3LDTA

Crystal structure of an outer membrane protein(ompa)from legionella pneumophila
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
147
structure length
144
Chain Sequence
GLVASIYRDSKRKIIRDLQKQDIQYVEYGDTRTLIIPTDKYFMSSPRLNEICYPGLNNVIRLLNFYPQSTIYVAGFTDNVGSRKRKLSQAQAETMMTFLWANGIAAKRLKAEGYGDKNAISDNAIIHGSAQNRRIEIQWFTSEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein, OmpA family protein
publication title Crystal structure of an Outer membrane protein(OmpA)from Legionella pneumophila
rcsb
source organism Legionella pneumophila
molecule tags Membrane protein
total genus 42
structure length 144
sequence length 147
ec nomenclature
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3ldtA00
4G4ZA 2N48A 3CYPB 4G4XA 3WPWA 4PWTA 2LBTA 3S0HA 2ZVZA 2K1SA 2LCAA 3TD4A 4ZHVA 5EB1B 3S02A 3CYQA 2L26A 3WPXA 5EAZA 5EB0A 4R40B 4ZHYB 1R1MA 4G4WA 4ERHA 4G4VA 3OONA 2HQSC 2W8BC 2ZVYA 3S06A 3TD3A 4G4YA 3LDTA 2ZOVA 3KHNA 3S0WA 3TD5A 1OAPA 2MQEA 3IMPA 2KGWA 4B62A 4ZHWA 3S0YA 4RHAA 2AIZP 3S03A 4G88A 4B5CA 2ZF8A
chains in the Genus database with same CATH superfamily
3WJPA 3SIUA 1VQLF 3FD6A 4RQOA 3V7QA 3M4SA 5GANK 1H7MA 1XV2A 1VQ9F 1VQKF 3JARB 3CCUF 3LWOC 1YJWF 3JAKA 1VQOF 1FSZA 3P0ZA 4IHJA 3ZP4A 2GLZA 1ONIA 4I4TA 4G4YA 4X20A 4U3JB 3LDTA 5HWEA 4TUYB 2IAFA 3NK6A 1W5AA 3WGMA 2UZHA 4O4LA 2Z1UA 4I50A 3RYIB 1GO1A 3VMFB 5HXZA 3P4EA 5HXUA 3UT5B 3RE3A 1XBIA 4R40B 1JD1A 1QAHA 4X1KB 2UYJA 1RA4A 2JNBA 3G4SF 4YJ2A 2HRUA 2RB9A 3JALA 4YJ3A 4F6RB 2NMUA 4X3LA 4BT7A 3LWQC 4C8IA 4IIJA 2CSLA 3HKEB 5KMGA 2HP0A 3S03A 3SIVA 1XHOA 2RHJA 3E22A 1YQNA 5FNVB 5LA6A 4B5CA 1NJIH 1KQSF 4EB6B 5LXTB 3JAWA 5CA1A 1E7KA 2LBTA 5CA0A 3ZP7A 1YGYA 1ZWZA 2Z1FA 3R0PA 3VIUA 3WGKA 4TZZA 3VYSC 5LYJB 3HWUA 3ON1A 1Z5WA 2HX0A 2RHLA 5J2UA 1UI9A 1CLIA 2UYKA 3EORA 1Q8RA 3HKDB 5GIPC 5FJ4C 3IR9A 3F6MA 2HS4A 3TD5A 2CWJA 3OW2F 2HVYD 1GO0A 1CK2A 1X7OA 1QVFF 2UYNA 3N2GA 4O4HA 2FC3A 5GONA 3CCEF 1KNKA 2K1SA 3JAKB 4IHJB 1VQMF 1GZ0A 4I4TB 4X20B 3LFOA 1J7HA 4BY9D 2CW4A 2RHOA 5JQGA 3GHZA 3OBWA 4O2BA 1W40A 1RLUA 4LNUA 4ZK7A 2OZBA 5HP8A 3C9TA 4O4LB 4I50B 3I56F 1PF5A 3VTIC 1H48A 3MQWA 4KWEA 5GINC 4U39A 3WPWA 4B46A 1OFUA 4C8EA 4ZI7A 2Z1TA 5IJ9A 2BO1A 2I6RA 5IJ0A 4YJ2B 4C4WC 3JALB 2Q1XA 2OTMA 4YJ3B 5FNVA 1IV2A 3K2XA 1ODEA 1R1MA 4G4WA 4IIJB 4ERHA 1TVKA 1Q7YH 5KMGB 2HP0B 5LP6A 3E22B 5LA6B 4WBNA 3IKEA 3J81M 3IMPA 3JAWB 5CA1B 1VQ4F 1W3EX 5CA0B 1NQ3A 4DXDA 1U3PA 1RQ7A 4G4XA 5J2UB 2Q1YA 1XRGA 5A2QM 2PMPA 4B45A 3QUWA 3J7AR 1VQPF 1IPAA 1M1KH 4O2AB 3CCJF 2DT4A 1VQ8F 3NMUC 4ZOLA 5EYPB 1FNKA 5AVMA 4EI9A 3RA5A 1UFYA 4FFBA 3RYFA 3S0WA 3KE1A 2MQEA 3KJKA 2UYNB 4BVRA 3N2GB 4O4HB 3T80A 3S0YA 5EIBD 5GONB 2YXZA 5B8FA 3N4ZA 3N2KA 2QA4F 3F0EA 3WJRA 2IQQA 2BTUA 1W42A 3JATA 3V7EA 5EWRA 5JQGB 3CPWF 3MCAB 3CCRF 1QVGF 3D54A 3G6EF 4O2BB 4X1IA 5EB1B 1VQ7F 3P10A 3JVHA 3LMEA 2L26A 4LNUB 4DRXB 3VYUC 1SA0A 3VCZA 5HP7A 2W8BC 3KJJA 2LBXA 5G4VC 1SZQA 3E1YA 3RYCA 3VYTC 5FLXM 2H6LA 2VAPA 4ZI7B 5IJ9B 2CHTA 2OTJF 3FFMA 4RHAA 3CCSF 1DBFA 5IJ0B 1JY8A 2KTVA 3CPQA 4C8GA 3I3FA 3G71F 1M90H 4C81A 5HY0A 3IEWA 3Q8HA 1Z5VA 5LP6C 4HNAA 1TVKB 4ZHQA 2HP3A 3C9RA 3I55F 5MN4A 3NVIB 5LP6B 4WBNB 5JVDA 4LCKA 4G4VA 3CG6A 1IV4A 5ITZA 5JCOC 3ESJA 1W41A 2HS3A 2ZOVA 4O2AA 1X25A 2R6R1 3MCQA 3WGNA 5EYPA 3VI6A 1T0AA 4I55A 2AMTA 3JASA 3N4YA 2QEXF 3CMAF 2YYEA 3C9UA 2N48A 3CYPB 5J2TA 2Z1EA 2AIFA 4O4IA 4ZOLB 1TUBA 2I6DA 3E20B 3VO8A 5MN6A 3CCLF 5IT9M 4FFBB 3CC4F 2HS0A 3RYFB 3HJWC 4M8IA 3GYQA 4XCQA 2V9YA 4BT5A 2KG4A 3M1XA 1X52A 1QD9A 3C9SA 5IYZA 3N2KB 4DRXA 3JATB 4ZHWA 1YHQF 3WJQA 1W5FA 3FD5A 1QU9A 4X1IB 4G4ZA 5JH7A 1K8AH 1SDSA 2Z01A 3HTNA 1YJNF 1SA0B 3CCMF 3C8LA 3RA6A 4NQ3A 3ERNA 4EI8A 3RYCB 3IKFA 2OTLF 1DT9A 2HQSC 4BVSA 3DDNA 3KIZA 3CC2F 3F0FA 3B6NA 3U0OA 2GVIA 2DYYA 4HNAB 2BTQB 3K12A 4ZHQB 1PXWA 1N8RH 1U3LA 5LOVA 5GAPK 4BVTA 5JCOA 1FNJA 1W59A 5JVDB 1YI2F 2H8EA 3ELCA 2G9IA 1JFFA 3FPIA 5EIBC 5ITZB 1Q86H 3WXMB 2VAWA 5C8YA 1Q81H 2ALEA 5G4UC 4TV9B 4ZHYB 4I55B 3JASB 1JN1A 1K73H 5J2TB 3HKBA 4O4IB 1TUBB 3LWVC 2BTOA 2R751 4BT2A 3NK7A 1Q82H 1T0KB 2F9ZC 3LWRC 5MN5A 1RLGA 2KTUA 5CB4A 4X1YA 2P6YA 3MDOA 3GTZA 4NWOB 2ZAUA 1VQNF 3CYQA 5IYZB 3QTYA 2WALA 3LWPC 2HRYA 3QHDA 1IV1A 3TD3A 3L7QA 3F0DA 3LYBA 5HY4A 1W5BA 4O4JA 5JH7B 3KHNA 3CCQF 5DCVA 2FGYA 1H47A 3WGJA 4TV8A 4G88A 3F0GA 2H8CA 3RYHA 4BT3A 3JCMM 1COMA 3V4DA 3ZOPA 3S0HA 4X3MA 5EZYA 5KX5A 1W55A 5BMVA 5HY1A 5EB0A 3DC2A 2EWCA 3ZO8A 3OONA 1YITF 1KD1H 1KNJA 1CN7A 2B33A 3CD6F 1VQ5F 3PLAC 3CC7F 1VHAA 4C82A 1YIJF 2VXYA 1OAPA 5LOVB 1NMUB 3D00A 2OHWA 4TV9A 3CB2A 3O85A 2GZLA 3HKCA 1FFXA 2AIZP 1JFFB 3WGLA 3V3TA 2CZWA 2ZF8A 4ZHVA 5C8YB 2UYPA 3CCVF 1VQ6F 1JJ2F 1W5EA 2ZVZA 3VOBA 2CVLA 2VAMA 1GX1A 3WPXA 1U40A 1U43A 1KC8H 5HY2A 4BT4A 3D01A 3HKBB 2ZVYA 2ZODA 1VQVA 5GIOC 2IG8A 5EO3A 3JARA 3CXCF 4BW0B 5CB4B 4X1YB 4E6EA 4U3JA 3HAXD 4TUYA 2VGMA 4PWTA 3FBAA 2QI2A 1W581 1W57A 3TD4A 3S02A 4O4JB 3JAMM 3K0TA 1IV3A 3RYIA 4TV8B 3UT5A 3MBMA 3BYQA 3RYHB 4X1KA 4BT6A 1S72F 1W2BF 5EZYB 4F6RA 5KX5B 2VGNA 4BVQA 5BMVB 3HKEA 4EI7A 2PHNA 1K9MH 2LCAA 1YJ9F 2CHSA 2QTPA 4EB6A 5LXTA 4NUTA 1X7PA 3PAFA 3K14A 3I7TA 3VOAA 3J80M 3AGKA 3OBYA 3HKCB 5LYJA 1FFXB 3M84A 3IEQA 3S06A 3CMEF 3NVKE 2KGWA 2RHHA 1RQ2A 4B62A 2LBWA 1VK3A 3HKDA 1VH8A 5EAZA
chains in the Genus database with same CATH topology
4G4ZA 2N48A 3CYPB 4G4XA 3WPWA 4PWTA 2LBTA 3S0HA 2ZVZA 2K1SA 2LCAA 3TD4A 4ZHVA 5EB1B 3S02A 3CYQA 2L26A 3WPXA 5EAZA 5EB0A 4R40B 4ZHYB 1R1MA 4G4WA 4ERHA 4G4VA 3OONA 2HQSC 2W8BC 2ZVYA 3S06A 3TD3A 4G4YA 3LDTA 2ZOVA 3KHNA 3S0WA 3TD5A 1OAPA 2MQEA 3IMPA 2KGWA 4B62A 4ZHWA 3S0YA 4RHAA 2AIZP 3S03A 4G88A 4B5CA 2ZF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4Z A;  2N48 A;  3CYP B;  4G4X A;  3WPW A;  4PWT A;  2LBT A;  3S0H A;  2ZVZ A;  2K1S A;  2LCA A;  3TD4 A;  4ZHV A;  5EB1 B;  3S02 A;  3CYQ A;  2L26 A;  3WPX A;  5EAZ A;  5EB0 A;  4R40 B;  4ZHY B;  1R1M A;  4G4W A;  4ERH A;  4G4V A;  3OON A;  2HQS C;  2W8B C;  2ZVY A;  3S06 A;  3TD3 A;  4G4Y A;  3LDT A;  2ZOV A;  3KHN A;  3S0W A;  3TD5 A;  1OAP A;  2MQE A;  3IMP A;  2KGW A;  4B62 A;  4ZHW A;  3S0Y A;  4RHA A;  2AIZ P;  3S03 A;  4G88 A;  4B5C A;  2ZF8 A; 
#chains in the Genus database with same CATH topology
 3WJP A;  3SIU A;  1VQL F;  3FD6 A;  4RQO A;  3V7Q A;  3M4S A;  5GAN K;  1H7M A;  1XV2 A;  1VQ9 F;  1VQK F;  3JAR B;  3CCU F;  3LWO C;  1YJW F;  3JAK A;  1VQO F;  1FSZ A;  3P0Z A;  4IHJ A;  3ZP4 A;  2GLZ A;  1ONI A;  4I4T A;  4G4Y A;  4X20 A;  4U3J B;  3LDT A;  5HWE A;  4TUY B;  2IAF A;  3NK6 A;  1W5A A;  3WGM A;  2UZH A;  4O4L A;  2Z1U A;  4I50 A;  3RYI B;  1GO1 A;  3VMF B;  5HXZ A;  3P4E A;  5HXU A;  3UT5 B;  3RE3 A;  1XBI A;  4R40 B;  1JD1 A;  1QAH A;  4X1K B;  2UYJ A;  1RA4 A;  2JNB A;  3G4S F;  4YJ2 A;  2HRU A;  2RB9 A;  3JAL A;  4YJ3 A;  4F6R B;  2NMU A;  4X3L A;  4BT7 A;  3LWQ C;  4C8I A;  4IIJ A;  2CSL A;  3HKE B;  5KMG A;  2HP0 A;  3S03 A;  3SIV A;  1XHO A;  2RHJ A;  3E22 A;  1YQN A;  5FNV B;  5LA6 A;  4B5C A;  1NJI H;  1KQS F;  4EB6 B;  5LXT B;  3JAW A;  5CA1 A;  1E7K A;  2LBT A;  5CA0 A;  3ZP7 A;  1YGY A;  1ZWZ A;  2Z1F A;  3R0P A;  3VIU A;  3WGK A;  4TZZ A;  3VYS C;  5LYJ B;  3HWU A;  3ON1 A;  1Z5W A;  2HX0 A;  2RHL A;  5J2U A;  1UI9 A;  1CLI A;  2UYK A;  3EOR A;  1Q8R A;  3HKD B;  5GIP C;  5FJ4 C;  3IR9 A;  3F6M A;  2HS4 A;  3TD5 A;  2CWJ A;  3OW2 F;  2HVY D;  1GO0 A;  1CK2 A;  1X7O A;  1QVF F;  2UYN A;  3N2G A;  4O4H A;  2FC3 A;  5GON A;  3CCE F;  1KNK A;  2K1S A;  3JAK B;  4IHJ B;  1VQM F;  1GZ0 A;  4I4T B;  4X20 B;  3LFO A;  1J7H A;  4BY9 D;  2CW4 A;  2RHO A;  5JQG A;  3GHZ A;  3OBW A;  4O2B A;  1W40 A;  1RLU A;  4LNU A;  4ZK7 A;  2OZB A;  5HP8 A;  3C9T A;  4O4L B;  4I50 B;  3I56 F;  1PF5 A;  3VTI C;  1H48 A;  3MQW A;  4KWE A;  5GIN C;  4U39 A;  3WPW A;  4B46 A;  1OFU A;  4C8E A;  4ZI7 A;  2Z1T A;  5IJ9 A;  2BO1 A;  2I6R A;  5IJ0 A;  4YJ2 B;  4C4W C;  3JAL B;  2Q1X A;  2OTM A;  4YJ3 B;  5FNV A;  1IV2 A;  3K2X A;  1ODE A;  1R1M A;  4G4W A;  4IIJ B;  4ERH A;  1TVK A;  1Q7Y H;  5KMG B;  2HP0 B;  5LP6 A;  3E22 B;  5LA6 B;  4WBN A;  3IKE A;  3J81 M;  3IMP A;  3JAW B;  5CA1 B;  1VQ4 F;  1W3E X;  5CA0 B;  1NQ3 A;  4DXD A;  1U3P A;  1RQ7 A;  4G4X A;  5J2U B;  2Q1Y A;  1XRG A;  5A2Q M;  2PMP A;  4B45 A;  3QUW A;  3J7A R;  1VQP F;  1IPA A;  1M1K H;  4O2A B;  3CCJ F;  2DT4 A;  1VQ8 F;  3NMU C;  4ZOL A;  5EYP B;  1FNK A;  5AVM A;  4EI9 A;  3RA5 A;  1UFY A;  4FFB A;  3RYF A;  3S0W A;  3KE1 A;  2MQE A;  3KJK A;  2UYN B;  4BVR A;  3N2G B;  4O4H B;  3T80 A;  3S0Y A;  5EIB D;  5GON B;  2YXZ A;  5B8F A;  3N4Z A;  3N2K A;  2QA4 F;  3F0E A;  3WJR A;  2IQQ A;  2BTU A;  1W42 A;  3JAT A;  3V7E A;  5EWR A;  5JQG B;  3CPW F;  3MCA B;  3CCR F;  1QVG F;  3D54 A;  3G6E F;  4O2B B;  4X1I A;  5EB1 B;  1VQ7 F;  3P10 A;  3JVH A;  3LME A;  2L26 A;  4LNU B;  4DRX B;  3VYU C;  1SA0 A;  3VCZ A;  5HP7 A;  2W8B C;  3KJJ A;  2LBX A;  5G4V C;  1SZQ A;  3E1Y A;  3RYC A;  3VYT C;  5FLX M;  2H6L A;  2VAP A;  4ZI7 B;  5IJ9 B;  2CHT A;  2OTJ F;  3FFM A;  4RHA A;  3CCS F;  1DBF A;  5IJ0 B;  1JY8 A;  2KTV A;  3CPQ A;  4C8G A;  3I3F A;  3G71 F;  1M90 H;  4C81 A;  5HY0 A;  3IEW A;  3Q8H A;  1Z5V A;  5LP6 C;  4HNA A;  1TVK B;  4ZHQ A;  2HP3 A;  3C9R A;  3I55 F;  5MN4 A;  3NVI B;  5LP6 B;  4WBN B;  5JVD A;  4LCK A;  4G4V A;  3CG6 A;  1IV4 A;  5ITZ A;  5JCO C;  3ESJ A;  1W41 A;  2HS3 A;  2ZOV A;  4O2A A;  1X25 A;  2R6R 1;  3MCQ A;  3WGN A;  5EYP A;  3VI6 A;  1T0A A;  4I55 A;  2AMT A;  3JAS A;  3N4Y A;  2QEX F;  3CMA F;  2YYE A;  3C9U A;  2N48 A;  3CYP B;  5J2T A;  2Z1E A;  2AIF A;  4O4I A;  4ZOL B;  1TUB A;  2I6D A;  3E20 B;  3VO8 A;  5MN6 A;  3CCL F;  5IT9 M;  4FFB B;  3CC4 F;  2HS0 A;  3RYF B;  3HJW C;  4M8I A;  3GYQ A;  4XCQ A;  2V9Y A;  4BT5 A;  2KG4 A;  3M1X A;  1X52 A;  1QD9 A;  3C9S A;  5IYZ A;  3N2K B;  4DRX A;  3JAT B;  4ZHW A;  1YHQ F;  3WJQ A;  1W5F A;  3FD5 A;  1QU9 A;  4X1I B;  4G4Z A;  5JH7 A;  1K8A H;  1SDS A;  2Z01 A;  3HTN A;  1YJN F;  1SA0 B;  3CCM F;  3C8L A;  3RA6 A;  4NQ3 A;  3ERN A;  4EI8 A;  3RYC B;  3IKF A;  2OTL F;  1DT9 A;  2HQS C;  4BVS A;  3DDN A;  3KIZ A;  3CC2 F;  3F0F A;  3B6N A;  3U0O A;  2GVI A;  2DYY A;  4HNA B;  2BTQ B;  3K12 A;  4ZHQ B;  1PXW A;  1N8R H;  1U3L A;  5LOV A;  5GAP K;  4BVT A;  5JCO A;  1FNJ A;  1W59 A;  5JVD B;  1YI2 F;  2H8E A;  3ELC A;  2G9I A;  1JFF A;  3FPI A;  5EIB C;  5ITZ B;  1Q86 H;  3WXM B;  2VAW A;  5C8Y A;  1Q81 H;  2ALE A;  5G4U C;  4TV9 B;  4ZHY B;  4I55 B;  3JAS B;  1JN1 A;  1K73 H;  5J2T B;  3HKB A;  4O4I B;  1TUB B;  3LWV C;  2BTO A;  2R75 1;  4BT2 A;  3NK7 A;  1Q82 H;  1T0K B;  2F9Z C;  3LWR C;  5MN5 A;  1RLG A;  2KTU A;  5CB4 A;  4X1Y A;  2P6Y A;  3MDO A;  3GTZ A;  4NWO B;  2ZAU A;  1VQN F;  3CYQ A;  5IYZ B;  3QTY A;  2WAL A;  3LWP C;  2HRY A;  3QHD A;  1IV1 A;  3TD3 A;  3L7Q A;  3F0D A;  3LYB A;  5HY4 A;  1W5B A;  4O4J A;  5JH7 B;  3KHN A;  3CCQ F;  5DCV A;  2FGY A;  1H47 A;  3WGJ A;  4TV8 A;  4G88 A;  3F0G A;  2H8C A;  3RYH A;  4BT3 A;  3JCM M;  1COM A;  3V4D A;  3ZOP A;  3S0H A;  4X3M A;  5EZY A;  5KX5 A;  1W55 A;  5BMV A;  5HY1 A;  5EB0 A;  3DC2 A;  2EWC A;  3ZO8 A;  3OON A;  1YIT F;  1KD1 H;  1KNJ A;  1CN7 A;  2B33 A;  3CD6 F;  1VQ5 F;  3PLA C;  3CC7 F;  1VHA A;  4C82 A;  1YIJ F;  2VXY A;  1OAP A;  5LOV B;  1NMU B;  3D00 A;  2OHW A;  4TV9 A;  3CB2 A;  3O85 A;  2GZL A;  3HKC A;  1FFX A;  2AIZ P;  1JFF B;  3WGL A;  3V3T A;  2CZW A;  2ZF8 A;  4ZHV A;  5C8Y B;  2UYP A;  3CCV F;  1VQ6 F;  1JJ2 F;  1W5E A;  2ZVZ A;  3VOB A;  2CVL A;  2VAM A;  1GX1 A;  3WPX A;  1U40 A;  1U43 A;  1KC8 H;  5HY2 A;  4BT4 A;  3D01 A;  3HKB B;  2ZVY A;  2ZOD A;  1VQV A;  5GIO C;  2IG8 A;  5EO3 A;  3JAR A;  3CXC F;  4BW0 B;  5CB4 B;  4X1Y B;  4E6E A;  4U3J A;  3HAX D;  4TUY A;  2VGM A;  4PWT A;  3FBA A;  2QI2 A;  1W58 1;  1W57 A;  3TD4 A;  3S02 A;  4O4J B;  3JAM M;  3K0T A;  1IV3 A;  3RYI A;  4TV8 B;  3UT5 A;  3MBM A;  3BYQ A;  3RYH B;  4X1K A;  4BT6 A;  1S72 F;  1W2B F;  5EZY B;  4F6R A;  5KX5 B;  2VGN A;  4BVQ A;  5BMV B;  3HKE A;  4EI7 A;  2PHN A;  1K9M H;  2LCA A;  1YJ9 F;  2CHS A;  2QTP A;  4EB6 A;  5LXT A;  4NUT A;  1X7P A;  3PAF A;  3K14 A;  3I7T A;  3VOA A;  3J80 M;  3AGK A;  3OBY A;  3HKC B;  5LYJ A;  1FFX B;  3M84 A;  3IEQ A;  3S06 A;  3CME F;  3NVK E;  2KGW A;  2RHH A;  1RQ2 A;  4B62 A;  2LBW A;  1VK3 A;  3HKD A;  1VH8 A;  5EAZ A; 
#chains in the Genus database with same CATH homology
 4G4Z A;  2N48 A;  3CYP B;  4G4X A;  3WPW A;  4PWT A;  2LBT A;  3S0H A;  2ZVZ A;  2K1S A;  2LCA A;  3TD4 A;  4ZHV A;  5EB1 B;  3S02 A;  3CYQ A;  2L26 A;  3WPX A;  5EAZ A;  5EB0 A;  4R40 B;  4ZHY B;  1R1M A;  4G4W A;  4ERH A;  4G4V A;  3OON A;  2HQS C;  2W8B C;  2ZVY A;  3S06 A;  3TD3 A;  4G4Y A;  3LDT A;  2ZOV A;  3KHN A;  3S0W A;  3TD5 A;  1OAP A;  2MQE A;  3IMP A;  2KGW A;  4B62 A;  4ZHW A;  3S0Y A;  4RHA A;  2AIZ P;  3S03 A;  4G88 A;  4B5C A;  2ZF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...