1FFXB

Tubulin:stathmin-like domain complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
427
structure length
410
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 4 A X-ray structure of a tubulin:stathmin-like domain complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
molecule keywords PROTEIN (TUBULIN)
total genus 65
structure length 410
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1ffxB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1ffxB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1ffxB01
3RYHB 5C8YA 4I4TB 5J2UB 3RYFB 1RLUA 3N2KA 4B46A 3C8LA 3UT5A 4O2AA 4LNUB 1RQ7A 5CA1A 1TVKB 2BTOA 4DXDA 4I50A 5EYPB 1W5BA 5LA6B 5CA1B 4U3JA 4I50B 5JH7A 4TUYB 4O4LB 5KMGB 5CA0B 5CA0A 4O4IA 1W5FA 3RYHA 4O2AB 5EZYB 2VXYA 3R4VA 2VAMA 3RYFA 4O4JB 4M8IA 4WBNA 1JFFB 4X1KA 2R6R1 3HKBB 3JAWB 4IIJB 4EI8A 4DRXB 5LOVA 4X20B 4EB6A 4I55A 5IYZB 3JAWA 4YJ2A 3HKCB 4O4HB 4FFBB 5CB4A 5LXTA 3N2KB 1W59A 3RYIB 5C8YB 1FFXA 4TV9A 5EZYA 2RHHA 3HKCA 5LP6B 5ITZB 4O4LA 5KMGA 4TUYA 1W5AA 3JALB 5IJ9B 4X1YA 4ZOLA 4O2BB 4ZHQA 3ZBQA 3RB8A 3HKDA 5M7EA 4ZI7B 5KX5B 2BTQA 4O4JA 3JATA 3N2GA 4O4IB 5J2TB 1SA0B 3WGKA 3UT5B 1SA0A 5GONB 5JH7B 5LP6C 1Z5WA 3VPAA 3E22A 3JAKB 4TV8A 5MN6A 3VO9A 5MN4A 5JVDA 3M89A 4X1YB 4X1IB 1TUBA 3VOBA 4LNUA 4E6EA 3JARA 3HKEA 1W5EA 1Z5VA 5J2TA 3RYCB 4EI7A 5LYJA 5JCOC 5LYJB 4XCQA 5EIBD 3VOAA 4FFBA 4O2BA 4ZHQB 5IJ0A 4F6RB 1W581 4HNAB 5BMVB 4DRXA 5LOVB 5BMVA 2R751 5IJ0B 5JQGB 3WGMA 5JQGA 2VAWA 5GONA 3JARB 4YJ2B 3RYCA 2RHJA 2XKBA 4YJ3A 4X20A 4KWEA 2GVIA 3WGLA 2BTQB 3HKBA 3E22B 3WGJA 3HKDB 1JFFA 3CB2A 5EIBC 2RHOA 2VAPA 1TVKA 3M8KA 4YJ3B 4IHJB 2XKAA 4EI9A 4IHJA 5LP6A 2Q1XA 1FFXB 4TV9B 3N2GB 4X1IA 4U3JB 3RYIA 5JCOA 5EYPA 4ZOLB 3JATB 4TV8B 3JALA 3ZIDA 3V3TA 3WGNA 4HNAA 1FSZA 3VO8A 5ITZA 4X1KB 4WBNB 2Q1YA 4I4TA 5J2UA 5CB4B 5LXTB 1OFUA 3ZBPA 3JASA 4B45A 5IYZA 4I55B 4ZI7A 3HKEB 5KX5A 5FNVB 4O4HA 4U39A 1RQ2A 1TUBB 5IJ9A 4F6RA 5MN5A 4EB6B 5JVDB 5LA6A 5FNVA 2RHLA 4IIJA 3JAKA 3JASB
chains in the Genus database with same CATH superfamily
3U4CA 1AS2A 1MBZA 5E4TA 3CO5A 1N1EA 4WLFA 2ERXA 2JW5A 3KJXA 1F3OA 4MINA 4GZRB 4PICA 1X7XA 1A3CA 2HGZA 5JECA 2NW6A 4N82A 4M1WA 2FPPA 1RI1A 1RC1A 2BVNA 2VYCA 2GWRA 2J3KA 3CC2F 3E15A 4HTAA 4G88A 4KMRA 3BRWA 3SR0A 4QUEA 4P92A 1N77A 2EEZA 1M1YA 3AUAA 4LMAA 3FRHA 3TAUA 3AVXA 3I37X 5JAOA 3QTTA 3UWDA 5FQNA 1CZKA 3NETA 4HVAA 5AW1A 2VT6A 4XPIB 1EK2A 4ITUA 1DIHA 4ZI3A 2HHJA 3A32A 3NCTA 1ACJA 1L3BA 2X8WA 3HWUA 1AUQA 3FGNA 4NS4A 4ON9A 3T9FA 1CP9A 3OFVA 4CMIB 3TTUA 3BIXA 3DHWC 4P9PA 2X58A 5A0FA 2Z2XA 3AI3A 4DIFA 2BM9A 3QUAA 4YYEA 2ZXUA 2OBNA 1S76D 1AY0A 4NICA 5IM5A 2IHZA 4GGPA 1XAGA 3PLAE 3ZVKA 3VC2A 3BHPA 4FZ1A 1NXPA 2BFOA 4J10A 3S2UA 4F86A 3LXUX 2GBPA 4A6XA 4B71A 1O96B 3VJRA 1SXJA 4WESA 3G6WA 2WAXA 3ETDA 5ILGA 5SYAA 3EXEB 4EW3A 2NXEA 3FNRA 4YMWA 1EN5A 2RGDA 3ANMA 3OOSA 2F3QA 2OCDA 4OHMA 5DSZA 1RFLA 2ODQA 2Q46A 4F1JA 5EG5A 4AT1A 1WLSA 4CT4B 1SHZA 4JJFA 1AQNA 3DVRX 2QPTA 4LDJA 1O1YA 1QV7A 2VRWA 4G5XA 2XUOA 4Z4IA 1SAYA 3L7KA 5JS7A 4P86A 2OCXA 4AI8A 1X39A 3AQ4A 3IIEA 2DF8A 5JAMA 1KMMA 3DO5A 2AE1A 4ZO9A 3LGSA 1T3TA 3MJDA 2NPIA 1T0JB 4TGLA 4BT5A 3CU5A 3CVOA 2W8BB 1D5WA 3FRIA 3GZ4A 1N33B 3K1ZA 4JROA 2EILC 4NJMA 5T5QA 3DZJA 3S44A 2W83A 3D6AA 4EMSA 2EWMA 3GHZA 1Q7YH 3HO8A 4KXFB 4TYQA 1WMSA 4WXMA 1F8XA 1JBQA 1HV8A 4YAWA 2XTNA 5EP4A 3CLRC 3UMVA 3BE4A 2CNNA 3ESYA 2RB9A 1GUZA 3EF3A 3EGDB 3NT4A 4Q9DA 3VPBA 4H44B 4HDAA 3ZW9A 4Q7MB 1KI1A 3PNPA 2RBKA 3MRTA 1V35A 2BR3A 1E9BA 2C29D 2R1VA 3I9NA 3PT9A 3ZGOA 2V65A 1JEDA 3GAMA 1MDBA 3BMXA 4XPIA 1KIAA 5AVKA 4EL0A 3FDFA 3WGIA 4WJKB 4NCNA 4HDMB 2VPYA 3ZJUA 3FCYA 1MB9A 2HXGA 2VKTA 2XKAA 3OLVA 1KY2A 2BH9A 3QH4A 1F4PA 4G2TA 1WB8A 1MA3A 1C0EA 3NCHA 4NCAA 3LNNA 2C8JA 3G7NA 2VSNA 3N76A 1WDMA 3MQFA 4RK6A 1XKXA 4XJSA 5AKYA 1F17A 4F4IA 3ASYA 4BKUA 5HKOA 1IUPA 3ZYZA 4YWHA 1L7EA 3T3IA 2N75A 2QKYA 2BDTA 3EPPA 2CCKA 1YFLA 5J9PC 3HN2A 1FTYA 1VPVA 4LE1A 4A5OA 4EGCB 1UWKA 3PTAA 3AVUA 1A77A 1UMCB 2K1SA 5HF9A 4UULA 2LCFA 4BX0A 5C1PA 4MDFA 2DKOA 4C22A 3UFXB 3ZMVA 2DTXA 3I04A 5IJ9A 4DSNA 4E4TA 4PZAA 4YGXB 3OLCX 5ESDA 4XIGS 5FLYA 4LVCA 2XCSB 2H4WA 4TKLA 5FLKA 2F7SA 4B76A 1VJDA 1X70A 2OORA 4CG0A 5IUJC 5IK2D 2IHNA 1JVMA 1Q12A 2C42A 1TKCA 1BA2A 5ADVA 1H8HA 4XCVA 2PM8A 1AV7A 3ORQA 4HAUA 4PO3X 1Q57A 5NLLA 8AT1A 3VNUA 2PI4A 1JL3A 3EZLA 4XB1A 1KJNA 1V9LA 4HGPA 4IO1A 3UPUA 4D6TH 1T3LA 3G68A 2WC1A 3LS2A 4U2DA 4MR9A 4OJTA 2BE7A 3J80N 4J75A 3CYPB 1GNPA 2C59A 3OEHA 3W04A 5CJJA 1F0PA 4QG7A 1FXWA 1UR5A 4L02A 4QBHA 5KINB 1ZM4A 1RKQA 4G6ZA 5D7BA 3VSEA 4BVAA 4QVGA 3JQEA 1D5NA 4XDHA 3L7JA 3PC7A 5LVAA 1N2CB 1OA0A 4CM3A 4K2HA 4I0XB 1R7RA 4UCOA 3MBMA 1POXA 3H87A 4G09A 4YRLA 5DMHA 2ZTSA 3RVRA 5CFQA 1JDTA 3RUAA 4XVQA 3K5WA 4OK5A 3BA8A 2NACA 1T5SA 5LSAA 1RACA 1VQPV 1VSTA 4PO8A 3CT4A 1SC5B 3NBAA 4B3BA 4B32A 2JCXA 2ZIWB 5IAAA 3W3AA 2CSXA 2QPOA 5BN1A 4L3VA 1P7WA 2G4LA 3ZBQA 4Q93A 4KYVA 5EVCA 4BQOA 4B3JA 3CLSD 2HBQA 3U4GA 3ROTA 1TUEB 3BXFA 1MXHA 4O8ZA 2CXHA 3FAZA 4O5AA 1W44A 2PUVA 3VDMA 5GONB 1IBCA 2VPQA 4BBPA 2PUGA 3EFOB 4ZT6A 3Q8XB 3U3KA 4RDIA 4V2UA 4WPGA 3UJPA 1OAPA 2QWRB 3ORFA 4P22A 3RLIA 3W9SA 4C3VA 2APJA 2P22C 5AW8A 4PZDA 4JT2A 1WP8A 4MUEA 3UEOA 1JQ0A 3WG7C 4JMPA 4LYAA 3GX1A 1U8ZA 3O84A 4X3LA 1H93A 4UVHA 1P2BA 5B3AA 3W5UA 3L02A 3NRJA 2I78A 4D44A 3PKJA 1XLUA 4IQ8A 5CFNA 2HKIA 4KO4S 2F43A 1VPEA 2FN3A 3AZQA 1QGZA 3ILVA 3JYOA 4MA4A 1SCBA 4Y1RA 8MHTA 2H7CA 3IIMA 1HT0A 1SELA 3QSYA 1JDJA 3C5HA 5E6RB 1NMYA 1W581 3TUJC 2XZTA 3IA7A 3CSSA 2OGZA 3STWA 4BQQA 4D9IA 4DUYO 5EQJB 1NHGA 2YBEA 3UJ6A 5HYVA 3R3WA 5T7BA 2I80A 1NJ1A 4AL4A 1WXXA 3PC2A 3TM4A 4C7JA 5A9GA 5C46F 1XWFA 1ZVQA 2UVPB 3P2JA 1KZHA 4Q66C 2XSZD 5KBYA 1BMTA 4CKBA 4KC0A 4NNOA 4BIOA 1SNYA 1P44A 2VTKA 2Z3VA 1I7SB 4U3FH 3KSZO 4RFSA 1YMUA 5C4MA 5CA0F 4CS2A 3H9EO 1GU1A 3P2EA 4Q1DA 3DV0A 1I4EB 3BABA 3CIFA 4W7HA 4W1RA 1HYHA 5GW7A 4OJYA 5EC1C 1DJLA 1G20B 5DYTA 2OHWA 5THKA 3ZDCA 4KIWA 1N4AA 1PR3A 1ZSPA 2PVSA 3TYXA 1Y42X 2HFJA 2PNFA 2EL7A 2BTUA 2XV1A 2O1XA 1IWOA 2GZAA 4HTFA 3CLRD 4OHVA 2BPOA 2ET6A 2EGGA 1MEJA 3RVMA 3INGA 1PGPA 2ZS7A 2QMZA 1L4HA 3SC3A 3ZE7A 1XV2A 1D2NA 5AM4A 3DCNA 2FLKA 3IJ4A 2PK3A 2QRPA 3ZQJA 5FUXA 5K8UA 1WKBA 2IPNA 3FGZA 4MW0A 1JZSA 2A5GA 5IYZA 2QLMA 3U5TA 3NMUC 1QAQA 4ZAXA 3VPCA 2ADPA 4U4AA 3J7AR 4ARVA 3B3QA 4Z3OA 2W42A 1EDZA 4WFEA 1LPNA 1IH8A 3QEOA 5FPPA 1EKXA 3QWFA 3OX2A 3N8IA 3OEHD 4X97A 4DHWA 2W0FC 4FONA 2H16A 3TJTA 3LO5A 4LNUB 1CKEA 4E21A 4V0OA 4CCSA 5CBGA 1VKHA 3O8QA 4MLPA 4JV5O 3V7UA 4IL5A 3UANA 4DCCA 2VSQA 3MFYA 1C4OA 3E0QA 2ZBFA 2CD9A 4TQFA 2PMPA 4Z49A 1T2DA 4AKIA 3ZW7A 4CUKA 1IXZA 2OYQA 5EY5B 4PHFA 4BWVA 1K7FB 2O23A 2IRWA 2X5XA 3VR4H 3W3AD 2J0SA 3PFFA 2RK4A 2H5LA 3G2IA 4H33A 2VJMA 1UQRA 1W4RA 3KD3A 4HLDA 4YY3B 1Z2DA 1B3RA 1DF4A 2JZOA 3IXQA 4KL1A 1FP4A 4R2JA 5AK4A 3FDZB 5DNCA 1I7DA 1Q1EA 3LKDA 3U4AA 1CD5A 5C3UA 3DZ8A 2F8SA 4F4CA 4LHYA 2FR8A 2CNBA 3LZ6A 4HB2A 5T6BA 4UDXX 4C0LA 2HWYA 4ZJZA 4CLOA 1LFAA 1J2JA 1TK3A 4KVZA 3B6IA 1VMGA 3UWSA 3JSAA 3OFNG 2XRYA 4FFVA 4TVBA 3W8NA 3VAZA 2IL1A 1CFJA 1T36B 2BJWA 2FWJA 1RXIA 2RCNA 3EY9A 5I7OA 3BZWA 1P0MA 3AYXB 4MV7A 2JLSA 5B58T 3PFHA 3WMEA 3QX3A 2EF1A 3VOTA 3PX3A 1RM3A 2EJCA 5LLTA 4L0QA 1I4DD 3IAM1 1N57A 1QYWA 3QWHA 4DLYA 1YU9A 5JXGA 3GPLA 1X7WB 2F90A 2D7JA 1WCIA 3PBKA 5CMUA 1G2QA 1WL8A 3BTOA 1VA4A 1Y3CE 4QOFA 3ABKC 1OKKD 1KWGA 5TQ2A 5HGXA 1WDLA 5IEJA 3W9UA 5THXA 5LL6P 2VRBA 4QPNA 1OFVA 1UZMA 2AMVA 4RF3A 5CEFA 3HJRA 2OHIA 4J94A 4QDJA 5HVNA 1GK9A 4Q9NA 3GGCA 1T8UA 2V0CA 2WSIA 3JQCA 3DZIA 2JEXA 1CK2A 5BYJA 3HBMA 2VS1A 3FCXA 1DVRA 1BCRA 4RELA 5F7ZA 3SY8A 1XA3A 2VHYA 2JBAA 1NR1A 4L4ZA 2CHTA 4HXGA 1DBSA 2EJRA 3AUJB 4MITA 3H16A 4Q1EA 3T9AA 1P2TA 1UJCA 3CXRA 4RENA 3SHOA 5DH9A 5KYUA 3BAAA 2OAQ1 4P30A 2W00A 2LBTA 3HEBA 4QUKA 2O6LA 4R7ZA 4XX1A 3IE1A 3R3SA 2NV0A 4RD4A 2ZCEA 3N4ZA 1DIAA 1NKSA 2J0EA 2XYHA 3NAZA 4AVYA 1W2HA 4KYUA 1LK5A 3BWMA 4KFUA 5JH7F 4JXZA 5IU6A 4OLJA 3EBOA 4JQYA 4CKCB 3LNCA 5L7WA 4C14A 2OO3A 4LRQA 4QOJA 3AY6A 1J21A 2GVNA 1T8RA 1N2HA 1FQOA 5IJXA 1KGSA 4AUMA 1E98A 3QOWA 4N7MA 4AUNA 4YUXA 4P0QB 3SYOA 1B8UA 4KBFA 1LPPA 4Y3UA 1UK7A 3OTWA 1Q19A 4CIVA 4D9HA 2VGNA 1OU4A 2H65A 3QVMA 3BFRA 5AJXA 4RD3A 4YJFB 5KNBA 1X7WA 4MVSA 3THXA 1PGNA 1GGEA 2ZRQA 3DMTC 2OV6A 3G9ZA 2ZIEA 1FSSA 3Q5GA 4PA7A 2C0PA 4Q9IA 4AS3A 4MWOA 1J7HA 2PQMA 3I12A 2NSJA 3DL2A 3R2JA 3QU9A 2FW6A 3RIYA 2EKDA 2MSLA 1GTSA 3Q2IA 2QAGB 3AF0A 3H2ZA 4XYGA 1MX9A 2FFQA 1J95A 4GP7A 3T3DA 2BMJA 4BB6A 4GZ6A 3O03A 2Y68A 4UHBA 4NYMQ 2CNDA 2X1LA 2XOKD 3I76A 3RYHB 1U1GA 1JG4A 2PWYA 3OWHA 5GAJA 2PSFA 3A1VA 3CHYA 2CV0A 3TM5A 3I9KA 5HFAA 2RNBA 1AKUA 4GU5A 1V43A 4JN6B 2GD6A 4WH0A 2ZK7A 1Z56C 4DXDA 1YKGA 4KE9A 5H70A 1A9QA 2OUKA 2ZE5A 3OUUA 3KKNA 5CA1B 2FUG1 1RLIA 5JXIA 4HY3A 3SPXA 1Q1NA 4PBTA 4K9RA 1U7TA 2R5WA 5EXSA 3ZD7A 2SHKA 1HFWA 1NLZA 2PJDA 2W22A 3KJHA 3KVYA 3AFMA 1SF9A 5CJPA 2OCLA 3T0IA 3WYCA 5A9SB 4I8XA 4B8WA 1JFFB 3TETA 3X2QC 2UUAB 1UMDB 3PGLA 4EI8A 1E5TA 3MJ4A 1Z62A 4C03A 5G53C 2QRVB 2JCVA 1A88A 2Y92A 1LD3A 2XE6A 3UCXA 2XI4A 1U8AA 2H9IA 2OC4A 2YN4A 1Y3AA 2YTZA 2OOSA 4HGQA 4J7AA 1XZFA 3VTFA 4BNWA 4JEMA 3JWHA 2D06A 5DBIA 2R1TA 1ZICA 2EW2A 3AR8A 3DT6A 5BSRA 4HJRA 3H4TA 2JFHA 3AU9A 3L93A 5FUVA 3QO8A 5AHXA 5ALWA 4FFKA 2BZGA 2CJWA 2IOHA 2VCYA 4GLJA 2R8ZA 5KUMA 2HMSA 1ZONA 5B1IA 4UVAA 5DOZA 2QTPA 3CJHB 3ZX6A 1TYAE 2QLJA 3R5XA 1C9EA 5IBPA 1NBEA 4ND3A 4AJLA 5LNK1 5ALZA 1QJ4A 3ND6A 3TMKA 3CWCA 1J07A 1SERA 3FTNA 4OIFA 5AUPB 4RYLA 2P5OA 4EW1A 2LGQA 5JFGA 1C9YA 1C8LA 1G20A 5B1EA 3MTDA 5C7IO 5BT9A 4CEIB 1TD1A 2QRZA 4WW0A 1O8BA 3WB2A 3FTQA 2FWMX 1U8YA 3EUWA 3UIEA 3DV0B 4UTVA 1CZLA 1P33A 3ON5A 3OPQA 5T41A 3UKJA 4DRZA 2IH3C 1WXQA 5CCEA 4EVRA 2JD1A 3GH1A 5DPMA 5JSZB 1DCTA 5GVSA 3W2EA 2FG5A 2X5NA 4WY5A 2XWJI 3ZH2A 1F2TA 4EF6A 2BJHA 5CPFA 4DV4B 4YI5A 4D8YA 2QTZA 4R3UC 2NZ8A 3EIQA 3ORHA 1VQOV 3I45A 3OIWA 3KDAA 4YJ3A 3R8FA 5ALFA 3GRYA 5FO0A 1T2NA 1T9AA 3UJAA 3AEIA 3IC5A 5IKOA 1L7NA 1H6AA 1T2FA 1Y67A 3SNHA 2C7OA 3F0GA 4CV2A 1MJGM 2WLJA 2F00A 1N32B 2FFRA 3CCFA 1EM1A 1YJNF 1CR1A 1B41A 3C6XA 1XMXA 2PIDA 1A9XB 3QYPA 2RSLA 4EA7A 3F9CA 3L84A 3AF6A 4CGZA 1NAHA 3IO3A 1EBOA 2V59A 4G63A 4PAQA 5CVDA 3WLEA 4B9AA 4BGDA 1TMKA 1KXZA 2WA4A 3JVUA 1G60A 2I2WA 4QE7A 3KWJA 4HLQB 2WHQA 1HOTA 2CLOB 5ALDA 5FFMA 4PBRA 3OAAG 1LZLA 4IDDA 3P71T 1QGUB 5B1DA 3RAJA 4DQXA 2G09A 5FJIA 1IV4A 4K8OA 3KG2A 1E9VA 4JI1O 3OZRA 1SKYE 2KX7A 1K66A 1OWNA 3N59A 1RTTA 1YHYA 5DCWA 3NJ4A 4A8PA 1SUDA 1VKRA 4MUAA 4RAOA 3U4MA 2JIZG 2UZ1B 3UT5A 2WIBA 1V1JA 2DGDA 5FWXA 2PSSA 4E4EA 4HGNA 2VNAA 3GGPA 1BFKA 5FFFA 5CPBA 1ZUIA 2AUTA 2BFMA 3WDLA 4ZJYA 1VIYA 3BJMA 4L9WA 4BKQA 4EUNA 5BUSA 5EQDA 1VQ6F 2X6RA 1GZVA 2IV2X 4E2ZA 4J43A 5JAPA 3TXAA 5TPWB 3BJRA 2VZ8A 4B3IA 4CR6A 2I6FA 3QZUA 1P39A 4HMQA 3AH8A 4A8JC 2YS6A 4I9NA 5MFPA 4DUZO 4ENWA 4I3FA 3CEJA 4H08A 5DM70 3ZBTA 1Q20A 3EHBB 4MPDA 2GAIA 5CW2A 2OBYA 1WPRA 3PUYA 5TGZA 4AW9A 4DXHA 1XG5A 5JJIA 2H8GA 1RYNA 2H4HA 3PDIB 3F47A 1G8PA 4K2AA 5ALUA 5LP6B 5E7IA 1Q7CA 2X19A 5EB1B 2FUG6 3BFXA 5AIAA 2O5EA 3TD5A 2HA5A 1ZD3A 1U6KA 2H57A 2G67A 2NTYC 1RMTA 3G6BA 1C3LA 2J3JA 5ALIA 5G4LA 3QVKA 3SEAA 1KYIA 2VDRB 3GCXA 3A9TA 3OSZA 4IWYA 4NYMR 2VTBB 2QWOB 4AK9A 1QUFA 3I83A 4MV0A 2AS0A 4MUKA 4W6ZA 1VJ0A 3WGGA 4H1WA 2CJXA 2CFOA 4NCHA 1KQGA 2V7XA 3CRQA 2DYRB 2VQFB 3K2QA 2JGMA 2RGUA 1L5ZA 2PZFA 4UEKA 5JQWA 1N36B 1Z82A 1OH7A 1T8YA 1TXGA 4J7XA 5JSQA 2M6LA 1RC0A 2JHCA 4O2BF 4XIIA 5JS1A 5LYJA 1U28A 1UKEA 1MABB 4GR5A 4P80A 5LMUO 1KVTA 4BO0A 5C5IA 4KDRA 2DEUA 4OLBA 2A4MA 2ZR9A 1AP5A 2LDXA 4PXAA 2FPKA 3NONA 4B75A 3GEGA 1N0JA 2IW5A 1XAHA 3EH1A 5DYNA 2X8BA 3IQGX 2EV9A 1KFEB 3N27A 2NSYA 4WBNF 4ZTUB 2EILB 1NW9B 3SZUA 2OZVA 1QGOA 1C4XA 1RZVA 4I1RA 4IQ0A 4BFXA 4CI9A 1X8XA 4G81A 1KTVA 2CMDA 1GL9B 2HYDA 2IY7A 2R66A 2VBCA 4PHHA 1IVYA 2PKQO 3A05A 1JXOA 4P81A 4P54A 4QJ5A 3T7EA 1GM5A 1GZSA 3D8HA 3NT5A 1A5TA 1U2QA 4EY3A 3THWB 2YYAA 1OYYA 3IC7A 1A5ZA 4K7JA 8LDHA 2C98A 2XE7A 3CCEV 4Z4FA 4B84A 2F8TA 2ZM5A 4BPRA 3V8MA 2B30A 4UBLA 3H5OA 1G9SA 2GKOA 4DMGA 2REOA 4Z9XA 3AK4A 4G24A 4W5NA 5I7WA 2NLOA 2BFEA 3NANA 1N9GA 3BA9A 3OX1A 1HEUA 3RV4A 4MRRA 3A25A 5DSTA 5LDDC 2HK8A 2NTNA 3MTQA 3P9XA 4FNGA 1E32A 5J2TF 3SGIA 1A9ZA 3WK4A 5H80A 1U6JA 2OXTA 3MOSA 4HH0A 3L8HA 4EKWA 3EMBA 4I9GA 1P7GA 1T6XA 2UV8A 1LR1A 1XBLA 1EG7A 1WZUA 3H86A 3JY6A 2QMYA 2HJHA 3HJCA 3TJRA 2WKSA 4Q7EA 4EO9A 2PAAA 2ZBEA 5NULA 3DCYA 3CPQA 3I92A 3I9V1 4FFRA 3EA0A 3OEEG 1ZGBA 2KJQA 4RV4A 2JJMA 5DGHA 3ZJ5A 4IY1A 4IS2A 3N0TA 3E2PA 1WOMA 3WDMA 3TD9A 5HXAA 2NZXA 3QLEA 4JBYA 3TD4A 1SWWA 1X1CA 4NAUA 5BR1A 2QZ9A 4BFWA 4FNOA 2BONA 2YBDA 4C0XA 2LQTA 4WX2B 2P9BA 1LNZA 2X0RA 1GAJA 4BWAA 1NJ5A 2QY6A 1PR9A 3LQ4A 3IEXA 3AV3A 4UZFA 2P3QA 3DH0A 2JIDA 2ZSFA 2DB3A 2JAPA 5HTOA 1EBBA 4JELA 2DHQA 1XJ0A 3NIBA 4R9RA 3HB0A 2DJ5A 1M1YB 1MSWD 3TMAA 3U5ZB 3AESA 3IILA 4ZEVA 1ISFA 1JLKA 3T8YA 3RS0A 1CY1A 1X7ZB 1PBTA 1XQ9A 2FPPB 1KL7A 3PYMA 2C2YA 5F3DA 5G0WA 4B4DA 4ETWA 3WGUA 3QPVA 3SE7A 1TRHA 4W4KA 4CR8A 1Z83A 3KJFA 4CKXA 1Z2CA 3UG6A 1N1MA 4F9FA 1D8TA 1WG8A 3ABOB 2VWJA 3U44B 10MHA 2XAJA 1RQXA 3O31A 2ABWA 3V00A 2DERA 2NXNA 4QE9A 1DJMA 3DP9A 1UT6A 3LAWA 3Q3IA 5AH0A 3G1TA 3JATA 1VHWA 4X5OA 2JAHA 1C3XA 2FW1A 2NM0A 3RC1A 1FXKB 2P6PA 2CMHA 1BWPA 4AS2A 1JB9A 1W4LA 4EABA 1HNZO 3KJGA 4GM4A 2NU8B 4A8TA 3SS7X 2G9QA 4DMUB 4R71A 1DIGA 4RC9A 3AIMA 1SCKA 2YEVB 4V0NA 1WP7A 1IUKA 2WFZA 5KYUB 3Q7PA 3S1AB 3CC4V 5DHAA 5HHTA 3OQMA 4EO7A 3BDVA 4QYSA 1CT9A 4QUDA 1WSBA 3VYSC 5HP7A 3K8OE 1ULSA 2VRCD 4GBGA 2E75B 4U7PB 4QJFB 2PKEA 3AB3A 2FF7A 2YWDA 1LH0A 5D00A 2AFIB 3A58B 4WK0B 1SCNE 4B2YA 2P6UA 4LN1A 1BN6A 1IONA 3ZWQA 1D0IA 4M0LA 5I5EA 1PAUA 3PA6A 5HGJA 1XNRO 1EXMA 3OJWA 1K6JA 1C1DB 1T0UA 2NGRA 3EZXA 4AZ3B 3ASOC 1YQQA 1DC4A 4KXRA 4ZO7A 4FLXA 5FI5A 5IAEA 3RVOA 3TOZA 4CI0B 4GAEA 3C1AA 5A62A 1AD2A 4V24A 2ZYAA 4PG8A 4HEA6 3UATA 4C6TB 5F7XA 2AR7A 2QYTA 3A26A 4FQ8A 3VUFA 2YIVX 2MMGA 3FJOA 3GY0A 2XDAA 2X7RB 3OMXA 1WW8A 4C3UA 5B6JA 4C4RA 1HDIA 3WGJA 4PFJA 4EHAA 1RA4A 3WY9A 3CRAA 3QELB 1Q86W 1ENZA 1N2GA 4U2CA 3T7AA 2OAGA 2WYVA 3I9MA 4OIMA 3W90A 1KYYA 2EWCA 4YV1A 4RQEA 4IEFB 5LZ8A 3PUJA 1LJ8A 1NC1A 2ZYTX 2UXNA 4R7TA 3AG1B 3U11A 1ONBA 1ZIYA 1ZD4A 2N42A 3CTPA 5H68A 3WP1B 3UTCA 1QCCA 3KVOA 4G9GA 3ZU2A 2COKA 3WGNA 2BFAA 3TJMA 2VJMB 2XT0A 4IDFA 4Q3KA 1EHYA 2YS8A 3GNTA 5H3LA 1R0BA 1S72V 3DJYA 4HN2A 3SZ3A 3ZVRA 1GZ0A 4DLRA 4ZDKA 3IPYA 1OXTA 4C5AA 2E87A 1FP2A 1Y7TA 2JI6A 4GI1A 4CCYA 1Z7BA 3WJ1A 3DBLB 3ZQ4A 4MUIA 1G18A 2AJTA 4IXWA 1T9HA 4XM0A 2RHLA 2PF4E 4PC1A 4YJFA 3TZQA 2I2AA 2A1TS 4TUYF 3PX2A 1MO5A 1J2TA 2XTJA 5TXGA 1ORVA 1X0XA 1PR6A 5BV8A 1XPRA 4MRMA 3RYFB 3LF1A 4H0FA 5JNSA 5ECWA 3QUTA 2GOYA 3RQIA 2CC2A 2BSAA 1SKMA 1NTZH 3P96A 1X9IA 3IPXA 1YV9A 2WLTA 4Y2GA 3R0PA 4L4UA 2VUTA 4PAWA 2GCOA 2KLHA 2XUJA 1LS6A 3I8OA 3K1AB 3MPOA 4IOJA 4FILA 2EZOA 2VPZA 1IIBA 1DKQA 1O4VA 1OLUA 1XMVA 2B8NA 2PLWA 4GOND 4H1UA 4BMSA 3CNOA 5CA0A 2C2HA 2H48A 3DW1X 3EOBI 3FZEA 4ZYLA 1SHKA 2GBLC 1JX6A 2ZOSA 3EC7A 2HGSA 5F3RA 4WBNA 1CUJA 2KPOA 4I5FA 3UB4A 1I3KA 1VIAA 2PMKA 2R79A 4ZOCA 3AKCA 2A06H 1BW9A 1VMAA 3HJBA 1N5DA 1KZ6A 1XDWA 4DDMA 1TZBA 1M56B 3L0BA 1NG1A 4I9FA 4I1IA 3A4MA 5DLEA 1PR1A 2W9XA 5JFOA 2HV9A 3OJOA 3C3YA 4HS4A 3WLTA 2XCLA 5WRFA 1S8FA 3KAPA 2B94A 4F11A 4G4ZA 2FWAA 1EUCA 1N1DA 3E9NA 4FLYA 1RYYA 5IZCA 4C7OB 2FPOA 5TSDA 3WMXA 1J0AA 1L4KA 1XTTA 3CKYA 1AI6A 1UC9A 2J9FB 4R9VA 4RMNA 3LM8A 1QQAA 1KEWA 1NI4A 3GFOA 5KVSA 1YFJA 4B17A 1E3EA 3K70B 1ONNA 3DDUA 2F95B 1D2AA 2J32A 2R65A 3JTMA 1DAMA 4ZCPA 1W76A 3F3MA 3I04M 3O2SB 2WWXA 4HEHA 4JY7A 3T3HA 4MTGA 3PGJA 3JAKB 4G1BA 3VO9A 4CTMA 1P84F 2GHRA 3HUFA 2DH5A 3L6RA 2XMCA 1SQSA 2G08A 2YINC 4PCVA 4DO2A 2Z9DA 3GA7A 1U0EA 2FWNA 3B3JA 3CC7V 4JI4O 2H08A 2JHPA 3KKKA 4DQ0A 2BELA 4ZAVA 3TUIC 3CURA 1GKYA 1ZMXA 3K0GA 1DZIA 4DDTA 1G8HA 1Z0ZA 1NZFA 3HACA 4KQWA 3KQNA 2C5GA 3PNSA 3T0FA 1EWYA 4B81A 1GHTA 2ZQZA 3EWAA 4QFCA 2VP6A 4CH6A 1TB4A 3F6MA 3T06B 2BRUA 2ZULA 2P1ZA 3ICPA 4C6HA 3PVCA 3MUEA 4JX9A 5JHHB 5SYMA 4U7JA 5FYQA 1W49A 1BRMA 2NQ2C 2DUWA 2X22A 3GMDA 1ZL8B 4M1EA 4EBFA 1T9CA 5GJVC 5H6RA 4KQIA 6ADHA 2WU4A 3P9NA 4INAA 4NULA 2Y66A 4NWOB 4BV8A 4JP5A 5AJVB 3W7XA 1U3UA 2IP2A 4JCOA 1JAXA 4EEXA 2ZAIA 4AUKA 2E55A 1B8PA 1KB9F 2FKXA 1RKXA 2AC7A 1TTQB 3HPLC 4JLDA 3FYUC 3TLYA 5KVVA 4BY9E 1ZSVA 5BNIA 1L8LA 1IXRC 2CSLA 2YI8A 2EQAA 2RKWA 1FPMA 2HA3A 4EA6A 1RYDA 4CQMA 1V96A 721PA 4D5EA 4DKJA 3GNQA 4QHYA 5DSXA 3L06A 2H0RA 4JUIA 1HLFA 4URVR 3PR2B 5HEKA 3FWZA 1GAEO 2D2CB 4KX3A 2W6MA 1ZGHA 4TM8A 1WPQA 1DWOA 4I4TA 4IUCS 3UV7A 3B6ZA 4QZVA 2YZGA 3GYGA 1QUEA 3AL3A 1VQPF 4GEGA 3SBOA 3PQCA 4EPRA 1RLMA 1EX9A 1PJ3A 1K3UB 1N0HA 4MXDA 2ZM6B 1GL3A 1KO5A 3DBIA 1ZO8A 1IBSA 1CJTC 1UQUA 1M5TA 1OMOA 1YZQA 2GF9A 2IDZA 3JASB 1REQA 5D8DA 4PA9A 2IEBA 2IOFA 3A6HA 1LC0A 4KE6A 4D8TA 3FGPA 3M99B 3G49A 3VBEA 3M6MD 2YOHA 3HI4A 5C8XA 1JQJC 2ODMA 1XL0A 1VG1A 3B2QA 1N7JA 3GLQA 5K6RA 3GBPA 4B3FX 1YT5A 3E48A 2Y4TA 3I1FA 5I3ZA 2NSDA 3NVIB 2QXUA 2N3ZA 2JBWA 1KI4A 3KOWA 1ZOLA 1Z0KA 3BGOS 4GZ3A 3C3TA 5JH7A 3TF5A 3VDXA 3PX7A 1Z0SA 1LLUA 2C0CA 5B4VA 1H1DA 1RPJA 3FAVA 2HCJB 3E27A 2QMEA 3RYFA 4MNTA 4OXYA 1V45E 2O6HA 2QRGA 4Q4JB 2DPYA 4M99A 4MP6A 2XT6A 4RHEA 2X2PA 1XALA 4AU1A 5LUAA 3LYHA 2FP4B 1HWYA 3ENWA 1E2HA 4GE0A 4JWTA 1W3EX 4J2TA 2IPAB 3VZPA 1SZDA 1O7JA 4BHTA 1M2FA 1JVSA 2QVYX 3SYPA 4L85A 3ROEA 5ITZB 3W1VA 4LV5B 1FLAA 3MC1A 4I4NA 3T4ZA 2CYAA 1C9JA 2ZQMA 4UZEA 1XEWY 2HLHA 1YF3A 1TJYA 1TZCA 5EP2A 3EWIA 3ZTWA 4JU9A 1JWAB 3INRA 3V80A 1N5LA 1G38A 5E95A 1RYEA 1P0PA 4U7FA 2GHTA 1WETA 2Z6AA 1Z06A 5KYGA 1GFWA 3LSSA 1E60A 1HNNA 1T5TA 3X44A 1KHHA 2GPYA 5BOSA 4Q3OA 1M93A 5CXQA 3S02A 3VPAA 1GDHA 2QRHA 3H7IA 2IUSA 4DNQA 3CYQA 3VIUA 5IARA 5KVQA 4D3ZA 3ZE8A 1JIJA 3LVRE 1ZUQA 4PDRA 4LC1A 1F2VA 2CBXA 3KVVA 2WG1A 1OWLA 1IVNA 3EG9B 2CL6X 1TC2A 2ZIOA 1FW8A 1WVIA 2ONZA 3PHJA 3RN4A 3C9TA 1K0UA 2PWBA 4WFGA 1LJUA 2ORIA 1K3TA 3OX4A 4JC0A 5J63A 2EFEB 2NPFA 5BV2P 2D3TA 4MQMA 2TMYA 4CTNA 4FJ2A 1SBQA 3UMGA 2D2IA 4PQFA 1B2LA 2C00A 5JJLA 3OJXA 2ZAMA 1S77D 3IQIX 1FL9A 4WLUA 3QU5A 3UJ9A 4EKDA 1HZZA 5KEIA 3GVIA 1G2IA 2QM8A 1LUAA 2IEDA 4TXJA 4WGFA 2RGNA 3FB5C 4ASUD 1HYQA 4MARA 2UXDB 1MA0A 1BMDA 1E5DA 2QK4A 1H3FA 3P8ZA 4F12A 4UVIA 1MFPA 5IJZA 1GUYA 5IS2A 1DG9A 4G1FA 2QR5A 2ID4A 3FF1A 3H0EA 4S04A 1VL2A 4HQ0A 3TDKA 4NXNB 1KEPA 3WL8A 3P9IA 5FEUA 3K9HA 3NTOA 4WZBE 2IHKA 1SUFA 4HB3A 2W0XA 1KZ1A 3KHNA 2L82A 1CSEE 1SG6A 2P30A 4XPZA 4EHIA 2YXPX 3CBQA 2QR2A 3LNTA 4WK4B 4BWGA 4ZCMA 4ZV4A 1W9HA 2DULA 3ZS9A 1Z63A 3OE7G 2IP4A 4JOSA 1TM7E 3OZFA 5ALJA 3CNLA 1C3VA 1F0NA 1UPTA 1E79A 5CVEA 2OGTA 4MULA 3AF1A 4DZRA 4Q5IA 5EJ4A 3G2LA 3QA3E 5EKUA 4I46A 4DB2A 2EBWA 3TGLA 4H18A 2BT4A 4D3XA 5KYXB 1R6XA 2G4CA 4EA9A 5H3HA 1JHZA 4RY0A 3DBVO 3LY8A 5JPIA 4OUKX 1RQGA 3DD5A 1SK9A 2JLCA 2VOEA 3EASA 3KJIA 3NIDB 4TT3D 3R66A 4OP3A 1N6NA 2W6IG 1T29A 1K9VF 5B3SC 5AO9A 1FDOA 4HNUA 1QH8B 4KNWA 3DHYA 4PIVA 4WKOA 3O8DA 1YDMA 4OXNA 3R65A 3B9QA 5G0VA 1UOEA 1KC8W 4BYGA 3KTAA 1YTFB 4GQIA 4MJXA 2E4UA 3H1JH 1YVUA 1PV1A 1W93A 1Y5NA 3K9BA 4WNCA 4QFBA 1JJBA 2G8LA 5LQUA 1DEOA 1P9WA 5CA1A 3MUFA 4FNMA 5FWYA 3P9RA 2C9ZA 4UDYX 4AP9A 4DR5O 4XSHA 1SKVA 3NVAA 2VQFO 1ADCA 3F97A 4ZVTA 3O83A 4AO6A 1CUIA 1KE2A 3ICVA 3ZE9A 4B7UA 1R6AA 2YXBA 3KJNA 4EH1A 2P6YA 4HQKA 3RYHA 4JWKA 4B33A 4XEUA 2IH2A 3AG2C 1X7HA 3OESA 1M56C 2O2GA 4K9SA 3T52A 2B0CA 2JEZA 4J1TC 2R6HA 2D5CA 4XUDA 5EZQA 4D79A 1GILA 1WKCA 4EY7A 2IS2A 4Y2PA 1C0KA 5B3JA 2FKNA 3K2IA 3SIWA 2R00A 2F66C 2PY5A 4K5QA 1IK6A 5FA8A 1LTQA 5FTKA 3EF1A 4B83A 2CHFA 4X60A 4CV1A 4E1AA 3AI7A 3CZQA 5TRTA 2B4RO 3H6GA 4G5SA 1NATA 6YASA 1V1MA 3P52A 4PS1A 1W5AA 3V7QA 2X0DA 2UYHA 5IRCD 2NYRA 3SEZA 3HKDA 4Q01A 3ZE1B 1QV6A 5HCUA 4C2BA 1DADA 3NBFA 2VEOA 2EHJA 2PXCA 2W48A 4PQEA 4DG5A 5FBVB 3P5SA 2WICA 3MMXA 1YA6A 1NTOA 4CS4A 1DT5A 5KYXA 5JH7B 1FXSA 1HX7A 4DR2B 3EIOA 2OIEA 1IK4A 3I6ZA 3IRVA 3KT0A 3MOGA 1LPAB 1KEEA 2FHPA 3WZMA 4YTEA 3QHDA 1VLVA 3TLEA 4DLVA 1J8QA 3BOSA 1P6UA 3IGFA 3JWPA 3GJ8A 1X8LA 2VS0A 1AE1A 1LJLA 3D5EA 1V3QE 1VGRA 4GPD1 4PLTA 5AXDA 5A02A 4JJ7A 5FAKA 1U3LA 2DP4E 2J0QA 1G5RA 5AUNB 4OUDA 2MSCB 1U40A 2P6MA 3MA0A 2VNSA 1ELOA 1QG0A 4E3WA 2ECFA 3CVJA 4QOEA 1VSUA 4L78A 3SIRA 3SYAA 3IDZA 3S29A 1R2QA 4LDPA 1X59A 4QQFA 3X1MA 2X8AA 4EQZA 4X71A 3P4YA 1B6RA 3D5QA 1SG0A 1JCHA 1K27A 1YVDA 2NOAA 2R9VA 2WPNA 4N39A 3WFIA 4I66A 3TW0A 2BMEA 4F4UA 3LDUA 1BX3A 1KAMA 1TA4A 3AB8A 3DFUA 4JVNA 1BC5A 3HDVA 5EIAA 5LQAA 2QBYA 1Y1PA 4Q7JB 4LF7O 2V0NA 4BAUA 1RFYA 3H2YA 1XL6A 1Y6JA 4IDNA 3MVEA 2YQZA 3BVOA 3WGYA 3EPJA 1H2LA 3TX2A 3E05A 1VL1A 4OB6A 1G5PA 4DXAA 3FE2A 1ILEA 2C2OA 4RKEA 3A11A 4YUZA 2FSIA 4NKGB 1ZOOA 3S6JA 1YS1X 1TQ2A 1F9EA 4LXIA 4IFTA 2A5FA 3EG9A 4AP6A 1C0IA 4TT3A 5D86A 1TLTA 2NADA 2JFOA 1UBOS 1P3DA 1AIPA 3FYSA 2OK8A 1FF9A 2ZIVB 1HE4A 5GM1A 3JALA 3I3FA 1NX6A 3OHSX 3R6LA 4O8CA 2JH9A 3I1YA 4JZYA 3OLZA 2O20A 2CXUA 1AV6A 1NQUA 4URXR 2F9MA 1K2WA 1PGQA 1JLMA 3E3NA 2J4DA 2ZVZA 2G9RA 2JI9A 1NVPD 3FPGA 1HEIA 1PG2A 4OUDB 3NBYC 4QPDA 3HB7A 2WB2A 2L6LA 1F51E 1K6XA 3TI9A 2WD7A 4DTIA 1IY9A 2OT3B 1G20E 1PS8A 3UQ8A 1KBHA 3BXEA 3I2KA 3Q2KA 3ANXA 1BQ0A 3E82A 4GC9A 3LGAA 1P1BA 3LDDA 5D3KA 3RHZA 2N46A 3BG5A 3PE3A 5EC8A 1XEXA 4IVNA 2VKQA 4E7PA 3NDPA 1VOTA 4WKPA 1GRNA 2O5RA 5I9TA 2W2OA 5HJ7A 4CTKA 5GIPE 3G4SV 4TT8A 2DG2A 1NT4A 4H4CA 1HSZA 1AKYA 5CH3A 3E8FA 4JIGA 3USES 2XD9A 3N74A 5LLSA 4RLFA 1J8FA 2CKDA 3FPCA 4O4IF 2BEWB 3QJGA 4DQDA 2C3MA 2ZQ5A 1AZWA 5B2ZA 4JSRA 5BR8B 4AZ0A 1XMIA 2AR0A 4GMHA 5F33A 5JRDS 4A0GA 3ZIUA 1ISSA 1TF2A 2UYGA 3EQ2A 9MHTA 1T3SA 3GNSA 3H75A 4ZMBA 1RE1A 3A37A 2UYNA 2J7PD 2UU9O 3UF0A 3DXRB 1BSMA 2PWAA 4Y8VA 3FKQA 2PX8A 5IYZB 2F48A 3BB3A 1ICEA 3L7AA 3ONFA 4UREA 1MJGA 3ZPXA 5B12A 1UZLA 1E1RA 1KBQA 4D8WA 4Q21A 3B1KA 3I30X 3DE5X 4B48A 4FFDA 1FBNA 4Q3EA 2A3RA 1SZXA 1SO8A 3FPSA 5AXAA 5LUBA 2W6JA 2A2ZA 3IAHA 3EDQA 3H1KH 4Q4CA 1JR3D 3AR4A 3ZCCA 1C8BA 1L5RA 4ISCA 3VZQA 2LZ0A 2KB1A 1Z36A 2DUMA 4FFLA 3ROQA 4B6JA 4D96A 1R0ZA 2BSXA 3HYSA 2WU1A 5DI9A 1FJGO 3IE0A 5E3JA 4ZRNA 5GOZA 2EX4A 4DZZA 5M04A 4LF9B 3FROA 3V6MA 4KXLA 1WXHA 1PWZA 2NXJA 3GUHA 3KXLA 5TMEA 3K1AA 3QXXA 2OCCB 2Y1CA 4P9NA 2A5DA 1YFZA 2O2SA 3MXOA 4RFSB 3NIFB 4TXNA 4Q7LA 5MN4A 1QH8A 1VRCA 2IX3A 1Q0HA 4GMDA 4I7EA 4XEHA 3LGXA 4EYGA 1IY0A 1H22A 4OMFG 2PJZA 3C8ZA 3GJ3A 3RYCB 1RM1B 1GAXA 3DO6A 7MHTA 3N7TA 3AZPA 5FCDA 1XDBA 3ZZ0A 2QLLA 1QLHA 3I5XA 3BMCA 1Q86H 5JS2A 4TN5A 1UC4B 2N74A 1ZJ6A 5K8VA 2CDYA 4DA0A 1GCAA 3UCSC 1FFCA 1QR8A 2IHYA 3AXTA 3P26A 1R4ZA 2EG9A 3JVHA 1IG3A 2TS1A 3CWQA 4ECEA 2YHAA 4KEAA 5K4AA 1FFWA 2CB9A 1XEWX 2HBYA 3VI4B 1GPDG 3ZUPA 2JVKA 4CIDA 3GUCA 2RDMA 2YOGA 5AKLA 1HE8B 1USGA 2Q67A 3SC4A 2AHYA 1KY5A 2XJ4A 1RMYA 2LTAA 4IYRA 4PZPA 3TVTA 3VYSB 1VQKV 4UCXA 1UH5A 1UPXA 3MNFA 5EPEA 1IL0A 1S9HA 3OBIA 3WX0A 1OIXA 3LDFA 4LTMA 5FBWB 4G4GA 1FRZA 5LWHA 1PE0A 1VJGA 2F8LA 4LGCA 1CYEA 2DHRA 1YTUA 3IAFA 4ONEA 3NDRA 5BQFA 2QD1A 3ADOA 1PUXA 3HU1A 4XDGA 4YFYA 1KNKA 2R1TB 4KLAA 2FPUA 4PLFA 1H0HA 2VSOA 4BYMA 4KFCA 5CG1A 1NONA 4M87A 3FFQA 1XZLA 3LQ1A 3AX6A 3SBDA 1OFUA 4JI8O 1ORQC 1JAYA 4AXBA 4I0XA 1NI4B 2NO7A 4R69A 4UKDA 4XB6B 2OENG 4ZP1A 4NAVA 3KTOA 2RGRA 4BBJA 3F67A 2WLKA 1U90A 4MKGA 4AQ7A 4G0WA 1E3JA 4JIMA 3LWDA 1JHOA 2HLDA 2GASA 5ILQA 4FSDA 1ACLA 3AK3A 2MSKA 4D0NA 1RCTE 2NVOA 1PVVA 4JOBA 2R97A 3ICCA 4QGFA 4PTLA 2IF2A 4ZZ2A 1XZBA 2QLFA 1ODKA 3BIFA 4BNLA 5CXUA 2J4FA 5A4JA 3SXPA 3IQWA 2HEIA 1YOBA 5CM2Z 1UBFA 2A9OA 4EHLA 5G4UC 1MDFA 1JA9A 4HXYA 2XXBA 3U2QA 3N8NA 1TEXA 2NN4A 2E4ZA 1D2CA 2IZ7A 2VDLB 4B5LA 1E1RD 1IBLB 3NB0A 2P4HX 4HNRA 4L22A 3F3KA 3HGTA 5BW4A 1ESDA 2JDIA 2KYRA 1QTNA 5FPYA 2GCOB 4MWSA 4HDOB 4RVCA 4MVRA 1VQ9F 2Q2OA 2QN3A 2I1WA 1HSOA 1M6WA 3G71V 1Q2UA 2XAUA 3OIGA 3O7WA 3TTSA 3WSVA 1U9IC 3G0DA 3DZDA 2V98A 3Q98A 2JFFA 4LXTA 5HTKA 2QAGA 3HGQA 2ZRMA 1V7PC 4PC6A 2B99A 1OGYA 2GD0A 1XJCA 3G6KA 1J7KA 2CW5A 3RAGA 4DMLA 1W94A 1EJ0A 1YRLA 1WBJB 4O4LA 1N5OX 3LXXA 4XQEA 1W29A 3VR6H 2FK8A 3CKLA 2AEMA 3Q87B 4MB6A 3K9LA 2D5IA 5CT6A 5IN4A 5HZKA 1P4GA 4RM2A 3RHSA 1R5BA 3ZXUB 5L3GA 1TAGA 2X42A 3W4KA 5G1OA 5KSWB 4LZNA 3W6ZA 5HJ5A 5CM9C 4N0QA 1NMUB 3WGKA 1OXXK 3OCCA 3BHNA 3K14A 1SMKA 4HO1X 4K03A 4Y2JA 4ZYYA 4C30A 1IM2A 2C9MA 4L8JA 1Z5GA 4KQ1A 4XB2A 4O59O 3KLNA 2OCIA 6NULA 2AUNA 4LVOA 1OE0A 1Q17A 3OIYA 2R4TA 4IBOA 4CC6A 4E4YA 3TQHA 3F5WC 1TIPA 3ELYA 4LYEA 5EUQB 1GPYA 4EHNA 1UK8A 5H81A 3ELDA 5B1BB 2QSYA 3PC4A 2M1ZA 4O0MA 2GLUA 2Z9BA 3L8DA 1EK6A 4KTVE 4HVCA 5HZGA 3VRHA 1D0VA 3ZN2A 5LOVB 5BMVA 1V39A 4A0FA 3OECA 4D7TA 2P3OA 2IS1A 3WI7A 4Z7JA 1WCIB 1ZJZA 1W0KD 3GWGA 1DELA 2EL9A 2ORVA 1HC7A 5FL7G 3FTCA 3GI1A 2AZDA 2EFGA 2GA8A 1SFRA 2JD0A 2O06A 3CW8X 3GGJA 3GRCA 4GOKA 2XMSA 3ETEA 2DETA 5HP4A 5HWEA 3PQDA 1G4HA 2G7MC 1F2UA 3DMRA 1VQ5F 2WPDD 3W2HA 4LJ6A 3M1YA 3TJZA 1PI3A 1ZKDA 2TECE 5HG0A 5TQ2B 3FOCA 1P4RA 3THRA 2O48X 3L7MA 5IW8A 4BLUA 4KN5A 4U2KA 4E2XA 1Z47A 4QRIA 3QLVA 4RGVA 3T80A 1DC6A 4BW0B 1PWHA 1QPBA 2ZJ7A 3LY7A 4G07A 3H17A 3TKAA 3CX4A 2JFBA 3BPZA 1W88B 3DLIA 3P4UA 4I6GA 4JYPA 2BFDA 4X3OA 5GJCA 1XFDA 5EGSA 2VWKA 1YBHA 2QXYA 2YMMA 1G8AA 4R8CA 1UBHS 2ZUCA 4HDRB 5EBWC 3PUVA 1CWUA 4N5HX 4HMPA 4OYHA 3JVEA 2CCJA 2BKVA 3IKVA 3U26A 3LI2A 4U39A 1OJLA 2ZJ0A 3DLAA 5GQSA 2WLNA 3AG4B 4MVYA 4UNSA 1E8DA 1M1XB 2JNWA 4E2LA 1B43A 1M67A 1WA8B 1RTKA 1YB7A 1KFCB 1DPGA 5CBPB 1MTOA 2OD7A 4B46A 4H4DA 4DSTA 2AX4A 2QUBA 1IWPB 2WF5A 3W5VA 5EUCA 2C7QA 2YZMA 5JY6A 5AKGA 1PJQA 2YIBD 3CH4B 4FHCA 1L5HA 1PK8A 4Z1MD 5KOJB 4U3JA 5HILA 4Y9RA 1DX6A 4XH9B 1OI2A 5EPUA 3RFUA 3TLMA 2C0QA 3QKIA 1KU9A 4TM7A 1RCFA 3IBTA 3K35A 1NVTA 2ZR0A 1B0ZA 3RRMA 5JTUA 2FN4A 4BO4A 4U6NA 3GUZA 3P7MA 3TOCA 1HE1C 4ZKIA 5HWSA 5LJLA 1Q7RA 3BQ9A 5LB2A 3LK7A 3BD8A 5EK0A 4PDMA 1CUVA 1DGSA 1O2DA 1TFRA 2GCGA 3ASUA 4IIFA 4G2KA 2EBHX 2NZWA 4RW0A 3RS8A 3AVYA 5IZ4A 1RLTA 1EGAA 2XD4A 5FNZA 3T7JA 2GPSA 4LIPD 2LPMA 3WA6A 4F46A 1QR9A 5JRZA 1A8PA 2VATA 4UEQA 3ZMSA 1L5FA 1GG8A 2UVDA 2JRIA 2R6ZA 5EGNA 5HFMA 5EZYF 3G4SF 4HB0A 3KQSA 3E3LA 4M36A 3W5JA 1S8OA 2ZKLA 1Y8CA 3MLAA 5CHEA 5EJEA 5EFZA 2I9KA 4EZEA 5E2IA 5B55A 1GDTA 1OX4A 5A4FS 1DLBA 5H7XA 2Q49A 2H1HA 1BRTA 3EZFA 1U81A 2ZITA 4ZZIA 2LUOA 3CEMA 2XIJA 3CJTA 2ZYHA 2ZUEA 4JKOA 2EJWA 2G1KA 3DMGA 3OIDA 2QX8A 5BSHA 2ZYUX 4OBEA 1JSLA 1PYDA 1ZG3A 2ACKA 4QHSA 4AYXA 3FUWA 1Q0LA 4G26A 3V7YA 3P0FA 1YDEA 1EM8A 3RU2A 3KEQA 1IXMA 1KMCA 2HA6A 4N7RA 4CM9A 3FCEA 4E13A 5KTMA 1SU4A 4L5AA 1A72A 1L0LH 1P1CA 2RIRA 5CVUA 3T41A 1M7BA 2Z56A 4C76A 5CB4F 1JH9A 1IDN1 1ZOPA 1IDOA 3B09A 2QWPB 2HL6A 5AP9A 2M6KA 1GPUA 1TTPB 4RF5A 3RG8A 5BVHB 4R3NA 1IN5A 2DBRA 2NXCA 5GONA 1OFGA 5F2EA 3RR2A 1HTWA 1SOWA 1NRWA 4U2FA 3SE0A 1SZCA 4WFFA 4B09A 2QG6A 1ABBA 1VHLA 4IDPA 1RJ9A 4N3AA 3R7LA 2C7GA 2RC5A 3H9QA 1Y34E 3IDQA 3KWLA 3ELBA 1FNJA 2OCYC 1VF7A 3CLTD 3EDYA 4JEHA 4R01A 4K1LA 1IULA 4L6IA 5B30A 3GUVA 5EE0A 3PTLA 2RKBA 1P29A 5BPHA 1DKLA 4J29A 3X2SA 2NWQA 4RF2A 3E4CA 4LRYA 2GARA 3UUWA 3TGUH 1EG2A 1FQJA 4Y1GA 3BBPA 3ZU5A 5EYPA 1V8BA 2YL2A 5TGTA 4BX8A 1ZW6A 1S3JA 2Q3BA 2CV1A 4G8DA 4HI0E 4CN9A 1TDJA 2YXDA 2OXEA 4RZXA 4JT4A 3WJ2A 4NPCA 1O89A 2ZIAA 4GCZA 3HU5A 3LC7O 3A0HZ 1A7UA 3CCVF 2CK3A 4MVJP 4V38A 2V55B 2QAJA 4CQJA 4EHFA 3R3HA 1YB2A 1ZR2A 2ZFUA 3KBOA 3LP6A 2YSUB 1YJAA 2YIBA 4MVOA 2CMFA 5DTIA 5CD1A 4ND2A 3ZEDA 1N6OA 5SV2A 1JLLB 1PVDA 4PYJA 3S1AA 1Q50A 4R1SA 1YAJA 2CKMA 2AHZA 3DSRA 5IF3A 4UVGA 2CUZA 2AGVA 3N2KA 3L41A 3LBFA 4KXWA 5GJWC 3R3UA 1GNLA 5CH8A 2B3DA 2VJQA 2YRXA 1ZCZA 3S8MA 4HG2A 4MR9B 4PLPA 2SKDA 1G21B 4RLQA 5CP8A 2WD9A 1GZUA 1I2MA 3MYRA 1KYWA 1YVEI 2PXXA 4BO2A 2PUHA 3NKLA 4QYWA 3PC6A 5EZYB 4B9EA 2IQ5A 3L6CA 3V9AA 4DJFC 3WRYC 1SESA 1KNQA 4R1LA 1MN6A 1OBHA 2HFKA 2QRJA 3FX2A 5REQA 4MHTA 1GAQA 2A8YA 3H6KA 3FYTA 5LBIA 3QSGA 4HV4A 1JIIA 1NA5A 4UD6A 4JTAB 2AB0A 1JQ5A 2D5LA 2ERYA 3D3WA 3PNVA 5TARA 4BMNA 3DOOA 3Q3HA 1LEHA 1I6WA 4E88A 4WFKA 4DV0B 2DECA 2UUOA 3IE2A 4OBWA 5CW1A 4PHTA 5L8VA 4ZOLA 2AVDA 2GTPA 3PNYA 4D82A 1DDOA 4FD2A 1SZJG 4KI0A 1XVLA 4N0DA 4PINA 1V41E 5ETJA 1DTSA 5K6TA 4BWFB 4DWJA 2O3UA 4JOCA 4UBMA 4YPFA 3DL4A 4G8JA 4MX8A 2NZJA 3EGDA 1B0AA 1XZQA 1IHOA 3BQMB 1DQPA 4NDAA 1J6UA 1G55A 3ABLB 1PJ8A 1Y5MA 4FE3A 4HWOA 4TS4A 3CZAA 2TMGA 1T8PA 3GU3A 1CIVA 2JA2A 3SSNA 4DR3O 2JBHA 3FSGD 5BT8A 2BM1A 4GT1A 2P7TC 1ORHA 1VCIA 4Q6WA 4TZKA 2MR6A 1OASA 1SCQA 5H82A 4YIHA 1Z35A 4RUFA 1FKAO 3TBKA 4XUCA 3I4LA 5A6SA 1HMYA 4IXDA 3C7CB 3M5DA 4UE2A 2EXXA 1TA9A 4IDOA 2HJVA 5U4QA 3RS4A 1T6YA 5DIFA 3RGGA 5JNWA 1Q7EA 1TT5A 2HIHA 4XWKA 4QREA 3HS3A 3PC8A 4OHFA 4DILA 5C4GB 5DM1A 4XYLA 3RA6A 2I67A 1UWCA 1DIOB 3LVBA 3CG6A 1ARZA 1N0NA 3VBBA 4A10A 3SLKA 5K3OA 2HYIC 5G4KB 3D3WB 3CCQV 4HUJA 3QI7A 3VR6A 4TVSA 2LGJA 1Q1QA 2VJDA 4ZK7A 2PS0A 4LC9A 1KJ8A 5DBOA 2WNSA 4QASA 1UIMA 1OILA 4BGIA 1XOIA 1RWBA 3FYEB 3NTXA 1LV8A 1LGYA 4BN4A 2BC9A 3IIJA 1Z2PX 2C95A 2QDOA 1Z22A 1FNKA 2OBBA 2XQVA 3FDIA 2QD4A 1X6VA 2CBGA 1Z4OA 2WE8A 3WS7A 2DYSC 2HP0B 3Q4GA 1PYGA 3R6WA 3TQQA 1T0HB 4I9UA 1A1SA 1Z37A 4EECA 4QXQA 4M3NA 5ALOA 5F2VO 2KTUA 2FFHA 3K31A 3MILA 3SF8A 2MU1A 4FMDF 2I29A 4TV8B 5AI9A 3F5TA 3NXKA 2ZSIA 4D9EA 3IAEA 3BMOA 4JENA 3M6WA 4KWIA 4P4SA 5KWIA 3DFMA 1TE2A 3DYVA 3KSRA 4N0MA 4ZAYA 3TLJA 3PHGA 1JQBA 3KPVA 2G83A 2KBFA 4Q4AB 2AW9A 3GLRA 2O8FB 2CN1A 1YJXA 4X3CA 3H5LA 1NV8A 2I4OA 3D6VA 4P34A 2ZRFA 1Z39A 4NECA 2GHYA 3ZCXA 1L2TA 2O4CA 3AM5A 1E79G 3A1UA 4IIJA 1YS2X 5T64A 5DGCA 5I47A 2A0KA 4ARCA 2GRUA 2SICE 3MWKA 3TZ6A 3RAEC 5HRCA 4JGSA 3S2IA 1BWRA 4H1HA 4TWAA 1GN9A 3E61A 4QPJA 1ZH0A 2H54A 3EC1A 4QOIA 4REMA 4CDNA 4F1WA 4WKBA 2Z30A 5KCMA 2IYVA 4YQFA 2JJ8A 5FTLA 3C3EA 3K96A 4B3MB 1JW9B 1AKRA 4TVOA 3S0WA 4K81B 3QUSA 1RRVA 1UFIA 3K2EA 2CDNA 1JXMA 3K8YA 3MS2A 4D3YA 3U7EB 1YZFA 1T2EA 1XROA 3ZLTA 2BSKB 3U1BA 5B4TA 2VP3A 5AW5A 1ZAYA 3ZHSA 4OAQA 1DIBA 4NFHA 1T36A 2FXVA 1D7AA 1NBME 1ZL2A 2FSVA 3FUCA 1NXVA 3OX3A 1E2MA 2ODTX 4NONA 1I4TD 4RZQA 1T25A 3W06A 3VVMA 3ZD8A 3NC0C 1V5WA 4CLRA 1IQUA 2P2LA 3D4PA 3CISA 4PZ0A 1M2VA 1H2AS 4CLOB 3VDNB 4GHWA 3F96A 3SEFA 3DD1A 4BV3A 1THZA 1SVSA 5IY5C 4LFBB 3DV2A 2X0FA 1JQEA 4PANA 4BVQA 3OIFA 4G85A 5C1OA 3DDSA 2QU7A 3KKMA 2P68A 2QEQA 1T0PA 4M9SA 3UKDA 2PRIA 4D1YA 5B66Z 1JJIA 3LC2O 4UE3S 1QHGA 3IXMA 2O8BB 4BV2A 2BTQA 1CTQA 1DBQA 2CMKA 3IR9A 1SRRA 2VPPA 3IMKA 2JIMA 1NBWB 4G23A 5FB3A 1UDBA 5A3QA 1Y9JA 4F60A 5BN5A 5ALVA 1GM7A 4F45A 1Z5WA 2CY0A 3EGXA 2A0YA 3NC4A 1J00A 2UUBO 3ONWA 1RM0A 3JQ9A 1CS4C 4GICA 3W7SA 3HN7A 1OJ7A 1PK7A 2ANBA 4KVAA 4MYCA 2BFWA 3UJCA 3BUSA 2NO4A 2CVQA 1QYVA 2WALA 2W2KA 2WSYB 3A3YA 2Q5OA 1W5EA 2X4DA 1O77A 3DCIA 4RVFA 5EUBA 2IXDA 3I9FA 2VHWA 1U0HC 5HDQA 4P5EA 1QP7A 1T3ZA 3FFAA 1P7CA 3C43A 2QG9A 3LHKA 5YASA 3F8WA 5CGQB 3OLXA 3GJQA 3TFWA 1I7QB 1EFPA 3G8AA 5DCLA 2EKZA 4GLBA 4QEKA 2BN4A 2EC5A 1WPGA 2PKXA 3KQLA 2PZBA 2YXEA 4NU8X 1Z07A 4F5ZA 1V3TA 1SZPA 2DWDC 1GA4A 4BGVA 4BEBA 1B26A 1WW3A 3E7FA 3O4IA 5FI3A 2UXCO 2AD5A 2HCRA 5G2OA 4X8OA 3RUEA 5CAEA 2ZODA 3ZUGA 3HLYA 4FEAA 4GDMA 3ILXA 4LYDA 3C24A 1POWA 3REFA 621PA 4O3MA 3UH1A 3RC7A 1Y9ZA 1BNCA 1FFXB 4DV2B 3ZGYA 2M2IA 4U3JB 3DEKA 3ZK7A 4HYQA 2CXSA 1AB6A 5DRTA 2FDCA 1ORIA 3FMVA 3PEEA 3WKAA 2G1PA 1CP2A 1RADA 3KU4A 4MI9A 3K9NA 1W2BF 3IPRA 4UHDA 2GBCA 3SYLA 1K7YA 421PA 4MUMA 2QJ1A 4FZVA 1G64A 4JP3A 2AMJA 2Z2KA 3WYNA 3PEWA 1ATZA 1XTPA 1RPZA 1Q1BA 4F2GA 3ZV3A 5JOQA 1OLSA 2HBZA 1NW5A 4E1VA 5IT5A 1W2GA 3U7RA 4ENSA 3URMA 1XI1A 4ZQGA 1QVWA 1UQTA 4MTLA 4PQGA 3H1BA 3LIPA 2EJVA 4WASA 4V39A 1TW3A 1FNDA 3IMCA 1W30A 3F3YA 4H7KA 5IH3A 4O3FA 3UA3A 1DLJA 2R96A 4TYWA 2M6SA 4JJIA 5EXPA 2PA3A 3CX6A 3IUMA 3NHJA 2OLJA 4KR0A 3GXBA 1U7HA 2XYPA 2PPLA 1OROA 4P53A 3S2SA 4B0OA 3T1HB 1CDDA 2Q6TA 3FOBA 3BH0A 1TQ8A 3G9QA 3FTDA 1EFDN 2V7VA 4BE4A 1VPLA 3FNGA 1BVHA 1PZEA 3LPAA 4IXMA 2RCYA 3OP1A 4JJ6A 1W5FA 1N2OA 1MF7A 2HX0A 1FS0G 2EFJA 2WUGA 5IT9M 4JL5A 3L1KA 2UYOA 3USZA 3OD4A 3HAXD 4MSUA 1I32A 2FGYA 2PX5A 5DNEA 5JDIC 1PJLA 3EOZA 3GD7A 3MTJA 5DX1A 1IBLO 5TQ0B 1VP7A 3WKDA 5HDBB 5KNCA 1BU8A 1FB5A 1I6KA 1K97A 1XZGA 3NTUA 2QI2A 4MS4B 4TTQA 4KQ6A 1N8TA 4RPJA 4C4AA 3I8SA 4OGFA 2R6JA 2I7TA 5FBZA 2QZ4A 3C3BA 5M7EA 3LF2A 3K0CC 1KFBB 1SVWA 3K9QO 2FSPA 3B3AA 5H9VA 3WNVA 1QU2A 4PVDA 2Q1WA 4W6QA 3U4QA 1TVEA 2BZ0A 2LKDA 3KOOA 3PVSA 4BNZA 4JEIA 5H1YA 4BJ1A 2PFGA 2ODBA 4IIDA 2LP7A 1GN6A 1HZJA 2HJSA 2XNCA 3VPFA 4QPKA 1FVFA 5KHJA 4NDNE 5CYOA 4D0RA 4WFAV 2Z1DA 3B13B 4RTSA 3WZLA 2Q5IA 1OT5A 3UPTA 5LHHA 2YX1A 2PYZA 3C0KA 4OHYA 2RBGA 1DG3A 4HS9A 3CIOA 2GM5A 3AIIA 3PFBA 2F4NA 4IGKA 8ATCA 3DGFC 5H8WA 2NNLD 2HS0A 4LY9A 3WQHA 1GDDA 1NVWQ 3ETLA 1NX9A 1Z45A 1RI2A 2IYUA 5AM1A 2YYYA 1M6VA 3LBIA 5ITSA 3A2LA 1LKZA 1F2TB 1R27A 4J41A 4TRRA 1E5QA 4OQNA 3RNLA 5FH9A 4V02A 2WUFA 2YWRA 5BSEA 1HDYA 1UKAA 3J7TA 3LT2A 4P32A 4WKCA 4ZU6X 3KCXA 3A27A 4EITA 3TVDA 3D31A 1WX1A 3PXUA 1MPXA 1NV9A 1V95A 2XCQA 3JW8A 4MQ5A 3R8XA 1L0NH 1QQ6A 2XDWA 3LYUA 4H6XA 4ZXFA 2IK8A 1RWOA 2VNIA 2ZIUB 3W6PA 2WT9A 4ARZA 3K4HA 3DP7A 1J49A 1Z68A 3K72B 3NHWA 3MGAA 3PT5A 4BMDA 4C4XA 1M10A 1JJAA 4RKRA 2DTEA 2AG8A 2B7CA 4HBZA 2OA0A 1CRZA 4Z1OA 5KAIZ 3NV9A 4GI3A 2R9AA 1N8SA 2HCBA 3RTAA 3KOYA 3DMNA 3I1JA 1U7OA 3TNYA 5EJ5A 3UK6A 2JLVA 4EJSC 2Q0XA 5JZVA 4EFBA 1OTXA 1XZJA 3HQ4O 3K09C 5G41A 4YS6A 3RD5A 1QQ7A 4R0NA 3WWOA 4DBLC 5DULA 3AR2A 2ZZKA 4DLAA 4MYRA 2DQ0A 5A04A 3J80A 3CCJF 3U7QA 1ESMA 3ICXA 2ZXEA 2QR3A 4H7IA 4UB6Z 1A4UA 1NQ5A 1UBNA 5E8RA 4FP9A 5FA6A 2VJCA 3T34A 5JS8A 5LIPA 2RGAA 1XHFA 5A5VA 2OXFA 1OAOA 2L18A 4GOXA 2GBIA 3EARA 3OEED 3ZLUA 1E9AA 3O3MB 4OK6A 1XX6A 4CKYA 4D42A 5E4FA 2PX0A 3AV0B 1JMKC 3L4BA 2VG8A 2AUMA 1RLOA 1RLUA 2O0LA 2O8CA 1DKUA 5AHOA 2C7RA 3OE4A 4JODA 1RJGA 1UMBA 2IODA 1KSGA 3E7XA 1VKOA 5LYJF 5JAUA 3E3OA 2IY8A 1E69A 3TSOA 4K3UA 4JR1A 4JF3A 5EFOA 3FB1A 1B73A 4WOJA 4MPJA 3L2OB 1VF6C 4ODIA 1IURA 3BXPA 2Q9UA 3IXLA 3IUEA 4M4SA 2WWHA 4N8DA 3SYRA 5TS2A 4D92A 5F7OA 4HDKB 4BVEA 5K20A 1D6MA 2WILA 4OA8A 4RGYA 2HK9A 2C61A 4KJZA 3ZJZA 3L05A 4XR9A 4G4XA 2C1XA 3AG3C 5ALEA 1IIRA 4DR3B 1TADA 4FZ5A 1I5RA 5J5AA 5HR5A 1SXJB 3I5YA 2HJWA 4PYLA 1BHSA 3RU3A 3U56A 2EG5A 2QN6A 4LPSA 4Y6GB 4A1FA 1NVFA 2NU6B 3UWPA 4GQBA 4YAGA 1GQSA 2YKGA 1PFGA 4R9NA 3C16C 1O4WA 1JBEA 1MW9X 1NVXQ 2Y2UA 3QEJA 4J0CA 4KPUB 3V3KA 1IJFA 1LBIA 1MX3A 1SKAA 2QSUA 3HDJA 3NX4A 3P9ZA 4IEIA 4ZAFA 5KDLA 4KFMA 2WIDA 2I6QA 4C0AC 3CH7A 2ZUDA 4QVKA 1U3TA 3JYNA 4WNIA 5IJ9B 2J0VA 3KKYA 3O4RA 2WTNA 3CMMA 4PPYA 2BCEA 3G88A 3MYYA 4PPQA 5ECDA 5FAXA 4JI2O 2HHCA 2F62A 1H66A 4IVRA 4M22A 4M1SA 3ZVLA 2MTBA 5EJ2A 1X8KA 1ZMRA 1A32A 1YL5A 5AKHA 3COVA 3O0TA 1YXBA 1GOTA 4B5CA 1UM9A 3P45A 1R4AA 3L82B 3OUTA 4Q05A 1GT91 1MB4A 2A7XA 2ACWA 3B53X 1M73E 3DHNA 1EWKA 2C4UA 2ES4A 3HWRA 4AJ9A 1PYOA 4OFBA 4YQZA 2NUTA 2ZWOA 4DTCA 5E6SB 3WFJA 1MG1A 3LKBA 4I8DA 1TZ2A 4K6KA 2AOXA 1ZD9A 4DDVA 2VF2A 4UTNA 4LMPA 4WT7A 1SIBE 2H1WA 4MCIA 5KJ1A 4AULA 3VKHA 1FU8A 4O33A 3O6VA 4FZ0A 4W9NC 3HUDA 3I2IA 3M1AA 2O3QA 3LPNA 3QVLA 2VAVA 1T1SA 4FK8A 2C84A 2F3PA 2VLBA 1B00A 2X9VA 4I5EA 2AXQA 1A71A 1JP7A 1I6MA 3IGAC 3QMWA 1IFXA 4F5DA 2F4VO 2A92A 4XBFA 2A0XA 3FXAA 2ZRKA 1YITF 2CYBA 5FTWA 4PRLA 4JXXA 3O9OA 3PNLA 4PBSA 1SIUA 2AFHB 1I2CA 3UMSA 5JATA 4C8EA 1W4BA 1XLTC 3PXCX 4L0DA 1ZNQO 5AI0A 3RQSA 4UHJA 3EX7C 2BSQA 1SKBA 2NXWA 5EN4A 4JBLA 3BTUA 2BEWA 2XJ9A 1PBNA 5EJFA 4UNRA 1XZAA 4E08A 4F97A 1JHUA 3WBFA 4LBZA 4QGHA 2ZSBA 4UFNA 4IRMA 4BC1A 3SHTA 5KNBH 2Q50A 3CR7A 4MW8A 3C3AA 4RA9A 4I2VA 3U9TA 4CKEA 4QO7A 2E6KA 3WQSB 4FYHA 1LSSA 4K26A 3T54A 4FLTA 2G07A 3ZBPA 2H4YA 2DQ4A 4AMVA 4S05A 4DR7B 2P5TB 4I55B 2F67A 4KAAA 2IBZH 4MP3A 1G8MA 5JC1A 1UEJA 2EIHA 1O96A 3FZYA 2WD7B 4HATA 1HFEL 4HSEA 2Y67A 5AW6A 2KG4A 5C5EA 2BP7B 3GBVA 1AR4A 2Q9LA 1RHJA 3QXJA 4TTIA 4TWBA 1O0SA 2FZCA 2XQKA 3WQQA 4COOA 4QKQA 1CRPA 1YTFD 3NJRA 3AG5A 5L45A 5ADWA 2C3UA 5CB6A 4OREX 3L73H 4DR4B 3ASZA 3S7TA 1TUEA 2HN9A 2QRNA 4I50A 1XSEA 3QNMA 1BCCH 4BFSA 4UPDA 1W4CA 1ZK2A 1R0KA 2XODA 4JUDX 2VDVE 4N5IX 2WYUA 3COZA 4CM1A 3U3JA 1QIDA 2CK3G 2ZIXB 3ZGXA 4LZOA 3I3OA 1XELA 1FVHA 2ZOVA 1U0SY 1SCUB 4ACBA 4JC5A 1TEZA 4MEAA 3ZWCA 1JE1A 3AUFA 3EFEA 1PTJC 1KOJA 3H19A 4J16A 1QK5A 1BL8A 3WLPA 4YRIA 1MEOA 4OJNA 5C32A 3PWTA 4ENUA 4HQNA 3WMWA 5IBRA 5KJCA 3EXIA 4GKVA 3G2NA 3R4CA 2Q6OA 4OXSA 5FPHA 5K6AC 4YO7A 2BFBB 2XGMA 4G5FA 1VQ6V 2P3LA 1CUXA 3AW8A 9GPBA 3KPUA 4I81A 1R8SA 1U5CA 1BO6A 2H1SA 4JC4A 4N5NA 3HB9A 1F48A 2RI1A 4IEEA 1L7RA 3F3SA 1K5PA 1U0GA 4BEVA 1C14A 1WB4A 2HPHA 2HADA 2PA0A 3ZRSA 1FRQA 3AHIA 3DVAB 3L7NA 3NT2A 3PDJA 4TSRA 1AQJA 4BO1A 4PX3A 2WWFA 1QCEA 3QYFA 1QIEA 2WBLC 1PT5A 3H65A 2FPIB 2JFYA 2KI5A 3ND8A 4DDWA 1PL7A 1VG0B 3NIWA 3RASA 4GXTA 4EFEA 3QO5A 4B3SO 3OTOB 2FXIA 2SCUA 3V8QA 2HW8A 3KSBC 4FWIB 1AI4A 1QJCA 3M7MX 2HCTA 4KGDA 3SBXA 2PMWB 2UVPA 4RWUA 1AN9A 3O74A 4UVBA 4CMHA 5FPRA 1HNXB 2ZPUA 2XCOA 5ALYA 4N5LA 1JXAA 2DQ3A 3BE6A 4M9QA 4BLTA 1Z25A 3FA2A 3MXTA 1K4MA 2FNAA 3K9AA 1YJNV 4FYIA 1E0DA 4I5DA 1GPKA 2OV2A 5E6RA 1DMSA 3R0IA 1GD1O 5IT9N 4V2IA 2VHCA 2OBLA 1FXHA 4Z8YA 4JLWA 2HRYA 4CFYA 4KQ2A 4YT4A 3LUFA 5T57A 5IYDO 2WAAA 2PZJA 1Z5ZA 1WXFA 4DR2O 2QW0X 1Q2XA 4QFMA 5JCXA 2CNLA 2B78A 2Q1UA 4O63O 1VSQA 2BGRA 1IXSB 4ES6A 2HB6A 3O4HA 4X7PA 3WL5A 4BP3A 4TKVA 4RHCA 1UOPA 3EEYA 2R4UA 3M70A 4L5BA 4EKYA 2Q1SA 1XCLA 1NVBA 4HDNB 4DSAA 5CD9A 4OHZA 3L04A 5CVCA 2V4MA 1R8XA 3G82C 3CF2A 1XNHA 1ZVMA 4RLHA 4IDBA 4WOBA 1T91A 4YI3A 3HFJA 3RAPR 2ZUBA 1IJBA 3D4NA 2WJVA 1N33O 4GUAA 4H9GA 3CPJB 3NHMA 2HI0A 1DAFA 2H3HA 4M1TA 2V8BA 2ZM6O 1TEVA 5THQA 4A73A 2JGLA 1FBTA 2Q68A 2GN2A 3K0AA 5MHTA 4Y0VA 4WN9A 3T1VA 4V3BA 2OG1A 1OCRC 4OI2A 3FD9A 4TWKA 4WUTA 2H1FA 2O2IA 2XCIA 3SN6A 1RR6A 3QI2A 5JNTA 4EGFA 4YPOA 4C5CA 2R7LA 4DLWA 4NYJQ 2REQB 1WUYA 1OFUX 1OYWA 1FTWA 3ZI7A 4P0TA 4DWOA 5IX8A 1U0BB 4RORA 1UKBA 3GVXA 1VLLA 5MGNA 5CR9A 4BQNA 2ZREA 4ENQA 1MIHA 1SQ0A 1Z4QA 3SDLA 2A5YB 2ZDHA 1QBKC 2DJIA 4M9ZA 3L70H 1ENOA 5E3HA 1M1KW 4GKBA 4OAPA 4IYJA 2RBEA 2V9PA 2ISSD 2Y0BA 3UA4A 4EP1A 3K1JA 2AD1A 2O2CA 1IXYA 2FPGB 3ZWBA 4ZDIA 1WV1A 4QGBA 2AYXA 1CVIA 1J8MF 1EK1A 3PHLA 4LI0A 4X62B 4R05A 1EH5A 1E6WA 2PDAA 5FWAA 2ZD9A 4M0KA 4B4UA 1DKMA 1FUYB 1J8YF 1WE2A 4L5YA 4QHTA 3OLWA 2MOKA 4TYPA 2D8MA 1D1QA 3LXMA 3QTBA 1TVCA 3MMSA 1V7QA 4LG1A 1ZRMA 4JK3A 3CEIA 1KI8A 3D4BA 5LZ4A 2QTWB 1VL0A 1I0ZA 4D41A 1M9NA 2KE5A 5I7EA 1JEYB 3B1JA 5FA5A 3HBNA 3WK8A 5FNVF 2R8XA 3G2JA 4TQDA 1YJBA 2XQIA 3QVXA 4YP9A 1P19A 1Q91A 1JSRA 3RT9A 3KAQA 3VR3D 1E4OA 2QQ5A 3CM0A 1UBKS 3PITA 1AG9A 3Q11A 4GOJA 4NENB 2GJ8A 4ZT4A 3HP7A 3E58A 2QVZX 5B2FA 1E2QA 5ERGB 3CE9A 5K99A 1QNFA 3W5AA 1TAQA 4KQJA 1AOXA 1F4LA 4JSYA 3SSAA 1A4RA 2J67A 1EA7A 1DB3A 4ZANA 2INGX 4H1TA 1U2ZA 3SC6A 4C4YA 5JHGB 5DM60 1UUFA 4CL8A 3OW2U 3D1LA 4S1NA 1JI0A 3Q0EA 4UUNA 2XAAA 5JS6A 1O95D 3HFRA 2WVHA 3NOOA 1GRVA 2EZPA 4TXHA 1F8FA 3C8MA 3MJTA 3SFVA 1KKDA 3P0IA 5C0OE 3OAAD 1KPIA 1CJMA 3F4BA 3IQZA 2BKLA 1V4VA 1MIOA 2F9FA 3KWMA 3GG2A 2PUWA 4FFBA 4DLUA 4UUAA 1V37A 3R3VA 1XQVA 1UPFA 2QJRA 4IL6Z 3JQ8B 3PLNA 4YGYA 4A8HA 1ZC3A 1A9SA 2QN7A 3BD9A 4OL9A 5LQMA 1I7PA 2I3AA 2WFLA 1ISJA 4OGQB 1E4YA 3FPLA 4KMMA 3SJAC 2FI1A 2Q73A 1CQWA 1RC8A 3WAKA 3G2KA 4TKUB 4E5VA 5CLJA 2QE7G 1KVUA 3KR0A 1HDXA 1Q7GA 3PWSA 5KQSA 5L9AA 1N5MA 2H1VA 4EB3A 1OR8A 3BD7A 1NP6A 4XLTA 2PFSA 4LOIA 3V55A 3ECSA 5HFNA 4HGRA 1PD3A 1UMBB 1RKVA 4PTYA 5IPFA 2E0IA 3WRYA 2WIKA 3DULA 1WO8A 1Z7YA 2ZROA 1KKMA 3K5PA 4JDUA 1KJIA 2NT4A 2VYNA 4YWJA 1KERA 3FPIA 1NJ8A 3QVOA 4O2LA 4C04A 3Q15C 4RIHA 4WESB 1LRJA 2VDWA 1ECJA 3M83A 3GLUA 3UMRA 4NB5A 3JSXA 2C8LA 3OLYA 4Y2HA 5EVJA 1ST2A 4DY6A 1EX1A 4AJ1A 1ZEMA 2CHGA 2L0XA 1PR5A 3LKVA 4F4LA 5CB4B 2H4XA 3D54D 3AY3A 4OB8A 4Z6KA 2OL4A 4JVSB 1ZGCA 2W8ZA 1JFTA 5A5GA 1IV1A 2Y6VA 3EJ6A 4WCFA 2XASA 1M7GA 4AY4A 4FKZA 4E5YA 3ELCA 3I2HA 2LIVA 2XTMA 3F5QA 1F6DA 3G8CA 2I54A 3OZBA 2QY9A 2HOQA 2VHJA 1W0JG 5EJAA 2QRQA 3NASA 1SRYA 4BAYA 2EX1A 2QN1A 3HSSA 1ZQ9A 4F7WA 2G28A 5DNVA 4DVGA 4JD5A 2HDOA 4NV0A 4UDNA 1KK3A 3IOEA 4FDAA 2IC5A 4PGFA 3AJRA 2B36A 4Q1VA 4RQBA 4D9BA 1HLGA 4DG8A 3H9UA 3GP8A 4V0RA 4OSEA 1XU9A 1ZM2A 3IAYA 2WHXA 1LV7A 2C83A 2NZVG 1S72F 2OHJA 1VE1A 1Y5RA 4O4LB 3HC7A 3NWJA 5T4HA 1U1CA 2BEUB 5CFLA 3EBPA 3KSMA 3LUGA 4NAHA 1XZNA 4QECA 3QUWA 4X63A 3VFDA 3ZIAD 4AQYB 5IUKC 4DN6A 3SYTA 4EFLA 5DWQA 1KU6A 3CN9A 4NK5A 4PA4A 2AOTB 3B7PA 4YXWA 3K2XA 1X2BA 1CW2B 2ZRCA 1YQ9A 2GD2A 3NV7A 1L8XA 3RLFA 3UCEA 1FQKA 1PZHA 5IFLA 3UGQA 4J4TA 2XNDD 4MV9A 2GF2A 3GJSA 2AN4A 4G27B 1BHJA 3KHUA 3LDTA 3IOMA 5JANA 4LJLA 3F4LA 2ZTVA 3CZ4A 1FTSA 3NHUA 1E6CA 4ZQBA 4P2BA 4IJWA 4HWPA 3HCOA 1NH2B 1I13A 2EEPA 3PRHA 4HR7A 2Z8ZA 1XXHB 1R0WA 2WKQA 4OM8A 3KJJA 1ZI9A 4GWGA 4LOJA 4MIEA 4DYHA 4F4FA 1ZIXA 2GV9A 4JDPA 2OHOA 3GWOA 1OWOA 1QK4A 4AXXA 1QHHA 2M98A 3ACBA 4ESVA 1CIPA 2VA8A 3UC9A 2RHGB 4LJYA 3UT6A 4UVDA 1NTRA 5JYCA 3WBKA 4DIBA 5KDDA 1XRPA 1RWNA 2PGGA 4JA0A 4CMJA 1XI2A 4Q4LA 3WO0A 2Y76A 1PG0A 4EEKA 4OK3A 3DTVD 2DPXA 5DDIP 4US2R 3GJ4A 3K0FA 2QMHA 4ZYVA 1VZ2A 1WXDA 3S7ZA 4CMBA 1E2EA 3L49A 4KXQA 4DBVO 1XQYA 1ZGGA 1PU2A 5IASA 5K9ZA 5AUQA 4Q18A 3SYCA 1G0OA 4BOYA 4JAAA 2BEVB 4EPVA 3QHPA 3Q9SA 2ZBUA 1H1LB 1Z6PA 3BMQA 5E6UB 1Q6UA 1HQDA 5B1OA 1BCSA 4JL8A 1MA1A 3H3XA 5CIWA 4AWAA 2GAAA