1FFXB

Tubulin:stathmin-like domain complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
427
structure length
410
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TUBULIN)
publication title The 4 A X-ray structure of a tubulin:stathmin-like domain complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 65
structure length 410
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1ffxB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1ffxB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1ffxB01
1Z5VA 5J2UA 5LYJA 5LYJB 3E22A 3JAKA 4F6RA 1W5BA 3E22B 1Z5WA 3JAKB 4F6RB 4WBNA 4X1KA 4ZOLA 5LA6A 4WBNB 3RYHA 4X1KB 4ZOLB 4O4JA 5LA6B 2RHJA 4I4TA 2XKBA 3JASA 2R6R1 3N2GA 3JASB 5M7EA 3RYCA 4IHJA 3N2GB 1RQ7A 4O2AB 3RYCB 1TUBA 4IHJB 1JFFA 1TUBB 4HNAA 5LP6A 5JH7A 5LP6B 2VAMA 1W5EA 5JH7B 4B46A 2BTQB 3JALA 3JALB 3VO8A 5JVDA 3VOAA 1W59A 4XCQA 5JVDB 4TV9B 3HKEB 4O2BA 2GVIA 3ZBQA 2XKAA 4O4LB 4O2BB 5EYPB 4IIJA 4O4HA 5BMVB 4IIJB 4O4HB 4ZHQA 5IJ0A 4ZHQB 4X20A 5IJ0B 3M89A 5J2UB 4U39A 4X20B 4YJ3A 3RYIA 4YJ3B 3RYIB 1FFXA 5J2TA 1FFXB 5LOVA 5J2TB 3UT5A 3HKBA 3RYHB 5LOVB 3WGNA 4O4JB 5JQGA 3VPAA 4I4TB 4O4IA 5JQGB 5ITZA 2Q1XA 3N2KA 3R4VA 1JFFB 3N2KB 5KX5A 4HNAB 5MN5A 5KX5B 3ZIDA 3JAWA 3JAWB 3HKDA 5CA1A 2Q1YA 1RQ2A 1W5AA 5CA1B 5IJ9A 1W5FA 5JCOA 5LP6C 4E6EA 5IJ9B 3WGKA 1OFUA 1W581 5GONA 5MN6A 5EIBD 5GONB 5EIBC 5KMGA 5KMGB 3RYFA 2VAPA 3RYFB 4EI7A 3VOBA 1RLUA 5IYZA 4I55A 3WGLA 5CB4A 3UT5B 3HKBB 5CA0A 5CB4B 3WGMA 5CA0B 4ZI7A 4O4IB 5ITZB 4U3JA 4EB6A 4KWEA 4EB6B 4EI9A 3WGJA 4B45A 3JARA 3JARB 4TV8A 3HKDB 4TV8B 3C8LA 1FSZA 2RHHA 4FFBA 4DXDA 4FFBB 3CB2A 4TUYA 4TUYB 3JATA 3VO9A 2VAWA 2BTOA 3JATB 5JCOC 5MN4A 4X1YA 3ZBPA 4X1YB 5EZYA 1SA0A 5EZYB 2R751 4O2AA 1SA0B 4YJ2A 5FNVA 5C8YA 5LXTA 3V3TA 4YJ2B 4I55B 4LNUA 5FNVB 5C8YB 5IYZB 5LXTB 4LNUB 4DRXA 2RHLA 3HKCA 4DRXB 3HKCB 4X1IA 2BTQA 4ZI7B 4X1IB 2VXYA 4U3JB 4I50A 4I50B 3M8KA 1TVKA 3HKEA 4TV9A 1TVKB 4M8IA 4EI8A 3RB8A 4O4LA 5EYPA 5BMVA 2RHOA
chains in the Genus database with same CATH superfamily
3CH4B 5HKKD 2Q5JA 3S1AA 4JYYA 3E20B 1JIKA 3IIIA 5GM2A 4I6GA 3UJNA 4WF9V 3CCVF 2W2VA 5CX4A 3ZZ0A 3PLRA 2W37A 2EJRA 1YR9A 3ZN1A 2O2XA 2D3WA 2HJSA 3UZUA 1Z2AA 2BSXA 1P2BA 3OJLA 1GZ7A 3K15A 3I04M 1CR6A 2Q0QA 3VPXA 4E94A 5FFFA 2QLTA 1Q3HA 3AONB 3PDWA 2Q6AA 1D2DA 1W85A 1TAQA 3Q4HB 4DEXA 3WLKX 4HUTA 1LRLA 2OFWA 1V11A 3BF7A 1XNQB 2D3TA 3FGOA 1WLSA 2D1FA 2EKLA 3D6FA 3ND8A 2YWHA 1TM4E 2FVYA 4IHKA 4KO2S 1LEHA 3P10A 1K0FA 1O96B 3EEIA 5BUCA 1JJBA 4IQFA 1NIPA 4K6KA 1V54C 3H1LH 5DYIA 3WG7C 2MR6A 3IQDB 1J2EA 3OR6C 1E1KA 2JFYA 2QV0A 3ZR4B 2IYZA 3K6SB 2IHZA 3PWZA 2RI6A 4QX6A 4TKZA 3BC1A 3K57A 4L9WA 1GTMA 4S1TA 3C8HA 3AG4C 4E5UA 3DHVA 3UB4A 2H5JA 5J9FA 4JOSA 3QTCA 2G6TA 3ZNPA 1FSGA 1Q6HA 1VYUA 4DLLA 4Q19A 5JJKA 4MP3A 5EJEA 3EARA 2PZSA 1T8YA 2GPBA 2Y1CA 5FRDA 4C4RA 2QQGA 5IXJA 4NHOA 4L7QA 1HTTA 3DNFA 3NANA 3OHPA 2CNWD 4CFSA 3A1CA 1UZAA 2V7QD 2HZBA 3K71B 1YE8A 4KQMA 3L0OA 2KG7B 1SUAA 3V6MA 5IN5A 4EI7A 4CETA 4BU0A 3R0ZA 2QM3A 1OYVA 5E4TA 1UWLA 3GU3A 3WQSB 1D07A 5TR9A 4EB3A 5SY9A 3UAYA 4K28A 2NM0A 3K94A 4TUYA 2H4WA 2CAZC 5C1PA 3AUUA 3H2SA 4Q3LA 1W87A 4B82A 5AW1A 3DOHA 3ELWA 3IQIX 3IBSA 4S05A 3CMAV 1NFQA 1DUSA 3L7NA 3ZDDA 2V03A 1U40A 2UYPA 3M8KA 1TVKB 1C29B 1QZUA 3GFPA 4AT1A 4F21A 2OTJF 1LBQA 1NUPA 1B43A 4BGUA 5E3HA 1NR7A 3EVFA 1JH9A 1VSVA 3ZCCA 2NU6B 1R5OA 1ZVVA 4OA5A 1U2GA 3PUYA 1CBUA 4XYLA 8AT1A 1ZL8A 2RE8A 5DWVA 4P98A 4I99A 1RWBA 4DXWA 1W2BF 2WTUA 3PYMA 1U3TA 3AHDA 3IQHX 5KOJA 1YO6A 2Q5QA 2MYPA 2ZLBA 3CLTC 1U2GC 3SPHA 2BR3A 1AQIA 4EKIA 1W0CA 4Q4LA 5DTEA 1GDTA 1REQA 3H5TA 3LK6A 4P58A 3VR3A 1KI6B 3L0YA 3A1WA 1E9AA 1Q92A 3C1UA 4FZ3A 5FTKA 3WLJA 3HJUA 1ZK3A 1AN9A 2VF8A 4BP1A 3NBYC 5EKXA 2P1ZA 1AR4A 2YH2A 4C4YA 3JD1A 4BNXA 4PELA 3DD1A 2ZJ3A 5LLTA 4ODIA 4NJEB 1QP7A 1NG9A 1QQ6A 5JSQA 4G5HA 4EFBA 4MHTA 1EXNA 4CQNA 4FYWA 4DCNA 3GARA 2WWGA 3X1XA 4AJLA 4MKFA 4V0RA 3TD2A 5ER6A 1Y80A 4JU9A 4PQRA 4D3SA 5AR1A 1U3PA 3U0OA 2R8XA 4PDMA 2J45A 1ISRA 5JUWA 5BV1A 1GLVA 3JWHA 2WAOA 1PUIA 2HK9A 3Q9UA 5H3CA 4NOLA 4MB0A 1NT2A 4HLNA 2BGGA 1X86B 4B2YA 3S2UA 3ADDA 3G2IA 4KHPB 3R7DA 1VA5A 1H0HA 4U3JA 3NWOA 4AUNA 4H1VA 3UCFA 3N8KA 5B3AA 3VPFA 1XIVA 1AMNA 1PS0A 5AW0A 1K7CA 3COPA 5CTJA 3SYPA 4JJ6A 3LNMB 1I51A 3JYPA 4DL9A 3AF4A 3F1KA 2CHFA 3LYHA 4CEHB 7REQA 1J8FA 1JEQA 2OM2A 4E33A 4EGAA 2HBYA 1YE3A 3VQYA 4YPOA 2YWGA 3L7AA 3ZE1B 1I5EA 1V45E 3OCWA 3FDZA 3MD0A 1N3BA 5FWXA 3HU2A 3QKRA 1T6XA 3NT5A 1XG5A 1QNFA 1Q17A 2DR0A 3VYTC 5IYCO 2BEWA 3S40A 4DIDA 3ZN2A 4JOCA 4D74A 4BVHA 1ZH6A 4WOCA 3WJ1A 1EP9A 1B23P 2CXHA 1YZNA 5EESA 1Q82W 4URXR 1B6RA 3TUJC 1DCMA 3ZOPA 4YJDA 3AYZB 4Q1AA 6CHYA 3CPEA 3R9IA 1HDRA 2JIZG 4WH0A 3ABKB 4G36A 2ZJ1A 2P8SA 2QX8A 3P2EA 1MPXA 2Z58A 4OTZA 3FYUA 3LC0A 1WG8A 4OI0A 5ABPA 2WSBA 5KAIZ 5BSTA 3I05A 2CSLA 1DWPA 2CLSA 1ULZA 4RV9A 5DI3B 3ZV3A 2GF0A 3CCEF 4U9IS 4RH3A 1NTKH 4JSRA 2JGDB 1CP3A 2O8DA 4E7OA 3UFXB 3L06A 5CVUA 1MENA 5F2VO 3JVDA 4BR6A 1IDOA 5SY4A 1OA1A 3AW9A 2YI9A 3SQDA 2GAIA 1Z35A 1SBCA 2TYSB 4WGGA 5LP6A 3W2EA 2R1VB 1KMNA 3IDQA 2AEMA 3ZMZA 1VG0B 3CF4G 3IVXA 1ENVA 3PXEA 2EILB 3C3BA 4BX3A 2VZEA 4OHKA 3SDLA 1PSWA 3RASA 2O8CA 3D2CA 4HXGA 1R5BA 4HGYA 5LP6C 1ZXBA 5M34A 2H2DA 4DC9A 1FS6A 3RVJA 4TMFA 2ZQYA 1F8XA 1FFHA 1W30A 1FYVA 4G0UA 2OLKA 1N9GA 5CIWA 1YJQA 1X3SA 2JL1A 2HB6A 1ISMA 4E5DA 4TMWA 2DOKA 3VC7A 4WZ6A 5AHWA 3UOGA 1S0UA 4DQUA 2X7XA 1P5FA 1EWTA 1UI9A 1R4MA 1Z5NA 1Q2XA 3KDSE 3DEKA 3GRUA 5EWMB 2WW8A 4NVRA 3NOXA 4RXTA 3VDXA 3DKKA 4TSFD 1O57A 4N7JA 3CD6F 1Q86H 1KP3A 1TZKA 4XCQA 3AG1B 4GX1A 4M0FA 1G2PA 2NLJC 5GIPE 4Z2YA 3MGCA 4AD8A 2O8FB 5ADWA 5KSPA 1U7HA 1N0IA 3B20A 3BN3A 2GEBA 2VSQA 4UXJA 5DF1A 2BV3A 1IV4A 1IM8A 1HLGA 1VF6C 3QVJA 2ZVPX 4IL6Z 1KQGA 4ZMBA 2UYQA 3BXXA 2W6JG 3ZLBA 2VTVA 1TM2A 4PHTA 5E7IA 4X92A 2DFDA 3TFOA 3H6HA 4NNPA 1U2EA 4Q48A 2FWIA 2LDXA 3CN7A 2Q6KA 4RK7A 2HWXA 2IP1A 3TZBA 4JT8A 4DV6B 2JI8A 1XEWY 2XMGA 4JJAA 4R2JA 1QE5A 3I76A 4X41A 1CNMA 3TD4A 3IMGA 3HB1A 2LD4A 4EHLA 1DG9A 4F3RA 2AQKA 3OG9A 3AVPA 3C97A 4ZGWA 4JR2A 2YASA 1E2IA 3GCZA 4JS0A 4AM8A 3AFNA 4IX9A 4P9PA 1COZA 2JATA 1ODIA 2PMDA 3K6KA 3E15A 2NYAA 1COMA 1ZC3A 1WHTA 4J94A 2A9FA 3DCJA 5CH5A 1HO3A 1ZOIA 3L82B 5BWCA 3KDAA 1IDSA 1GSAA 1THZA 2JC3A 3V8EA 2EJVA 3ED5A 3ZYCA 1LJUA 2UUAB 1LBHA 3DTVB 2CV1A 4EFKA 2YQ5A 4QPCA 5EG5A 2AFHE 1F4PA 5BN5B 4EHKA 4XWOA 3EZXA 1ZCFA 3C3YA 3SBOA 2VWKA 1KZ4A 5EXEA 3WVNA 6AT1A 3QVMA 2QR5A 3H9GA 3TFQA 4V1CA 3C7TA 3ZI7A 3GLFE 1T10A 5IAEA 5EQDA 4XVHA 1Y33E 2OTJV 4X94A 1GM8A 1V5WA 4I5EA 2JDIG 4GL2A 1ZP6A 1J39A 1EFDN 3MXOA 3IKMB 2YVUA 4UEKA 1PJLA 4Y2VA 3RWMB 2AOUA 2NADA 5J2TF 3UICA 3UATA 2LO1A 1T0JB 4CM7A 4TTPA 1WXHA 3TIXB 1Z88A 1Z2EA 1HQYE 3ZHBA 3KT8A 4MS4B 2BP7B 4NNJA 2HX0A 2DUMA 1U2RA 1P18A 3HXQA 1GPNA 1NF2A 5CM2Z 3PI7A 3CW8X 4GMHA 3G9UA 3DBLB 2XDYA 3OBBA 2RHGB 3DYIA 1BMFA 3CRCA 3A25A 3H42B 2QEQA 4N41A 1C1XA 3U19A 1IN6A 3OX2A 1YZYA 2R9VA 4EA6A 2ZI4A 3TM4A 1X7XA 4GC9A 2PFSA 5M29A 3P3PA 4LKRA 4DW1A 4LJRA 1F4MA 2YQ4A 3QA9A 2GJ9A 4HVCA 1U2QA 2Y1GA 2DJ5A 1U90A 1CS0A 4IEFB 5EFZA 3CJQA 4G5QA 2YUIA 4LF5B 9ABPA 2E76B 3UM7A 3HTNA 5D51S 3HCFA 1J1UA 4P22A 1E6LA 4BP8A 4J7ZA 1ZW6A 3AEKB 4X3LA 1NBMD 2R4TA 4J76A 3H5NA 4AMUA 3EZ6A 2DW4A 2N0SA 1OXKB 4M1ZA 1T8TA 4EX7A 3TLEA 4DG9A 3ZWBA 1S5HC 1XVIA 4ND4A 4DDKA 5TS2A 1Q1EA 4KXNA 3BHIA 5DNUA 1LLUA 1G5RA 4GPEA 5REQB 1DL5A 3R5TA 2I0FA 2R85A 1JOYA 2PRZA 4ALMA 3QG5A 2YWDA 1K1EA 1BEZA 3O9VA 4EB8A 4TPKA 3HLYA 3ROEA 2IDMA 3UNXA 4O6VA 3SJ7A 3D6AA 1W49A 1Y1RA 3UA4A 2V7QG 3NG1A 1VHTA 2YCBA 1SC9A 4HF7A 3CPQA 5FOTA 4HEA1 4JI5O 3ACDA 3GYQA 4KXFB 2P40A 1KB9F 2M6SA 4LJYA 2CFCA 4NWOB 1VL0A 1X7YA 3H1KH 3ZWKA 1TE2A 2N1BA 3LQYA 1RI1A 4WIAA 1R3JC 2C9ZA 4QSMA 3WKDA 5FWDA 3HQ4O 3QU4A 3MCAB 3W9SA 3IP6A 4GE3A 2JB9A 4M9SA 3U31A 1LPBB 2WMOB 1VXOA 4WESB 3G88A 4NXMO 4FYIA 4A0GA 2BFWA 4H0LB 1VKRA 2E4XA 1SRYA 1AR5A 4KKVA 1N6NA 1ENOA 2X6CA 1MJ5A 3FCYA 3P45A 1JWBB 1QB8A 2Y76A 2FC3A 1EWYA 3VCZA 5LYJB 2Q5IA 3E86A 1EZJA 1W44A 3C3SA 2GTPA 3TBHA 3ANTA 2FJUA 2GPJA 4IXMA 3MS4A 4DMGA 4PBRA 5EQJB 2Q0HA 1R0YA 2P4HX 2W7TA 1Z82A 4F6EA 3P94A 4CDGA 2P62A 1WB7A 3R3YA 2LQTA 1F51E 1W4ZA 4INOA 2ZEJA 4G0WA 1CY7A 3ZE9A 1FPQA 4ETWA 5E7QA 2XCOA 4KITB 3CJHB 3IEVA 3MCZA 3ADOA 5ALJA 4E5VA 2NXJA 3EGWA 4KFTA 1GCGA 3G8BA 1TA4A 4DV7B 5C1DA 2JS7A 3GLRA 1AO0A 1JFTA 1ML4A 5E4YA 4LWSB 5JOQA 4LG1A 5CD1A 4EFDA 4C7JA 3L4JA 4DMMA 9LDBA 5HXZA 4R1PA 1N2IA 2DN9A 3LO8A 1D1QA 3BGDA 2XHZA 3CX5F 1LK7A 5DHTA 1YFJA 3TTXA 2W9XA 4G5SA 3K4HA 3RYCB 4WXMA 4EY3A 1KDRA 3TVYA 3WJPA 1M7BA 1H4QA 5CDGA 4UJ5A 2H8GA 4L9RA 2EJ7A 4PZDA 4CNBA 4BKUA 1VSUA 4BT3A 1SB8A 1O4VA 1V5EA 4UVIA 3F9CA 2C03A 1Q14A 3CVYA 1OQAA 2HIGA 2JFFA 3OETA 3TTWA 1B3RA 1Q12A 4BMOB 2TRSB 5FL7D 3L1JA 2E6KA 2V58A 1W42A 2H2WA 4DLZA 1XRLA 3GBSA 4LVNA 1BHO1 1QV9A 3L0PA 1K8AH 4YWJA 4UMVA 4QDZA 3D3IA 2ZROA 4K5QA 1SK8A 2BCJQ 2I4OA 4JLUA 1DTOA 1SUBA 1T91A 3EW9A 4IUDS 5FPRA 4D4KA 2QD4A 2EXXA 3AI3A 5FTNA 1JDTA 4MUHA 3I0NA 3AEXA 3ITNA 1U7PA 4E5PA 2ZXFA 3BTUA 5J5VA 5K3DA 1L5MA 3X3HA 4KWCA 1RC0A 2OXFA 1DQNA 2Q0SA 4B6QA 3RANA 1QLNA 2EJWA 1G16A 2B8EA 5T4EA 2RHTA 3GFTA 3TCXB 1GFIA 3O0TA 5H5NA 2G72A 4KN9S 4L4ZA 1ARZA 2RJNA 3CF6R 3SIUA 1EX1A 4F7WA 4AWXA 3T1CA 2CDYA 1V39A 2CWWA 3Q40A 3KALA 3K0HA 4RFSA 2C7GA 3O8OA 1Q6UA 4P7BA 4ENTA 1YHQV 3MJCA 3O1HB 3D4LA 2WJGA 2VNSA 1KJJA 2ZE5A 5LP1A 3CE9A 4OHOA 2FMKA 1FL9A 3P4XA 2DX7A 2NYRA 4YP5A 3FDFA 2HS0A 1M1UA 4IIFA 3VU9A 4RPIA 4PPQA 3DL0A 2CYCA 3DOUA 3RU7A 2VT7A 1DWOA 4CMHA 4JOQA 1YQXA 4WK6A 2ORED 4R6XA 4A0QA 1P0QA 5E3IA 3B77A 1X1BA 3ZD9A 2PBLA 3P20A 4XARA 3PJDA 5HY0A 3SXUA 2RHJA 2BGWA 4D9NA 5LM3A 5BNWA 1GA4A 2B20A 3D8NA 3I5MA 2J3QA 5IANA 1DOHA 2FL4A 2GCEA 4NS4A 3PCXA 1E6CA 2VSNA 2AFHA 4OQEA 2LP7A 3OM8A 1E3DA 2G5PA 3LQKA 3SGIA 4MRMB 5KDLA 3GLFA 3PNKA 1DJMA 5EJ7A 3B3QA 2I3DA 1ZESA 1PBTA 2BFFA 2DLCX 1LSSA 1VK3A 1T2FA 2XQVA 1KD1W 3IP9A 4H08A 3FTEA 5IAKA 2ZSKA 1QHIA 2BFBA 4MYCA 4D9EA 4RJJA 4ZICA 2ODBA 3CX6A 1YBFA 3NX4A 3LDUA 5EKSA 2PMWB 2C7QA 5A2QM 2Q7EA 3OTOB 2AZDA 1XD2B 3SF8A 3UK1A 4A0SA 1A9ZA 4TSFG 5KYYA 1OLOA 1SC6A 1A95A 4DYDA 4AFNA 3SQNA 1TA9A 1U0NA 3EF1A 2J6HA 1Z73A 4S1PA 4UCVA 2BWJA 4MS1A 5F9MA 1CEYA 4G9EA 2GF9A 2BHNA 3N2LA 2JLUA 1Z2DA 2ZUTA 2HX1A 4DUZB 1O9HA 4INZA 1Q0RA 2BLNA 2OXCA 2H1VA 1TZJA 1I9CA 3USES 2ZRIA 3GG9A 2WIJA 3FB6C 3L18A 4LAFA 4UM9B 4E4YA 4ZGBA 4KI0A 3HFRA 3I2JA 4ZYZA 3ZP4A 2O7VA 1E9BA 3G3EA 3SKXA 4NOMA 3GRFA 3I7TA 3ZVMA 2LGQA 4OP1A 1JEYA 3HBJA 1H1DA 3U7EB 1HNNA 1ZKMA 1JR6A 1U9IA 4HFJA 4LC9A 3T52A 5FTMA 3J81M 5E6RA 2JIDA 4XJSA 5DZSA 3JZAA 1EK1A 3RRNA 1UMDB 2HFJA 5JBNA 1YEWA 1WF6A 4LJKA 3DDWA 4EEXA 1GM7A 3OLWA 3QU5A 2GEFA 3H2ZA 4YRKA 2E3JA 3RAEC 2JW5A 2JLQA 4K03A 5A02A 4X20A 2WBLC 3AG2C 2CW5A 4F5EA 3HKBA 3RNOA 1C30A 1DC3A 3KYCA 1ENYA 1YCGA 3DFIA 3R5KA 1VL5A 3DXYA 1QLWA 4E21A 3SM9A 1NVDA 3QJGA 4K8XA 4PG7A 2WB4A 3FVRA 1N8KA 4HTFB 3GUUA 5D6OA 5I8WA 5T67A 1SCUB 2ZRNA 4EG0A 1YJXA 4MEJA 1ZLXA 4P3YA 3T1QA 4YV7A 3BPSA 2AT1A 2QOEA 1KDTA 5HPYB 1GTOA 2XQIA 2DYSB 3O2QB 1FCJA 3MBMA 3QUBA 1C8BA 4EUEA 1CUHA 1QLHA 3GVPA 4YBZA 2IWHA 2REQA 4NAUA 3LUDA 5SYNA 2DQ0A 2J9FB 5FUWA 4WY5A 2Y77A 4O4JA 3DKRA 1D5CA 4G1BA 5CVEA 4IRMA 4LXXA 3K05A 2Y0CA 3DVQX 1Z13A 4LXQA 1X3LA 5JVDA 2FG5A 2JGNA 5HE9A 5IM5A 3K0BA 1UBKS 3TW8A 2OG1A 5EI5A 4QXOA 3B51X 3DE6X 3ZGYA 3I9FA 1VI2A 1ZI8A 2YHIA 3KB2A 2ZB3A 2P6OA 3JQCA 5B55A 3HBLA 2VF7A 4TMYA 2YFHA 2B1JA 4UQPA 4MT8A 2FKNA 1YI2F 4BL5A 3PQEA 3C43A 4IXNA 1IQ0A 4BO0A 2WYHA 4MI3A 4DCCA 3CQ9A 1IUNA 1KZ9A 3TSCA 1J7HA 1RHQA 4GYWA 5EIFA 3I5XA 4RTOA 5BW8A 4LN1A 1E6UA 1N32B 5IKXA 2Q6IA 2JLXA 1F51A 4QT4A 1X8XA 4Y1FA 1GNQA 3VQVA 4FP9A 4RA6B 1XTRA 4CNQA 5FFNA 5JE8A 2QXUA 2QKAA 1A2QA 1SEVA 1CFZA 3LHKA 4JZGA 5C34B 1Z4QA 4CTJA 4B47A 1DPGA 3BK7A 2Z8ZA 1XHXA 4OXKA 3VO8A 1A1SA 1IRXA 1NBMG 2N04A 1NUQA 2FMHA 1Y8QA 4TTJA 3DFFA 1Q6YA 2ZU0C 5G4UC 4WK0B 2ZQMA 2HUPA 1XAIA 3CWBH 1JFFB 3QU2A 4BO2A 4JLBA 1B4DA 5JFGA 3MS7A 1JA9A 3PTAA 4NY1A 3GFRA 3DPSA 5C7LO 1VYTA 1EUCA 2PRIA 1KQSF 2IHKA 4LI0A 5LD2B 1W0JD 4X0EA 5FTJA 2FSPA 5AKXA 3I9MA 3CBGA 2R72A 3MT0A 2IX3A 2GCOA 1PZFA 3KPYA 4FQ7A 4YY3B 5AIBA 1EBBA 1M34E 3OQHA 2X4GA 5DP1A 3PLNA 1SBNE 1IAQA 4B2IA 3AFIA 4WWHA 5D5HA 1Q83A 4ZARA 2IF2A 2VRBA 1W8IA 5HFLA 4KP7A 4URYR 1VIYA 1YS6A 4KREA 2XNDA 1YRHA 4PNHA 5AVRA 5L7WA 4Q1EA 2GCPA 3C4QA 3OLZA 5MN6A 5IKMA 2H94A 2Z1FA 1GZ4A 5C46F 2H65A 3W79A 4BTVA 4TL9A 3FRHA 5AKKA 1XXHA 4EGQA 2CGOA 4Y1GA 4C14A 2DU8A 3PYLA 4GG1A 2B5OA 4PCUA 3JRXA 4P4NA 4D42A 5JAQA 1NN1A 1Y5LA 5TV2A 4EK9A 3LOPA 5CCEA 1NASA 4ZZ3A 4Q3CA 2JVJA 2J8ZA 2BFDA 4IGFA 1YJ9V 5TT0A 4ZYYA 4LYAA 5F5NA 4LC0A 1LX6A 3IHTA 4Q3DA 1AI5A 3DZJA 3SZRA 1H7MA 4TZ0A 5AM3A 2Z1EA 5IASA 1ZONA 4J9UE 1CYDA 1WPRA 3M4SA 4FLEA 1NXWA 2BGLA 1RJ9A 3AF5A 1EEXB 3OX4A 3BRCA 1KEEA 3KLPX 1QCZA 1RTKA 1Q8IA 3AJ8A 4OQLA 1O5OA 4YJ3B 4Y2XA 1D8AA 2ZT8A 1ZJZA 4CDMA 1USIA 3ULKA 5EINA 4L9AA 4B08A 4PRZA 4KB5A 4OGKA 1O94D 4XDYA 1ONPA 2P0AA 2NZWA 7GPBA 3AR7A 5E1MA 5CA0F 5FPQA 4OX9B 5AKGA 1PLJA 4J1TC 2ZI9A 4CEIB 4RZQA 4DSTA 3P9XA 5B1YA 1OGIA 4Q18A 3S06A 3EY4A 3PHLA 4FUQA 2WKQA 3AWDA 1RKBA 2GK7A 1FMLA 3EMDA 3CPHA 4LPSA 4D8VA 5DNCA 5FF9A 4JC0A 4W1PA 2C88A 3HEBA 1Z5VA 1J09A 2HLHA 4GGPA 3QHDA 4HPXB 2PNJA 2UUCB 3L6RA 4Z51A 4XYEA 3OMLA 4ZEOA 4MPDA 4DCSA 1GZ5A 4BRWA 3E3OA 4G5RA 3FZQA 5SZIA 5JISA 4QBKA 3FNGA 1N33O 2ZR7A 1XZNA 5FL7G 3H11B 5IBQA 2BEUB 1TL7C 1GZ3A 3COJA 4DLYA 4Y9TA 1H6BA 1CTQA 4ENQA 1NSYA 5ITZA 3U0BA 2I6GA 3BD8A 1R1DA 3RFCA 4K6GA 4DV1B 1SKBA 5IAJA 4HQOA 4PX3A 4KG7A 2EIJC 2AXTZ 1DAKA 4G9GA 5AT1A 1NQVA 1NFRA 3TQSA 1IHXA 1M57B 1WP9A 4CV3A 2ADPA 3KSBC 2FZGA 4EVRA 4RACA 4DOMA 3CX3A 4BXOA 3I01A 4U5XA 2IYFA 4OJQA 3EMVA 4C6RA 3STHA 5BUSA 5ED4A 3I4LA 2AUNA 1XWFA 3RA6A 2AD5A 3V7QA 2AL7A 3T5BA 1GITA 1YZQA 3VAZA 2R7MA 3RV4A 3PJSK 4XYGA 2IYXA 2FOXA 4WXEA 4JB0A 2JH8A 3CC8A 5AG2A 2QLFA 1ZMOA 2QJRA 3MMPA 3GCXA 4U2EA 2A5DA 4H3HB 1CK2A 4AU1A 4ZGGA 4DTIA 4JU8A 1CPYA 3ZY5A 1HOXA 1A9OA 3MTEA 3KRTA 1UBFA 4UBKA 3H1PA 4QPJA 3CS5A 3CMAF 1XTSA 3E0XA 4NV0A 4IL5A 2G71A 4HG2A 2W58A 2E21A 2AJDA 5ALSA 1VXRA 5MFPA 3O3OB 4KX3A 1C3LA 1JMVA 4I55F 4Z3KA 1I3CA 3NTQA 4ZJZA 5DXFA 1HYBA 2JEXA 4IDFA 1E4EA 4QTTB 3MWYW 3ET4A 4NSNA 3UWOA 1V55C 3MINA 1CIPA 1Q19A 3N2GA 1Y3BE 3WMWA 3U7FB 3ABMC 1Z6XA 1ZEJA 5FULA 2AFIA 2I6DA 4OD0A 1JEJA 1V16A 3CPSA 3NHZA 4IFIA 5KUKA 2HN9A 4FX2A 2IYEA 3ON1A 2FEPA 5J63A 1D9ZA 3PNOA 4D9BA 4RDXA 3X2FA 2LBPA 4WA8A 5CA1B 3BDIA 1E1CA 1P75A 4QE7A 1U1CA 5EIBC 2R87A 4H0NA 4AYXA 2YUAA 2J67A 2F1JA 2GLTA 1B8VA 3O5AA 2WSLA 5I7AA 2ZE7A 1YULA 1H9AA 2CH7A 3A1DA 5YASA 5AW9A 2FR8A 3S8YA 4MKIA 4D1YA 5JLAA 2TECE 3OE4A 3TLKA 1L7MA 3NETA 2ZYDA 5C8YB 1PVVA 4H9GA 2Y2UA 1Y8RA 3COYA 3SE7A 2DFTA 2AYXA 2DR2A 4EHHA 3NUZA 1KSHA 2BMDA 2FR8C 2ODWA 4PW0A 3P19A 4UOEA 5FDFA 4G4SO 4KDRA 3PKJA 5FI3A 3I3FA 2XUIA 4PLZA 2WKWA 2VHJA 1T8WA 1W9HA 1QC5B 3EPJA 1ZUNA 3KO8A 4D4GA 1YKSA 4PPNA 1J42A 2QMOA 3N2EA 3INYA 4WN3A 3D8UA 5CNIA 4MUIA 2A5JA 4N9QA 3LRPA 3BXOA 1SVKA 4FD2A 2JI4A 4NIMA 4Y1EA 3OZSA 1V37A 1NMEA 1PGJA 2CV2A 1QH8A 1KC1A 3RSZA 4BDSA 2I03A 3EXHB 1I7QB 2Y6VA 5CH8A 2XUMA 1GYPA 3GG2A 4FBGA 2WINI 3ESZA 4R98A 1GQSA 4DYVA 1TO1E 2AG1A 3R6GA 4FFBB 3WLEA 5FD8A 3L8HA 3GLGB 4M99A 4PJ0Z 3IR7A 4DY4A 2HP0A 4I9GA 2ZJOA 2FSGA 2X6RA 5AW2A 2ZWPA 2J33A 3ER6A 1EHCA 4YN3A 3ISTA 5IVKA 3JD3A 3QPCA 2Y1EA 1XKTA 4NL4H 1PNMA 5T64A 2R68A 1SS3A 1I24A 1BDJA 2QU7A 3CCJV 4WKGA 4R71A 3U7HB 2QI9C 1SXJD 4MGIR 1XL0A 4KR2A 5J4LA 2PQ0A 3H18A 3NCHA 3P9ZA 1UJCA 4GZ6A 3PEVA 5P8WA 1L6RA 4BJ3A 5L45A 1XCMA 1BVYF 5IXSA 1MVLA 4E31A 3B85A 5FHQA 4HVLA 1YHNA 1EI9A 4DA6A 2PWYA 1UPTA 5D84A 2HSEA 1FUEA 3M8AA 4HYQA 3RVRA 1F4VA 1TGOA 2B1RA 1RYDA 1J95A 1OKKA 3LE8A 4NNOA 2BCEA 3NK7A 2IHUA 4GSYA 5EIWA 1W88A 4J80A 4N03A 1IWBB 3APOA 2V5VA 1K8QA 3ZWOA 5IH7A 1TADA 5BV7A 3KWMA 2P9YA 2WM2A 1KEPA 2B0JA 3DPIA 4K0KB 4WKBA 4PHHA 5I7EA 2WJ4A 4CMIB 4D4LA 3HYRA 3BRQA 2OV2A 2Q5HA 4D2IA 4URZR 4EW2A 5ALIA 1AKEA 3C8DA 1NY6A 5KPDA 2TS1A 5B4VA 1XHEA 1ZH0A 5IK2A 4R2LA 4PO9A 2IXGA 4HEHA 4EPTA 4RV4A 2RAUA 2ZUEA 4J9ZB 1I0ZA 1GAXA 1XTBA 2A3NA 1NNSA 2X0LA 3OQ1A 3D7KA 1L5SA 3TB6A 3LVFO 1CUZA 5A4IS 3AP1A 1RXWA 1ORQC 1CVIA 3UUFA 3FYSA 3A6JA 2X1VA 1U3CA 3V1UA 4CQMA 2O1SA 4QEKA 3I9OA 1J0BA 3MMSA 4IP0A 3OZWA 2GUGA 4TWZA 4KXLA 4IJKA 1ETUA 4TSKA 3ZWMA 3HKCA 5DIZA 4B2LA 4B7AA 4N8DA 1GRCA 3DMPA 1PQWA 3GWGA 1X15A 1V5IA 3B1JA 3CUYA 4V02A 3G2KA 5JATA 4PDRA 1PQUA 1P2VA 1H2EA 4OJNA 1XR3A 4BTEA 1I4DD 2BE3A 1TUBA 4IHJB 3U9TA 1BT8A 9GPBA 1OFIA 4TWJA 3G17A 1QYCA 3R66A 5FAKA 2PUWA 1DEOA 1KI4A 2MSCB 4FDTA 1W0KA 2WUWE 1PJBA 4ZT3A 3DDNA 5IJAA 3UOAB 2PV7A 5HUHA 2H18A 4B3DA 2P91A 2JHFA 1W0JG 3CPJB 2Q49A 3DE4X 3AQIA 3PGA1 3ZU5A 3QVLA 1GGFA 1Y89A 2R84A 5F7XA 4EEQA 1U0SY 4XI9A 4U6SA 3ASNB 1CZKA 2FEXA 1TF2A 1HE5A 3L49A 1Q81H 2YSUB 3R0PA 4LRQA 4N9WA 2OENG 1I5XA 1S2OA 1UM9A 5HFMA 3QEJA 4HBNA 4XA8A 2QMHA 4YLYA 2FPLA 3N0RA 2VAWA 1LBTA 1LFAA 3H8VA 3PNPA 1H1LA 4Y6OA 3HM9A 5TRTA 1KKUA 3AKDA 1GR1A 5JW6A 2VSOA 3OUUA 3QBDA 1SG0A 3UV6A 3KUCA 5HQJA 2WUDA 3P2OA 3OOWA 2FV8A 3LDEA 1MVOA 3FB4A 1A7UA 2K2QB 3ZOZA 2FWBA 2VXBA 1EMDA 5LMZA 2YWFA 5KNDH 3BUSA 3OCXA 1NJIH 3L9XA 1T1EA 1X7DA 5JSHA 3U3XA 1MHTA 5ALQA 2QWNB 2ZK7A 1WP8A 1CR4A 1T26A 1FYXA 3IT1A 3GJ5A 4GRDA 1R16A 3TS1A 4WCFB 3KJQA 4WZZA 1YI8A 3HE3A 1RI4A 3ZDXB 3O83A 4CM1A 5A9SB 1W581 2P9TA 4JEHA 2AB0A 4A8JA 4TS9A 1XJWA 2X5KO 4ND8B 2WU4A 1U7DA 2DLDA 4D41A 3CXCF 4OXIA 5JXHA 2DECA 3OIDA 5CNMA 2RBEA 3EFOA 3M3DA 4OBEA 4U2BA 2P4SA 1DCFA 3QOWA 4E03A 1VCHA 3T54A 4PX9A 2ZDQA 1H5UA 1WCIB 4ZAGA 4A8JC 2W93A 2OBBA 3IE0A 4OY3A 2PFKA 1MIOB 3FVTA 2YIAA 2QA4V 2WTMA 4L85A 3AR2A 3GJ7A 3CXCU 5D5PA 3BGSA 2FN4A 3JPWA 1CUAA 3HXOA 4G56A 5E6SB 3HCEA 3WB2A 1EWRA 1DKUA 2SCUB 4DWVA 2P4KA 5C35A 3M89A 1UXKA 3KZVA 2GRUA 2WJJA 5I9LA 4HN9A 2IBMA 1PCXA 4LRUA 5CBHA 3M6UA 4RPLA 2AX4A 1JA1A 2XEDA 4C5BA 3O1JC 5A6SB 4ZT7A 3ILYA 1M6NA 2IU0A 1Z7WA 3LPCA 3ENWA 4TVBA 1W73A 1ICEA 5JFOA 2JKYA 2E4UA 1PWZA 2RGXA 4ZV7A 1MGPA 1UH5A 1GGVA 4FQ5A 3UXEA 1VRCA 3ZHVA 4YHHB 1FDVA 2JZCA 4BNZA 3AIOA 1FP7A 3CE2A 2OYSA 2J3IA 2ZB8A 3GBVA 4I4NA 3QVSA 1ZUWA 5EE0A 1NDQA 4B9AA 1G1XB 2XUJA 5DCUA 1Z0KA 1R8QA 3OEHD 2VTKA 3P2MA 1U8YA 1BCSB 2B8JA 2B2NA 1GFWA 1TJNA 2OZLA 3DLAA 4F97A 2GQ0A 2Q1XA 1NYRA 4G0NA 4HDAA 1T0KB 3GCWA 4UVBA 1QHHA 4RUEA 4MYHA 4PFSA 4OHBA 1PR0A 2V7TA 3MTQA 3TVDA 2XUFA 1CF9A 2GN8A 1P6UA 2HY7A 4H4CA 3RWOA 3TIIA 3QWFA 3U56A 5DV9A 4JI8O 4B80A 5GANK 4DB2A 2ZNJA 3CP1A 2FJPA 2OCXA 4BLVA 5FWYA 4ZAFA 1P5RA 1PD1A 3BBPA 3OU6A 4J0DA 4D9MA 4DT1B 3VR4H 5HCUA 1P61B 4D79A 5B1OA 2KB0A 2RK4A 2MW2B 5DN6A 2AWOA 2XR1A 1IEWA 5G0SA 1VPLA 5CB8A 3OTQA 3OLYA 4Z4CA 2WV9A 1PLLA 1PL6A 5KYKA 3OLQA 2PGIA 5HFJA 2EFJA 2D13A 3R4VA 2C9CA 3KWLA 4BLTA 4FLTA 2E48A 3QVWA 1U2SA 4D96A 1O9BA 4ZO4A 1KC3A 1P5JA 3FZYA 2GR9A 5JZ9A 4K9MA 4FS8A 3NB0A 4NQRA 5JCZA 4QM7A 5B1EA 3KTAB 1OWPA 4JIMA 1PL7A 1J2TA 3ANSA 4DM4A 1JQLB 4RDIA 1CYEA 4NLLA 3OBWA 2GERA 3HNRA 3ZJ4A 4B0OA 1FC0A 2V9CA 1KDPA 3B8EA 5FBRB 1A77A 3TIGA 3MW8A 3LQ2A 5CFLA 4WL0A 3ZHSA 4HNRA 4XRGA 3QNEA 2Q45A 3IOYA 3F8SA 1Z28A 3VAYA 1M6VA 3KT6A 4KQFA 1LVHA 2FTKE 5CB0A 2UZ0A 3CY6A 1M2OB 5IVHA 2H5LA 2NG1A 4AX4A 1L7BA 3GC6A 2C8VA 4LXTA 5J47A 2E55A 4BVBA 1PWHA 5CXXA 1V2GA 3WOVA 3FLEA 2AJ8A 4J0QA 5KCZA 2XYHA 5BNFA 3FUTA 2JJ1D 1DO2A 3GPLA 3KOZA 4PG8A 4Z8XA 2CMGA 3C3CA 3FI9A 1QF7A 1YGYA 3GLHB 2C8LA 2JBAB 1QFSA 2QTSA 1K0UA 3KU4A 3T9FA 1VQPV 5D7NA 3KUXA 2W83A 1T8SA 3OD1A 1T5BA 5NLLA 1KOGA 3F46A 4LCKA 4X63A 5HXUA 4PLFA 4YCDA 3D3KA 1AZWA 3GZ4A 3FRIA 5FPKA 1ACMA 1SZCA 4QOEA 2EHDA 5F64A 1DTEA 4DZZA 1KVRA 1XP8A 3ILVA 1VF6A 4J0IA 3OC6A 3PE3A 4H0CA 4DR1B 3PL5A 1KI7A 3KPVA 2LJ2A 3T7JA 2XNHA 2P2DA 1KHTA 2GM4A 4C8EA 3EDCA 5HJ2A 3IPAA 3ZTYA 3MZ0A 5ECYA 1XZAA 5HIKA 1LQUA 3LSTA 5HUQA 4HSGA 3OFNA 4I0WB 1V9SA 2VHVA 2O3QA 1D2HA 2JHPA 1XXLA 4Q05A 4RQTA 3WFVA 1DDGA 3ZW8A 5A06A 4BPBA 4DLBA 3VVBA 1KO1A 4MAMA 1BGXT 3OURA 4I6EA 1EGHA 2NU9A 4P6VF 2HDNB 1JSZA 3RVBA 1SCBA 3AVTA 5TMEA 1UMBA 1QLEC 5B6JA 2ABWA 1ZJ4A 4FX5A 4J0KA 2WF5A 1EVEA 1WXFA 4FE3A 1XEXA 1BE3H 5LBTA 5AVQA 4PLHA 1HF3A 3Q5EA 4Q4AB 4W8OA 5JLJA 4YMGA 3OQBA 3BJIC 2GSMB 1Q22A 2B25A 3ETHA 1XC7A 4HADA 3LX8A 3LBHA 1NLZA 4ZD6A 4G2TA 3U2QA 1B8PA 3FR7A 2RBKA 1BMQA 4B7XA 1YHQF 5FUQA 2QAGA 4E7PA 3OLCX 4Z9YA 5J2TA 4MR8A 1A04A 2JASA 4M0PA 2OXTA 2KW5A 5A2QN 1GFZA 1N25A 3SEZA 2NTVA 3EFBA 4QYMA 1M1ZA 2I2WA 3RUDA 2QAGC 3BJZA 2EATA 2MJLA 4IDDA 2LE0A 2HC9A 2GFQA 1NGSA 2OR3A 1Q3EA 4MVJF 2HRZA 3WHIA 1GHTA 4IH4A 1IURA 4KL1A 3QBVA 4MWTA 1NX9A 1WABA 3OA0A 2VJNA 3ZBPA 4AN0A 4B81A 4AY6A 2WD9A 2G9IA 2H2IA 2VXYA 5CGQB 2CE4A 5BMVA 1WY7A 5CP8A 5H8WA 4CM4B 1V1MB 3GGCA 4XWYA 4FCWA 3TX2A 2WB2A 3FUCA 2ERYA 1NVVR 2MSDB 2GM3A 2J32A 5IAOA 4GRAA 4QOGA 3SDZA 1U8CB 4N3AA 2Z3YA 3SHQA 4HMPA 1ODKA 3VI3B 3ZQKA 4QL3A 4GVXA 3ZWNA 2PUTA 3WYFA 2I1WA 4IWYA 2EIKC 2KQXA 4HEA6 1T8PA 1G3QA 5DX1A 1JHVA 1YRQA 2NTEA 4E70A 4B3RB 4GR4A 4W5NA 3WHLA 5JS2A 1L1EA 4N49A 4C0HA 2DJVA 3RRJA 3COVA 1MEOA 2QJOA 3DDCA 3TQRA 3J81N 2LDBA 4M0MA 5IFKA 1L5KA 3SWWA 3JQGA 2H54A 5I9BA 1T2NA 5GTIZ 3OA2A 2VDMB 1Z17A 1I14A 3H9EO 2Y0IA 3L7YA 4NBLA 4G1FA 1DG1G 1H6AA 1K7XB 2OTMA 1G4HA 3LX6A 4M0LA 1JBEA 1ZY2A 3A58B 1I32A 2B6NA 3R9XB 2EWVA 1ODLA 4OYRA 5ERXA 3PFHA 4PYIA 3R75A 2R44A 3A7DA 1ZPDA 3I55V 5BNZA 5B3SC 2DE0X 2RMKB 1W40A 2W6NA 2VNKA 1TQ4A 3CUEF 2AI2A 1UBEA 3A9TA 2FUNB 2FZ4A 1SERA 4HPWA 1EVIA 1WMSA 4LWOA 3D3WA 3Q9SA 3FCCA 2XUQA 4O59O 1EDBA 1RYEA 1UC4B 3HGTA 3RKUA 5DTRA 3K8QA 1UXJA 1BG6A 4LCBA 4NU5A 4EGCB 3OMXA 5L4NA 3CYQA 1GTL1 1YQ9A 3I2FA 3O4HA 4NYIR 4DMKA 2UZ4A 1C2YA 2HR1A 4AJJA 1F9EA 2M32A 3FWZA 2EF1A 5SZHB 1Y1PA 3C5EA 2GAJA 3ND5A 3U7GA 2CNKA 4DJAA 5KQMA 1AQNA 3U37A 2OYRA 3LXUX 5KZMB 3AESB 1CU1A 3QJ5A 4D92A 3OEYA 3WL7A 1ABFA 5AK0A 1RJDA 1SHZA 5B1HA 5ERYA 4MUAA 221PA 1FXHA 4N1AA 2PVCA 4UNQA 3HA7A 2IHVA 1SQSA 1OAPA 3QH4A 2X9QA 1VI5A 1R15A 4GO1A 3MGKA 1YL5A 2WWIA 5C52B 1DRKA 4UDYX 4QO7A 1GKUB 4F72A 2DBRA 3A05A 4FVMA 1E2NA 1TGVA 2X8LA 3EMBA 2OMKA 5F33A 1U3DA 5BSVA 1JCHA 2WU1A 1B0AA 3NHFA 3AFHA 3F78A 3S28A 2CDCA 3B09A 1HL7A 3V1MA 1Y74A 1WV0A 2D00A 4PC7A 2O2YA 1LLCA 5K3BA 3UCXA 4BEBA 4B8YA 1G21A 1VHAA 1GV1A 2BSKA 2MT9A 3WYBA 2OAP1 2ZI6A 3MCTA 4QICA 4KGXA 4F12A 5CT8A 2PL9A 3ICEA 2GUZA 2HXYA 4KXQA 4RV5A 3ZD7A 3DC2A 2XYGA 1QQ5A 2RB9A 2ZBGA 3UO8B 3VDRA 1ZNYA 1S8FA 4YECA 3QKWA 3PQDA 1JIVA 3K35A 3W9YA 1OBVA 1FNNA 3G0CA 4MJ7A 4DUYB 1GQOA 4CL0A 3LYAA 4Q4CA 1B6GA 1CJTC 2IJHA 3EIHA 2NYVA 4OUKX 1R6UA 2P9BA 4TSRA 1KSFX 2J5BA 5IDVA 3STXA 3FWPA 2Y9MB 4H6PA 4ND7A 2FTKA 2SECE 2Q5FA 1X92A 1CF4A 4GD3Q 4MZXA 4RKYA 1BE1A 4BNVA 3B1XA 3EGOA 4MLZA 4QDJA 3PRYA 2IYVA 3BDVA 2ECFA 4LFCB 4IS2A 2AN4A 2IITA 1EK0A 1EP3B 3ANYB 3T0GA 1W25A 4AZTA 3QO7A 1CETA 4YAEA 4B5CA 4GMKA 3OEHG 1W4RA 4JODA 4QUBA 4QYXA 3G2MA 4ZJUA 2Z2IA 4KMOA 1AGRA 3A04A 1GTSA 2WUEA 3WU2Z 1L3BA 4FZJA 3IKJA 3EXAA 1N5OX 4CKBB 5D1NA 3KQQA 2YX1A 4TZZA 4ZODA 3KTDA 2BELA 1ZKDA 2QGFA 3O31A 1SKVA 4FNGA 4LBEC 4DQKA 1MAHA 4YP1A 1QVAA 5HM6A 4HGRA 2O07A 3SYMA 4E88A 3QFCA 1JN0A 1JLLB 3HLTA 5IC5A 1Z5OA 1ENZA 5JWPA 4NTZA 4HHEA 3GUYA 1W36B 3NHSA 2X3UA 3TOXA 2ZJYA 2VTEA 3WNBA 3GEDA 3AHHA 2YJ6A 4F38A 2FPPA 3C8UA 3DEIA 2WC1A 2GBOA 1XXHE 2F8SA 1U0JA 1Y7IA 3VNUA 4JLMA 1DV2A 1CWUA 2VPQA 2VHCA 4MW5A 4R0VA 3M1XA 1FW6A 1ZDMA 3CNHA 4YV2A 4XXHA 1RPTA 1LBSA 1T2UA 4JCOA 4RD6A 4YPFA 3RQSA 1IPAA 1K75A 1ONOA 1QDLB 5A7HA 4IS3A 1WBJB 1JQ3A 1V8DA 4RJIA 2ZJZA 4L87A 2ID7A 4EKWA 4IIGA 3O73A 3VSEA 4ZTZB 1F23A 3WISA 4RADA 4MW9A 2A9QA 4AF6A 4JUFA 4ARVA 1IDN1 1P2TA 1SBIA 2VL7A 2RK3A 2ZSFA 6PFKA 4QVGA 4JL8A 4QECA 1YZ3A 1YJ9F 1GU0A 1P4AA 5JD5A 4CT0A 5D86A 3QEBZ 3ONDA 2EHJA 5BV2P 3BZBA 1S5JA 3TD6A 5LHGA 3SDBA 2HCTA 2PRSA 3KSZO 2JVKA 1XTTA 3IPXA 3VR3D 3CSXA 3AV0B 3UHJA 4ECAA 2FQ1A 1NPYA 2JJ1G 3CCRV 2OHJA 2F8MA 2OP0A 2V4ZA 5K9ZA 3EWSA 1QGUB 4OHCA 4MLCA 4DIOA 2RGGA 4DR4B 3TLYA 2ZRJA 4RWUA 4PGHA 4OXSA 1VLVA 5DSXA 1EXDA 1KORA 2IPXA 1H3NA 1SUEA 3ASOB 2JH3A 2PO5A 3RFFA 4A26A 4I3FA 2XUOA 2H2HA 1TJ3A 1XRSB 4RTSA 3FYIB 3TIFA 2GVDC 4FHZA 2CHTA 3DH0A 4D9CA 2OZPA 3WYGA 3LF1A 3ZXUB 3HBMA 2C58A 4ZOAA 4HQNA 3HTXA 4KQ9A 4BEVA 4BKRA 1D2MA 1TYCA 3PK0A 2V7WA 1V7QA 3L0DA 5B2ZA 2HV9A 2F3UA 1T2DA 2XOKA 2VTBB 5HZKA 4X1IB 4RA9B 3LQ1A 3GOHA 3VVLA 1VG1A 3LQQA 4HCJA 1XZGA 4N6OA 1CY0A 1MPTA 1HL3A 3G2LA 3L0SA 2JIQA 1SVOA 3DV2A 2PG3A 2BT4A 4ZEVA 3TKLA 5KWIA 3BJMA 3OUFA 3G7NA 2A0XA 4UVGA 4D82A 2PI4A 3IMKA 5IWCA 2AOWA 1N9KA 4RABA 3WK6A 4ZQFA 3D4NA 1TECE 4K2HA 1XFDA 4YXWA 4LHVA 4D3ZA 4NE9A 2CTRA 4O4IA 4MVOA 4XM0A 4HQFA 1V3UA 1XHFA 3ZWWA 3DXXA 3DZHA 2B69A 1K34A 2OUKA 1C8LA 3E8MA 4HFNA 3FMIA 4UE6A 4N23A 4TKLA 4DV2B 3FSEA 5JO9A 2F1MA 3ZRXA 5G53C 1NLMA 4A0HA 1JAYA 1K63A 2ONJA 4QUHA 2HMUA 1EVKA 2QWXA 3ED1A 1TQHA 1E1YA 2GN1A 4DV5B 3J7AR 3C7DB 1Q15A 1EN5A 4ZDKA 3LUCA 4JTAB 3ZPXA 2M6LA 3WL4A 4XFKA 4X64B 2GN6A 2ZXWC 1WKCA 1G20B 2BKAA 4C7OA 4F9EA 3FMFA 2XSZA 1I2CA 1UDWA 3P0EA 4HGZA 1U8EA 2Z9CA 3C9RA 2ZYVX 1PJZA 2P6MA 4HVTA 4EWLA 2GJSA 3I62A 4B3GA 3K9HA 5ES4B 1EE1A 3HL4A 3OCCA 1ZXXA 3A4YA 2OFPA 4F4CA 1F0NA 2AJLI 1R3KC 1N7IA 2ZG6A 5LSAA 4BQPA 2AFIE 4LF9O 3RJMA 1A7KA 4MJLA 4ZRMA 4JJFA 1TUIA 1WU8A 3DE7X 3K5MA 3E58A 5EY5B 1WP7A 2AFVA 4YMUA 3F96A 4OB8A 3RT9A 1TRKA 3PF9A 5F3DA 1Z56C 1E77A 2AF4C 4ZXFA 4AQYB 4CCWA 2CJFA 1GZVA 1MW9X 1WXEA 5EQFA 4YAOA 2H1FA 3K5PA 3LY5A 2VHEA 4X3CA 3UCEA 2WPDA 4RYLA 5LYJF 1RM1B 2F59A 1D6MA 2VUUA 4JENA 2GZ3A 4OP3A 2FX2A 3DMHA 4HAIA 4HAXA 1KK0A 3IKTA 3VKUA 2Q1TA 1VQMF 1JGTA 3OI7A 4U39A 2MSNA 4KQIA 2IE0A 3I1IA 4GH5A 1MU0A 4MQLA 4C07A 3FWHA 3ECCA 3LGSA 2BFEA 3T5DA 4Z0NA 3AERB 1N34B 3TRDA 3ZK9A 2Q9AA 2PBFA 2V59A 1MA1A 1YZBA 1PE0A 4AJNA 1URFA 3ZH9B 4DQDA 4TRNA 2J87A 4XDHA 3SVZA 3WNZA 2PKRA 4EO7A 2V1UA 3G0DA 4JJKA 2BD0A 1RHRA 1UBUS 4YT4A 3T1TA 2Q3MA 3I6MA 2ZF8A 2ERCA 2RN9A 4I9UA 3AFGA 1XROA 3G59A 3NHAA 1NW9B 1PFUA 3IAUA 1NHWA 4L50A 3SYQA 5JY6A 2R86A 3A6KA 5BXQC 5A0VA 5CIYA 1I4TD 1U0RA 3G9ZA 4J43A 4E51A 4MVMA 3P7MA 5CAEB 1PJ3A 5KO2A 2VP9A 5COBA 1I0IA 5BN4B 3T3GA 1NH2B 4HNVA 4YUXA 2XQJA 1XU7A 2PKXA 3ZY3A 2C31A 2O3UA 1ISHA 4TYWA 3JD0A 5H5JA 1ROPA 2XRFA 1JH8A 2JFGA 4IZOA 4Z7JA 5IABA 1R8SA 3UM9A 3ZMUA 2CVPA 5B3LA 3UT5A 5U4QA 4FEYA 4HFMA 5A9TA 4ZMRA 3U3ZA 4XFDA 1ILWA 1MOPA 1WA8A 4Q12A 4RHFA 3IB3A 3H5VA 4W5OA 1OFVA 3NWBA 4TLBA 4XPIA 2QD5A 5M5BA 1HLFA 1MCZA 4JI4O 2OY0A 2CV0A 3IC9A 4WI1A 4AJ2A 4YV1A 3E8SA 3UVEA 2X9GA 1XV2A 3D8SA 4YO8A 3G89A 5EJMA 4DNQA 4Q1DA 4R1TA 1ECFA 3CCJF 2HK7A 3WGTA 5LDHA 4LDPA 3UXHA 1P0FA 1G6Q1 4TMTA 4N7BA 4F04A 2IOFK 1SXHA 1TJ5A 3B1VA 3LBIA 4I7ZB 1PEKE 4ZOCA 5LA6B 1SQ6A 3STWA 5HG0A 4HK4A 721PA 3O85A 1GP2A 1X7ZA 1HKHA 2XA1A 2EULA 4I8IA 4QHSA 4O1IA 3NBMA 2YR0A 2G25A 2X0KA 3OFVA 5EUMA 4BAYA 1RRMA 4KE8A 2ZR0A 3FTPA 4HB3A 5K0BA 4YUVA 1FMFA 2ZDIC 1KJWA 5JPIA 3SEAA 4Y0VA 2V4DA 1BS9A 3RD5A 4F1JA 2QQ5A 4OIFA 3THWA 3JQEA 4EY8A 4C7BA 3CEAA 1LK5A 5CA0A 3OO0A 2AG8A 2GK6A 2O19A 1N4CA 5FJIA 2QRZA 1KYIA 2A9PA 5EUBA 1DJNA 4UNSA 1WS6A 2PD6A 1F20A 3CRQA 4LF6B 5AW6A 1RYFA 3GPCA 2ATXA 1A9PA 1NVFA 2QSAA 3MWKA 3GJTA 4F3KA 1MB2A 2WNIA 3FNEA 5ALNA 5JS1A 4YMSA 2DQ3A 4CYMA 4XVRA 1FNJA 4Y6SA 1NQTA 3T3DA 4MW4A 4DV3O 2L69A 4J1TA 1NE7A 1KWKA 5HA5A 1MH9A 4CT4B 2R6DA 1ABBA 3DOIA 4BLUA 3UYLA 5I45A 3RVYA 2FEWB 2WIAA 3WL5A 4P36A 1X39A 4D5EA 3VHXA 5TDHA 2Q3JA 3TX6A 2P9FA 5BY2A 3RA5A 3W5CA 1XOUA 1BSMA 3DD5A 4P92A 3UJ6A 5GONB 2E85A 4YALA 2AHOA 2OCDA 3KKOA 1D7AA 4WLNA 1NTZH 4CKCB 2IK8A 1I5YA 5BN3B 1GPMA 4FN5A 1X8LA 2AMJA 1Q7BA 1M3SA 1KECA 2CVHA 4NONA 3AJEA 5B4UA 2JLVA 5ALPA 1KMIY 4X7PA 1M1NA 2BEVA 4AYWA 3KV3O 3GEBA 5EHXA 3HUEA 1GGEA 1BU5A 4XCXA 2NSHA 3ONWA 4Q01A 2W48A 1TKCA 5A4DA 5TIIA 2C1ZA 4KN8A 5J59A 2VJOA 3IIEA 1OI4A 4JYAB 4EPXA 1EJ0A 3FPFA 2NVOA 3DCNA 3EWNA 5DM1A 3OM3B 1KEUA 2FZEA 2P9ZA 4W9MC 4LK2A 2EJBA 3HB9A 1OV6A 2PFGA 4KTVE 4ZDJA 4Y0AA 3ZMSA 3CYFA 4JI7B 4NBRA 1L4HA 3EIWA 4MHOA 1I7NA 3DW3X 5KEIA 2VWGA 2PYJA 5GMOA 2J31A 5FA5A 3BEDA 4H7FA 1M2VA 4PC6A 5EE9A 1F0KA 3QGMA 2W6MA 4BLWA 3G9TA 5BNIA 3KQLA 5DTMA 1MXHA 1N2EA 1WEKA 4W7IA 3W04A 3TD3A 2V74B 1QP4A 3CYPB 3WL8A 4MNTA 5HQTA 2YYZA 1A5BB 4GECA 1DIOB 3KXLA 1P3Y1 1N78A 4TWAA 5G02A 2IHNA 3MM4A 2P7HA 2UXCO 5C4GB 2FEKA 2JGLA 2Q27A 5IU6A 2WLIB 3TPCA 4IIYA 1E7RA 3ZBQA 3HY6A 3BH6A 3F90A 4EX6A 1NT4A 1ID1A 2QTGA 4ZV4A 4DR5O 2ODMA 3CEMA 3TWOA 4NEQA 5B6PA 4AJIA 3R6WA 4NCAA 3KQVA 4OLJA 1NKSA 1RHKA 4W8GA 2CJYA 2JLBA 1UBHS 1FJGO 3ZXXA 5I6DA 1VLMA 4QTUB 1XKQA 3QW2A 2ACVA 1GADO 4V0LA 2XYRA 1DX6A 5GTDA 3EY9A 2MCFA 4MRNA 2BISA 3H1FA 4X8AA 2QA4F 1RJEA 4I1IA 2C7RA 4GLXA 5LXTB 4IQ8A 2QTRA 4TS1A 4QQ8A 3K2QA 3SE0A 1J8YF 4FYXA 1MORA 2PD4A 1KVSA 4Y18A 4TX1A 1US8B 2FOIA 3KJXA 3NPMA 4JVLA 3EB9A 3WLHA 2X8JB 4FW9A 1WBDA 3GZNB 5C81A 2Y69C 2OIEA 1DAPA 4FGKA 1VQMV 2PMEA 1H2FA 2GCNA 2ITDC 2IOFA 4BIMA 4O8CA 2W2KB 4AXBA 5T3UA 4QQNA 4KQCA 1CE8A 1ZH8A 3WS7A 3TCNA 1M83A 4KYTA 1X9HA 5SZJA 1XMXA 4CFYA 3E9EA 4NFHA 3W2HA 1EA5A 4I4LA 5A4JA 2G07A 4OQPA 4UDNA 1P39A 1Y76B 1YTFD 4Q82A 4WX2B 3QF4B 3TI7A 1JQDA 3DZCA 2OP1A 4QFBA 4AURA 1HQKA 4IKEA 1ZIYA 2MINA 4L75A 4C3UA 1GR0A 2HA6A 2YFYA 4Q7KA 4EI8A 3NWEA 3UJHA 5A03A 2ZKOA 2FOLA 3FZEA 3QU9A 4AYTA 1M74A 4OAPA 3G2OA 3M6FA 1NA5A 3FBTA 4QDOA 4HDRB 3BSWA 2HNAA 1OBOA 1M2GA 3ZVNA 4IDEA 2QTBA 4GM4A 3L7OA 3ZXYA 2QGNA 3QYPA 4MPTA 3RYIB 1A4IA 3M1YA 1E7WA 2WYOA 5L3GA 3KC2A 3G0BA 1K73W 1L7QA 1WHSA 4IR7A 3WO0A 2V45A 1OVGA 4TN1A 3ESXA 1UBNA 1T0IA 1C1HA 4QGHA 2H9YA 2J0UB 3ZDRA 5L3DA 3BMCB 2WUGA 5FR2A 3IIJA 2E5LB 3U3JA 4N8SA 2OO7A 3ICOA 3I09A 4B7CA 2CTQA 3ER9A 2VDLB 4H7EA 3PTLA 1FEZA 1XJ5A 2CL6X 3ZZTA 3BTVA 1MC8A 1SDSA 3A1VA 4CIAA 1ONBA 1U28A 5DM6V 1XZPA 1FFSA 3Q5GA 5MF6A 3WDLA 1R6KA 1X94A 4KXUA 1YB7A 1Y3AA 3OZCA 3CEHA 4NFYA 4IJUA 1J0CA 1IXMA 1C9MA 2AR7A 2ZBUA 1GEGA 3SYOA 1L5FA 2O2GA 3CW2A 1DRJA 1U28C 3LYLA 5F1YA 4G2NA 2RJZA 2NSDA 4KO4S 1M93A 1YQNA 2ZJFA 3LM8A 2VATA 5DP2A 4ZI3A 2DPXA 5K20A 3HU1A 2ODQA 2WMDA 3ML0A 3FYTA 2FZCA 1GGJA 1EQ2A 3QEKA 3T95A 5AICA 1FD9A 2UXBB 1Z37A 4WN9A 3THXA 2ZYRA 4LVUA 3K9NA 2HYIC 2JFPA 2ORWA 4HH0A 4GP6A 3A6PC 2ZRKA 3EXFA 2L17A 4Y6LA 4ZI7B 3IQZA 4UPVA 5JZOA 2G1JA 1O95A 3NK6A 2VDUE 3D2BA 5FQNA 2RH9B 2PS9A 1TFRA 3ZY4A 5LMNO 1Y5NA 4OIMA 3TRIA 1CB0A 1ZW1A 1FTNA 1U8UA 2QNRA 4NFSA 1VLLA 4UUBA 1VQPF 4AILC 2Q5EA 4MMYB 3BEOA 4YJ3F 2OCBA 4XWAA 3IVMA 1O95C 3GEHA 1Y4UA 1H2BA 1U11A 3N3AC 3I56F 4EQ6B 4TRMA 2W0XA 2N46A 4Q5IA 1EUYA 5EC2C 1Z0DA 4MDYA 3HN6A 2X7HA 3B9QA 2VJBA 2V5UA 4BAGA 3EGXB 2UYYA 1WCXA 3PFIA 3LIPA 1A98A 1QDUA 1NVTA 1OMOA 1XNHA 5TF0A 3JD4A 2PKQO 1QAMA 4HKTA 5ICSA 1UZLA 3KQMA 1T43A 3ZLVA 4N5DA 5THXA 4AI6A 4LIPD 5ICMA 3D54D 3WMGA 1R5JA 2NN4A 3QX3A 2GD2A 3KUKA 3FNFA 3A27A 4XEHA 2CSUA 5T5QA 1UK6A 1Z8HA 3CT6A 3DS8A 3NTOA 4Z86A 1SHKA 3UC9A 1LDEA 3IE2A 2CCKA 1P0PA 3JALB 1M57C 2VEOA 5E1DA 3U0VA 5K3SA 4BZWA 1D7OA 1GUDA 3C48A 3T3IA 2IEAA 5BOVA 1GNSA 1AF7A 1QHYA 1GD1O 4HWSA 3G7UA 1T9CA 1VQ1A 4M46A 5ESWA 2JNBA 1C9YA 2JD1A 3H13A 3V32A 3FRJA 4F3YA 1USGA 4FZVA 5AJWA 3WOHA 3AG6A 1II0A 1IN7A 4MW2A 3N6VA 4O2LA 1MB3A 1QX4A 2Z5VA 5BQFA 1I3KA 4FR0A 3L93A 4Z3OA 3VTIC 2XVMA 4RCZA 5GVSA 2HA3A 2K7FA 3P0JA 1ZD2P 1RPOA 1J5EB 1SAYA 2QRVA 2BGJA 3A6FA 3TGPA 1A9XA 3FW1A 2WHQA 1BQEA 3T6KA 1ZXLA 3C24A 2ID8A 4CM9A 2PRKA 3T0IA 4XJVA 1M4UA 4HDKB 1FNSA 5C5CA 3EIQA 1E3QA 4KFRA 2W2QA 3CA8A 4RNCA 3KXPA 2GD0A 2W4MA 2L0XA 2GN9A 2KSQA 1B04A 4QUDA 2HP8A 3MHTA 1XRJA 1SUSA 3OR7C 4AY3A 5IJ9A 4P83A 1CNEA 2ZOSA 3PT9A 4N7MA 1JHRA 3I0MA 4CLRA 1SBHA 8OHMA 16PKA 4RF2A 2IJKA 4TXLA 1FNKA 3K70C 5KA5A 1F7VA 1XCLA 1T2VA 2EFYA 1J33A 3E70C 1ZN7A 1PZHA 3OQPA 4QNMA 3AK2A 3NAGA 4N5HX 3F6RA 2JJ2A 4JP8A 3KIZA 3QG1A 4UZEA 4GX5A 4M7OA 5T57A 2HWWA 1Y48E 3FFQA 4CG0A 1F2TB 1Q0TA 4JFRA 3WHPA 2A06H 4YUAA 4ZZ0A 3AEQB 5CCBA 3PEEA 5IUKC 4DJJA 2EW8A 2VF5X 4ZO9A 3OTFA 1GAEO 3R7WA 2PR2A 1NP6A 5AK4A 5CA1F 1YI0A 4COOA 1VG8A 4KK4A 3WC4A 3NAQA 3EG9A 1BA2A 2P3OA 1XQWA 4UVEA 4Q3EA 2AR9A 3IVRA 2AOTA 4PPFA 2ZKIA 3C9TA 3VR2A 4BQRA 4Q16A 2ZREA 3A1SA 3U3DA 1JDNA 3J7AU 3G1UA 1DC4A 2Z6UA 1KVTA 4RPKA 4C5CA 1OTYA 2EFEB 5C8YF 2Z2ZA 1KZYC 2YXZA 2BR4A 1K4KA 1ADCA 5JMOA 3I55F 1MX9A 1G6HA 5IHXA 3KHSA 1LNZA 1YOBA 4PYMA 4WVLA 3QUCA 2CNDA 2FFHA 1JR9A 1J7KA 3PJGA 4FBMA 3GT3A 3TOCA 2C5GA 2C77A 3EULA 3RU9A 2BTQB 2FN3A 1D2NA 1SWVA 3PC6A 4LF7O 1D3AA 3QE4A 5NULA 3NVKI 1CUEA 4EARA 1CUFA 1RHJA 3EZFA 3L4KA 2JAHA 4QXAA 2G5CA 1FNCA 1SIBE 1TCAA 3TTVA 3KOXA 3RRXA 4Y98A 4UHJA 4DA7A 1VQ5V 2CJXA 1ORTA 3SIRA 4BKMA 1EZZA 4PR0A 2TMDA 1IJKA 2GVNA 3V8QA 3TQOA 2P6NA 5I7VA 1XZEA 3G49A 2F17A 3U81A 1T5EA 3AEIA 2XNDD 3WJ7A 4HB4A 4MQFA 4TS3A 2AVDA 3FSJX 4JLNA 3CCSF 2ATCA 3E5NA 4TZKA 3F0FA 3R0VA 5HF9A 2RD2A 3QTLA 1AO3A 4H6VA 1CEEA 1EWVA 3GQBB 3N8GA 2H16A 4RHEA 3UJ9A 3ZU4A 4YAJA 4IIDA 1MJFA 3CKKA 4U8GA 1AJPA 1HEUA 2GILA 4YIHA 1G21E 2HRYA 4DR3O 4EYOA 3BH7A 3BICA 1FLAA 4RY8A 4TMVA 4LNAA 4M7WA 4MR9A 2V3CC 5EFOA 5AVXA 2IYTA 2J3HA 4C06A 1ORRA 1G5HA 1JQKA 5KYUA 1DAFA 4BT6A 2YNMD 3AP3A 2GX6A 2OZKA 3M1LA 1VQNF 3IOMA 4DWJA 3CF2A 2B35A 3M7MX 4LZLA 4V03A 3GP8A 4AXXA 1TYAE 3RT7A 5E6UB 1OCEA 4KEAA 4Q7LA 1R12A 1W41A 5F12A 3W5IA 3V2IA 4Z5XA 1UBOS 3SJUA 2A67A 4L0QA 4I9QA 3BCHA 4PQEA 3BIWA 4JP3A 3S3XA 3VYWA 3HN7A 3F6SA 2GM5A 2EIXA 3R5FA 4IOKA 1TUEB 2SKDA 3CTMA 3K2IA 1U5AA 2P5TB 4MB2A 2H1OA 4J0CA 4Z4HA 2Q4PA 1VMIA 4UCXA 3V4OA 3KKPA 1X80B 5AO9A 1CQJB 3GP5A 4QUAA 5ILOA 4F4FA 2A1TS 3LIIA 2CN1A 1E7MA 5I7WA 1SRQA 3OZFA 5CITA 3Q4HA 1NU6A 3I56V 1CUGA 1GO1A 3KFVA 1OSNA 2QXTA 4HAMA 1RYZA 3QKTA 1JDPA 1ZIDA 3IHKA 2QR4A 1SBQA 4B3FX 3DYVA 2CZWA 3ROXA 1AT1A 3NVDA 1FXWF 1YCFA 4I3HA 1O96A 4MDHA 4PYLA 4JQSA 4R83A 3WL3A 2C57A 2B3TA 4DGSA 2HF8A 5IDYA 3EAGA 3K6SA 3Q9LA 4KR6A 3P71T 4Q7EA 2HAEA 4YRCA 4IHJF 5TJHA 2R6R1 2QSYA 2KWIA 4KQ6A 3SQXA 2I4TA 2B2CA 1NI4B 2NTJA 1VE3A 4WLEA 2CKDA 1VIVA 1K06A 3H0KA 4J4TA 2J0EA 2AYYA 1DQZA 3L77A 4A23A 4JR1A 2GZDA 2E5FA 3S5JA 4H27A 4K6HA 3CINA 1IBLB 3WNQA 3NRBA 1CP9A 1RRVA 2RJ3A 4HV4A 2Y4TA 2FPUA 4XVQA 4Y6RA 1B15A 3KKQA 4MVJA 2XX3A 2AWNA 2R7KA 4KZPA 3VVCA 3C6KA 2H9IA 2RB5A 4W1SA 1KDYA 1HYGA 2VFAA 1M9NA 1H8EA 1QO9A 4ROTA 4LY3A 1RCUA 2UYCA 1TVKA 1V9CA 4EYQA 4WZBB 4LHYA 3JWEA 4C3OB 3Q2KA 1JYSA 4XGRA 2DH5A 3NBUA 2WK1A 3PDCA 1PFGA 3K72B 2NU6A 3QKUA 3GVCA 1XNJA 1LPMA 4OPAA 2DY0A 5H6RA 4OGGA 3F7MA 1UEXC 3OUZA 3HCCA 4KX5A 2O0KA 3TNYA 4EA9A 5BY1A 3X2SA 1HA3A 1D6NA 4YS6A 3RN4A 1JG2A 3L0BA 3WGKA 5EIBD 4M8SA 3ZVLA 1JXQA 4UC0A 3JVUA 1MEEA 4DG5A 1XO1A 1HK7A 2Q9CA 3RVKA 2PX0A 2ZM6B 3E8BA 2YXLA 1PD0A 4BO7A 4H2DA 4NKRA 5H81A 1KI6A 1RAGA 4K8OA 4NBSA 4AIIA 1ZM3A 2HJGA 3H3JA 1KOJA 2RGRA 3CCRF 5KYWA 5FNVB 2PZKA 1LPPA 3C70A 5JRJA 1NJ5A 3BMXA 2HV8A 3AWIA 4NJEA 3TLZA 1VP3A 3P5SA 3BXEA 5AWFC 2YZNA 5JAPA 1SZPA 3QNWA 2CXXA 1J6UA 3Q0TA 2XA9A 3OY2A 1FFGA 4FCCA 1V48A 1F8YA 2FX5A 2VP5A 4HX2A 1RZ3A 4RZ2A 2O05A 1TRHA 2CFIA 4HJRA 1TUGA 4I4TB 2FU5C 1FYFA 4RESA 2HJFC 2WVHA 4W6QA 1UPCA 2PS1A 4EW1A 5DMHA 1I0LA 2XF8A 3WK7A 1XA3A 1HR0B 1DS6A 1Q7YH 1TJYA 1OFTA 3TZKA 4GQAA 1GM5A 1NOIA 3GJ3A 3KZ1E 2Q7GA 3QM1A 1KC8H 4B8ZA 3HDJA 5DNVA 4GSLA 4NQ3A 2ATIA 5EJGA 2BUCA 2ZT5A 4OQXA 4IOLA 1I4LD 4KXWA 2X40A 2WJPA 4QG3A 2ZRPA 1GKKA 1U2TA 1T4CB 2IU4A 4CG3A 2AG6A 4HZIA 3JQ6A 4P0TA 4J75A 3N8IA 2NVWA 4LPKA 1RAFA 2NQ2C 1MMMA 4CEHA 2WA4A 3HCPA 1X13A 4ER7A 4W99A 3UO2A 1G1MA 1QQBA 1DXYA 1YDWA 3A14A 4HL6A 2OCPA 3MWDB 3H0CA 5FOXA 1B74A 3DEZA 1ZVKA 4M8KA 2ORVA 2VWHA 2IT1A 1XHLA 5DI9A 2BGRA 3OMNB 3BIOA 3Q7SA 2JCGA 3ZJTA 4XWWA 4M1YA 3I6QA 5IG2A 3GZJA 2XVZA 3EVTA 4DJTA 4ZCPA 2GSWA 2P6JA 4Q9HA 4DLVA 4LFBO 1USVA 5JJIA 2FE4A 1K5GA 2PBZA 3KQHA 2Z4TA 4MVQA 1J23A 2D06A 4C6TB 2Q28A 4LJ7A 3QI2A 5GAJA 3EPRA 2EYQA 3F0EA 3CCSV 3KCQA 1XAHA 4UTRA 1UMCB 1OKKD 4RVOA 4MUNA 1LBIA 3ZDBA 5DI3A 5C4IA 1G98A 4BB9A 2JGDA 3UFXA 3ABKC 1KVUA 1XL4A 1AH2A 4R9SA 4RD2A 3LFUA 1A8QA 1QGZA 5F5XA 4OV6B 3WWCA 3ETQA 1BXZA 2YXBA 5KHGA 5HF6A 4FNAA 3ROKA 4REQA 1EBOA 1PKEA 4EIWA 4ITRC 1VQNV 3JZFA 2EKZA 1W4AA 2AYZA 3Q0EA 1I3LA 4LZPA 1R5NA 4FLYA 3CCMF 2P0EA 3L4SO 1RM3A 3BXFA 2F9MA 3C2QA 4D80A 3AETB 1THMA 5IK2D 2HFKA 2EILC 4HYEA 4GPZA 1MKYA 1IOVA 3ZY6A 1PR5A 4B62A 1PG5A 4WMLA 3EF0A 4PA6A 5HZGA 3PEFA 1V47A 4GKVA 1R4NB 1UR5A 5EWMA 2QE6A 3L0ZA 4CQMD 4YCBA 4RF3A 1PPJH 3K73O 5B3KA 5GV7A 1WUTA 1MQ9A 2P77A 3E3MA 1P8AA 3BKWA 2YKGA 4NABA 1M76A 3HVRA 3F5TA 1RPAA 4B6FA 3K5HA 2YHBA 1Z29A 1Z75A 2HRRA 2EG5A 4TZ6A 4ZQBA 2O59A 4L5YA 1I94B 3WLNA 4IQ4A 4BWFB 1XJCA 2QX9A 1TPZA 5KKAA 3ZIAA 1ZK2A 4XUGB 3AG1C 1FU8A 5EBLC 2FW8A 3GLSA 3E1YA 4CH6A 2VDPB 1W0KD 4J3JA 3GIDA 2D7DA 1CUBA 1FQOA 1AJEA 1T13A 5TGZA 4ZT6A 1TT5A 5K0CA 3QVXA 3AT1A 3WHKA 5JXIA 2M7WA 1KZHA 4RIIA 1K4YA 4ZQCB 1SHUX 1R3DA 2LVBA 4XSVA 1ORVA 1RAHA 2W2XA 4RHTA 3H2JA 2OV1A 4OQMA 4IVNA 4RVHA 2WD7B 1YZGA 5AXBA 4H7HA 5T8KA 3VH4A 4TXMA 1P4HA 4G23A 4Q21A 4PLWA 5MGBA 1RZVA 3WK5A 1DLIA 4B3TB 3P0RA 1VPTA 1DB3A 3QOFA 2NVUB 4KO3S 3S6JA 5T8KC 3D7MA 3CUUA 2ISSD 3E4CA 4BNDB 2XNDG 4FE7A 2FK8A 1H3EA 3KE8A 4K2AA 3CZ5A 3LK7A 4ZT4A 1WN7A 5HTOA 2BFNA 1K9MH 3LY7A 1FKAO 1TVCA 3DTVA 2P2LA 3CMMA 1L5YA 5BN5A 1PVOA 1EBFA 1AUXA 5KNCA 2WHEA 4G4JA 3VJLA 3LGXA 3RR2A 2PU7A 1XEQA 5CG2A 1FDTA 1QP8A 5EMMA 4JBNA 4PA3A 3CWZA 4WINA 5KWEA 1LDYA 1VJ0A 2OE2A 4OK5A 1QVGU 4U0KA 3E7DA 2QLLA 1D6JA 2FRXA 2VUTA 1T8UA 4F84A 2AZ0A 2XCLA 1XN1A 1XEAA 3E05A 3TMKA 4LC1A 3HDTA 1YZFA 5JYEA 2R6GA 2I2FA 3CLTD 4EJSB 4G0VA 4XTCS 3T1HO 1W46A 3ELBA 4M3NA 4YUYA 3I2YX 1YC2A 2Q3HA 1BWRA 1XMOO 3UBTA 4FFLA 4IHQA 4ZQGA 2UZ3A 2YICA 4ARIA 4MS4A 2Q9LA 1P33A 2BP7A 1VMEA 5FOWA 1M1YE 1M8FA 4N3CA 5K5EA 3DWGA 1TEZA 1L6IA 2P4QA 2VH5R 1UAYA 5BSUA 4LS3A 2ONZA 1NW8A 1BXGB 4AQ7A 4E12A 2AN9A 3LWOC 4KIGA 3DMTC 4M0DA 1SA0B 5IJWA 4LXIA 1E5VA 5DH9A 4L5IA 3ZWXA 2Q07A 4R2MA 4PE5B 4OJYA 3KWJA 3KAQA 4E2WA 3HY3A 1BCCH 2DYYA 4MCHA 3G82C 4BFYA 1LTHR 1RBMA 4RX1A 3UMRA 1Z06A 4DXAA 2KBEA 2Q50A 4PS1A 1ZG3A 4JLDA 3UK7A 3JZIA 2M1ZA 2P2ZA 4C2BA 2PUDA 1DC5A 2V55B 5F5LA 2PLWA 4BGIA 3OC0A 1B3BA 1C3VA 3EDOA 2VH1A 1GIAA 2DUJA 2YEVB 1AI7A 5ELMA 4FM2A 1I13A 2ZODA 2O0LA 3WYEA 2WLTA 5K8UA 4KCGA 4PA9A 2FGYA 2DJIA 1E7KA 3EDRA 5I3CA 3K5LA 3V00A 4LXHA 4GKKO 4KRXA 3PEYA 2PY6A 5REQA 1HE4A 2W6OA 2C82A 4WNIA 2P3QA 1NNLA 4UTVA 2JEUA 3T9DA 3TTUA 1L8XA 4RHAA 3C6QA 2G9NA 3NYIA 4M8IA 1J9EA 5JZVA 3ZDQA 1Z62A 3L3BA 3LHDA 3DZGA 5ILGA 3C7AA 4PWTA 5F7JA 1XCPA 2H5IA 2Q6OA 3VBEA 3N3BC 5EP4A 3BOSA 3AJ9A 4MV3A 2C2OA 1JDSA 3MJEA 2QPLA 1V5FA 1YZTA 5SICE 5KQLA 2AVNA 5DN6D 2IY7A 1JE1A 1QRAA 5FI5A 4FFMA 3W90A 3WYCA 1H94A 1QH0A 1ORIA 1WAMA 1N77A 5CM9C 1AKRA 3ADKA 2HZ7A 1TXGA 5C5DA 5TQ2A 1V5GA 2N74A 2YHAA 4H44B 1Q95A 2O2IA 1YS2X 3BD9A 5IBRA 2NU8B 4F5YA 1WX1A 3MCAA 1PHPA 5B1NA 3ZGOA 4GYJA 1E2PA 1PZMA 3O4VA 4WESA 3EIOA 1V4VA 1XKLA 4GOND 4TMZA 1IN4A 2J6BA 2O9JA 4OYLA 4ZZ1A 2UZHA 2O23A 5LYJA 4BNJA 3WIDA 4C1BA 3ZHOA 4LV5B 2QLNA 1V6CA 4EVIA 4EHJA 1BHJA 2WFLB 1A5AB 3Q12A 4J90A 3T7RA 3N86A 4PICA 5BYJA 1FDOA 4O4HB 5J4VA 4QVKA 2R7NA 4X97A 1VF7A 3CIFA 2ACKA 4M1KA 1ZBQA 1NW7A 2XMPA 5LBQA 4EKNB 3CCMV 4WASA 4R40B 4YK7A 3CJHA 3LLSA 4XQCA 2A30A 4DVGA 1ES9A 3PC7A 4YT2A 1EQUA 4D98A 4PYKA 1FFCA 3M70A 4E5SA 1RLUA 3NNNA 4K9NA 5HKLA 4ZKDA 1SC5B 1JYEA 1P44A 1FFTB 2HLDA 4RFLA 2I9KA 4LWSA 1PJCA 5GADl 5DGIA 2IA5A 1HTWA 2RHBA 3TYXA 2FWAA 3LTNC 1CX9B 2AC4A 2WAYA 3UHAA 3Q7RA 1AUOA 4IIUA 5CMUA 1CY6A 2HWKA 3P0ZA 3N7AA 3RIHA 5JD6A 1IVNA 2P8JA 2OZBA 1R9GA 2XKKA 1E0AA 4B5LA 3RYCA 4BB5A 4AKTA 5DW0A 1JYFA 1N8RW 2XCUA 4HNSA 3W5JA 2RHWA 1MQ8B 3GDOA 2ICAA 1FX0B 1X0VA 3K9AA 3CU5A 1UBMS 2XE6A 1QIIA 4CHTA 4OHYA 4KRYA 1D5NA 1P9NA 3VRHA 1G9TA 1Y6XA 2JGRA 5CFQA 1BCRB 2QKCA 2VIIA 3A0UA 3PN1A 2F8LA 1M73E 4Z9BA 5G1PA 3W06A 1QXSA 4DNPA 1DXQA 3R4CA 3OFND 1WLEA 3V5NA 2XT9A 1ZAUA 4KUHA 2ID4A 3NT4A 2RKBA 4MDFA 3UJ7A 1F3OA 2WDZA 1E3TA 4DV4O 1P77A 1V43A 1OUMA 2HDOA 3CZRA 2J46A 5LU8A 2QT1A 2F66C 3GGGA 4Z99A 4D7TA 3MDSA 1P1FA 3OFKA 1HNZO 3JTEA 2QRQA 1D8TA 1NRIA 4GDFA 2A6PA 3IGFA 1M54A 4XTRA 1HETA 1UOOA 4KR3A 2WLMA 1KMHB 2QPTA 1G4YB 1FVOA 4JT2A 3BHPA 5DHAA 5EL0A 3AF0A 2IS2A 5AM0A 3PENA 3LBFA 3T7CA 2H92A 4JI0B 4BX2A 3QVGB 4C21A 4YMTA 5CDHA 2IEZA 4DV0B 2B4TO 2BHLA 3LV8A 1V95A 3BA8A 1RYYA 2YV2A 4KQGA 4KR7A 1B1CA 5EE5B 5JCXA 3I01M 3QW4B 2ZDIA 3LD9A 2JAWA 1MB4A 1P1JA 4GEKA 4PCAA 1RWXA 2BJHA 3JXEA 4YJ2B 3LPDA 4BX9A 2PUJA 2BN4A 1AVTA 4HUQB 4DA9A 1GLNA 4BEWA 3C98A 1XQ8A 4CIVA 3JS5A 3A4VA 4AJKA 3PT5A 2XAQA 1RLJA 4ZTUB 1R6VA 2PGXA 5DW3A 5EN4A 1KPGA 1XZCA 2IUTA 2PVSA 3CJTA 4W7HA 4C0WA 2DM6A 2TSYB 3MELA 3OMWA 3V8BA 2HTEA 4Z7OB 1ID8A 2ZQ5A 1IU9A 4DMCA 1UAGA 3PF8A 3IDOA 4MRMA 5T4BA 3N6XA 5LB2A 1CUDA 1YR2A 3RVQA 3QQ5A 2R9RB 3OD4A 1KXZA 3NVAA 1ZRMA 4MTLA 1X7WB 1PR3A 4NPAA 3KQNA 4MWCA 3UG7A 2QD2A 3IBCA 2H1RA 2XD4A 4V0ME 1F5SA 3KQOA 5J40A 1BMFD 4OKSA 4E32A 3EIEA 2BZ0A 1VL2A 2IGTA 4CEJB 4JYCA 2AA3A 1XD2A 3JQ7B 2H31A 4OAOA 1V7PC 4HDOB 3FZNA 4LR3A 1U9YA 3V4PB 2VWPA 821PA 2WZBA 1M1YA 4D81A 5JCJA 4ZTBA 3VJKA 2GO1A 4MWZA 1VJDA 1O77A 3WGGA 1NR1A 3TDMA 2UYOA 4F5ZA 4LZZA 4CCYB 2J59A 1E3WB 3HJTA 1JG4A 1WCV1 2C5FA 2QA5A 1SH7A 4MVYA 3KZNA 1W0KG 2HO5A 3DM5A 1TIBA 2VXCA 1GARA 2ORYA 2ZB4A 4EZEA 1D04A 1EBUA 2Q46A 3L1VA 4G4SP 1GQYA 2IV7A 2JAOA 1W55A 4S1NA 1XMSA