1FFXB

Tubulin:stathmin-like domain complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
427
structure length
410
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TUBULIN)
publication title The 4 A X-ray structure of a tubulin:stathmin-like domain complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 65
structure length 410
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1ffxB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1ffxB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1ffxB01
1JFFB 3N2GA 3RYHA 4TUYB 5J2TB 1RQ7A 3N2KB 3RYFB 5JH7B 3M89A 4FFBB 4YJ2B 5LYJB 4DRXA 4YJ3A 5ITZA 5JVDA 3ZBQA 4U3JA 3RB8A 5MN4A 4I55A 4X1IB 4F6RB 3CB2A 3JAKB 3JAWA 3JASB 5IJ0B 3HKDA 3HKBA 5CB4A 4ZHQA 4O4JA 5LXTA 4HNAB 3WGKA 3RYIA 4KWEA 5IJ9A 2VAMA 4LNUA 4XCQA 3RYHB 4E6EA 5LP6B 1SA0B 4X1KA 3RYCA 4B46A 5IYZB 4EI9A 2RHJA 4DRXB 4O4LA 5KX5A 2RHLA 4ZOLA 3VO9A 5EIBC 5C8YB 4X20A 1FFXB 2XKBA 4EB6A 3HKBB 1OFUA 5M7EA 1TVKB 3UT5A 3JATB 4LNUB 3VOBA 2BTQA 1W5AA 5EIBD 3V3TA 4TV9A 3JALA 5JQGB 1Z5WA 3HKEB 3JARB 4X1YA 4IHJA 4O2BA 4I4TB 4O4HA 5EYPB 5BMVB 5CA0B 5LOVA 2VAWA 4O2AB 1W59A 4IIJA 1RQ2A 4ZOLB 3N2GB 5J2UA 5EZYA 5KMGA 2Q1YA 2RHHA 4EI7A 4TV8A 1W5BA 3UT5B 3HKCA 5JVDB 4YJ3B 5LA6A 5ITZB 4U3JB 4I50A 5MN6A 4I55B 3JALB 5GONA 1TUBA 3JAWB 3HKDB 5FNVA 4IHJB 5CA1A 2GVIA 4O4IA 1JFFA 5CB4B 4ZHQB 5J2TA 4O4JB 4TUYA 5LXTB 3N2KA 3RYFA 5JH7A 3RYIB 4U39A 5IJ9B 3WGJA 4FFBA 4YJ2A 4X1KB 3RYCB 2VAPA 1W5EA 4TV8B 4ZI7A 3R4VA 2RHOA 3JAKA 3JASA 5IJ0A 3E22A 3WGNA 4O4LB 5KX5B 4I50B 3VOAA 4X20B 2R751 5JCOC 4EB6B 2BTOA 2VXYA 3ZIDA 5LP6A 1SA0A 5LP6C 4WBNA 1W5FA 3M8KA 5IYZA 2BTQB 2Q1XA 4TV9B 3WGLA 4X1YB 3WGMA 4DXDA 5LOVB 4O2BB 4O4HB 4ZI7B 5C8YA 1FFXA 3E22B 3C8LA 4IIJB 5MN5A 1TVKA 5J2UB 1Z5VA 5EZYB 5KMGB 2R6R1 3VO8A 3JATA 5LYJA 4EI8A 1RLUA 2XKAA 4M8IA 4X1IA 4WBNB 4F6RA 3HKEA 3JARA 5JQGA 4B45A 3HKCB 5LA6B 5BMVA 4I4TA 5EYPA 5CA0A 3VPAA 4O2AA 5GONB 4HNAA 1FSZA 1TUBB 5JCOA 1W581 3ZBPA 5FNVB 5CA1B 4O4IB
chains in the Genus database with same CATH superfamily
2V7QG 5DTQA 1K92A 4YCAA 2IU3A 3RO7A 3D0OA 1HYEA 5D3KA 1ES9A 1AN0A 1U1DA 4X1KA 3MPOA 3G71F 5EJ2A 3AP3A 2J85A 1K88A 2H2FA 1YK1A 1J8QA 1UBJS 3L8HA 2XT6A 4AJIA 1L5VA 2ZTMA 3EZYA 4BNXA 2XGMA 3WLAA 4A26A 3CMCO 3JSLA 2MYTA 1U3GA 2MSLA 1QAQA 5L4SA 1E2GA 1A2BA 1CF2O 3CV3A 3K2QA 5I4KA 5LMNB 1ZICA 4AUEA 5KYYA 4YP0A 2XJ9A 1RQXA 3EG9A 1PFYA 2JFYA 1AI7A 4KWCA 4QQ8A 5F12A 2G0NA 1X1DA 3EC2A 2YEVA 5FR1A 1ZM9A 2Z1MA 4IQ8A 2Y1OA 2O3RA 2YUAA 2OZPA 3QUQA 2CGEA 4CLOB 4IYIA 1R3KC 1WX1A 2GLXA 4WZAB 4EYQA 2DW4A 4X97A 4ZHQA 2HA6A 4JKIA 2HRZA 2B4QA 4NESA 1YS1X 4OX9B 1H3EA 4JPRA 3H11A 3WL6A 5H3CA 3TOVA 3SSNA 2ZYDA 2GERA 4UMDA 4LP8A 3NOOA 3GN1A 1T8SA 4IIFA 5JXGA 3CRCA 5CEJA 1T1RA 3PNOA 3ZQUA 4C8GA 4EAQA 3V2UA 5F3WB 3DV0B 3LXXA 3PICA 3WC4A 3B13B 4A10A 1XJ0A 3UAGA 3IR7A 5IX8A 1ECFA 3X0DA 4OV6B 3D6MA 3P0FA 3GN2A 3PT5A 5LD2B 1KZ4A 4X95A 1T6NA 2WM3A 4FN5A 1ARZA 4ZZ0A 4XVCA 1C0KA 4NTYA 1E18A 4RQTA 4CEHA 3F1LA 4QD3A 4BT4A 2XUOA 3WNQA 1JSXA 4LV5B 2XMZA 3SF0A 1JIVA 3I1FA 3LQKA 3IEQA 2J45A 1JG6A 3FJOA 3IR6A 4GI5A 4HQRA 4FFBB 4ZEXA 4C7UA 3Q3EA 2BSAA 4KAFA 3MJEA 2XEDA 2R6DA 1SUAA 2XY4A 3TRJA 2DKOA 4EL0A 1JSRA 4FFMA 4AS3A 3SF8A 2QB5A 3L71H 2F95B 4L95C 8ADHA 1O95D 4TROA 3HA7A 2B9EA 1DZIA 2C2WA 4NG5A 1ISPA 4NV1A 5FPOA 5HZMA 4Y18A 1A9XB 3SNHA 3UJDA 1FVFA 5IP5A 1QM5A 3IDFA 2QHXA 5DHRA 1XRNA 1Q1GA 5IWAO 1H0HA 1RPJA 2BBSA 3CEAA 4B7KA 2R70A 3AR9A 1GXSB 4TYPA 5AVSA 4NENA 3I61A 1ODJA 5HP8A 4CJXA 4UOZA 3I8XA 3PE3A 4G5RA 4EIWA 4I5EA 4OHMA 5KVCA 2QG6A 4MWGA 1BHSA 3OLXA 1FVHA 1G9TA 5LYJF 2V9CA 2JLUA 3G4SV 2QTGA 4KX3A 3IXMA 1Q0LA 2H85A 1AVTA 2Y4OA 5DN6D 3BS4A 3WMEA 3GG9A 1GTOA 3ZGVA 1VL6A 4OIMA 3HU2A 4NEGA 3SOZA 3TZCA 1ZU5A 2WJZB 1QUFA 2X15A 3MCWA 5FTMA 1GNLA 2ADQB 1BQ0A 2A9HA 4LV6A 4JBHA 4QXMA 3OVMA 3K0SA 2YNMD 4I9GA 5KAPA 1EDDA 4AUMA 4F3KA 1KDOA 1SD2A 4YRCA 3T1NA 4DV4O 1N8NA 5CBFA 1YNOA 1DAFA 3ID6C 1X1QA 1X1AA 3ZYZA 1QONA 3PHJA 1UEIA 4MV9A 3KQMA 2NV6A 1Q20A 4PXSA 5JD6A 2I2BA 4MDYA 1VQ8F 1HR0O 4N9QA 1LR1A 4GPZA 3H8SA 1BU8A 3WTBA 4JVNA 2XWBF 4HGOA 2WKQA 4G24A 4H37A 1MAWA 3O94A 4UUJC 1PTKA 3T54A 3EWSA 1G9SA 2RGGA 1LWNA 4JUBA 3F7NA 1GPBA 4BB5A 2ZB7A 3GP8A 3UF0A 5TLSA 1GM8A 3OP4A 4I8DA 1PWHA 4LZOA 1WXGA 4MRRA 2JIZG 2IP2A 4LF8O 3CVXA 3M1YA 3GUCA 4TT3D 3UAZA 1P9OA 3H2KA 2PHZA 2SKCA 4BMSA 1E0JA 4RV9A 3STVA 5B57C 3KS9A 4ZT7A 3OQ1A 1P45A 3WRXA 4IDDA 4JI6O 4R83A 5K9ZA 2PEZA 5F2KA 4FNGA 4C5CA 1XNHA 3TLYA 3M1AA 1B04A 5FHQA 1PL0A 4LUCA 1TLFA 3R7SA 3L6CA 4RVFA 1BDJA 3VR4D 4C6RA 1QZ3A 1DUSA 5J3JA 1OAOA 5HQ3A 2RJNA 3ZIDA 3P32A 1KMHA 3SYTA 5AKKA 4U7OA 1GH6A 2BW0A 1QYCA 5HBRA 4NCKA 1QQ6A 2JI7A 3IA7A 3O2QB 1ANKA 3BD6A 2P79A 4Z9AA 1HDRA 2WE8A 4HLDA 1RQLA 4A2PA 2PRJA 2EF1A 4JTCB 4OGKA 4YDRA 3GARA 4E5PA 4RL6A 1JEDA 3TIXB 3P2EA 1S3FA 3F49S 2NM0A 1KQ3A 4RTJA 3PB3A 5BYAA 3DP7A 1BVYF 5JSZA 2OL4A 4MV0A 4LNAA 1NKDA 3IAM1 4Y98A 4CLEA 1ISGA 2DFNA 2E2WA 3I5XA 2HHHO 1WDKA 2IYWA 5DCYA 1LEHA 4ECAA 3GWKC 1CUUA 1N4CA 3NWOA 3M1XA 5LBUA 3AINA 1H4TA 5KTRA 5LJLA 4Z1MD 1FP4B 5CX1B 3D7LA 4WFJA 3F5MA 2IU6A 3K9AA 4WXYB 3QLVC 3V4DA 3QI2A 4NL4H 3BERA 2ZI6A 1J0CA 1KI8A 1MC1A 2VATA 1XMSA 3CG4A 4BNFA 4YDSA 3BGVA 1YVUA 1L8LA 5GINC 3A3OA 5F77A 5TMPA 2MIIA 3FF1A 4XQEA 4DR5B 4DCTA 2YSUB 1ESZA 2B5WA 3A7EA 3CCRV 1EUZA 2EC5A 4HDNA 3AVOA 1YB6A 1UR5A 4D4IA 2X22A 3ZGNA 2I9PA 5EUQB 3U62A 3GLGE 4ODIA 4PGGA 3HVJA 3L9WA 3U81A 2AN9A 4NZZA 4MGYR 4Q9NA 3UNXA 1RYMA 4CFZA 4DZTA 1WLEA 1N2SA 3FTPA 2P1RA 1Q17A 2UYKA 1QFZA 1PPJH 3ZVMA 3R9WA 1NDUA 2VJYA 4JU8A 5FCDA 4X9XA 1MRSA 4JEIA 1NPYA 5FA6A 1D04A 1X2BA 4BX0A 4P4NA 2H08A 4B2LA 3ZXXA 1AF7A 1JVNA 3CWBH 3ESAA 3HEBA 4MKXA 3ZUPA 1YMUA 4P33A 3Q41A 3KKEA 4W5TA 2EG9A 3ESJA 2NU6A 2JCSA 2HJRA 3ZP7A 2QRHA 3FCOA 4C1NA 2KJQA 4MS2A 3QKTA 5KNCD 1FP6A 3DKKA 2E5LB 1E94E 1U9JA 2OXTA 2BCGY 1KERA 2AE2A 4JLJA 4BVTA 4ZCLA 4G5SA 3GLFE 3NASA 2AJTA 1EFPB 1Z4LA 2PSHA 3F3SA 1L1QA 2NZJA 4ZOLF 3NP7A 2FOLA 2WFZA 5CK5A 1W0JD 4G5OA 5F5NA 4YRAA 2O8CA 2WYVA 3KJJA 1TO1E 2PWBA 1S2MA 2J87A 2QRGA 4K81B 1PNQA 4JI1O 4P93A 5FNVA 4BUJA 5ICMA 4JCCA 2IDZA 5G40A 4MVQA 5TF0A 1NR5A 3PD1A 5B3SC 3FTEA 4P5DA 2WT4A 2JFWA 5CN0A 3DKRA 2G1AA 5A2QN 4I1SA 3COVA 1H1LB 1GTVA 3C6YA 3NHZA 2VKTA 3M6IA 2PBRA 2XLBA 6REQB 2YVQA 1JDTA 4DDKA 2VRWA 2HRDA 3FFQA 1UK9A 3VHLB 4XE5A 4WBSA 1XREA 3R0JA 2Y4UA 1B8PA 1ZRNA 3VYUC 2WTBA 3RSSA 1B0UA 2GBLC 5CBPA 5HRCA 5DLYA 3UFBA 2NXEA 2J0EA 2JLWA 4W5RA 3UICA 2Z5LA 4J75A 1BX3A 3EVDA 3P20A 3UXHA 4BO1A 1BHBA 2VQEB 4REQB 5C53B 3OQVA 3H17A 1H2AS 3BM5A 3H9JA 2BKXA 4PHFA 4BEBA 4BLWA 5B36A 4LOKA 1D2DA 1KEVA 3KAPA 4FCTA 3NHJA 1CY2A 4KP4A 4DCUA 1GZ3A 2QSYA 4H0CA 1LLDA 3N3BC 5IXJA 2SCUA 4QARA 3FOWA 4QRHA 4JC8A 3OOHA 3I55F 5B6JA 1JLHA 3PT9A 1SWWA 1Z06A 5K6RA 2P27A 2FRVA 5CCEA 3OKPA 4B3JA 2DBVO 2C5AA 1OXBB 3BTOA 1BS3A 3F0EA 4R1PA 3U80A 4RTKA 3GNQA 3FLEA 3FNGA 2JS7A 1D4FA 4ZAVA 1KQFA 1Y3DE 3IVGA 1FDOA 5F21A 4BX9A 4WTOA 3EZXA 5H8WA 3TTWA 2IYLD 2N0SA 4MYTA 1GM5A 1O96A 4X8OA 5BN5A 3K6SA 1DKQA 3H9GA 1Q90D 1QTNA 4S0XA 3LUPA 3P0RA 4BVEA 3AI3A 1H42A 4N12A 3CSXA 4Z7OB 2ALJA 1E60A 4Q47A 3UMSA 4ILKA 3QMMA 3WXMB 4BZWA 3BY6A 2RE8A 3PPWA 3K12A 5B1BC 1PW5A 4L0QA 3E5NA 5BSVA 2FVXA 4KRGA 2YWRA 4OA5A 3LMEA 3PVCA 3K9LA 2RD2A 3QKUA 1VG9B 4NVRA 4G4ZA 1KK3A 4KOAA 3D2CA 2O2JA 3DC7A 3OZTA 2C9BA 3R4CA 1Y76A 4M1MA 4XX1A 2H1WA 2Z8YA 2LBWA 1JN0A 1Q6ZA 5EOVA 1ZM3A 1H6BA 4LNHA 1RM1B 3DF7A 5EIHA 1CEEA 4MGZR 4OFBA 1NP7A 3DT6A 1WMFA 3KCXA 4ZCSA 3COYA 1HQCA 4GI2A 3LOPA 3P4YA 2C84A 4BFZA 4JLOA 2UUAO 1GWNA 3W2TA 2QTTA 2X6RA 4YAWA 1ZQ1A 4LNUA 3ZV4A 4D5EA 4K1XA 4V0KA 4QOHA 5JS7A 1T26A 1AJEA 3WGYA 1A5TA 1Z82A 3B60A 3DMRA 3VPCA 1A5AB 2CXRA 4FK8A 3B6NA 1MR3F 3WLPA 1QBKC 4L15A 5KTYA 4NV0A 1GTSA 1PIWA 4ZVKA 2PUTA 1HYHA 4OX9Y 2B1RA 2PCLA 2KW5A 1PX0A 4CCSA 1JHVA 4AKIA 3A2KA 3OP1A 4CT0A 2VSNA 1XUQA 4FFWA 3OMWA 2AOTB 4ZMSA 4YRFA 3RLFA 1KOFA 3FFXA 3H3JA 5FWXA 1E79D 1GGFA 3B6JA 3AT1A 1K4KA 3TOXA 4YWJA 4JQZA 1EVZA 2GZDA 5D6NA 2BMWA 3NC4A 1T25A 2GN6A 4J0GA 1HT2E 3I3SR 4BMOB 1GNSA 3D7NA 4JQYA 2XWQA 3CG6A 3H7AA 2I8CA 3RJ9A 3OO1A 2UVQA 3UMMA 4ZIBA 1TQ2A 3G5MA 5DP1A 4ZCQA 5LBIA 5IM4A 4DR3O 3A0UA 5JALA 4OHYA 5B1AC 4KI0A 1YDHA 4OA8A 5JMOA 4MTCA 3CM0A 4MRSA 5CT6A 3ETDA 3W2FA 3IPCA 1XPRA 3OR7C 1UC4B 4D92A 4H4EA 3CC8A 3SPXA 3A28A 4RY9A 3AHFA 3CMEV 4PIMA 4XIIA 1N2CB 3E9EA 4LPKA 3SZRA 4OB7A 1VLVA 3V1KA 1V3TA 4CCYB 2GKGA 5FF9A 2WUVA 1WDLA 4GHWA 4PHZA 1NSTA 5KINB 3A27A 3C7TA 3RYFB 2XHEA 3K9HA 3MTJA 4RY2A 3T12A 4Q3NA 4BLUA 2FWBA 3ZX5A 2AFHB 3EC1A 3WK9A 5IYZB 2ONYA 3LT1A 4Y2GA 5C8DA 3IP3A 1TA4A 1GTRA 3Q3VA 3LDDA 4DR7O 5TQ2A 2H65A 3OOJA 2OHWA 2WPDG 4QHTA 4DBLC 5CDHA 3JQ7B 4X90A 1LRKA 3D6AA 3U2QA 2VPTA 1WXQA 4MTGA 1OXSC 1K73W 1SU8A 1KD1W 1DC5A 2WB2A 1LY1A 1SVUA 3ETNA 2YRWA 3BEHA 2IHKA 3D64A 5DNWA 3EBPA 1A7AA 5JRZA 1HLFA 4ZI7F 2PH1A 2YHSA 4KO8A 1QTQA 4X89A 3PC8C 3TNDA 1NI4B 1OCCB 1YB2A 1C9JA 2CDCA 1ZH8A 4UUQA 4HGZA 5CT8A 4MW1A 3TAHA 5BP7A 1XTZA 4C8IA 2GTIA 1MZEA 3ONVA 4L76A 5FLKA 5A3JA 2G04A 3L8YA 3AVWA 4UW9A 1MJNA 4Y6SA 4BP9A 4DB2A 1VQ1A 4OK6A 3ZE2B 4D9KA 1WY5A 2OTCA 5AM3A 4NY1A 3NHKA 5JDIA 1M90W 3R1IA 5JCJD 3C6XA 3GHYA 2NNUA 2OILA 1CYEA 3O4RA 4FGUA 5FV4A 1NQTA 3TOCA 3U11A 4JFAA 1N2OA 2G76A 2X0NA 1X42A 4MS4B 2FK8A 3CCBA 1JEAA 3C7KA 4LFBB 1GTZA 5JISA 4BW0B 5T3UA 5B8FA 1AQJA 1P2SA 3RUEA 1GRRA 3D8BA 3W0LB 4PC1A 2XZTA 2IYXA 4N5MA 1X0XA 1PLJA 1NG1A 3ZV3A 3KQKA 3GEBA 3U4GA 3WK8A 3BJZA 2GTHA 5KTKA 1BEUB 4XVQA 3AL2A 2R6R1 5HYVA 4YRLA 4RE5A 4BVFA 2IPNA 3O4VA 2Q67A 1M54A 2TS1A 1EZVH 1KWKA 4CG2A 1R9GA 2ZDIC 1L5GB 3BZUA 4LGCA 3MIIA 1N3LA 1R5OA 1TAHA 1PFVA 1VCMA 1MG5A 2VT6A 2RKBA 2E0IA 5GY7A 2ZF8A 3SMQA 3EZGA 4KXUA 4A3SA 1G8JA 4LOLA 4K9RA 4RKRA 4M1YA 1ZCBA 3RDPA 3E7WA 2VHYA 1XTBA 4V3BA 2X0EA 3KOOA 2POCA 1JZSA 2H48A 2RDCA 4U7GA 2OYCA 2VTBB 2WIGA 2CVZA 3CURA 1UANA 3EPPA 4UNQA 1B6TA 2C2ZA 3UAYA 1K73H 4L16A 4ALMA 1KD1H 1YBAA 1EZZA 2JFNA 1IMJA 3IV7A 3KDAA 5GONF 2Z56A 4JGIA 1L5SA 2Z2JA 3DWFA 1NUTA 5JNSA 2I71A 1AMNA 1H4QA 5LYJA 1XLTC 2VDOB 1WDTA 3TZHA 1M34B 3KIPA 1CDEA 3B1WA 3G68A 3MMXA 2ZIXA 4KXFB 4TTAA 2R8OA 5J4LA 1YZKA 2FUG1 2XWSA 5JWPA 4OOFA 3PHBE 3W9SA 3STLC 2WUWE 1I13A 4O2LA 5CAEB 2IYEA 4LWQA 2QRVA 2ZIWB 3OZVA 2FHPA 4GP6A 4ZQFA 1MB4A 3PCXA 1G3MA 4MYHA 2B1GA 4GPD1 4MTXA 3ZCUA 3CWCA 4TN5A 4OMFG 3NOVA 4IHAA 1H2LA 4N5NA 1SWVA 3I04A 1RYBA 2AUNA 2QD3A 1W4LA 4JI2O 3D5EA 4C5BA 2Y0DA 2HA3A 2WKWA 2R96A 3LOUA 2B6NA 1IYZA 1Z6ZA 1XRLA 3DBIA 3AR2A 1JLKA 3QVMA 1T5IA 1GFIA 1A72A 3R0VA 1VKNA 4PD4F 5KUTA 3HY6A 3AZPA 3K05A 1QFMA 4EJ2A 4DWJA 3KD3A 1VQ6F 1RI5A 3DSQA 1UK8A 3TW8A 1WWKA 3FPKA 5IWCA 5GADl 1AE1A 2ZUCA 1YL6A 3SC4A 3DFUA 5JDCA 3CLRD 3LUGA 4I1IA 2ZBQA 4A8JA 4BUZA 2CE2X 3RC8A 3ED1A 3CB2A 3JAWA 4UXNA 3BCCH 3CVVA 3O3NB 1ONOA 2QZ9A 1YUNA 2EZ8A 3J80N 5JPDA 1UWCA 2PTMA 1FDRA 4GCZA 2QTRA 5M29A 1K5GA 4EVIA 5REQB 2JFVA 1DDIA 4XD2A 1S77D 4EQ6B 2QM3A 1A96A 1AU9A 1XMQO 3U4HA 2PTHA 3A1VA 5SZKB 3TKAA 1QANA 3VM6A 3KR1A 3DSRA 1N2IA 5KOJB 1YHZA 3HMQA 1OBFO 4WINA 2YMLA 2HREA 5BMVF 3FD5A 4TTSA 4JX8A 2X6QA 1JSLA 4IDCA 2Y1FA 3PCTA 2C2AA 5J1SB 1TYDE 1TU4A 3TETA 4M8KA 2HO4A 1HL7A 1J2JA 3ZIAG 1WHSB 1P74A 3RIHA 1H2MA 4MA0A 3AXSA 1J22A 2O05A 4RS3A 2VGNA 3NHRA 4L27A 3SHVA 5HJ7A 1SIOA 2GRJA 3JARB 5FL7G 2X1MA 5FUBA 3HUEA 2OQIA 5IYCO 4YHBA 2O7RA 1YT5A 1V9CA 1R5BA 1IWOA 1Q19A 3ZZNA 1TT5A 4HVTA 2WLTA 5B4UA 5CLFA 5JH7F 4MS3A 1OFIA 4K8XA 5KSPA 1CRLA 4D98A 3DC5A 1FNBA 2CMKA 4H16A 3V1MA 3UGKA 1YJ9V 4Y2QA 2BDUA 3A58B 5IVKA 1YUMA 4C2UA 2F93B 3ASNC 4PICA 4RHUA 4KX5A 2AJCA 1AROP 3Q6IA 1NBWB 4NK5A 3A1EA 4WACA 1KFKB 1RM3A 4B6JA 1H2XA 4KN5A 2EDCA 3IEVA 2PRKA 4DMHA 1HLDA 5JS8A 3KFLA 1SQFA 1ZD4A 2GF2A 1US6A 3VGJA 1V41E 5JLJA 5TEVA 3HDYA 2XB4A 3FG9A 1SKBA 5GAJA 3GD7A 3QFRA 4Z0NA 4HRVA 3EUAA 3AK4A 2A9FA 3Q88A 2IELA 3I7TA 5DV9A 4P82A 2ZTUA 4AWBA 3W5DA 3X3HA 2J0QA 1U2ZA 2QORA 2QV7A 4AJ9A 5ED0A 4FIDA 3AK1A 3VPGA 3AUYA 2BTOA 4JGBA 4PG6A 4DTCA 4FYWA 3WRYC 1MUUA 2NN3C 1JQ0A 3WP1B 3I0MA 2YWJA 1NV8A 2GFIA 5CRIA 1RD4A 1ZSYA 2ZE6A 1R0YA 3JD2A 1NYRA 3MOGA 3VPAA 3V8PA 4DSTA 3BB3A 4FJ2A 3GPBA 3HHEA 3G5LA 1C1DA 1YKSA 4IMRA 4QTYA 1NZ6A 4M8LA 4F1WA 5CDFA 4HZUA 1XE3A 3WV5A 1A9RA 2CHEA 3MCVA 4WPGA 4ZOLA 1NWCA 4Q20A 3WB1A 3LQ2A 2ZUDA 3PKIA 1KKDA 4EATA 1RYFA 1TEHA 4EJSB 4FDAA 4WKNA 1I3NA 3DO5A 2HRYA 4Q1CA 4WZBE 2ADPA 1L5RA 4AB1A 1JQKA 1R9JA 3CRRA 3AIKA 3B3GA 3SYAA 1BJRE 3ET5A 4IGGA 3C7AA 4EZIA 5AJHA 5DNVA 4OYHA 1KECA 5KHOC 4S05A 3GVXA 5EZ6B 5K8CA 1EGVB 3L0ZA 3WHIA 1DRKA 1CETA 2E1RA 2JFPA 4BWAA 5IDVA 3S3TA 3K8OE 3I1YA 3JWIA 2UZHA 1T3HA 5H5JA 4J0JA 4DGSA 3EZFA 1L4MA 1P9NA 4BNGA 1QFYA 3O9MA 4IMJB 3ZBUA 1U97A 3CXCU 1W2WB 3R5FA 5F98A 3W6NA 4EP1A 3MC1A 3N8IA 4ALIA 5FPQA 8AT1A 3NUGA 1USIA 2FRXA 3J81N 1QUEA 4EW2A 4G0ZA 5HUQA 3F8SA 2ZQYA 2J6IA 2PGOA 2M1XA 3OZRA 3TGUH 2RC5A 5ER9A 1ZTEA 4XDKA 4X00A 4XPIA 5D87A 1DKNA 3WSTA 2FLKA 3HYLA 5EXEA 2UXCO 1JHMA 2GKSA 3T7JA 2G5PA 1NN3A 5L51A 3FNIA 4FFOA 1AKVA 4EMUA 1EB9A 3SDLA 3LOQA 3COZA 5EJ9A 5DCUA 2P5OA 2VYND 5C8YF 4MA5A 2GSWA 3TKLA 2PY5A 3RA6A 1N34O 3PC6A 3NHAA 4TM7A 4GLJA 1X1CA 1XD2B 3B1YA 4C76A 2ZBEA 1RI1A 3MXOA 1ACLA 4LGVA 4BR6A 3ZOPA 3HB4X 3WXBA 2PVPA 3KQWA 3E2EA 2NT4A 2RGDA 2J5XA 4OHVA 1G8MA 2QN8A 2V7QA 3WNCA 1Z5PA 2XDAA 2HY7A 4LZJA 2A35A 3H1PA 3E82A 4MKHA 4MVJD 1U0NA 4BRSA 1E4EA 4ZO7A 3NBXX 2J3KA 5AUNB 1M6HA 3JVEA 2JAHA 1T8WA 5C1BA 2QMYA 4GPBA 5FOUA 1QHFA 4LXIA 4OTZA 1ZJ6A 3TMYA 3S2YA 2J9RA 4J76A 4XYBA 2QUKA 4DA4A 1RYHA 4IILA 4B6FA 4J41A 3ILXA 3OFSA 1VJ1A 4MW5A 4W8GA 4XQCA 2Y9PB 1T1EA 2C5EA 5MFPA 1U4NA 4PX5A 5EZYB 3LU1A 4LYEA 4N47A 3GGCA 3FAVA 5KYTA 1JT2A 3D4IA 4GUDA 1V8DA 1O89A 2L18A 3O90A 3MYRA 2YMMA 4Q3CA 3RRNA 1EEXB 3PUVA 4PZZA 2Q8QA 3RYHB 1P80A 2ZKIA 2WIBA 4FC7A 2AVDA 1AKUA 1FNDA 3DS8A 1GX1A 4DS3A 1UP6A 5BQPA 3D6VA 4O29A 1ABEA 1EZ1A 4E7PA 3FJYA 3H0KA 2OCCC 2GLZA 1S5PA 1WQ3A 5KJFA 1AM4D 1Y7IA 3N2EA 2QAGA 1SY7A 4QBFA 4NR1A 1QAOA 5KREA 5JATA 4ZPJA 4D4MA 3D9QX 1Y6GA 3VU3A 1FMTA 1EXDA 4CMEC 5HTOA 3Q3GE 1UWKA 3AP2A 1UAGA 2OORC 2H2DA 4IMIB 5L4LA 1EQUA 2Z58A 3AUXA 3S1SA 1YVRA 1IV3A 5I5EA 4NOLA 3LA6A 4R9SA 2XTZA 2AMFA 3DPIA 1ZSNA 2Q5JA 5ELMA 3A36A 5BN4B 3PF9A 4RHEA 5CA1B 4PZEA 4C6TB 5BSEA 1WMDA 3VC2A 1OCEA 3G2PA 1L4GA 2IZ0A 2WQ7A 2XF2A 4IIUA 4KO3S 2UXXA 4L7VA 3MJVA 2OM2A 4D26A 4PI2A 2VCEA 1ZM4A 4B9AA 4DWOA 1ZWKA 1C7JA 2ZJYA 4DIDA 4WWHA 3N8NA 2QTLA 3RVNA 2VHTA 3JD3A 1NKVA 3V1UA 2DQ4A 2CFIA 4Y9TA 2EX1A 3KJNA 4UATA 1TK3A 4Q9LA 4F91B 1ODSA 2PT5A 4UBNA 4V0ME 1YRWA 1JT9A 5AW4A 2YFYA 2GXUA 2WWTA 2BFDA 5IJ9B 1F0YA 1F3OA 4YXWG 4PC6A 1T24A 1KI3A 3MB5A 4EG1A 2ECOA 3LZDA 4WF9V 2FSVA 5LP6C 3I8SA 1TM3E 3NX4A 3PU6A 4G28B 4ZAXA 3K70D 5BWLA 3BF7A 1E2FA 4C4XA 1JSZA 1YUBA 5TISZ 3JD1A 1TYAE 3IMGA 5B3AA 1MEJA 1XA0A 5DFAA 3L9DA 2W8ZA 1CC1S 4JVSB 3IUSA 4A5SA 5BVHA 4G1MB 2VXBA 4OU4A 1XL6A 3W1VA 1M57B 4O1IA 4YRRA 3TJMA 4D8VA 3OBWA 3EGOA 3PQEA 1KARA 1FJHA 3LSTA 4ASUD 3IFSA 4G8JA 5KKNB 1XAJA 2IJJA 2VEDA 1Q81H 2ARKA 4L5CA 4RD6A 1GNTA 3ZQJA 4OMUA 1Y8ZA 1YR9A 3PD7A 3T1CA 3WHLA 1DC7A 2EULA 3NCTA 3RWMB 4L2IA 4C0XA 3QQ5A 4HUQB 1D6NA 3HO6A 4NX2A 1SCNE 4FHZA 1QTRA 5IDQA 4QQFA 1RI4A 5AKIA 5EJIA 4AZ3B 1RAAA 2IUSA 4ZI7A 4KR6A 3BDIA 1KZ7B 3UMFA 4EQZA 5HA5A 3MG9A 1K6EA 2GNPA 4J91A 3SBXA 1B16A 2IQQA 1JXMA 5F9HA 1Y6FA 1RM5A 2QEXF 3GDGA 1Z8HA 2VZ0A 4P9OA 1URFA 1V7QA 4WH0A 1UJCA 3LQYA 4G0UA 3UJAA 3TE7A 4FD2A 4CIYA 3T61A 3ZE0B 1M1YA 1C8LA 2JBAA 5J63A 1VC2A 2X0RA 2ZRLA 1KH2A 3VZPA 3AOEA 3ESQA 3S0JA 2XAUA 4EW3A 2FPLA 3HRHA 3CD6V 4EK9A 3C9TA 4RSGA 1C8VB 4R6XA 1ESDA 2C4HA 3MBMA 4DKXA 5DXFA 1XQVA 5B3SB 3QKSB 4HXYA 2RJZA 3TTYA 3HYNA 2VHJA 1E98A 3LQQA 1S72F 2Q07A 3WE7A 4DQUA 1YF2A 2CSXA 3AFHA 3ZLJA 1U1IA 3N2KA 3BBPA 1YHNA 1OV9A 1MQ8B 1OZ0A 4QO8A 1QLEC 1F1BA 2YC4C 1FQJA 2ZTVA 2PMDA 3LT0A 3V7WA 1H1TA 2F3UA 4MAAA 2WV9A 3HB5X 1H2GA 3K0CC 2YZKA 4LK2A 3PX7A 3GZJA 1CQPA 1KYWA 4IJ6A 3FB7C 1DAHA 2P2GA 1ZMRA 4C3ZA 4XWGA 1UXHA 1VXRA 3P7MA 4FLZA 1NASA 4GI7A 2Z3WA 5KJCA 4I08A 3U7IA 1UEJA 4K9NA 3PLNA 4Y8VA 3PQ8A 4ND7A 2XV1A 3WQRA 1MN6A 2F1JA 1WP7A 4I0XA 4XB6B 2R1VB 3PGA1 2R6FA 1KZHA 2VJCA 3ILYA 3VV2A 1VQOV 1AKNA 2IH3C 2ZCJA 5TV2A 3AKCA 2V65A 2QU7A 5EE1A 3PC3A 2GN0A 1LVGA 2VNAA 1SD1A 2JIBA 4RTSA 3OIVA 3OJEA 4ZCMA 1KEEB 3D7KA 1NUQA 2IW3A 1AXEA 5AW6A 1YFKA 1T13A 5TC4A 4UCWA 1XELA 4XGKA 2EIXA 3LWVC 3ZRWA 3MBIA 1U0FA 4GICA 2EL9A 1P0IA 1UWVA 2J7KA 4Q1DA 4FZVA 1ZH2A 1N6HA 1ZMXA 1RIIA 3ZLBA 3BHIA 5L95A 1ZG3A 2AEFA 1IEWA 2V4ZA 4RTNA 3N6VA 3NETA 4TL9A 4KK3A 2WV7A 5CXQA 1I94B 3CVUA 1K5HA 4EA7A 4A2QA 3MBKA 3CPEA 5JS1A 2UXNA 4LXTA 1Y8RA 4J1NA 2AFIA 4ZYLA 4JI7B 1NQUA 5ALZA 4JI3O 4M0KA 3JQGA 3UWDA 3TPZA 1XZIA 3LSSA 1O4WA 2X8WA 2ISQA 4PLYA 3TS1A 5B1BB 4NK4A 1EE1A 5LN1A 1Q0RA 4CTOA 3L77A 2JIMA 4JS0A 5JQGB 4YP6A 3VR3A 4DG8A 4FOLA 2QE7G 1FUKA 2F1IA 4QDXA 5K8IA 5B64A 3T1VA 4ENSA 1G20E 1PJRA 1XNRO 1U8EA 1H3NA 4JJ8A 1OAKA 3L07A 2K1EA 3QI7A 3KVNA 4EB6B 2NSLA 4RDHA 4YYEA 3ABIA 4CE6A 4A0HA 1Q6HA 1JHDA 4J1TC 3R5SA 3UKOA 3KT3A 4G07A 1CBUA 1C0LA 1M2OB 3ERCA 2JI9A 1VKZA 1JF8A 1FYJA 3H3FA 3OR6C 3ZDFA 3QMVA 2H63A 4M0UA 1KK1A 2DQYA 1IEXA 2IEIA 3FB1A 1VCIA 1I08A 1ZP6A 4YIOA 5IMBA 3KQHA 3NGLA 3OTQA 4X3MA 2JFHA 1CUWA 1Q5OA 1Q1AA 2FN8A 1GO2A 3H2ZA 4TTPA 2IGBA 3FLMA 3GEIA 1WMAA 3VHXA 3DJYA 1G7CA 4MW7A 1T43A 4E22A 3APQA 2A2ZA 3R66A 1U96A 5F52A 2R4UA 6GPBA 2AKAB 2CDYA 3IPYA 2P67A 1BMFG 3ECSA 1ORHA 2FB9A 1ZZGA 1P4SA 3KBBA 1T9CA 4XSVA 2FTKA 2EFDB 1U04A 4COKA 2CNNA 4LRTB 4DXAA 4MV7A 4HI0E 4D7TA 3GLVA 3N5KA 3LT5A 5JCZA 3ZWXA 2ZQZA 1OILA 1U0SY 4GM1A 1KK2A 3P5SA 4ZT6A 2BE3A 5BMVA 4TLBA 5FTJA 5B1AB 3DE6X 4CFYA 2REXB 1RAGA 4ID3A 1XNQO 1VE7A 4C7KA 4M1SA 1Q77A 3EA4A 5DRYA 2BEUA 3X2QC 5KI6A 4C0AC 1QV6A 1SMKA 4GL4A 1FJXA 2H54A 1F4PA 1ZWLA 1VM6A 1EWQA 4RK4A 1ETHA 5CDUA 5TY0A 3PWZA 3RROA 4D9IA 5HUHA 3MLEA 2OVFA 2EZTA 3B36A 4GQBA 3QNEA 3RW9A 5E1OA 1KI2A 1QVVA 1S2IA 2IHVA 1WUIS 3RVBA 1KVRA 3TIIA 1GCUA 4YRJA 1ITZA 2NU9A 5JH7A 4DA8A 1MXFA 2D4HA 3MJHA 1GUAA 2PA0A 4BNHA 1YDEA 5G3YA 3WLJA 2O8FA 3L4BC 3CR3C 4C87A 2A1UB 2XGSA 1WSBA 3QBDA 2QXTA 4P4TA 1IBMO 2JF0A 3VI3B 3T9FA 3SJCA 4B8WA 3R3YA 1YAJA 5CUQA 4JJ6A 2ZSIA 5LLSA 4GX5A 5SY9A 1ONSA 3ZHOA 2QENA 4RGQA 3QEJA 1F5SA 1UMBB 1PV2A 4D9CA 4H6VA 1HTTA 2UUCO 3TL2A 1AH2A 1BWSA 5FRDA 2WIFA 3HVUA 4F6RB 8MHTA 4UCXA 4A8TA 2EV9A 4MEJA 4BB9A 5AJYA 1CS4C 4YVFA 2Y93A 1RZRD 3WQQA 1R6KA 1EZJA 3F7TA 4ND8B 1H05A 1S1MA 3K0FB 5F76A 5DMHA 1I5OA 2Q68A 4D9JA 2B37A 3KK0A 3TTXA 4YJ3B 2GX6A 3GAZA 4KL1A 4OCZA 1VCOA 2VDPB 1UBUS 1BXRB 2ZIMA 4KBYA 1QJ4A 3RC1A 5SZIA 3RIEA 1OJHA 3FYUC 4AN0A 5J2UF 3WJ1A 3PNKA 3CVJA 1QDUA 5HKAA 1X8KA 5B1HA 4PBTA 2W6CX 4PZPA 3LWBA 3OLYA 1E9SA 5LUBA 4ZRMA 5EXSA 1XP8A 5ALLA 2H3HA 4PHHA 4RUFA 1B8NA 2XCOA 3Q12A 3IALA 5GOZA 1WETA 1GHTA 3DZ8A 3TNFA 4LMPA 2XSZD 1A7JA 4W99A 1I7FA 4RH1A 1E1QD 4B3TB 1SVSA 1N8TA 5BMOA 3PFGA 3EIQA 2OOKA 2REBA 3NW9A 2CVLA 4BBPA 3ZR4B 2NNWB 4W9MC 2FW9A 5AK3A 3GLIB 4D57A 1FQWA 3QEKA 1KEUA 3NNDA 2VLBA 1YFLA 4WXEA 3JWGA 1WA8B 3W8RA 5CR9A 1JR6A 1Z8DA 2W6JG 3I83A 5JU6A 4U8GA 4UULA 4RE6A 2G9ZA 2P1ZA 1CF9A 3A3NA 3KM0A 4QUHA 4ZHVA 1R27A 1ZNWA 3B2EA 3MLAA 2X3UA 1N6OA 3EIXA 1YA4A 1F7UA 3CCCA 5HF8A 5L3ZA 2XUZA 4ZJUA 4LCKA 3KEMA 5F7XA 1MABB 1YBFA 5IW8A 1O7JA 3OEYA 3BOSA 4JEUA 2X8AA 1US8B 4BAGA 1QBGA 3CYPB 2P9BA 4XKJA 5AVRA 1HV8A 2PT6A 1K7FB 5IKEA 2AXQA 2VJNA 3U4MA 3ZHQA 1XKQA 3EMBA 4QULA 4PLWA 2AK2A 3OZWA 4G23A 3DQPA 3TPCA 4M1KA 3JU3A 1S2LA 4LSZA 1FRZA 2CXNA 3SYPA 1GCAA 1NMYA 2ZSDA 4ENTA 4KLRA 4J0FA 3DDUA 4XM2A 3A9CA 2ISSD 5EVJA 2QIPA 1LBQA 1CJVC 1B06A 3R5TA 4PAMA 4F1JA 3NTUA 5H81A 2JLYA 2X40A 1TUBA 5DWVA 1QVRA 3S0WA 3Q8LA 1XFDA 1RABA 4JBWA 2M6YA 2KHZA 3I52A 1QC5B 1XF1A 1W30A 1TYZA 4KO4S 4KKXB 821PA 1QPGA 4N7JA 1O6BA 2HK7A 2Q6OA 4QICA 5C8YA 1PFUA 3IMCA 1EM8A 3LKZA 4ZN6A 5AHXA 1C1YA 2JATA 5DYWA 1MTZA 5EYPA 4JA2A 3NAZA 2VYQA 3TXQA 4RADA 3CHYA 1UAYA 3BGWA 4Z53A 4QDTA 1HNWB 4F6EA 4RTOA 4W5NA 3OTWA 4R2HA 3GELA 2Q4PA 2QN9A 4DO2A 4XCQA 1FSSA 4P2GA 4TXJA 2FXIA 1K6IA 1C30B 1SA0B 2AF3C 2WOJA 3GMIA 2Y0BA 2QTMA 2YWHA 3LSUA 1D2CA 5J5VA 1NJ8A 4WVFA 1BH6A 4UPEA 1X7ZB 3GLTA 3IBGA 4YY3O 1ZR4A 4LMAA 2AJDA 2HR3A 3LYBA 4X1OA 3LUKA 1ZUHA 1W52X 1WMBA 3E7FA 4WCDA 3JZIA 3QKIA 3U09A 1OYVA 4LY0A 3QTLA 5AYVA 1U2SA 2C2MA 4YMUA 1M83A 1JU4A 2JRIA 1PP4A 2OO5C 2WA2A 4MPPA 1U3LA 4BE7B 1EFHA 1Y33E 4ES6A 2G17A 3ZEAA 4ED9A 4P81A 4D82A 4Z0TA 3F0TA 3E8XA 2JCXA 4I4TF 1T8UA 2B33A 5ELLA 5EWRA 1XMOO 2F9FA 4G27B 4WLVA 1Y42X 1JP7A 1XZAA 2VAVA 3D00A 3COJA 5BXYA 4RMNA 1EQAA 1VG8A 4B4OA 3CISA 4QECA 2WLHA 1SVNA 2BE7A 3R3JA 5HKLA 4JI8O 4ZIRA 2BMJA 4LAFA 4LYDA 2REQB 2BEVA 3OA2A 5CVTA 3EUFA 2W8BA 1I24A 2DYKA 4P22A 4OQYA 1I14A 1MOFA 1P81A 4KPFC 4EW6A 5J43A 1HDOA 3UT5B 4BMCA 4XVHA 2B4RO 3PE4A 4ESEA 4PYQA 2CCGA 4UCSA 4GXQA 4DABA 4Z7QB 2QLMA 2VDJA 2J4DA 3IJ4A 1TRHA 3O0TA 3WDMA 3OJOA 2C83A 4I81A 1U8TA 1ZU4A 4EECA 1V1RB 1WSAA 1V95A 3U7QA 1IXRC 2QLLA 1NUPA 1R0BA 4QUJA 5JPCA 3D4PA 2FDXA 1DTWA 1Z3CA 3AG6A 3PHCA 1ZCZA 1T5BA 4B8ZA 5B6PA 2QL6A 1O1YA 4QM7A 3ZD7A 2Q0SA 4TKUA 4UC0A 2VRCA 4MI6A 5FLXA 3KWMA 3FPIA 2XW6A 1E99A 4ICIA 3AQIA 4BT3A 3CW2A 1UQUA 1NVUQ 4EHFA 4QYSA 4K6OA 2PXCA 2EJWA 4AMZA 1NRWA 1X94A 4QRIA 3DOEA 2A3QA 1I80A 3EFOB 4LCJA 4BLRA 4G1VA 4ARZB 4DRXB 3QWFA 2AZDA 3NBFA 1GYQA 5IBQA 3GZNB 4R1OA 1AUOA 1IK6A 4PX2A 3PDJA 4G86A 1F6BA 5TE9A 3VAZA 2AW9A 4J07A 5AD1A 4BL5A 4EFMA 4EYOA 5DYYA 4LF9O 3EEYA 4XFDA 3LLUA 3ASNB 3QYFA 1E9DA 4FLMA 3ZHUA 4CMAA 1AP5A 1MAUA 2H2IA 1R9NA 3PUZA 3THXA 2Q5CA 2DJVA 2GVNA 3HK2A 4BT2A 2JASA 1A7KA 1MC8A 1TZCA 1J2YA 1GZ4A 1DG3A 1GZUA 1SPBS 1E7MA 5ICGA 1DJOA 1VJ5A 3HJRA 4BP1A 4YRMA 1ZVVA 2I3ZA 3A1SA 5A5EA 2D5CA 3E81A 4FVTA 2PVSA 1PJ4A 1KPIA 2DWQA 3ZRXA 2BH9A 3IE0A 2XUIA 1W2GA 2HV9A 2XIJA 4JXKA 4LJ7A 3OT4A 1Z73A 2Z6QA 3BTVA 3IEXA 5CMUA 4CF6A 4BQIA 5IKMA 3BMQA 4LRYA 3TQIA 2WW8A 3EQZA 3KTOA 1PG2A 2I7XA 3EPKA 4KACA 2HIGA 4YRPA 3GGSA 3LLVA 3Q6NA 4FR5A 4P83A 2C2GA 5F35A 3DB2A 5CMLA 3W5IA 3I56F 5BR1A 3H3XA 1BWPA 3DBLB 2ONZA 3UYLA 1VL1A 4LHSA 3AJRA 1UINA 3BA6A 2HGSA 3A70A 5EGSA 3LBIA 3CCQV 4RD2A 3D6FA 2TMKA 4HMOA 4I9QA 3OQHA 4XUDA 4F12A 2UXDB 1AKRA 5K0GA 1BGYH 3PNBA 3C9RA 1DT5A 4L08A 2WU4A 3HDQA 5EHQA 3RT1A 3AUUA 3EFFK 3FZNA 1CQWA 5DYNA 4OPMA 1GT6A 3QEBZ 1YTFD 1NBMG 3NGXA 1Z5WA 5LU8A 4WCFC 5IT9M 3PNVA 1D7AA 4XJSA 1LK0A 3QXGA 2WIAA 3T1YB 4RPIA 5M2QA 5K7SA 1T3TA 2JGLA 3S8YA 3C9UA 3L8MA 5HS4A 4DV3O 3CU5A 5KNDD 2OCBA 2VNJA 2I0FA 2X3YA 4JLDA 4P4GA 2IZZA 2OZLA 1XQ8A 3REQB 3LUTB 2HFKA 1A88A 3I23A 3VPSA 3PN1A 4O2BB 1BVHA 2R1ZA 3L7DA 4OFZA 4FX5A 1SUDA 3IEKA 4TWIA 3OMAB 1H85A 1N7GA 2ONJA 3IAM6 5EN4A 1GPNA 3L40A 1EFUA 3WX0A 3VR6H 2W42A 4W4TA 3HXKA 4F4DA 5E9QA 3OBBA 4FDUA 1SC4A 1XPUA 4HS9A 5CEEA 4PSVA 2QY9A 4MEBA 1G7TA 2BMDA 4C4SA 1S2GA 3R3UA 2Q1WA 3NLLA 3RNLA 4U5QA 5BWBA 3ZIAA 3LCMA 2P68A 2ICAA 2JGEA 3C87A 2PO5A 3VPXA 4C4PA 2JZCA 3A6DA 1KKCA 1TRKA 4QHSA 4G97A 3NYRA 1IY9A 5F51A 5GQSA 2G80A 5FL7A 1NIJA 1VPTA 1E1NA 4X6LA 2O52A 1QYDA 3A2MA 4G2KA 1V6CA 2JC3A 1FFCA 2PANA 3L6BA 7ADHA 2JCGA 2XB2A 1MOPA 4M53A 3UWOA 4BC1A 3BWDD 4AJEA 4K8OA 3QPDA 4TGLA 5A04A 1U7XA 4JLUA 3D6TB 3ESZA 2EW2A 4Q7QA 1Y3IA 1PZGA 5AW3A 5FUQA 1G8KA 2GVZC 3B70A 3ND5A 2HC9A 4CM9A 2JGFA 2HKIA 5JXJA 3ZJVA 4BT6A 4CV3A 3LDAA 3ADKA 2CYCA 3V1YA 3C6MA 2P6MA 5EJ5A 4HB2A 2VWJA 4GM4A 2D62A 4AY4A 1NI5A 3VZRA 2ZUVA 1GU1A 3NJ8A 3ZD6A 2QZPA 2C8LA 1CUYA 2Q0OC 2HU5A 3SS7X 3BEDA 4QEKA 2ZREA 4WD3A 1LFAA 3MMPA 3D7RA 3RBXA 5HOQA 1KMQA 4D9GA 4TSFD 2J9FB 5CDFE 3GVCA 5JD3A 3PENA 1I5EA 1KIMA 4M99A 4OGQB 2EFYA 2BEJA 2WLIB 2QL5A 4YO8A 2WDZA 5E7MA 1DT9A 2BBWA 3NVAA 3EVFA 1DHRA 4HN4B 4HXGA 1Y4ZA 3SR4A 1FYVA 1N75A 3DKPA 2OCCB 3EXHC 1WPGA 1E1RD 2EQ5A 4F0JA 2E3CA 4YV7A 3BTUA 1MAVA 4L8JA 1FU8A 3VU9A 1Y8AA 3ODPA 1NBHA 1CULC 4K28A 4K7JA 4B4KA 1IRIA 4FFDA 1OA1A 5H02A 4QDJA 2XOXA 4G5HA 1JAZA 3EEQA 3LDFA 4PZYA 1E3WB 2XLCA 1O8BA 3CJHB 4CCAA 4W5HA 1C5KA 3ORHA 1UPFA 4BW9A 2FN4A 2I22A 2B2NA 3HO1A 1N5JA 4B31A 1KRWA 3MLBA 3UFXB 2Z1TA 3WAKA 3AIMA 3ABMC 3V3KA 3OONA 2Q5IA 3TGWA 5LMNO 2XVMA 4HAYA 5HXUA 1XAIA 1V96A 2C7BA 3ZY4A 1Y1PA 3HLTA 1RQNA 4GLLA 4U7WA 3S1AA 1T2VA 3ZC3A 2G82A 5A6VA 3AEKB 4ZK6A 1N36B 2OXRA 4IOMA 1GNQA 4UMFA 1A76A 2B34A 1W41A 3GJXC 2YKGA 4YMLA 5IHPA 1RHKA 4LY6A 3ERNA 4ABYA 1SOAA 2AR9A 5DECA 1U2DC 4DCCA 3KKOA 4BNIA 1WG8A 1OHHG 1PFGA 4OX9O 2G3YA 4RK1A 3UCFA 4BMXA 1E9RA 2GCOA 4U4AA 1U11A 1C3XA 3KZNA 4KBGA 4XASA 3LCCA 1IN5A 1GQSA 5CK4A 5HQJA 3DWGA 5B1SA 3HJBA 1BCRB 1MO3A 4M7RA 2GM9A 2JCVA 2R6HA 1VQKV 3I9NA 3LDEA 2XVYA 3I8OA 2YXNA 3GX1A 4D9HA 4CWAA 5ES3A 3HADA 4IF4A 3ZKWB 4YK7A 4I0WB 2BR4A 4IVNA 1RPNA 1JDBB 2OD7A 5IZ4A 3GJ0A 1XEXB 4QT4A 3IILA 1JH8A 1YRYE 2CE4A 2OB2A 3IESA 4HV4A 4D8TA 1SEVA 3EEFA 2J8ZA 1ZH4A 3S2SA 4EFNA 4C82A 2PQMA 1I7NA 1J1UA 4X44A 5E9WA 3HI4A 1P6UA 1DXOA 4QLBA 1T6YA 2GPSA 3AHHA 3R7FA 2V98A 3NP9A 4R81A 4B5LA 4P6VF 4IAOA 3CC7F 2WU0A 2ITCC 4KAXA 3BMNA 1VECA 1S3GA 3W9YA 2FETA 1GK9A 2CLFB 2LNDA 4NZOA 1ZBQA 1NT2B 2ZWAA 3T3IA 1SBQA 2ZJ8A 2H92A 3I37X 3SS9X 3V33A 2FW7A 5A3QA 1K08A 2RGEA 4UHFA 3OUFA 3F1KA 4RMJA 2D1FA 4F3NA 1NR1A 2O54A 1B93A 4TTQA 4M38A 4OPAA 1L4UA 4TKVB 5I9MA 3T9EA 5LB2A 2P2DA 3DE0X 3SQOA 1NRIA 4PIPA 5EBLC 1UADA 1L7NA 1RAIA 1V8ZA 3P9QA 1T4MA 2UYOA 3JAMA 2WZBA 3VO9A 3MSCA 2PXXA 3T4UA 5JZMA 3DVSX 5G1NA 2XAAA 4CEJB 1QLEB 3DYBA 1XA3A 2QJTA 2I3GA 2XCTB 2XQJA 2ZVPX 2YY7A 4PPYA 3O3CA 1KO5A 1A69A 3CCSV 4FMDB 4D3SA 1PJ2A 5AHRA 1K98A 1IPAA 3MAGA 2FP3A 2F8TA 5TVKA 1ADBA 3NANA 4RV4A 3SG0A 2EILB 3GUUA 1XNGA 4GPIB 3MCUA 3EMKA 1VA4A 4ZI2A 1S4QA 5GP1A 4NBWA 3FDZA 2H0AA 3K9QO 4CM6A 4A2WA 1JYFA 4NUTA 3VH3A 2CJPA 2PX3A 4BV2A 4R84A 1ECJA 3CH6A 1KRHA 1RLTA 1SCIA 2B4KA 4JVMA 3FCCA 3CPWF 2AQHA 1O95C 2BOVA 5IM5A 1L5NA 4QQRA 5IBCA 5F7ZA 2D1QA 1T2NA 4JHXA 1VL5A 1VL8A 4ZVOA 4FJCC 5EIBD 3QHQA 4HWPA 3K8YA 2CHTA 1BCSA 3N2GB 3S02A 3RG8A 1DXHA 3DUFB 3T1HB 1BAPA 1VHDA 4N5DA 4DEXA 4Y6LA 4IRXA 4NJEA 3E61A 3S1LA 5JSFA 1Z0IA 4DY6A 3TLMA 1R2QA 3F6CA 2AFRA 1CT9A 3AESB 4QNRA 2FC3A 4IUCS 5EKSA 1TW3A 1RXIA 4KQGA 1AQ6A 1KQPA 1GDTA 1GU0A 4LS3A 1LVUA 5FI0B 3QFHA 3QF7A 4A6EA 4YAIA 3MJFA 4PW0A 2CXPA 5DIZA 4UM5A 1ADGA 2MR5A 2XBUA 5KS2A 2F67A 1G2PA 4EJ0A 4KR3A 1PNMA 3DDSA 2W2OA 2YNMC 4EJMA 5DISB 3LY5A 4ZCIA 1JG1A 1AURA 1GUZA 3A1NA 3SD7A 1HURA 4Y6GB 4M1TA 2EZ9A 2UZ3A 4JP3A 2QKYA 3IC9A 5FEMA 3KU1A 3UOGA 3DW1X 3ER6A 3SC2B 1Z47A 3E1GA 3FH0A 1OASA 2V1DA 1LDEA 1XI1A 3KU4A 4QSHA 4DV7B 4G4SO 3FNEA 4FILA 2DGDA 1NFFA 4MROA 2X6CA 1ADYA 2MW2B 1YIJF 4CLOA 1KFEB 4D0LB 4WZAA 2ZGVA 2Q2VA 2VLIA 2AMTA 4UZSA 4I4TA 1HDZA 4I3FA 3GLRA 1SKMA 2VQFB 1LFDB 4D6TH 5J4KA 2L82A 2ZBDA 4XYMA 4DR5O 4U7JA 3S99A 5K6TA 2R2AA 1S0VA 5F2OA 1VBFA 4M0MA 1L7EA 1RJFA 4FP9A 2R6CA 3ELUA 2O8EA 3OWHA 2HM7A 3LBYA 3DV0A 9ABPA 2C1ZA 3NC0C 3CF4G 3GGJA 4O33A 5HM6A 1KS2A 3INYA 3QOYA 1UZLA 3G1TA 1HC7A 1OWPA 3T7KA 1ZESA 1TAUA 5GJWC 2Q1XA 3K0EA 3X2QB 4C78A 2W6IG 2BE9A 1EA7A 3IQIX 2FRDA 3IXLA 1J6UA 3MWDB 2XHZA 2QSZA 3DE1X 2IJKA 1QZXA 3OCYA 2P6JA 3ZW9A 4QJBA 4AS2A 1F2TA 3AG5A 4E1BA 2N42A 1NXTA 2OECA 2E5LO 3VMFB 1XZBA 3ZVKA 5AHKA 3H9UA 3BXEA 3IEPA 3BRSA 3DZBA 4AN1A 1CY1A 1YULA 2FX5A 1T2EA 1PK9A 2HT1A 3UMRA 4IDPA 5IH7A 2DKFA 3ZBHA 2XYQA 1S2OA 3LBAA 2HX0A 1PZHA 4DLBA 3LC2O 3TG2A 3HFJA 1Q12A 1YS2X 1NURA 4I4NA 6ADHA 4NMLA 4HNQA 3WB9A 4B6PA 2RMKA 1WSWA 1J8VA 4LR3A 1X1SA 1IB0A 1QU7A 1QIMA 1Q6YA 1OWMA 1N8SA 1YB4A 2FUG6 2C7RA 4WFKA 4UUMA 1S02A 1ZH0A 2I4TA 4BVBA 3P1JA 1DOHA 1JLLA 1R64A 3BD9A 2YWGA 3RVJA 1SBHA 2PLNA 2XPCA 3PC7A 5AI8A 2N74A 2YZ7A 3FBAA 1ROPA 3LK7A 5JO9A 3W90A 1M2EA 1SCAA 1K68A 3CNBA 4PA3A 3A2FA 1LK7A 3V48A 4H7DA 2QQ5A 4FFLA 1XDZA 1R3LC 3U7HB 4ZQBA 2UZ1B 3FNBA 2QN3A 1SKUA 2IPAB 4R40A 2NP7A 2ZIFA 1VK3A 3JZMA 3NATA 4EO9A 3I39X 3KB2A 4KODA 4QU5A 2CW5A 2VQEO 3ZI4A 3AR7A 1MDFA 1VRCA 2GD0A 3ZV7A 1JDSA 3UM9A 5JQWA 4N3BA 1U7HA 3MGBA 3ZE9A 5EMKA 5KHAA 1K3EA 3CO0S 3F5SA 2DUMA 3WDKA 2OCYC 3C4QA 5KHKA 3E1YA 4Q12A 2R9VA 3C1AA 2LDBA 4KBFA 3SEFA 4OGGA 1DFHA 5CYOA 4XVUA 1TZBA 3KUUA 4CVNA 5AM0A 4HEA1 3L7YA 4PLFA 1FS0G 3V55A 3MWEB 2FB5A 1Q81W 1U28A 4CTJA 4GEGA 2MSEB 4MV5A 3NHSA 1JX6A 1YR6A 5IBRA 5FEUA 1WPBA 3MEQA 2NNLD 4MEAA 4C88A 2PMPA 2PYLA 2KSDA 2PZJA 3O2NA 4QO7A 4V1CB 3UWPA 4G9EA 3IUQA 4P7KA 2HDNB 3CNNA 4IH1A 2PJDA 4KV7A 2BFEA 4BUCA 1AO0A 2FQQA 1GGEA 4HAXA 3UQ8A 4G4YA 3RV3A 1I1HA 3WQBA 2HMTA 2ZQMA 1E3JA 1KVTA 3RS7A 3DXZA 2Z6UA 3OEHD 2GK3A 3USZA 1Z35A 1O6GA 3FB6C 4PG8A 5ARBA 4I7EA 2FMIA 6ABPA 1R8QA 2JLCA 3WB0A 3DXRA 1XHOA 2GJSA 1HE5A 1FNJA 2CUZA 2NVUA 5L3EA 1E32A 1W25A 4Z6KA 2BKVA 2ZIGA 4IDEA 2VZLA 3X1JA 1E0AA 4P38A 1BMFA 4P9PA 1EDZA 3MERA 1GPLA 4F38A 2VUTA 2Q3HA 2CBZA 4FYKA 1XRGA 4I7ZB 4P7FA 3N2YA 4CIVA 3WO1A 4E5YA 2N9UA 3RRXA 4QPNA 1EUDB 1EQ2A 2FWAA 5KYVA 3H9CA 3WS7A 4DCSA 1Y8CA 3WZ2A 1IX9A 4PNPA 4J80A 1E2LA 5KHGA 3GZ4A 3R7WB 3SFZA 4R31A 2UVPA 2DPGA 3SR2C 1C3LA 2LRHA 3RIYA 4UTZA 5HBGA 2FR0A 1JVMA 2CXUA 3DB1A 3CZQA 3FFBA 1PD1A 2R8PA 1D8AA 2C61A 4BGUA 3BTSA 3DCYA 2O8DA 1LLCA 4TWAA 1DEKA 4MR8A 4ZDWA 2E4XA 5B5EZ 4FPXA 4IVPA 2LKDA 1VMAA 1Q7GA 4U63A 1XN1A 3N2LA 2V6BA 1SQPH 1R6XA 3T4ZA 3QKRB 4PFSA 4PNEA 4DLUA 4OHRA 2YXPX 4GPAA 4K9OA 3ZXIA 2FLWA 4XZ3A 1SC5B 1U2RA 1QR6A 2QV0A 4L4RA 2YZ2A 1C9KA 1OBVA 3EJWA 1E9BA 5GIOC 4Z9XA 2J6CA 2DU8A 4BVRA 2JFOA 4ESVA 2JGRA 4FX2A 3HJUA 4EMSA 3IP6A 1CZLA 1W55A 3GA5A 5HRUA 1QLWA 1EFTA 2Q9LA 4M6WB 2PS1A 3F8TA 3EISA 2O8BB 3WMFA 1R6UA 5C51B 1EESA 2Y1XA 3LM8A 1W9MA 3UJCA 2JB9A 5K4GA 2H5LA 2NVWA 1BHQ1 2BCJQ 4ARCA 4ZPXA 5BUSA 1CZHA 3V1NA 2NADA 2Q7HA 2J4CA 3OPNA 3RWBA 3D3JA 1K8RA 3Q2OA 2QW1A 1QOQB 1Y3HA 3MJCA 1YZFA 2DM6A 4U6NA 2JIZA 1N0WA 1KU9A 1PR9A 3O74A 1A5ZA 1JVBA 2D06A 2BOCC 2D2VA 3RYIA 1ETUA 4E6EA 4YMIA 1VTKA 4ICGA 2IYQA 4S2EA 3DFMA 3LIPA 3I12A 2GAFA 1Y1TA 1U2GA 4KLZA 3VYUB 1ZX1A 2HU8A 3KKPA 2Z4SA 3EGDA 1H23A 1L8DA 2COKA 3FNFA 1ZLYA 5DX1A 1JIIA 3CUUA 3EMVA 4UM8B 1TOAA 4F4UA 3ZMUA 4IPTA 1OU4A 2W6JA 1UDBA 4OQFA 3IX7A 5K99A 7MHTA 3U7RA 2YCBA 4GZ5A 1OJLA 4CMHA 2LIVA 2Z01A 3OM3B 1JQ3A 2A5YB 2AK3A 2CDRA 3E4DA 4B2IA 4E2FA 1GZ5A 1II8A 5TGZA 1U0OC 4J16C 1XC7A 1KOJA 4PYNA 5AVKA 3BWMA 1NL3A 2IIQA 2Q5FA 3RVMA 2KG7B 2FWJA 1SZJG 2YXBA 3LYLA 2QLNA 4J11A 3IDOA 3HCCA 3V46A 2LXNA 3I9OA 3T7AA 2O7SA 3OWOA 1ZIPA 3AU9A 3AERB 5M7EA 2JJ1G 1U6IA 1Z12A 3M8AA 2C2HA 2WF8A 4W1RA 1P1IA 4LFBO 3ZVLA 4IVRA 5GONA 3GT3A 3L92A 2QY6A 1VHTA 4J2OA 1EFRG 1G8FA 3ELYA 1VFNA 4MMZB 3KKMA 2YC2C 1CEXA 3MJTA 3N87A 4DAEA 3CXUA 1N0NA 1HA3A 3ZW8A 2K2WA 1LTHR 2FG6C 1VOTA 3THSA 3U26A 1PFWA 5B1EA 2LW1A 2O48X 3CSDA 5TIIA 1MQ9A 2YJ6A 2CF5A 3PQ4A 3K6RA 4HX9A 2AOUB 5I7VA 1HEIA 3WLFA 1DADA 3FY4A 2JJMA 2HPVA 7YASA 1K1EA 3AUKA 2QL9A 2ZI9A 2CL5A 1EE2A 4RSHA 3ZE6A 3ZUGA 2P0YA 5JSUA 1WXXA 4I1OA 1JIUA 2QPLA 5KC9A 4YQYA 4N3NA 4DW8A 2BEWA 5D2CA 1DGQA 3K5NA 2BUBA 1RQ2A 1E8DA 4TTTS 5E2AA 2FI1A 3WLRA 1UPAA 1J5XA 2YFQA 3FTCA 4A2CA 4QUDA 3UWMA 2PZFA 3A04A 3L79A 4MCAA 2ZZMA 2SKDA 4EUFA 3P8ZA 1DNPA 4HHEA 3KSMA 4RJTA 1G4YB 3I6IA 3L1HA 1LZKA 3LFOA 2AG0A 3GU3A 3QY9A 4O3FA 4HWGA 3ML0A 3AM4A 4NXMB 2IE8A 2V45A 3Q7QA 1L4EA 5DB4A 3NONA 4P98A 3FMIA 3EULA 4WCFB 4AJHA 3LBHA 3MTDA 4PYJA 2NUAB 3B9QA 2B99A 2VP6A 1YQNA 3JY6A 3T3EA 4R8CA 4B74A 4U2CA 1WCIB 5KNBD 2WINI 4OBEA 3ZZTA 3E9YA 3K1JA 2O1XA 3VVBA 1YZUA 3I30X 1XTKA 3W8FA 5K2OA 5AKXA 1GTJ1 2O2IA 2XQVA 5DYGA 2EINC 1NH2D 3PTLA 4JODA 4WASA 3LHFA 4KK4A 2GVIA 2JHPA 3QE4A 4H7FA 3HZRA 3WMXA 1T2DA 3GC6A 1ACJA 3OF2A 1HKHA 3IYLW 1EP1B 2IUUA 2CK3G 1QXSA 1ZGZA 2EFGA 2FQYA 2VNKA 1O03A 4P32A 4EPVA 4O4HB 1YR7A 2RIRA 3RV4A 1W2BF 4QE3A 2V8OA 1E96A 2DR3A 3N0WA 4CL2A 1AP6A 2A30A 1H2NA 1YZNA 4O2AF 2CWJA 2QTAA 4NKRA 1VPEA 2BBTA 2HK6A 4G26A 4YV2A 4UHBA 1XXHB 3RANA 1BT8A 4YROA 5IVDA 3AJ9A 3G82C 3NTRA 1Q82H 1MVOA 1JS1X 3G6WA 1TGVA 4M1QA 4AECA 3E7PA 1YHQV 4RK6A 1NVPD 3HGMA 1A9OA 5IXYA 3UJBA 3JATB 5D3MA 4AN4A 1DWUA 4N6GA 1ESEA 4MUEA 3GRPA 4H3SA 1Y37A 1L4LA 5A4FS 4J7KA 3GMTA 3AV0B 3GLHA 3RSFA 4M9UA 4GYJA 3QYJA 3RA5A 4F1KA 1OZGA 1P9WA 4OSEA 1NQVA 4LI0A 4OL0A 4YASA 4UM9B 3RAJA 4D4KA 2WJ3A 1FDSA 4N21A 1YXBA 3L18A 3LO8A 4ZVSA 2YIJA 2W22A 5AJTA 4V2IA 2D5BA 3V7FA 4K2AA 1HKUA 2D00A 3AK3A 3ZY6A 1L9XA 1YBVA 3GFVA 2Y48A 4FFVA 4AXBA 2I03A 1IJEA 3NIDB 3CYQA 1M2FA 1FYWA 4NE9A 4EWLA 3JQ7A 5E7QA 4Y7CA 2P3QA 3MJDA 4R98A 1W0KG 4WEOA 1SXJD 1R3JC 2ZULA 5FI3A 3DDHA 4X8AA 1N33B 4Z4FA 1WR8A 2I66A 3TLCA 3IQZA 5ALTA 3NDPA 2IHUA 5B7QA 4TUYF 1WB4A 3CRZA 5JAHA 2JL1A 1HL3A 2VBFA 3QSGA 4ZT2A 4A8PA 2ZKOA 3TINA 4R7GA 1OSNA 2P6OA 2E5WA 2ZE8A 3QMPA 4QUKA 1I36A 4ALLA 1Q7CA 1F4LA 4F93B 5I01A 2RQ6A 1U2PA 3GLQA 4PR3A 3CLRC 3FUTA 1QVGF 3W4KA 2FR8A 1V7CA 1SG0A 1LD3A 2AE1A 4NEQA 5HJEA 1KFCB 2GZMA 2QLJA 2JGIA 2Z04A 5FA5A 3CCJF 1LDYA 3QF4B 1IZ3A 4QYTA 1SN7A 4HAIA 4QYWA 3CE9A 1GGVA 4O5OA 3O7WA 5DTRA 1QS0B 4M9SA 1FX1A 1A1VA 2FPSA 4HQNA 4LTMA 1E7SA 1AKQA 1IN6A 1EX9A 3A6ZA 3I4CA 1A9ZA 3ABMB 2FZLA 3K0DA 1Z38A 2GTSA 1I3CA 5DHTA 1PAUA 1Z8NA 1SH7A 4C04A 4EGJA 3TQCA 3VKFA 1LUWA 4WW0A 2VN8A 1W5EA 4FMCF 1NBMA 3BKXA 1ID1A 1CJSA 1FRVA 4UVGA 4K9KA 1ZM2A 5HF9A 3C14C 1W6RA 4PPGA 3ZJYA 3OCCA 2IPOA 3P4EA 3LD9A 1NE2A 1ONBA 2NT3A 5GJBA 5JTUA 3OU6A 1NMQA 3E58A 3H2SA 4IDNA 4B45A 3N74A 3RD5A 3LZ6A 2VPIA 1STOA 4PO8A 1EFAA 4J1QA 5KHJA 2DTDA 5KYWA 2QGFA 4OG2A 1P84F 4YI5A 2FZ4A 2B5VA 5E3HA 4I5FA 3G0DA 1QIFA 1R3UA 1L7BA 3BZBA 3HLYA 1Z39A 4EFBA 3JQFC 1NZJA 3MB8A 1YASA 3DLCA 1CHNA 2G7ZA 3JQ9A 1IUPA 3SKVA 3K06A 3EA0A 1LPBB 4RESA 3F7MA 2E1PA 4YRGA 4XI9A 3QVSA 4MUIA 2R8BA 1P4HA 3UH0A 2GK7A 5CB4B 1ZIXA 3AEIA 3SXPA 4CMIB 1K7YA 1AKWA 7ABPA 1L8QA 5E38A 4DPKA 3IL2A 1L7AA 3TZ6A 3QX7A 4I9HA 4MUMA 3K5IA 4NOKA 2M98A 3DZJA 4IXNA 5T67A 2HT6A 2DYRC 1YE5A 2Z09A 1NX9A 5LOVB 4G0MA 3ANXA 2R48A 2QTCA 2ES4A 3V4LA 1H2FA 4FFRA 2JFGA 4ARVA 2CSUA 2X13A 4C0HA 1K5PA 3WGIA 3CT4A 1PF7E 2BKUA 2IHZA 1ONNA 5AVTA 3DLBA 2GPBA 3G88A 2NO4A 5CFMA 3W7AA 3SY8A 2D2EA 4US2R 3HJGA 1LDMA 1RLIA 2FW8A 3L0OA 1VARA 2FP4A 1PVDA 3FKJA 5A6SB 3TQRA 1NRJB 1GFZA 4OBWA 1IHDA 2RBKA 4ZJPA 3EIFA 2XH8A 4JSTA 4EZEA 1QRUA 1P9RA 2WPDA 3AXTA 3C74A 1T36B 2Q8NA 3CSSA 1JW9B 1GILA 3EZ7A 1HE8B 4XEUA 1CQXA 2O7QA 2FK7A 4ZDKA 3GXBA 5K4HA 2GB4A 3LSYA 4MITA 4RFSB 3K0AA 2W2TA 2XX3A 4RIEA 4ZZ2A 3JASA 1X9IA 1GR1A 5CD1A 5BO5A 4BB0A 2A3NA 5FWYA 3AJ8A 1WAZA 1TTPB 4KQEA 1WBJB 4MGIR 2WD8A 2FSGA 5E1DA 4PR0A 5I8ZA 3ZEDA 1URPA 1PZXA 4PLCA 3CC4V 3VZBA 1UMDB 1VZ3A 3RTDA 1DVRA 3EQ9A 3IUBA 1TYCA 3PVZA 1NUHA 1W75A 2FDRA 2EF0A 1WD7A 5EQFA 3RSGA 1HG1A 3QE0A 1YJWV 5JADA 1QD9A 3CCVF 1BTOA 3ROXA 3OBYA 4ZU6X 1LI5A 3O8NA 4G0PA 3SFVA 5MFZA 2ITDC 3BWXA 4FCVA 2P3LA 1JR3A 4OP2A 4JT9A 3MHSC 1R6TA 5CEFA 5TMBA 1FYDA 5DPMA 2ADFA 3ELDA 3MWJA 1YI2V 1NVVQ 4W9NA 4C29A 2NR5A 5EEHA 3B77A 1VQ9V 4DILA 1XDCA 4O4LB 3V2GA 2XAHA 3UMJA 1M2KA 5E6UB 1KHTA 4W9RA 1R37A 1F8UA 1AA6A 1B73A 1I3LA 1OLXA 5EUBA 3DOIA 3DBHB 3LUDA 5I6DA 1UC8A 3VVMA 3WBFA 4N82A 1E7YA 3T3NA 4Q7JB 3AYXB 3HV0A 4YJKA 1ZK0A 3F6MA 1CR1A 4KPGA 2C58A 3KPWA 2VGMA 4FEAA 1J99A 3S40A 5EMHA 5DX0A 3KQLA 4YEDA 3K9FC 1GPDG 3FOAA 1PJ8A 3IC5A 4B6SA 5H0IA 3JD4A 1L7PA 1ZHOA 1LBIA 2DY0A 1E89A 1HX7A 2PGJA 4Q7KA 3QJ5A 3PQ3A 3DMNA 4JTDB 4DK0A 4AJ1A 5EESA 5LNK1 1GVHA 4TV8B 5H4GA 2AQIA 3NB0A 4YJDA 3JVHA 4GWGA 4QJIA 4XR9A 2PD6A 3PNMA 2PL3A 4EGQA 3KG2A 1WNFA 5AHOA 1DZ3A 5IAAA 3OMNB 5E6SA 2A9QA 4KZPA 3AR4A 1V8FA 3LZCA 3R7DA 5DTIA 3OCXA 3SZ3A 3C6BA 4GKKB 3CRNA 2W11A 4N39A 5DXAA 3JQBC 3A2NA 2EBOA 3R9IA 4OB8A 4L5BA 2G1JA 2V74B 4GVLA 3B3FA 3OLWA 4ZC8A 1WKBA 2BSKA 3M6MD 1OU0A 2JGUA 1MB0A 2W2LA 3WB2A 1TTHA 1MO2A 4YJ3F 2PL5A 1P5ZB 5I8PA 3NC1C 1R3DA 1PZFA 5G4KB 3ROTA 2OCAA 1W34A 4ISCA 4J6FA 1W9HA 1AF4A 2HTFA 1I7LA 2IH1C 4FONA 5EWMB 5SY6A 3OKAA 2H7CA 3UJ3X 4JLWA 1REQA 3EC7A 4ZO9A 4MHSA 1ORVA 2OGSA 1TF7A 3EFBA 1CW2B 4XQ9A 4GYKA 2JVDA 1XU7A 3ZIUA 4QNMA 1A7UA 2OAQ1 1I5RA 1RWWA 4UDNA 4OAPA 3SIWA 2CNBA 4HGQA 1FUIA 5L3SA 4UAVA 4W6QA 5K3AA 3UKJA 2FYTA 1RYZA 1G8YA 4AJ4A 1M8JA 4NJMB 3NQ41 4OLFA 1H8HD 3PJGA 1F8XA 2QUHA 3BQMB 3HWSA 3B1XA 4D9BA 1H1DA 3CC2F 1WPQA 3X2FA 2BI8A 4HKTA 4A73A 3LECA 2VZ8A 1JHXA 5BQXA 3H9QA 2WWHA 4EJSA 1FC0A 1OH6A 1IZYA 2FSFA 3EFHA 9GPBA 1CUXA 4N9WA 5EKTA 4GX0A 4LE1A 1P60A 3ZTTA 4F4JA 2ERXA 4GMXA 3MAAC 1Z7EA 1HDEA 3D4OA 3RHTA 1UM9A 2P4UA 3NOXA 2JBHA 2CV2A 1WHTA 2MWMA 5EXTA 1YSCA 1DAKA 1K2WA 4V24A 1XN4A 5T6BA 2M6RA 1GEGA 4D6XA 1UDCA 3MILA 4CIDA 5L3CA 2FEKA 4MV3A 2DYSC 2G09A 3PI7A 2ET6A 3EVBA 2Y0IA 2Q5OA 1R0SA 1R0ZA 2J3DA 2CFTA 3L0DA 1GKIA 4GS5A 5BT8A 1Z9BA 1L5OA 3KKQA 3KYDB 3F73A 1I2MA 2DPMA 1JWLA 4GR9A 2YWDA 3ZD9A 3QBVA 3G8YA 4M55A 5FO0A 1PT7A 5HCUA 1XTQA 5EXPA 2AG8A 2Q5QA 2NMUA 3QG5A 3PNYA 2CH7A 4BQSA 2Z3YA 4FJ1A 4Y7DA 1GL6A 2HP3A 5TQ0A 4N4AA 4MIEA 4FZRA 1MNAA 5F23A 1PNLA 2EFEB 1SZPA 4DC0A 3OC6A 2V4MA 4ZZ1A 3OUZA 4RJ2A 4ARSA 4RL4A 3T94A 1QGAA 4FT2A 3QXXA 3DLHA 3K70C 2X77A 2BKEA 2QWRB 4I8XA 1PNTA 4DA0A 3G7SA 3LTNC 1SQVH 2QBYB 2D1YA 5A1TA 1GAEO 2XA9A 3E35A 4DJFC 5BSUA 3F4KA 1KZ6A 1CUVA 1DOZA 1O8CA 3F96A 3G6EF 3ENZA 1WD5A 1RQ7A 5K3CA 4HQKA 5IKOA 1NNI1 4BO5A 3WU2Z 3A3YA 5IK2D 4L22A 3SOPA 3UENA 4NLLA 3KVVA 3FFWA 3WL8A 3KYBA 5FP0A 1NKSA 1VP7A 5C5DA 1NMEA 5AVVA 5K3FB 2YIVX 3H86A 2MOKA 2FUKA 1FY2A 3KELA 4R16A 4FWBA 2ZSKA 2RC6A 1KOLA 2WF6A 3M4YA 1YGPA 5M04A 4P4SA 2I7VA 4HQFA 4K0KB 2QW8A 2DFDA 4HNHA 5IJ0A 2C03A 1GT91 2R5WA 1U7UA 1Z4KA 4C05A 4PLPA 2CD7A 2PAAA 3P0EA 1VLLA 4FKBA 3D8RA 1G0OA 2C5SA 4MTLA 3AFNA 4RA6A 4ZYXA 4DLNA 1XDBA 4OQXA 2W6QA 1XSEA 1I94O 4D8WA 5BVGB 3RYHA 5IEJA 3OLVA 4EY5A 3PJEA 5AQEA 1EFVA 2I2WA 1XQ9A 2YWXA 4WNCA 2A92A 4EABA 1NVVR 4JI7O 4JAVA 5A0VA 1K0UA 1MC4A 2X6AA 1KAHA 3AOGA 4Z4HA 1JPUA 3F0DA 3QO8A 3A32A 4JLAA 1D2NA 3IURA 1Y8QB 3CZPA 1I6WA 2BGRA 4DJ5X 2X9QA 5BSTA 2YJ5A 4JQCA 1AA9A 3ESBA 1QG4A 2WZCA 1GUBA 1YDWA 4A0QA 3ETQA 2FN9A 5CDGA 1Y7PA 2OY0A 3X44A 4H0FA 1Y5IA 2GN2A 2ESRA 3MIZA 1GLGA 4JZYA 5B30A 1UPBA 1U3CA 2ZFUA 2WSBA 3HNPA 1W88B 3EVEA 1I7SB 3CF4A 4X1YB 4YT8A 1VGRA 4C6TA 3EMDA 1Z18A 3L7NA 1DKOA 1JFRA 3RVQA 5JZSA 1FKAO 4ZCPA 4O2AA 3MWLA 1C0EA 1JHPA 5JZ9A 4DMMA 3W34A 2IZ5A 2XRMA 1FOEB 2N48A 3IOCA 5ADWA 4AK9A 3OOWA 3D8SA 2W6IA 5LP6B 3O95A 4W8OA 5CT4A 5JRJA 3BILA 2RHJA 2Q8PA 1IE3A 5EO3A 4Y67A 4XW2A 2C5BA 2FJPA 4M1WA 1ZRSA 2IYUA 1ZPDA 3MTBA 4O8CA 4XGQA 2ZVYA 4Q3AA 3ZS8C 6LDHA 4B6RA 1DBPA 3LL7A 3RFFA 5KTNA 4XWOA 1RCUA 5JNWA 1BHAA 5D00A 1Q1QA 1LW7A 1PR0A 5C7OO 5DNYB 5LNK6 1Y82A 2DSTA 4XA8A 3LUHA 3OTIA 5DEIA 1MAHA 4MJXA 3VBBA 4CG1A 4WKBA 5FBRB 5K51A 4DMKA 1ZOLA 1NOKA 1QF6A 1ZKMA 4ERNA 4L87A 1U1EA 4PXAA 4I5GA 3TEFA 4ZMRA 3KKLA 3JVUA 2FFRA 2HSWA 3EFEA 1TFUA 2R7LA 2LTAA 2ABWA 2IJGX 4HNUA 3I4FA 5FR2A 4XFKA 3LWQC 2ZUBA 4EX6A 3HR8A 4XGIA 3B48A 1QK5A 3DTYA 4L8WB 2P22C 1OLUA 3RK1A 1IBSA 3HU5A 1ZD2P 1WJZA 2H4YA 5B3JA 5CHEA 1HDGO 1QDLB 1POWA 5J2UA 4LHXA 5FFFA 2CHUA 5DYIA 1TX4B 4MUGA 3T5BA 4B73A 3WYDA 2QMQA 2K7ZA 3L6EA 4TUYA 5LM3A 4W4KA 1G7SA 2SHKA 4LH7A 2XKJE 2FMUA 1JFSA 1JA0A 4TRRA 4LVCA 3AUSA 2W2QA 3IKMB 3EWAA 2IY8A 4AY6A 4F5EA 1ND5A 1PGOA 1MPXA 1WB6A 1AJNA 4UTVA 4OYRA 4UHJA 5TRTA 4Y1GA 4E08A 1P1CA 5U9CA 2C2XA 3E0QA 2AMLA 4R1SA 1ST2A 2JJ2G 1TLLA 5KPJA 3B7WA 4FGZA 3KO8A 1I0LA 4J94A 5D3QA 1IK4A 4MVOA 1CUZA 2OM6A 3B1KA 3MCZA 2BFBB 5H9WA 3I9JA 3U4QA 2ZLBA 4BXOA 2FEOA 1PUJA 2GN8A 1Y6ZA 1WQ1R 1SM4A 3GRYA 3CZRA 4YUZA 3QVKA 2ORYA 5A0FA 2JGDA 1FFDA 1C41A 5HWEA 2YYSA 3ZOKA 4U2FA 4BBJA 1T1JA 4CR8A 3E83A 3CCEF 3OY7A 1SD5A 3RK4A 4PHCA 3ORQA 3TM4A 5BW8A 4B3XA 1ZI9A 4O2BF 2XYGA 3QTTA 4X20B 1MJ5A 3FGOA 2OSBA 4LFCB 2B0JA 2VYCA 5AO9A 2EKZA 3OICA 3C3DA 3DMDA 1N9GB 4GNRA 5ALJA 1MBZA 1NY5A 3PC4A 1O9GA 2P9YA 5H9CA 1UJNA 3UG7A 4Y9RA 3C8ZA 3WSVA 1J1IA 5DM60 1CUEA 2YHAA 3EOAI 1GG8A 2WVJA 1QVZA 1EIZA 3SJAA 3D54A 2XZOA 2NU7A 2V9ZA 4B3TO 4BNZA 5EFOA 2WUGA 4EG4A 1FXWF 1XO1A 1SCUB 3ZWVA 4OQEA 1HOTA 3Q4HB 1EFKA 2HL6A 3ABOB 5TPWA 4WFIA 3GJRA 3K09C 1Q95A 1RFLA 1JMKC 2ACWA 3DG9A 4JJ4A 2NYVA 3WGQA 4RFLA 1FVOA 4MINA 4BIZA 1F1JA 1R00A 3SXUB 2FEWB 5AW9A 1JZTA 4PS1A 4A6DA 3OURA 4UDOA 3P26A 4YXWA 3V00A 1RXYA 3ZHRA 3OJ0A 3PX2A 4GL2A 2GYVA 1YVWA 5IYZF 2X5XA 4NMMA 4WGFA 3A0RB 5LC1A 1OD6A 3ZDCA 3UAVA 1QCEA 5DLEA 3A37A 1GSHA 1L1RA 1OXMA 3CNLA 3EORA 1R5NA 1JFFB 1MZPA 5GOTA 1JWBB 1RNLA 2JGNA 5F33A 1CJKC 1Y3CE 4OATA 3K9BA 4LOAA 3UATA 2SECE 3ANYB 1UBKS 1NIPA 1QAHA 2B4TO 2IHYA 1M1YE 3AU8A 1A2QA 1KZ9A 4GBMA 3VSAA 4L85A 1PWEA 2Z8ZA 1QOPB 5LSAA 1CV2A 1D3AA 3C0KA 3MJRA 4U2EA 2L0XA 4GOLD 3ISTA 1GKFA 5H3LA 1N8KA 3KKYA 3PRHA 1P33A 5GMOA 4LYGA 2Y67A 2B25A 2ID8A 2F4VB 3RSZA 4LZLA 1JEYB 3V8BA 3VOAA 1D5AA 1YZBA 2BTQB 4HATA 2OC9A 4TT8A 4B3HA 4HGRA 4GR5A 2PT9A 4CUKA 3THOA 1NXQA 4DLXA 4PBSA 3GGGA 1DAIA 4CV2A 4MW2A 1B41A 1E9CA 2ZE5A 3VDQA 3GF4A 4GT1A 4NZ9A 5JZOA 5FO1A 1ZD9A 2GM5A 1U8ZA 3I5MA 1HNWO 5F7JA 4BN5A 4M22A 1ODIA 3BIXA 4LE2A 2WVAA 1GG5A 1GFSA 4INPA 2WLNA 2QRPA 3FOZA 4FE4A 2MYPA 1DGSA 3V5NA 3UV7A 4H6PA 4MUYA 3ABUA 3I3OA 3ECAA 4AS1A 1DBFA 1IM2A 1R1MA 3UJPA 1Z6TA 4YHHB 4HDOB 4KTTE 3HR7A 1G98A 4BGVA 2CMGA 1GZVA 4FFBA 4KDEA 5M34A 2WK1A 2ZRGA 3H6HA 3BQ9A 4QASA 1C7FA 4ITUA 2IRWA 1NVXQ 2HDOA 2DHCA 2WWYA 3F5QA 3FIUA 3KJXA 1GGJA 1NV9A 1PGQA 2I2CA 5ILGA 4HPJB 4JR1A 4QHYA 4DCGA 2Q27A 4BZXA 4TRMA 2JGMA 4ENRA 1A9XA 4PQYA 1EWTA 4R8LA 4OGFA 4CKBB 1J70A 5I47A 1H9BA 4XJTA