 1ONOA 3QFFA 5L3BA 1DXOA 1R6AA 4LOLA 1DAOA 4F4DA 3CCBA 4JI6O 1G5IA 3EZXA 2XSZD 1EFTA 2GCEA 2PQ0A 1ZH8A 2HHLA 2E89A 4PICA 4U8HA 4U4AA 2RNBA 1LSUA 3BL5A 3STWA 2NZXA 1OHHD 3SKXA 3C8HA 4FHFA 1NBMA 3B3QA 2DWEC 3KUXA 4NZOA 2QYOA 4OB8A 3G2KA 3HWRA 1L4GA 3TH5A 1RYEA 1OZ0A 2WIJA 3EMKA 2X23A 2DKNA 4DA0A 3KZIZ 4MW9A 2WG0A 3QJ5A 4JLDA 1GR0A 4UVCA 1WZCA 2V6GA 1KYTA 1QAQA 5ARBA 1XCJA 1RLJA 4IDHA 3L73H 1OV9A 1SKBA 4WBNF 4TYPA 4KFCA 3WSVA 2FSFA 4YRSA 4DA9A 1UJ2A 4MLPA 2OHHA 3ABLC 1U8EA 1YHYA 4RABA 3I2KA 3W06A 1W2HA 4UMEA 2GVIA 1OBVA 4JBGA 4Z9AA 2WYOA 1C7FA 4A2PA 1PI3A 1IOWA 4C0HA 4KFRA 2WM2A 4TVSA 2QJRA 3J7TA 3BE4A 5IKMA 1K3TA 1TYCA 2WM3A 1H4TA 2J7PA 5AVZA 2B8TA 2OZBA 2B2NA 4LRWA 3GHHA 4NQ3A 3DMTC 5ESDA 3FB8C 1XAGA 1JHZA 3F96A 4KU4A 2COKA 2GPAA 4YV7A 3SWWA 4UZEA 1KKUA 4JUIA 3TAHA 3RWBA 1XKQA 2VP9A 2FJ0A 3HU5A 3JRNA 3PGJA 4Q3KA 1UWCA 2EP8A 3RF6A 4Z1MD 3UW3A 2QEQA 4QUKA 4C29A 4DEVA 5AVUA 2GZDA 4KQEA 5E6UA 2DCMA 2C94A 3GU3A 3JASB 1WOMA 3AV3A 4B5LA 1A9XA 4PSUA 4UKDA 2YS8A 5K0SA 4F5EA 4QM6A 1E3DA 3D1VA 3PDIA 3TIXB 1VQKV 1X7WB 3AHHA 5LL6P 1O96B 4TROA 4BNTA 2GRJA 4CLOB 3G9QA 5KX5A 2I7XA 2V8OA 4QODA 4YJKA 1K86A 3LBFA 5CDFE 4F3NA 2PSEA 1NKTA 4NMWA 4TQDA 4LV5B 3SKVA 2WTAA 1XMOO 1JX6A 4ASUA 1HLGA 3E20B 2W2PA 3LHIA 2ZYSA 4HTAA 3B6ZA 2UYNA 4OXSA 3F0FA 1DTWA 1JHUA 2P5OA 4PRLA 4G37A 1OHHG 1MIOB 2YYSA 1T2NA 3F8WA 4PSCA 3OM8A 4OHBA 1E5XA 4QQFA 4IL6Z 3HCRA 4ZYLA 1T24A 1MOPA 3CRNA 3V00A 4JC8A 4KRGA 5I4IA 1L4HA 1XZGA 5KKNB 3K5OA 2P90A 4E13A 3ZO8A 3D54A 4HGOA 2ISCA 2EZOA 2FWBA 5JYDA 2I2AA 4II7A 5AOCA 5KEIA 2Q6KA 1RSOB 1NTMH 3LDTA 2B98A 5BSMA 2VK2A 4OBBA 1OA0A 1IEWA 4YLYA 3AHFA 3H2KA 1EBFA 5BSHA 4ENPA 3MRTA 2FFJA 2H2FA 1SXJD 4LVUA 4P83A 1OXUA 5CHEA 5DRYA 1I9CA 3ADDA 1MO2A 2F17A 3INGA 3LUGA 4DLTA 4XYMA 2HW8A 4I4CA 4J29A 4K6KA 3TZQA 1NE7A 3BD7A 1M33A 2VH2A 3NHYA 2CNNA 4KREA 1KOGA 4BAZA 1Q44A 1BD4A 4GKVA 2M9MA 4FCCA 1HDYA 3GLFA 3UUGA 3VCZA 4YMTA 1WDLA 3ZZ0A 2B92A 2ODEA 3SG0A 1OF1A 5F7XA 4HEQA 3GDOA 1O9HA 1YJAA 1A8HA 2KW5A 2VLIA 4QFMA 1CIPA 4GXTA 2EILB 1PHRA 3ADBA 5ADVA 3VTKA 4EJ2A 4GPBA 4COKA 4Z1MG 3JYOA 3WL6A 2LGWA 4UW9A 1M2EA 3FOAA 4TXMA 4FZJA 1SCQA 4YCJA 1JFVA 1ZGHA 4A0GA 4F11A 3I1JA 2KJQA 4UB6Z 5FLYA 2HBZA 3UHAA 1V45E 5AVMA 4QOJA 4IFBA 2R9VA 3PBKA 5IFLA 5K6TA 1YL7A 3S28A 3WA7A 1ZRHA 7GPBA 2R00C 3SZUA 2R48A 1EWQA 2ZIXA 3MBOA 1KIMA 1V5WA 4MRAA 3BMQB 1Q86W 3K8QA 3NHKA 4IDGA 1YK0A 4E51A 2H2HA 5EQDA 4A0FA 1TQHA 2J9FA 2H1CA 2OFWA 1KI1A 1OTYA 5LXTB 2HA6A 5EPOA 3OKAA 2CGNA 1MJHA 4UVIA 1Y3CE 3GEEA 4E2LA 3FKJA 1FP2A 3QUCA 5EKDA 4N0EA 3IEQA 2C0PA 4D9IA 3H1JH 5K3SA 3V4VB 3H0EA 3H1KH 1VIBA 5FOSA 2ZSAA 3F67A 2QVXX 3UH1A 1OCCB 1FDOA 1KK0A 1HL3A 1V8BA 3QUSA 4JU8A 3RLFA 4OXKA 3ICPA 3C6QA 3DMNA 1NRXA 1D4AA 2VDWA 1OBOA 4TMFA 1UC4B 3P32A 4CE6A 3UOGA 3ZY5A 3K57A 2YTZA 2ZYWX 2WFLA 4RESA 4BP9A 4D4GA 3BQMB 3CXCU 3AJDA 4DLUA 3RN4A 2PRZA 4ZYVA 1JIQA 2QD4A 2DFNA 1DJPA 1VCMA 4I08A 1YJBA 3IDZA 2AHOA 5EFZA 4BGIA 3UUEA 1J0DA 2WQ6A 3R6DA 2Z5UA 3OCJA 4UV9A 3DZBA 2QVLA 5LQMA 2R4TA 4V24A 3GQBA 4BU1A 4DABA 4MGZR 4OMFG 1SZPA 2FUG6 3QFHA 2HMTA 4WA8A 4ZKEA 5BSTA 2DQ3A 4HNUA 1E96A 1IQ0A 1EBOA 4XIIA 3UCSC 2XE7A 4IJ6A 3NV9A 4IHJF 4LRXA 4LYJA 4YJFA 5EXXA 2YKGA 1OA1A 1VKHA 1VQOV 4D02A 5CA0F 1QBKC 5IM5A 3FFBA 2XOKA 3RJMA 4WRRA 4KQ2A 1HO3A 4PIMA 2RK6A 3KKOA 1X42A 2PA0A 3C3DA 5IHXA 4JGGA 1T9GS 3I23A 2AC4A 2BH2A 3QU5A 1JFTA 5FPPA 4JEIA 2B5UA 2QG6A 5IANA 1FFBA 4QFDA 4ZYXA 2XWSA 5IVIA 3LUFA 4MUKA 1T3HA 4XLZA 3F5TA 1MQAA 3K71B 5A03A 1IVYA 3DA8A 4GP9A 1V16A 2NZUG 1S5HC 4ZEWA 2YWGA 4YPOA 4X71A 3JAKA 1NATA 4QIHA 4AY6A 3DTYA 3SQMA 2JH8A 1TDJA 4O4JB 4ARVA 4EGJA 4DLLA 5DEIA 3FI9A 5ETJA 1BH6A 2AN3A 2EX4A 5B7NA 4MV4A 3WBBA 2X1HA 4OYRA 1NMSA 2GAJA 3ZY2A 3HA7A 3U3KA 1T0KB 3B8MA 2B21A 4M8NE 2ILMA 1XNGA 3C3BA 1YQWA 4DEYA 1LBTA 4LOAA 4M22A 4IDBA 3SYKA 4EX6A 1GPNA 2D0DA 3GAAA 4YMGA 4JIMA 4QGFA 4DANA 4K9SA 3TZCA 3AF4A 5C1DA 3R66A 4QAJA 4JP1A 5ALQA 3L8MA 2HMYB 2AH5A 2B4RO 1IV2A 3WZMA 4EGAA 4JTCB 3BQNB 4D79A 1Z0IA 2G77B 4MS2A 1OAOA 4AZWA 5IKXA 4KQ6A 1C7QA 3DBOB 3R7BA 4OA5A 3VHQA 2HP0B 3UPUA 3VZRA 5CBKA 4RDCA 3I0ZA 2JFOA 2BFCB 4DE5A 3EEOA 3NW9A 3HC7A 4NP6A 4ZT2A 1K2WA 2QUAA 4ZAVA 3VBBA 2P9TA 1OC4A 3NV7A 1VXRA 2QTLA 2Q6AA 2AOTB 3P4UA 2AFVA 4JODA 5A3QA 1LPMA 3R65A 1EZ4A 1S3FA 1FBNA 1P1KA 2OBBA 2CFCA 1ODJA 1J7JA 3CMCO 4HNVA 3VIUA 1L5QA 4IVPA 4XM1A 3W4JA 4UM9D 3D43A 4EBBA 5EBLC 3C3MA 1HDJA 4BUZA 2REXB 5DYIA 2OZVA 2XLBA 1OGJA 3JU3A 1ZNYA 2JVJA 4NS4A 1Y42X 1BCRB 2Q5OA 2XB8A 4L85A 2BEUB 3ZHTA 3E9MA 3EF3A 3QVXA 4I1UA 3B40A 1G7RA 2E82A 4QE9A 1PX0A 2OWDA 4C04A 3K30A 1R4ZA 4J42A 1K5GA 1VQ9V 1B0UA 4C0WA 4TRNA 2I0FA 4UPDA 4FFBB 3EGVA 2RHRA 1GTJ1 4ICGA 3NM6B 3Q88A 5K2MA 3A6JA 1YH3A 2V54A 3QTLA 2HH9A 4NXMB 5C8YB 4O4LA 1PE0A 3MMZA 5E1MA 5IJWA 3UA3A 1D2HA 1E69A 3VNSA 1PWXA 2EFGA 3H01A 1ENPA 2HB6A 1WD7A 2XXAA 2NO7A 5CJPA 3VMFA 3RIMA 5I9LA 1UMKA 2UYGA 1UUFA 3D6JA 5LBTA 2BUAA 5AHRA 5TSDA 2C29D 2BSXA 2JNBA 3D8UA 3IFSA 3PR3A 3OT4A 1VE6A 3WPWA 3CJHB 3ROZA 2YJ4A 3W04A 3LP6A 1OSNA 4M46A 2VJLA 2R5NA 3OPQA 1NVXQ 1SUIA 4LWQA 3D8CA 2VTVA 3CPWU 3T4PA 3ZLTA 3FNRA 3KP1A 4MLZA 4DRXA 1ODCA 1DPGA 2QL6A 3PS9A 2B8EA 2Z98A 4AN0A 3BRWD 1TF5A 2OCHA 5HVNA 2ZRAA 3GN2A 3GZ4A 4Y7CA 3GDHA 2Y2VA 1SC4A 1P1FA 7MDHA 1XVAA 3N53A 5CG1A 1PEDA 4WCFA 2WSYB 2ZM5A 4PA6A 4Q9AA 3IPAA 1Z68A 5A7HA 4ZVUA 3I4FA 1WBBA 4M89A 2LBTA 5EY5B 4GL4A 3F5MA 5C80A 1JPNA 1I9GA 1AKQA 3HUFA 3KQLA 4JI0O 5BNTA 1L0NH 3KE8A 1Z4IA 1SBZA 4XQ9A 4B3IA 1V55C 1N5IA 4OGWA 1F20A 3KB6A 5JFGA 1GA1A 3FOWA 4DLVA 4IDQA 1DKOA 1MG1A 3UZUA 4HDKB 3BCHA 4DM4A 1A0OA 5IT4A 1NNUA 3N9IA 1L7AA 5I4KA 2NVUA 2X77A 2VVTA 3GLSA 3OZUA 2GCGA 2XUAA 5JXHA 1QK3A 2QRZA 5C37A 5E79Z 3GMIA 2BM8A 1FS6A 2P6UA 4LHWA 4WESB 2ZANA 3T38A 4UAUA 2I76A 4ZOCA 4DIKA 2CYAA 4RHUA 3THYA 2CK3A 4RY0A 2Q9LA 2DBVO 2Q2WA 2D3OW 5D87A 4D6PA 3BXEA 4R83A 3IO3A 4ER0A 1YHNA 3DFFA 4JSYA 4LYDA 4UDNA 4HDOB 4OXXA 5CNKA 1AKYA 2WMNB 2HBYA 3UUWA 1CPYA 2V7WA 4O0MA 1Q84A 2AB0A 1XRLA 4TSKA 3OX2A 4NR0A 4I66A 2HSWA 1EB8A 3TVTA 1XF9A 2FI1A 1NBIA 2FPMA 1AGXA 1HZZA 1LI4A 3WNDA 4BEWA 3WQQA 1RMQA 4A1OA 1JJFA 2RH9B 3LUCA 2Q0QA 1Y5NA 3R8XA 5DI3B 2QYHA 2PX4A 3GV0A 3VO1A 4RF3A 1MOSA 4M98A 1JWAB 2EEZA 2JCXA 3ZWOA 4ZVPA 5HK9A 4JI2B 4GL2A 5HF6A 1R3UA 4FLUA 1I4OA 4DMLA 2ZWPA 2IPOA 2CDYA 3CUEF 4FCWA 4B82A 4F6LA 1NURA 2WUFA 4BMSA 3M1IA 2ARHA 3E5NA 2MT9A 3PEFA 2X3YA 4KBGA 2ZD9A 3R5XA 4QGAA 1GH6A 4KPFC 3VV3A 4R31A 3M1LA 1GDDA 4K28A 3GQVA 4DCPA 1XWWA 4YHHB 5HY0A 3K5IA 4EG8A 4RHAA 4F06A 2FETA 3DLCA 1G98A 4IGFA 5BORA 4I7EA 5G1NA 2EAUA 1XVVA 5EWJA 2K1SA 3FYUB 3FYHA 3R3WA 3PEWA 4AO8A 5HPYB 3CPJB 4W5NA 3E82A 1R37A 1USKA 3UMGA 2NVWA 4EJFA 1YTFD 2H7YA 1PGNA 5CA1B 4MQ4A 4PCVA 5BWNA 1U5CA 1W0KA 1SCAA 4UTPA 3BIFA 3AVUA 1X25A 3DCJA 3AKYA 4L5JA 4P7GA 4OUDA 1TLFA 4G09A 1WDKA 1XVTA 3SQLA 1CB0A 1YQGA 1BAPA 2DF8A 4ZKDA 4G4YA 3DOOA 1S0UA 4BNZA 5CVEA 3R0XA 3IHLA 4L1KA 4PG7A 2A88A 4LV6A 4OMCA 1A9XB 5AKXA 1FUKA 5B7QA 4KXXA 3GZJA 3NT4A 5F5NA 8GPBA 4F56A 4YMLA 4BIZA 4CMHA 2G25A 3WLEA 2NO6A 4HDAA 2CB0A 2N48A 3DL2A 1KSFX 1E2DA 3ILHA 3WK5A 1EJ2A 2XB2A 1EVEA 4ZOQI 3JAMM 1ZVVA 1WZIA 1Q5PA 3SJAC 2VHYA 2IK8A 2FK8A 2WNIA 3TOZA 5KWSA 2CZWA 2HJRA 5J40A 4K6FA 3ZTTA 4MR9A 3RQIA 2UYNB 1Q7TA 2VTBA 4RUFA 3MGCA 5B66Z 4GE0A 3RTBA 4QYMA 1DTWB 4JLSA 4F5YA 1PIWA 1DGSA 1UMBA 1V71A 3VGPA 1KETA 1H2HA 1CY0A 3RK0A 4HAXA 3IR5A 1C9KA 1LPSA 5DLPA 3UYKA 1SQFA 1NXWA 3GWZA 4RV4A 4UMDA 3ZV6A 3VQVA 4PDMA 4J1SA 4R2LA 3IDFA 3SPJA 2ZBQA 1CY7A 2R62A 1CP3A 3EXG1 2HEGA 2FMHA 4L7VA 3P9RA 3WNZA 2HNAA 4TV8A 3K6KA 3EZGA 3EGDA 3BKXA 1FXHA 3H1LH 5LC1A 1T15A 4GOLD 5I5EA 4NHEA 1X77A 3KDAA 4ISBA 2D7DA 3I9LA 4R1TA 2YXBA 1EUYA 3QFCA 4C9BA 1UXGA 1JDPA 5TJ9A 1FUYB 1S2OA 3FPSA 3OQ6A 5A5EA 1ZA1A 4X1YB 1L9KA 3GPCA 4X8HA 2YWRA 5JXIA 4LC0A 3COJA 1T4MA 3JYHA 4LZAA 3KTDA 1FDWA 3PUJA 2WJPA 1QK5A 2H5IA 1TF2A 2W8ZA 4MT8A 2ZJ3A 5LYYA 2P5YA 3ZD6A 2OO5C 4BRZA 3DE4X 1WR8A 5M29A 3DOFA 4UAGA 1PS9A 5DB4A 5MN4A 5BN5A 4M8KA 4CZ2A 1CK4A 1W75A 3ZXSA 4R1NA 1K7CA 3GLFB 1G7CA 3HYLA 2YNMD 3QE3A 4QVIA 4LTDA 1T43A 3N5KA 4OGGA 2FFQA 3CRQA 2Z6VA 1W36C 3Q0EA 1RLOA 1EQ2A 2QWOB 3DB2A 2R9RB 1A9PA 5I9TA 5EZ5A 3HB3B 4JLKA 1ZMTA 1P62B 5HIJA 2C4WA 2OZPA 2ACWA 4A0QA 1YUBA 3KQWA 2BFMA 1A4XA 2FEWB 1QBZA 1H2XA 4ER3A 2X2PA 2DOKA 1JLLB 2EBOA 3WLKX 5BUZA 1BEZA 2DTXA 4UHEA 3L84A 3MWFA 3FVQA 2ZUSA 1WXXA 1C4OA 3BREA 1YT5A 3STVA 1PL0A 2Y0DA 2ZAIA 3CH5A 3MWDA 1GWNA 5ARDA 2HA0A 1GN3A 1QF7A 3H1AA 1U0LA 4GOKA 5AJHA 2H8CA 4FOLA 5FWYB 2A8YA 3ZWNA 1YBHA 2CSXA 5JMTA 3MNFA 1WXEA 4LY9A 2GTIA 1H94A 3CSUA 4JI5O 3EHEA 1CDDA 1UMDA 1S3JA 1M8KA 2V7QD 3OPXA 1DCMA 2WABA 4TMYA 4OPHA 2RBEA 1HNWO 4QUDA 5CFPA 3SEAA 1I94B 4BVJA 1FLVA 2GX6A 4DV1B 4ICIA 1Q21A 2ZI9A 3G7NA 3KSUA 2FJPA 4LA4A 5IBQA 1J1UA 2QZPA 3PDJA 3U37A 4BX9A 1LVHA 1MIHA 3IKVA 2OK8A 3R44A 3B9RA 2VDWB 4AYXA 2F1KA 2K87A 4F1WA 3PYXA 3I83A 2NYVA 4YMSA 3COPA 5G3ZA 3PGA1 2PWYA 3IBSA 1ENOA 1T1EA 1VFNA 2WFLB 3GFPA 4H7FA 4A5SA 1WS6A 5LP6B 1X0VA 4HZ3A 4K6MA 1BS1A 3WNBA 3D9QX 4QU8A 3TD6A 1GY8A 2B8WA 1XQXA 4QWWA 4PNPA 1UZMA 3MA0A 1CERA 3C3SA 5CFNA 1Q7GA 3B2EE 4RMIA 3HADA 4ZIRB 1GEEA 1GGMA 1N5JA 1YRAA 1TZBA 1Y63A 3LXXA 5J9PC 4W82A 4IFEA 5L3QB 4BGEA 2QWQB 1YR8A 4AQYB 2Z6UA 2Y1LA 4U7GA 2G6BA 3GRFA 1L5LA 5ESWA 4PAWA 3RJTA 4CM3A 3BTOA 5BO5A 1RE1A 5PGMA 4HNGA 2Y0IA 1KI2A 2Q45A 1AA6A 2QX8A 3O3OB 1XB2A 4N5LA 2HMSA 3GA7A 3PU6A 1KAHA 2V8BA 4ZEXA 4GZ5A 2QD1A 1KP9A 3OTQA 2ORYA 4ZGGA 3NTVA 3IJ4A 1RQ7A 4WWHA 1HE1C 2FZCA 2O8BB 3LH5A 1KQSU 1V16B 1FXKC 3FAVA 2H7XA 3THWA 2X86A 2FUG1 3CB2A 1HRDA 4CG2A 4WGFA 5WRFA 3TGLA 1TM1E 1BIFA 1W9HA 3K8ZA 3V2IA 1XNQO 1A71A 4KXMA 3V2GA 2D2IA 4J9VA 2QRUA 3QPAA 1VL8A 1ZOPA 4V0OA 1NLFA 1E5DA 1R6TA 2YIVX 3A4TA 2ZG6A 1SN7A 1DT9A 1OD6A 4R2KA 2IJIA 5BSKA 2HPVA 4PYNA 5E3IA 3RJ9A 3AG1B 2HTFA 3VRHA 2CLKB 2FX3A 3EGXA 1H48A 1ISSA 2V7QG 3ND5A 3PFFA 2ORVA 1PS8A 2RHBA 1FMFA 3TZBA 3NANA 5FXMA 3BHIA 3IDAA 3NVAA 4NATA 2FLKA 3V1UA 2GHIA 4PJ0Z 1YTLA 1L4LA 3IR9A 2VP0A 2IZ1A 4WV3A 5TQ0B 5IMBA 1GDHA 4NE7A 1VQ7V 2WIBA 5EE9A 1ESNA 1ML4A 5DM6V 3DBIA 2I4NA 1ISJA 2QWRB 3G79A 2W70A 5J4YA 3C4QA 2QAJA 4DYLA 2ZJ0A 3CUKA 3HJTA 3P4YA 4BMNA 4Z4EA 2IC5A 4YCNA 4JKOA 4YXWA 4ABMA 3Q0TA 3ABMB 5DOZA 2V74B 2AD1A 4C4TA 4GLLA 1BRTA 2HBRA 4DR1O 4TVBA 3E4CA 1ZIXA 3IAFA 1IY0A 3GC6A 4EY4A 1J5XA 1BVYF 4KPEC 1XK7A 1VQ5F 4FGLA 1XL0A 2GK6A 3AGKA 3EVFA 2BF7A 4EM6A 1YJQA 4LF8O 3FB1A 4RD6A 4CL2A 4XD2A 2HQSA 4RHCA 3GGGA 5G1OA 1L8XA 1Z18A 1K8QA 4HSGA 4DCUA 3CUVA 1XPUA 4CN8A 4MJLA 4G0VA 2FF7A 4HLCA 3F4LA 1K4YA 3TJZA 2VC2B 1S6YA 1KJZA 3LUTB 3FPFA 3LQRA 2R6AA 1E59A 3KAKA 1KI9A 1M6YA 2XVYA 4AIRA 2W22A 1WPRA 4AT1A 1VL5A 1HP8A 1J0CA 3IUJA 1BJTA 4N3GA 1V1RA 2VEOA 3Q3JB 1SXQA 4M36A 3QVNA 3SMVA 4B6GA 1QDLB 1XCOA 4DQXA 2P6JA 3SX2A 1WE2A 5SYMA 2VYNA 2ZUTA 4DJAA 3G2HA 4R8MA 2QROA 4FKBA 3PG5A 5JAMA 4QM7A 3OECA 1COWA 4GVXA 4BT7A 1WBDA 4HB3A 2GGSA 4X3PA 1G55A 3IQIX 1UMCA 2GHTA 3H5IA 1Q8IA 1VIDA 5B6IA 1WMDA 2QGFA 5K3OA 5HUJA 1ZR2A 2PYDA 1R6XA 3MRSA 2FMTA 1YOBA 3WK7A 1KH1A 1VDMA 1WSAA 1NSTA 2ZZMA 4M7WA 4JJEA 3UHOA 2HS3A 4O4LB 2BGRA 4JNCA 1R5BA 3NHAA 1WB8A 2ICAA 1Y7TA 3RNOA 5AW5A 2AMYA 1XNRB 2EG9A 5GQSA 3ST7A 4PSVA 2YVKA 1SO8A 1DAFA 3EW9A 3LDDA 3L6CA 5CJJA 4G97A 3ZBPA 1PNKA 5ES4B 1C9DB 4S1VA 3IMGA 3GOHA 4GYYA 2B33A 4J0QA 2G80A 3L6UA 3C48A 3WI7A 2P79A 3WMFA 3ASNC 1G6KA 1KO5A 3G0GA 5CB4A 1KF0A 5CIYA 4EQZA 2GYYA 2EIMB 2FRDC 2PMEA 4FE3A 1EDZA 4QOSA 4MI6A 1PO7A 4N7MA 5DM60 1IXSB 2YY5A 1GM9A 2JRCA 5KJEA 2DSTA 1TO6A 3VC7A 3QEKA 1YS4A 3OLYA 1QE3A 3RE3A 1CE8B 4RULA 2EIHA 5JDCC 4DCOA 3DXZA 3HYRA 1W0CA 3IILA 4WJKB 4J7AA 3KDSE 3C2QA 5DJ5A 2J30A 2TECE 2XZPA 2G70A 4D45A 4WKPA 1R9NA 3B7GA 4HZGA 4J4HA 5EB0A 2ZJ5A 4X92A 2VF5X 3OBBA 1VP9A 4HBNA 1E92A 3IP7A 2XBLA 3QLEA 3WIVA 3OJWA 4EMSA 1Z2PX 1JDUA 4RW0A 3DDOA 4XCVA 3LCRA 3S5JA 3OFNA 2A0KA 1I7PA 1AMUA 2ORIA 4D1YA 2WTBA 1C1DB 1DI0A 3B9QA 3BJRA 4UCRA 2O1SA 3THYB 1DBIA 3KB8A 5FL7D 5KU1A 5LMZA 3A10A 4JI7B 1W4RA 2C7VA 5F2EA 1EEHA 3ZW8A 3MJTA 1RI2A 1XOUA 1KQ3A 4PAMA 3G2JA 1Q3EA 1P8JA 2O06A 3U7EB 4QO8A 3HGTA 4RH3A 3HY6A 1J25A 2JLAA 3AETB 4TMZA 1N2HA 5KNBA 4EY8A 2BYTA 3KKLA 4TKZA 3LWNA 2F1RA 3K9CA 4EG0A 3G0CA 1OU0A 3HV2A 1JIKA 2A30A 5DK6A 1LRLA 3I2IA 3FWNA 1Y6FA 2WUVA 1F4LA 1Z74A 2A9VA 2PQMA 1U8XX 1N1EA 3KPYA 3HG7A 1I4WA 4OMUA 1NUQA 4LYFA 4FIDA 2I78A 3BSWA 1GFZA 1WB6A 1J8YF 3IJEB 3RVDA 3Q4HB 1O87A 1CG6A 3ZDBA 3OTIA 4IGKA 1UIMA 4ND8B 3UXHA 4ZCMA 1USVA 2IY7A 3FHCB 3P0IA 3GZTB 2JLRA 2Q5IA 5EAIA 3I0NA 5J1SB 4EI8A 3LCMA 5FTJA 2BTOA 2IUYA 3ADCA 3VYUC 1PHPA 1FXSA 1GRNA 1W4AA 1OROA 3ED1A 3K5PA 1H2SB 2B8NA 1FTNA 1Y76B 4DG8A 2ETVA 2PL9A 5IM4A 5K8LA 4PO8A 5L4SA 3PHBE 2IYUA 3EQ9A 2DHQA 1CK2A 4TL6A 1XDSA 1ENYA 3MIIA 4KYIB 3I3OA 4YMHA 4LX8A 3P7MA 1NI4A 5H8WA 4GT1A 3A1TA 2B69A 2WI8A 3ZE2B 3NT5A 4NFHA 2XRMA 1NTOA 1U9JA 1MA1A 1YSCA 3V1MA 3MAAC 1BXRA 2QQ0A 4MV9A 3M34A 4HI0E 3DE3X 4PX9A 4KB5A 3ZIAA 3QIAA 2JHGA 1EFAA 2Q41A 4HGZA 2AZ2A 1PKXA 2IDKA 4HSEA 4ETWA 1K68A 4HWOA 2OHJA 3AIMA 4UJ3A 1TZ2A 3W8FA 2PZ8A 4H33A 3IYLW 1KY3A 4PR0A 3DFKA 3E9EA 2LRHA 2I66A 1K08A 1Q81W 1MV5A 2MCFA 1Z0AA 4RZXA 1YIJV 2OHFA 3DHYA 1OFIA 3I6BA 1I4DD 5FL7G 5TXGA 2PBFA 4V0QA 2MYPA 4DCGA 4EGFA 4DY4A 2XA1A 2A5FA 2F3UA 2D59A 3OY7A 5G4KA 1SD1A 5CX1B 5M5BA 5LCXA 5KUKA 1W4CA 3CCEF 4DV7O 4IHAA 4MVJM 2OT3B 2GD1O 3L5KA 4EEQA 2JFYA 4KR0A 3ESQA 1E2BA 3CLSC 3FE2A 1SKUA 4HGRA 3KHSA 3MG9A 5D7BA 2JVKA 2Q4TA 3VYSC 2F59A 4GBGA 2AMTA 1L1RA 4F3TA 2OXCA 1GTZA 1G0NA 3QLJA 5A62A 4IWXA 1TVMA 1MX9A 1QOZA 2ACEA 2P6MA 1GN2A 5C0OE 3ITDA 4TV8B 3K70B 3IAHA 1XJWA 3P2EA 1YVPA 3AFNA 1UI9A 2Y1FA 1WPBA 3ZV4A 4PPFA 1A7KA 1VF6A 2RCYA 5G41A 5L53A 2O4CA 3RS8A 2XASA 3ROEA 4EMUA 1LKZA 3AVWA 1TJPB 4YV1A 3ZY4A 1YE5A 3EXFB 4PTYA 1D6JA 3IVXA 1D9ZA 1E1MA 1KH3A 3ONFA 2NU9A 3G1TA 3B6EA 3RFCA 1BVHA 3T2MA 5GJVC 4H7HA 4C1BA 1HK7A 4P80A 1JU4A 2N3ZA 2WWTA 2W6NA 4UMVA 5BN5B 1QRTA 1JHVA 2UUCB 4X1KA 3K0KA 4HCJA 2H4ZA 4X62O 2JASA 4P3PA 3DHNA 3QMVA 5DBOA 5HXUA 4HUJA 1J7KA 4TVOA 2IHJA 5AM4A 2Y69B 1I5EA 4ZOLB 1PD0A 3MCAA 3FTQA 1UBRS 4ARCA 1HDIA 1QR8A 1TKCA 4LS3A 5JS6A 1DX9A 2BEWB 3QPCA 1PYGA 3E86A 4NJMB 4O6VA 3GD5A 1E4VA 4O2AA 1S2IA 4Q7LA 3U7FB 3BY6A 3ZS8C 3EXEB 3OOSA 1ZI6A 3ACDA 1WETA 1ZUNA 1C80A 1X6VA 4MJ3A 1I3CA 3K20A 1SU6A 1YDGA 4IMIB 3D6UA 3DZFA 2GAFA 3T95A 1Z5GA 1V95A 4PQEA 3HPRA 4N8SA 3I1FA