3LDTA

Crystal structure of an outer membrane protein(ompa)from legionella pneumophila
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
147
structure length
144
Chain Sequence
GLVASIYRDSKRKIIRDLQKQDIQYVEYGDTRTLIIPTDKYFMSSPRLNEICYPGLNNVIRLLNFYPQSTIYVAGFTDNVGSRKRKLSQAQAETMMTFLWANGIAAKRLKAEGYGDKNAISDNAIIHGSAQNRRIEIQWFTSEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Outer membrane protein, OmpA family protein
publication title Crystal structure of an Outer membrane protein(OmpA)from Legionella pneumophila
rcsb
source organism Legionella pneumophila
total genus 42
structure length 144
sequence length 147
ec nomenclature
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3ldtA00
1R1MA 3TD3A 2ZOVA 4PWTA 4B62A 3S0YA 3LDTA 3S0WA 3S03A 2ZVYA 2N48A 4R40B 3S0HA 5EB0A 5EB1B 4G4XA 4ZHVA 2K1SA 2LBTA 3KHNA 4G88A 2L26A 3WPWA 4G4WA 3CYQA 2ZF8A 2MQEA 3OONA 2LCAA 3TD5A 1OAPA 4ZHYB 4ZHWA 3IMPA 4B5CA 3S02A 2AIZP 4G4VA 3S06A 3TD4A 4ERHA 3CYPB 2KGWA 4G4ZA 3WPXA 2HQSC 2ZVZA 4RHAA 5EAZA 4G4YA 2W8BC
chains in the Genus database with same CATH superfamily
2VGNA 1IV1A 2F9ZC 2BO1A 2OHWA 1SDSA 3JAWB 5C8YB 1QAHA 3K14A 1Q81H 3JATA 2OTLF 3D00A 3RYHA 1JFFA 5MN6A 3JAMM 1S72F 3OBWA 4DRXB 2VXYA 5FLXM 4RHAA 4G4YA 4ZI7B 3CCRF 3L7QA 1QD9A 3HKDB 4LCKA 1QVFF 5HP7A 3VOAA 1YI2F 1T0AA 2CVLA 5EB1B 3V3TA 1NMUB 4C8EA 3ERNA 2V9YA 2JNBA 3RYIA 1U43A 3N4ZA 2DYYA 3VTIC 1YJNF 1VQ6F 1GZ0A 3OONA 1W581 3M84A 1Q86H 3CMAF 3IMPA 2P6YA 2WALA 2HVYD 3HKCB 3N2KB 1W41A 3LWPC 2HRYA 1W55A 2UYJA 3WPXA 1VQOF 3UT5A 3JATB 2Q1YA 4WBNA 3CCUF 1OFUA 1NQ3A 5LP6A 4I50A 3S03A 2NMUA 3GYQA 1NJIH 1VQ7F 1FNKA 3JAKB 3IEWA 1RLUA 2UYNA 2AMTA 5LA6B 5JQGB 2ZF8A 2VGMA 2AIZP 4BVRA 4EB6B 2KTVA 3T80A 3DDNA 4O4IB 3RYIB 4YJ2A 2YYEA 5IT9M 4O2AA 5EZYB 5LXTA 2QTPA 1JN1A 3ESJA 4BT3A 1KC8H 2LBXA 2RHOA 3LWRC 5DCVA 2RHJA 4X3LA 3BYQA 3UT5B 2VAMA 1IV4A 3CC4F 2IQQA 3G6EF 2PMPA 5LP6B 5JCOA 3J80M 1COMA 4BT2A 4DXDA 1Z5WA 2EWCA 4C4WC 3JCMM 4LNUA 1T0KB 5CB4A 4BY9D 3GTZA 2UZHA 3Q8HA 3LFOA 4B62A 1VQLF 5CA0A 3MDOA 5LXTB 1W2BF 1VQ9F 3P10A 4TZZA 4HNAB 1YQNA 4TV9A 2CW4A 5CA1B 1VQKF 2HS3A 5KMGA 1XBIA 4YJ3A 3HKBA 2RB9A 4X1YB 1VQVA 3ZOPA 3CPWF 3LWOC 3E1YA 1TVKA 2Q1XA 3IR9A 1VQ4F 3E20B 3KJKA 3VI6A 5AVMA 1VQPF 1ODEA 3N2GA 3WJPA 4IIJB 1CLIA 3P0ZA 5A2QM 1SA0A 3S0WA 5GINC 5CB4B 2OZBA 4B45A 2K1SA 2GZLA 5IJ9A 3CXCF 1H47A 4C82A 4F6RA 3JALA 4E6EA 3O85A 5G4VC 3TD5A 1IV3A 3C8LA 4FFBA 3RYCA 5KMGB 3HKEA 4NWOB 2HRUA 1U3PA 3F0FA 4I4TB 4X1KA 3FD6A 1QVGF 3WGNA 3KIZA 3C9SA 5J2TB 3V4DA 3VYSC 5GAPK 3ON1A 5J2UB 2HX0A 3ZP7A 2YXZA 3NK6A 4TUYA 1VQMF 3V7EA 2CHSA 3WXMB 1W42A 4BT4A 1XRGA 3D54A 5LOVA 1SA0B 1E7KA 2UYPA 3RE3A 4EI7A 3ELCA 1YITF 4XCQA 2Z1UA 1GO1A 4IHJA 5IJ9B 3WJRA 4BVTA 2CZWA 5IYZA 3JALB 3QUWA 1W5FA 4FFBB 3F0GA 3CPQA 3RYCB 2IAFA 4BW0B 5JVDA 3LWQC 4O2BA 3RYHB 1JFFB 5EYPA 5IJ0A 4R40B 2N48A 3S0HA 5HY4A 4ZK7A 4ZHVA 1FSZA 3RYFA 5GIPC 3JASA 4C8GA 5LP6C 3KHNA 5EO3A 3CB2A 1DT9A 1X7OA 3U0OA 3EORA 4U3JA 3OW2F 3VIUA 4RQOA 3S02A 1ONIA 3F0EA 1X7PA 4ZHQA 3TD4A 3F6MA 5LOVB 2LBWA 5G4UC 4G4ZA 4C81A 3PAFA 1M1KH 3QHDA 3IEQA 3IKFA 3K0TA 4IHJB 5JH7A 2I6DA 5ITZA 3HTNA 4O4HA 4G4XA 3J81M 1FNJA 2VAWA 1FFXA 4WBNB 2RHLA 3VCZA 1VQNF 5JVDB 2MQEA 4I50B 5EYPB 5IJ0B 5KX5A 1SZQA 4B46A 4ZHWA 3RYFB 4I55A 3JASB 5JCOC 3VMFB 2RHHA 1X25A 5HY2A 2UYNB 1W5AA 4U3JB 3CYPB 2QEXF 3GHZA 1ZWZA 3NVIB 1JD1A 2FGYA 3HAXD 1GX1A 2OTJF 3TD3A 1VQ5F 4ZHQB 3C9UA 2CHTA 4YJ2B 2BTOA 3N4YA 4O4JA 5LYJA 4O2AB 5EIBC 1YHQF 1H48A 1CK2A 5BMVA 2Z1EA 3E22A 5JH7B 3RA5A 3I55F 3D01A 3FBAA 2R751 5ITZB 2QA4F 4O4HB 2ZODA 2DT4A 3M1XA 2ZAUA 1FFXB 1RLGA 3JVHA 3WJQA 1K9MH 2B33A 3KE1A 2VAPA 3CC7F 1W3EX 5KX5B 4I55B 1VK3A 2HS4A 5C8YA 3LYBA 1UFYA 5FJ4C 3CG6A 4LNUB 4BT5A 2Z01A 3I7TA 1YJWF 1YIJF 3CCSF 1Q82H 3G71F 3J7AR 1VH8A 3MCAB 2QI2A 4TV8A 4ZI7A 1OAPA 4M8IA 4O4JB 5CA0B 1RQ2A 3HKDA 5MN5A 4X20A 3CCMF 3K12A 4TV9B 4X1IA 2KGWA 1KD1H 4YJ3B 1XV2A 3HKBB 5HWEA 4KWEA 5EAZA 4ZOLA 4C8IA 1W5BA 2ZOVA 1TVKB 1Q7YH 5HP8A 3AGKA 1H7MA 3VO8A 3WGKA 3HKCA 3N2KA 3V7QA 3PLAC 3N2GB 4G4WA 1JJ2F 2I6RA 3MQWA 3CCLF 3M4SA 2AIFA 1K8AH 2BTUA 2KG4A 1Z5VA 3FD5A 3MCQA 3S06A 4O4LA 2OTMA 2Z1FA 3ZO8A 3B6NA 3JAKA 4TV8B 4F6RB 3NVKE 1KQSF 3C9TA 3OBYA 5EIBD 3I56F 3HJWC 4BVSA 4X20B 5LA6A 5JQGA 5MN4A 1IV2A 3VYUC 1U40A 3P4EA 4X1IB 1DBFA 3FPIA 2Z1TA 3HKEB 1YJ9F 5EB0A 3WGMA 4EB6A 4X1KB 4O4IA 2L26A 4ZOLB 4X3MA 5EZYA 3LMEA 1K73H 5HY1A 1GO0A 4TUYB 4BT7A 1TUBA 1W5EA 5HXZA 3NMUC 3K2XA 4BVQA 2UYKA 1U3LA 1IPAA 1W57A 3VYTC 3HWUA 2BTQB 1N8RH 4O4LB 2H8EA 5IYZB 1M90H 4G88A 2GLZA 3WPWA 1YGYA 4BT6A 1Q8RA 2HP0A 4O2BB 2KTUA 1CN7A 4EI8A 3CCJF 4EI9A 5GANK 3WGJA 3IKEA 1W40A 3FFMA 3QTYA 4HNAA 2CWJA 2ZVZA 5CA1A 4G4VA 3WGLA 2W8BC 1KNKA 3I3FA 3R0PA 5FNVA 1VQ8F 4PWTA 3S0YA 3G4SF 4X1YA 1TUBB 3JARA 3C9RA 1RQ7A 2HS0A 3DC2A 4NQ3A 2LBTA 2PHNA 3ZP4A 2HP3A 5GIOC 3CCQF 3SIUA 3CMEF 3CYQA 1X52A 1JY8A 3LWVC 2LCAA 2H8CA 4ZHYB 4IIJA 5GONA 2H6LA 3CCEF 2IG8A 4ERHA 1KNJA 2HP0B 1W59A 3CCVF 1VHAA 1J7HA 3F0DA 2ALEA 1XHOA 2FC3A 3SIVA 1PF5A 5EWRA 3RA6A 5HXUA 1R1MA 3CD6F 3JAWA 2G9IA 1UI9A 3LDTA 5B8FA 3CC2F 2ZVYA 5HY0A 3VOBA 1QU9A 1RA4A 1PXWA 3KJJA 5FNVB 4I4TA 2R6R1 4DRXA 3JARB 2CSLA 4NUTA 3MBMA 4B5CA 5LYJB 5J2TA 5BMVB 5J2UA 3E22B 4U39A 2HQSC 2GVIA 5GONB 3NK7A
chains in the Genus database with same CATH topology
1R1MA 3TD3A 2ZOVA 4PWTA 4B62A 3S0YA 3LDTA 3S0WA 3S03A 2ZVYA 2N48A 4R40B 3S0HA 5EB0A 5EB1B 4G4XA 4ZHVA 2K1SA 2LBTA 3KHNA 4G88A 2L26A 3WPWA 4G4WA 3CYQA 2ZF8A 2MQEA 3OONA 2LCAA 3TD5A 1OAPA 4ZHYB 4ZHWA 3IMPA 4B5CA 3S02A 2AIZP 4G4VA 3S06A 3TD4A 4ERHA 3CYPB 2KGWA 4G4ZA 3WPXA 2HQSC 2ZVZA 4RHAA 5EAZA 4G4YA 2W8BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R1M A;  3TD3 A;  2ZOV A;  4PWT A;  4B62 A;  3S0Y A;  3LDT A;  3S0W A;  3S03 A;  2ZVY A;  2N48 A;  4R40 B;  3S0H A;  5EB0 A;  5EB1 B;  4G4X A;  4ZHV A;  2K1S A;  2LBT A;  3KHN A;  4G88 A;  2L26 A;  3WPW A;  4G4W A;  3CYQ A;  2ZF8 A;  2MQE A;  3OON A;  2LCA A;  3TD5 A;  1OAP A;  4ZHY B;  4ZHW A;  3IMP A;  4B5C A;  3S02 A;  2AIZ P;  4G4V A;  3S06 A;  3TD4 A;  4ERH A;  3CYP B;  2KGW A;  4G4Z A;  3WPX A;  2HQS C;  2ZVZ A;  4RHA A;  5EAZ A;  4G4Y A;  2W8B C; 
#chains in the Genus database with same CATH topology
 2VGN A;  1IV1 A;  2F9Z C;  2BO1 A;  2OHW A;  1SDS A;  3JAW B;  5C8Y B;  1QAH A;  3K14 A;  1Q81 H;  3JAT A;  2OTL F;  3D00 A;  3RYH A;  1JFF A;  5MN6 A;  3JAM M;  1S72 F;  3OBW A;  4DRX B;  2VXY A;  5FLX M;  4RHA A;  4G4Y A;  4ZI7 B;  3CCR F;  3L7Q A;  1QD9 A;  3HKD B;  4LCK A;  1QVF F;  5HP7 A;  3VOA A;  1YI2 F;  1T0A A;  2CVL A;  5EB1 B;  3V3T A;  1NMU B;  4C8E A;  3ERN A;  2V9Y A;  2JNB A;  3RYI A;  1U43 A;  3N4Z A;  2DYY A;  3VTI C;  1YJN F;  1VQ6 F;  1GZ0 A;  3OON A;  1W58 1;  3M84 A;  1Q86 H;  3CMA F;  3IMP A;  2P6Y A;  2WAL A;  2HVY D;  3HKC B;  3N2K B;  1W41 A;  3LWP C;  2HRY A;  1W55 A;  2UYJ A;  3WPX A;  1VQO F;  3UT5 A;  3JAT B;  2Q1Y A;  4WBN A;  3CCU F;  1OFU A;  1NQ3 A;  5LP6 A;  4I50 A;  3S03 A;  2NMU A;  3GYQ A;  1NJI H;  1VQ7 F;  1FNK A;  3JAK B;  3IEW A;  1RLU A;  2UYN A;  2AMT A;  5LA6 B;  5JQG B;  2ZF8 A;  2VGM A;  2AIZ P;  4BVR A;  4EB6 B;  2KTV A;  3T80 A;  3DDN A;  4O4I B;  3RYI B;  4YJ2 A;  2YYE A;  5IT9 M;  4O2A A;  5EZY B;  5LXT A;  2QTP A;  1JN1 A;  3ESJ A;  4BT3 A;  1KC8 H;  2LBX A;  2RHO A;  3LWR C;  5DCV A;  2RHJ A;  4X3L A;  3BYQ A;  3UT5 B;  2VAM A;  1IV4 A;  3CC4 F;  2IQQ A;  3G6E F;  2PMP A;  5LP6 B;  5JCO A;  3J80 M;  1COM A;  4BT2 A;  4DXD A;  1Z5W A;  2EWC A;  4C4W C;  3JCM M;  4LNU A;  1T0K B;  5CB4 A;  4BY9 D;  3GTZ A;  2UZH A;  3Q8H A;  3LFO A;  4B62 A;  1VQL F;  5CA0 A;  3MDO A;  5LXT B;  1W2B F;  1VQ9 F;  3P10 A;  4TZZ A;  4HNA B;  1YQN A;  4TV9 A;  2CW4 A;  5CA1 B;  1VQK F;  2HS3 A;  5KMG A;  1XBI A;  4YJ3 A;  3HKB A;  2RB9 A;  4X1Y B;  1VQV A;  3ZOP A;  3CPW F;  3LWO C;  3E1Y A;  1TVK A;  2Q1X A;  3IR9 A;  1VQ4 F;  3E20 B;  3KJK A;  3VI6 A;  5AVM A;  1VQP F;  1ODE A;  3N2G A;  3WJP A;  4IIJ B;  1CLI A;  3P0Z A;  5A2Q M;  1SA0 A;  3S0W A;  5GIN C;  5CB4 B;  2OZB A;  4B45 A;  2K1S A;  2GZL A;  5IJ9 A;  3CXC F;  1H47 A;  4C82 A;  4F6R A;  3JAL A;  4E6E A;  3O85 A;  5G4V C;  3TD5 A;  1IV3 A;  3C8L A;  4FFB A;  3RYC A;  5KMG B;  3HKE A;  4NWO B;  2HRU A;  1U3P A;  3F0F A;  4I4T B;  4X1K A;  3FD6 A;  1QVG F;  3WGN A;  3KIZ A;  3C9S A;  5J2T B;  3V4D A;  3VYS C;  5GAP K;  3ON1 A;  5J2U B;  2HX0 A;  3ZP7 A;  2YXZ A;  3NK6 A;  4TUY A;  1VQM F;  3V7E A;  2CHS A;  3WXM B;  1W42 A;  4BT4 A;  1XRG A;  3D54 A;  5LOV A;  1SA0 B;  1E7K A;  2UYP A;  3RE3 A;  4EI7 A;  3ELC A;  1YIT F;  4XCQ A;  2Z1U A;  1GO1 A;  4IHJ A;  5IJ9 B;  3WJR A;  4BVT A;  2CZW A;  5IYZ A;  3JAL B;  3QUW A;  1W5F A;  4FFB B;  3F0G A;  3CPQ A;  3RYC B;  2IAF A;  4BW0 B;  5JVD A;  3LWQ C;  4O2B A;  3RYH B;  1JFF B;  5EYP A;  5IJ0 A;  4R40 B;  2N48 A;  3S0H A;  5HY4 A;  4ZK7 A;  4ZHV A;  1FSZ A;  3RYF A;  5GIP C;  3JAS A;  4C8G A;  5LP6 C;  3KHN A;  5EO3 A;  3CB2 A;  1DT9 A;  1X7O A;  3U0O A;  3EOR A;  4U3J A;  3OW2 F;  3VIU A;  4RQO A;  3S02 A;  1ONI A;  3F0E A;  1X7P A;  4ZHQ A;  3TD4 A;  3F6M A;  5LOV B;  2LBW A;  5G4U C;  4G4Z A;  4C81 A;  3PAF A;  1M1K H;  3QHD A;  3IEQ A;  3IKF A;  3K0T A;  4IHJ B;  5JH7 A;  2I6D A;  5ITZ A;  3HTN A;  4O4H A;  4G4X A;  3J81 M;  1FNJ A;  2VAW A;  1FFX A;  4WBN B;  2RHL A;  3VCZ A;  1VQN F;  5JVD B;  2MQE A;  4I50 B;  5EYP B;  5IJ0 B;  5KX5 A;  1SZQ A;  4B46 A;  4ZHW A;  3RYF B;  4I55 A;  3JAS B;  5JCO C;  3VMF B;  2RHH A;  1X25 A;  5HY2 A;  2UYN B;  1W5A A;  4U3J B;  3CYP B;  2QEX F;  3GHZ A;  1ZWZ A;  3NVI B;  1JD1 A;  2FGY A;  3HAX D;  1GX1 A;  2OTJ F;  3TD3 A;  1VQ5 F;  4ZHQ B;  3C9U A;  2CHT A;  4YJ2 B;  2BTO A;  3N4Y A;  4O4J A;  5LYJ A;  4O2A B;  5EIB C;  1YHQ F;  1H48 A;  1CK2 A;  5BMV A;  2Z1E A;  3E22 A;  5JH7 B;  3RA5 A;  3I55 F;  3D01 A;  3FBA A;  2R75 1;  5ITZ B;  2QA4 F;  4O4H B;  2ZOD A;  2DT4 A;  3M1X A;  2ZAU A;  1FFX B;  1RLG A;  3JVH A;  3WJQ A;  1K9M H;  2B33 A;  3KE1 A;  2VAP A;  3CC7 F;  1W3E X;  5KX5 B;  4I55 B;  1VK3 A;  2HS4 A;  5C8Y A;  3LYB A;  1UFY A;  5FJ4 C;  3CG6 A;  4LNU B;  4BT5 A;  2Z01 A;  3I7T A;  1YJW F;  1YIJ F;  3CCS F;  1Q82 H;  3G71 F;  3J7A R;  1VH8 A;  3MCA B;  2QI2 A;  4TV8 A;  4ZI7 A;  1OAP A;  4M8I A;  4O4J B;  5CA0 B;  1RQ2 A;  3HKD A;  5MN5 A;  4X20 A;  3CCM F;  3K12 A;  4TV9 B;  4X1I A;  2KGW A;  1KD1 H;  4YJ3 B;  1XV2 A;  3HKB B;  5HWE A;  4KWE A;  5EAZ A;  4ZOL A;  4C8I A;  1W5B A;  2ZOV A;  1TVK B;  1Q7Y H;  5HP8 A;  3AGK A;  1H7M A;  3VO8 A;  3WGK A;  3HKC A;  3N2K A;  3V7Q A;  3PLA C;  3N2G B;  4G4W A;  1JJ2 F;  2I6R A;  3MQW A;  3CCL F;  3M4S A;  2AIF A;  1K8A H;  2BTU A;  2KG4 A;  1Z5V A;  3FD5 A;  3MCQ A;  3S06 A;  4O4L A;  2OTM A;  2Z1F A;  3ZO8 A;  3B6N A;  3JAK A;  4TV8 B;  4F6R B;  3NVK E;  1KQS F;  3C9T A;  3OBY A;  5EIB D;  3I56 F;  3HJW C;  4BVS A;  4X20 B;  5LA6 A;  5JQG A;  5MN4 A;  1IV2 A;  3VYU C;  1U40 A;  3P4E A;  4X1I B;  1DBF A;  3FPI A;  2Z1T A;  3HKE B;  1YJ9 F;  5EB0 A;  3WGM A;  4EB6 A;  4X1K B;  4O4I A;  2L26 A;  4ZOL B;  4X3M A;  5EZY A;  3LME A;  1K73 H;  5HY1 A;  1GO0 A;  4TUY B;  4BT7 A;  1TUB A;  1W5E A;  5HXZ A;  3NMU C;  3K2X A;  4BVQ A;  2UYK A;  1U3L A;  1IPA A;  1W57 A;  3VYT C;  3HWU A;  2BTQ B;  1N8R H;  4O4L B;  2H8E A;  5IYZ B;  1M90 H;  4G88 A;  2GLZ A;  3WPW A;  1YGY A;  4BT6 A;  1Q8R A;  2HP0 A;  4O2B B;  2KTU A;  1CN7 A;  4EI8 A;  3CCJ F;  4EI9 A;  5GAN K;  3WGJ A;  3IKE A;  1W40 A;  3FFM A;  3QTY A;  4HNA A;  2CWJ A;  2ZVZ A;  5CA1 A;  4G4V A;  3WGL A;  2W8B C;  1KNK A;  3I3F A;  3R0P A;  5FNV A;  1VQ8 F;  4PWT A;  3S0Y A;  3G4S F;  4X1Y A;  1TUB B;  3JAR A;  3C9R A;  1RQ7 A;  2HS0 A;  3DC2 A;  4NQ3 A;  2LBT A;  2PHN A;  3ZP4 A;  2HP3 A;  5GIO C;  3CCQ F;  3SIU A;  3CME F;  3CYQ A;  1X52 A;  1JY8 A;  3LWV C;  2LCA A;  2H8C A;  4ZHY B;  4IIJ A;  5GON A;  2H6L A;  3CCE F;  2IG8 A;  4ERH A;  1KNJ A;  2HP0 B;  1W59 A;  3CCV F;  1VHA A;  1J7H A;  3F0D A;  2ALE A;  1XHO A;  2FC3 A;  3SIV A;  1PF5 A;  5EWR A;  3RA6 A;  5HXU A;  1R1M A;  3CD6 F;  3JAW A;  2G9I A;  1UI9 A;  3LDT A;  5B8F A;  3CC2 F;  2ZVY A;  5HY0 A;  3VOB A;  1QU9 A;  1RA4 A;  1PXW A;  3KJJ A;  5FNV B;  4I4T A;  2R6R 1;  4DRX A;  3JAR B;  2CSL A;  4NUT A;  3MBM A;  4B5C A;  5LYJ B;  5J2T A;  5BMV B;  5J2U A;  3E22 B;  4U39 A;  2HQS C;  2GVI A;  5GON B;  3NK7 A; 
#chains in the Genus database with same CATH homology
 1R1M A;  3TD3 A;  2ZOV A;  4PWT A;  4B62 A;  3S0Y A;  3LDT A;  3S0W A;  3S03 A;  2ZVY A;  2N48 A;  4R40 B;  3S0H A;  5EB0 A;  5EB1 B;  4G4X A;  4ZHV A;  2K1S A;  2LBT A;  3KHN A;  4G88 A;  2L26 A;  3WPW A;  4G4W A;  3CYQ A;  2ZF8 A;  2MQE A;  3OON A;  2LCA A;  3TD5 A;  1OAP A;  4ZHY B;  4ZHW A;  3IMP A;  4B5C A;  3S02 A;  2AIZ P;  4G4V A;  3S06 A;  3TD4 A;  4ERH A;  3CYP B;  2KGW A;  4G4Z A;  3WPX A;  2HQS C;  2ZVZ A;  4RHA A;  5EAZ A;  4G4Y A;  2W8B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...