3LDTA

Crystal structure of an outer membrane protein(ompa)from legionella pneumophila
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
147
structure length
144
Chain Sequence
GLVASIYRDSKRKIIRDLQKQDIQYVEYGDTRTLIIPTDKYFMSSPRLNEICYPGLNNVIRLLNFYPQSTIYVAGFTDNVGSRKRKLSQAQAETMMTFLWANGIAAKRLKAEGYGDKNAISDNAIIHGSAQNRRIEIQWFTSEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an Outer membrane protein(OmpA)from Legionella pneumophila
rcsb
source organism Legionella pneumophila
molecule tags Membrane protein
molecule keywords Outer membrane protein, OmpA family protein
total genus 42
structure length 144
sequence length 147
ec nomenclature
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3ldtA00
4ZHVA 2HQSC 3S0HA 2ZOVA 3WPWA 3LDTA 3WPXA 1OAPA 4ZHYB 3IMPA 4PWTA 5EB0A 4G4WA 5EB1B 5EAZA 2KGWA 4RHAA 3S02A 2L26A 3TD4A 4B62A 3CYQA 2ZF8A 2ZVYA 2K1SA 2MQEA 2LCAA 2W8BC 4ZHWA 3S06A 3TD3A 2LBTA 3TD5A 3KHNA 2AIZP 4B5CA 4G4XA 2ZVZA 4R40B 2N48A 3CYPB 4G4YA 3S03A 4ERHA 3S0YA 4G88A 1R1MA 3OONA 4G4ZA 3S0WA 4G4VA
chains in the Genus database with same CATH superfamily
2YYEA 1FNKA 5CA1A 5LXTA 2G9IA 1JY8A 5LOVA 1VQ9F 3HKDB 2VAMA 1XBIA 3CCQF 2R751 4O4LA 5J2UA 5EWRA 2ZODA 2H8EA 5FNVA 3JAKB 4O4LB 1W42A 3P10A 1IV2A 3CYQA 3BYQA 3DDNA 5B8FA 1N8RH 5IJ9A 4ZOLA 3SIUA 4BVSA 3WGNA 5CA0B 4X1YA 3T80A 3IKFA 5IJ9B 1YGYA 2UYNB 4O4HB 3CYPB 3GHZA 5EIBD 3VOAA 3CC7F 5A2QM 5JQGB 4YJ3A 3VOBA 5LP6A 1H47A 1W55A 3LMEA 3HWUA 4PWTA 1QU9A 5EB0A 2VGMA 4YJ2A 3CCLF 3MCQA 4B46A 3IEQA 4I4TA 2LCAA 5IYZA 4TV8A 1JJ2F 3VTIC 4X1IA 4F6RB 4I4TB 1X25A 5JH7A 1VQKF 4G4XA 2IAFA 3CCMF 3JAKA 2EWCA 1U43A 5LYJB 1U40A 3K2XA 5GANK 2GVIA 4G4VA 3LWQC 3CPQA 3WJPA 5EZYA 3CCRF 1RLUA 1H7MA 3N4YA 4I50B 3ESJA 3R0PA 3WJRA 2HS0A 3RYCB 1SA0A 4M8IA 4RHAA 3N2GB 4HNAB 2HP3A 2W8BC 2HX0A 3CC2F 4U3JA 4ZI7A 1CN7A 3G6EF 4O4JA 2RHLA 4ERHA 3S03A 3RA5A 3E1YA 4G4ZA 1W40A 4X3LA 3F0DA 3WXMB 2QTPA 4X1IB 2GLZA 4O2AA 1XHOA 4EI9A 1K9MH 2PMPA 4C8IA 1W581 3IMPA 4O4IA 4YJ3B 1X7OA 3ELCA 4HNAA 5AVMA 2ZF8A 2ZVYA 3J81M 3ERNA 1VQPF 1VQ7F 2OTMA 3RYIA 3TD3A 3LFOA 2RB9A 3KE1A 3N2GA 4EI7A 2UYKA 3S0YA 3JATB 3K0TA 2H6LA 4C8GA 3F6MA 3IR9A 1XRGA 3EORA 3S0HA 3WPWA 4NWOB 1X7PA 1T0AA 1U3PA 2IQQA 4F6RA 5FNVB 1SZQA 3HTNA 5EO3A 5HP8A 3B6NA 5HY4A 4O4IB 2HS3A 2Z1UA 2WALA 3AGKA 3MCAB 3L7QA 3IKEA 5GONB 2HP0A 3HAXD 1JFFA 4TUYB 4C82A 4X1KB 1PXWA 3E20B 1ODEA 4ZHQB 1R1MA 2VAWA 4X20A 3JASA 3JCMM 1T0KB 2I6DA 1JD1A 3RYFB 4B45A 1YQNA 3VYUC 5C8YA 1U3LA 2LBWA 3IEWA 4BT7A 5C8YB 4TZZA 1H48A 2AIFA 3HKCA 3HKEA 4IHJA 4B62A 5HXUA 5EZYB 2RHOA 3E22A 3QUWA 5HY0A 5GONA 3ON1A 3VIUA 3RYHA 3E22B 3VYTC 1VHAA 5MN4A 3CCUF 3D01A 1VQNF 2ZVZA 1Q82H 4EI8A 3JAWB 5G4UC 2ZAUA 3V4DA 3N4ZA 3DC2A 2VGNA 1RQ7A 1S72F 2F9ZC 2UZHA 5CB4A 3CG6A 3Q8HA 3WGKA 1RLGA 3PAFA 1VQ8F 1PF5A 1Q86H 1OFUA 2JNBA 4LNUA 3CCJF 2Z1EA 4DRXB 1Z5WA 3GYQA 2DT4A 4ZHWA 2P6YA 2VXYA 3TD5A 3KHNA 1VK3A 3C8LA 3RYHB 4DXDA 3WGMA 3VO8A 1KNJA 5ITZA 4C4WC 2KTUA 4BT2A 3S0WA 3FPIA 5MN5A 5ITZB 2LBXA 3MBMA 3J7AR 2HVYD 5GIOC 2KG4A 1FSZA 4ZHQA 1TVKA 2H8CA 4BT4A 4RQOA 5J2TB 1UI9A 2PHNA 3JAMM 4YJ2B 4TV8B 3ZP7A 5LOVB 3JARA 3OW2F 3CCEF 4U3JB 1ONIA 3S06A 4WBNA 5IJ0A 4O4JB 3O85A 4I55A 1COMA 2Q1YA 5EYPB 4WBNB 5IJ0B 2QA4F 1YIJF 3CCSF 1NMUB 2Z1FA 3D00A 1W41A 1W5BA 3JVHA 1YITF 1W5EA 4BVRA 3FD6A 1SA0B 2R6R1 3CCVF 5EB1B 5J2TA 3CD6F 1IV3A 1KQSF 1RA4A 2Q1XA 2L26A 1W2BF 3V3TA 3ZOPA 3HKDA 3UT5B 3WGJA 5FLXM 1J7HA 4FFBA 4IIJA 4O2BA 3NK7A 2CZWA 3G4SF 2CWJA 3JATA 5DCVA 1IV4A 4LCKA 3RE3A 1ZWZA 4ZHVA 3CXCF 3P0ZA 2HQSC 1X52A 4BVTA 4ZHYB 5EYPA 4O2AB 3QHDA 5EAZA 2BTUA 3S02A 3VYSC 4BT5A 3CPWF 2K1SA 3MDOA 5G4VC 5CB4B 1TUBB 4FFBB 3VMFB 5LA6B 3JAWA 2YXZA 1VQVA 5JCOC 2QEXF 4R40B 3NK6A 4G88A 4U39A 1UFYA 3FD5A 1M90H 4NQ3A 3F0GA 1KC8H 3RYCA 5GIPC 1Z5VA 5BMVA 2ZOVA 3KIZA 3U0OA 5LXTB 4X3MA 1QAHA 5FJ4C 1IPAA 1VH8A 3CB2A 1YJWF 3TD4A 1VQ4F 1CLIA 1TUBA 2CHSA 1YHQF 3NVIB 3LWRC 1QVFF 1NJIH 3RA6A 1Q8RA 3SIVA 1XV2A 4X1KA 1QD9A 3D54A 3CMAF 5LP6B 5EIBC 2CVLA 2OTLF 3LYBA 1K73H 4EB6A 2IG8A 3GTZA 1OAPA 3F0FA 4ZK7A 5GAPK 1YJ9F 2BO1A 2B33A 3C9TA 3HKBB 3M4SA 2ALEA 5CA0A 5JVDB 2NMUA 2BTQB 2Z01A 3I3FA 3WJQA 2OTJF 4BW0B 3K14A 3I7TA 1KNKA 4BT3A 1FFXA 3ZO8A 1Q7YH 5LYJA 3M1XA 4O2BB 2HP0B 4EB6B 3WPXA 1VQOF 3N2KA 4E6EA 5HP7A 1SDSA 3HJWC 3JASB 3QTYA 1K8AH 3LWOC 1VQMF 3FFMA 4LNUB 3I55F 4ZI7B 3JARB 2OZBA 3WGLA 5GINC 1W59A 2RHJA 5CA1B 1M1KH 5HWEA 1KD1H 4IHJB 2GZLA 1E7KA 2UYPA 4I55B 4BY9D 1DBFA 4O4HA 4XCQA 1GO0A 4X1YB 1YJNF 2UYNA 3K12A 3HKCB 5JQGA 5HY1A 4ZOLB 4X20B 3V7QA 2OHWA 1VQLF 3VI6A 3LWVC 3J80M 1DT9A 1NQ3A 2KGWA 2UYJA 2V9YA 3RYIB 2DYYA 5BMVB 1TVKB 2BTOA 5LA6A 2I6RA 4IIJB 2RHHA 1IV1A 1GX1A 5IYZB 2QI2A 3HKEB 3NMUC 1W57A 4BT6A 2FC3A 4DRXA 4NUTA 3JALB 3CC4F 5JCOA 3MQWA 3JALA 1W3EX 3LDTA 3PLAC 1RQ2A 3LWPC 2FGYA 5KMGB 1FFXB 3M84A 3NVKE 3CMEF 3G71F 5MN6A 2Z1TA 1JFFB 4TUYA 5HY2A 2MQEA 2LBTA 3UT5A 5IT9M 1GO1A 3C9RA 4TV9B 3I56F 2CW4A 2N48A 4G4YA 4I50A 3F0EA 2HS4A 5J2UB 1Q81H 4TV9A 3RYFA 1W5FA 5HXZA 5LP6C 3C9SA 2CHTA 1VQ6F 3C9UA 3P4EA 1JN1A 3OBYA 3OBWA 4BVQA 3VCZA 2HRYA 4G4WA 3KJJA 1QVGF 3HKBA 1W5AA 5JH7B 4C8EA 2HRUA 3ZP4A 3FBAA 4KWEA 4C81A 5JVDA 3V7EA 3KJKA 1YI2F 5KMGA 1GZ0A 2AIZP 5KX5B 4B5CA 1CK2A 2AMTA 2KTVA 5KX5A 1FNJA 3N2KB 3OONA 2CSLA 1VQ5F 2VAPA
chains in the Genus database with same CATH topology
4ZHVA 2HQSC 3S0HA 2ZOVA 3WPWA 3LDTA 3WPXA 1OAPA 4ZHYB 3IMPA 4PWTA 5EB0A 4G4WA 5EB1B 5EAZA 2KGWA 4RHAA 3S02A 2L26A 3TD4A 4B62A 3CYQA 2ZF8A 2ZVYA 2K1SA 2MQEA 2LCAA 2W8BC 4ZHWA 3S06A 3TD3A 2LBTA 3TD5A 3KHNA 2AIZP 4B5CA 4G4XA 2ZVZA 4R40B 2N48A 3CYPB 4G4YA 3S03A 4ERHA 3S0YA 4G88A 1R1MA 3OONA 4G4ZA 3S0WA 4G4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHV A;  2HQS C;  3S0H A;  2ZOV A;  3WPW A;  3LDT A;  3WPX A;  1OAP A;  4ZHY B;  3IMP A;  4PWT A;  5EB0 A;  4G4W A;  5EB1 B;  5EAZ A;  2KGW A;  4RHA A;  3S02 A;  2L26 A;  3TD4 A;  4B62 A;  3CYQ A;  2ZF8 A;  2ZVY A;  2K1S A;  2MQE A;  2LCA A;  2W8B C;  4ZHW A;  3S06 A;  3TD3 A;  2LBT A;  3TD5 A;  3KHN A;  2AIZ P;  4B5C A;  4G4X A;  2ZVZ A;  4R40 B;  2N48 A;  3CYP B;  4G4Y A;  3S03 A;  4ERH A;  3S0Y A;  4G88 A;  1R1M A;  3OON A;  4G4Z A;  3S0W A;  4G4V A; 
#chains in the Genus database with same CATH topology
 2YYE A;  1FNK A;  5CA1 A;  5LXT A;  2G9I A;  1JY8 A;  5LOV A;  1VQ9 F;  3HKD B;  2VAM A;  1XBI A;  3CCQ F;  2R75 1;  4O4L A;  5J2U A;  5EWR A;  2ZOD A;  2H8E A;  5FNV A;  3JAK B;  4O4L B;  1W42 A;  3P10 A;  1IV2 A;  3CYQ A;  3BYQ A;  3DDN A;  5B8F A;  1N8R H;  5IJ9 A;  4ZOL A;  3SIU A;  4BVS A;  3WGN A;  5CA0 B;  4X1Y A;  3T80 A;  3IKF A;  5IJ9 B;  1YGY A;  2UYN B;  4O4H B;  3CYP B;  3GHZ A;  5EIB D;  3VOA A;  3CC7 F;  5A2Q M;  5JQG B;  4YJ3 A;  3VOB A;  5LP6 A;  1H47 A;  1W55 A;  3LME A;  3HWU A;  4PWT A;  1QU9 A;  5EB0 A;  2VGM A;  4YJ2 A;  3CCL F;  3MCQ A;  4B46 A;  3IEQ A;  4I4T A;  2LCA A;  5IYZ A;  4TV8 A;  1JJ2 F;  3VTI C;  4X1I A;  4F6R B;  4I4T B;  1X25 A;  5JH7 A;  1VQK F;  4G4X A;  2IAF A;  3CCM F;  3JAK A;  2EWC A;  1U43 A;  5LYJ B;  1U40 A;  3K2X A;  5GAN K;  2GVI A;  4G4V A;  3LWQ C;  3CPQ A;  3WJP A;  5EZY A;  3CCR F;  1RLU A;  1H7M A;  3N4Y A;  4I50 B;  3ESJ A;  3R0P A;  3WJR A;  2HS0 A;  3RYC B;  1SA0 A;  4M8I A;  4RHA A;  3N2G B;  4HNA B;  2HP3 A;  2W8B C;  2HX0 A;  3CC2 F;  4U3J A;  4ZI7 A;  1CN7 A;  3G6E F;  4O4J A;  2RHL A;  4ERH A;  3S03 A;  3RA5 A;  3E1Y A;  4G4Z A;  1W40 A;  4X3L A;  3F0D A;  3WXM B;  2QTP A;  4X1I B;  2GLZ A;  4O2A A;  1XHO A;  4EI9 A;  1K9M H;  2PMP A;  4C8I A;  1W58 1;  3IMP A;  4O4I A;  4YJ3 B;  1X7O A;  3ELC A;  4HNA A;  5AVM A;  2ZF8 A;  2ZVY A;  3J81 M;  3ERN A;  1VQP F;  1VQ7 F;  2OTM A;  3RYI A;  3TD3 A;  3LFO A;  2RB9 A;  3KE1 A;  3N2G A;  4EI7 A;  2UYK A;  3S0Y A;  3JAT B;  3K0T A;  2H6L A;  4C8G A;  3F6M A;  3IR9 A;  1XRG A;  3EOR A;  3S0H A;  3WPW A;  4NWO B;  1X7P A;  1T0A A;  1U3P A;  2IQQ A;  4F6R A;  5FNV B;  1SZQ A;  3HTN A;  5EO3 A;  5HP8 A;  3B6N A;  5HY4 A;  4O4I B;  2HS3 A;  2Z1U A;  2WAL A;  3AGK A;  3MCA B;  3L7Q A;  3IKE A;  5GON B;  2HP0 A;  3HAX D;  1JFF A;  4TUY B;  4C82 A;  4X1K B;  1PXW A;  3E20 B;  1ODE A;  4ZHQ B;  1R1M A;  2VAW A;  4X20 A;  3JAS A;  3JCM M;  1T0K B;  2I6D A;  1JD1 A;  3RYF B;  4B45 A;  1YQN A;  3VYU C;  5C8Y A;  1U3L A;  2LBW A;  3IEW A;  4BT7 A;  5C8Y B;  4TZZ A;  1H48 A;  2AIF A;  3HKC A;  3HKE A;  4IHJ A;  4B62 A;  5HXU A;  5EZY B;  2RHO A;  3E22 A;  3QUW A;  5HY0 A;  5GON A;  3ON1 A;  3VIU A;  3RYH A;  3E22 B;  3VYT C;  1VHA A;  5MN4 A;  3CCU F;  3D01 A;  1VQN F;  2ZVZ A;  1Q82 H;  4EI8 A;  3JAW B;  5G4U C;  2ZAU A;  3V4D A;  3N4Z A;  3DC2 A;  2VGN A;  1RQ7 A;  1S72 F;  2F9Z C;  2UZH A;  5CB4 A;  3CG6 A;  3Q8H A;  3WGK A;  1RLG A;  3PAF A;  1VQ8 F;  1PF5 A;  1Q86 H;  1OFU A;  2JNB A;  4LNU A;  3CCJ F;  2Z1E A;  4DRX B;  1Z5W A;  3GYQ A;  2DT4 A;  4ZHW A;  2P6Y A;  2VXY A;  3TD5 A;  3KHN A;  1VK3 A;  3C8L A;  3RYH B;  4DXD A;  3WGM A;  3VO8 A;  1KNJ A;  5ITZ A;  4C4W C;  2KTU A;  4BT2 A;  3S0W A;  3FPI A;  5MN5 A;  5ITZ B;  2LBX A;  3MBM A;  3J7A R;  2HVY D;  5GIO C;  2KG4 A;  1FSZ A;  4ZHQ A;  1TVK A;  2H8C A;  4BT4 A;  4RQO A;  5J2T B;  1UI9 A;  2PHN A;  3JAM M;  4YJ2 B;  4TV8 B;  3ZP7 A;  5LOV B;  3JAR A;  3OW2 F;  3CCE F;  4U3J B;  1ONI A;  3S06 A;  4WBN A;  5IJ0 A;  4O4J B;  3O85 A;  4I55 A;  1COM A;  2Q1Y A;  5EYP B;  4WBN B;  5IJ0 B;  2QA4 F;  1YIJ F;  3CCS F;  1NMU B;  2Z1F A;  3D00 A;  1W41 A;  1W5B A;  3JVH A;  1YIT F;  1W5E A;  4BVR A;  3FD6 A;  1SA0 B;  2R6R 1;  3CCV F;  5EB1 B;  5J2T A;  3CD6 F;  1IV3 A;  1KQS F;  1RA4 A;  2Q1X A;  2L26 A;  1W2B F;  3V3T A;  3ZOP A;  3HKD A;  3UT5 B;  3WGJ A;  5FLX M;  1J7H A;  4FFB A;  4IIJ A;  4O2B A;  3NK7 A;  2CZW A;  3G4S F;  2CWJ A;  3JAT A;  5DCV A;  1IV4 A;  4LCK A;  3RE3 A;  1ZWZ A;  4ZHV A;  3CXC F;  3P0Z A;  2HQS C;  1X52 A;  4BVT A;  4ZHY B;  5EYP A;  4O2A B;  3QHD A;  5EAZ A;  2BTU A;  3S02 A;  3VYS C;  4BT5 A;  3CPW F;  2K1S A;  3MDO A;  5G4V C;  5CB4 B;  1TUB B;  4FFB B;  3VMF B;  5LA6 B;  3JAW A;  2YXZ A;  1VQV A;  5JCO C;  2QEX F;  4R40 B;  3NK6 A;  4G88 A;  4U39 A;  1UFY A;  3FD5 A;  1M90 H;  4NQ3 A;  3F0G A;  1KC8 H;  3RYC A;  5GIP C;  1Z5V A;  5BMV A;  2ZOV A;  3KIZ A;  3U0O A;  5LXT B;  4X3M A;  1QAH A;  5FJ4 C;  1IPA A;  1VH8 A;  3CB2 A;  1YJW F;  3TD4 A;  1VQ4 F;  1CLI A;  1TUB A;  2CHS A;  1YHQ F;  3NVI B;  3LWR C;  1QVF F;  1NJI H;  3RA6 A;  1Q8R A;  3SIV A;  1XV2 A;  4X1K A;  1QD9 A;  3D54 A;  3CMA F;  5LP6 B;  5EIB C;  2CVL A;  2OTL F;  3LYB A;  1K73 H;  4EB6 A;  2IG8 A;  3GTZ A;  1OAP A;  3F0F A;  4ZK7 A;  5GAP K;  1YJ9 F;  2BO1 A;  2B33 A;  3C9T A;  3HKB B;  3M4S A;  2ALE A;  5CA0 A;  5JVD B;  2NMU A;  2BTQ B;  2Z01 A;  3I3F A;  3WJQ A;  2OTJ F;  4BW0 B;  3K14 A;  3I7T A;  1KNK A;  4BT3 A;  1FFX A;  3ZO8 A;  1Q7Y H;  5LYJ A;  3M1X A;  4O2B B;  2HP0 B;  4EB6 B;  3WPX A;  1VQO F;  3N2K A;  4E6E A;  5HP7 A;  1SDS A;  3HJW C;  3JAS B;  3QTY A;  1K8A H;  3LWO C;  1VQM F;  3FFM A;  4LNU B;  3I55 F;  4ZI7 B;  3JAR B;  2OZB A;  3WGL A;  5GIN C;  1W59 A;  2RHJ A;  5CA1 B;  1M1K H;  5HWE A;  1KD1 H;  4IHJ B;  2GZL A;  1E7K A;  2UYP A;  4I55 B;  4BY9 D;  1DBF A;  4O4H A;  4XCQ A;  1GO0 A;  4X1Y B;  1YJN F;  2UYN A;  3K12 A;  3HKC B;  5JQG A;  5HY1 A;  4ZOL B;  4X20 B;  3V7Q A;  2OHW A;  1VQL F;  3VI6 A;  3LWV C;  3J80 M;  1DT9 A;  1NQ3 A;  2KGW A;  2UYJ A;  2V9Y A;  3RYI B;  2DYY A;  5BMV B;  1TVK B;  2BTO A;  5LA6 A;  2I6R A;  4IIJ B;  2RHH A;  1IV1 A;  1GX1 A;  5IYZ B;  2QI2 A;  3HKE B;  3NMU C;  1W57 A;  4BT6 A;  2FC3 A;  4DRX A;  4NUT A;  3JAL B;  3CC4 F;  5JCO A;  3MQW A;  3JAL A;  1W3E X;  3LDT A;  3PLA C;  1RQ2 A;  3LWP C;  2FGY A;  5KMG B;  1FFX B;  3M84 A;  3NVK E;  3CME F;  3G71 F;  5MN6 A;  2Z1T A;  1JFF B;  4TUY A;  5HY2 A;  2MQE A;  2LBT A;  3UT5 A;  5IT9 M;  1GO1 A;  3C9R A;  4TV9 B;  3I56 F;  2CW4 A;  2N48 A;  4G4Y A;  4I50 A;  3F0E A;  2HS4 A;  5J2U B;  1Q81 H;  4TV9 A;  3RYF A;  1W5F A;  5HXZ A;  5LP6 C;  3C9S A;  2CHT A;  1VQ6 F;  3C9U A;  3P4E A;  1JN1 A;  3OBY A;  3OBW A;  4BVQ A;  3VCZ A;  2HRY A;  4G4W A;  3KJJ A;  1QVG F;  3HKB A;  1W5A A;  5JH7 B;  4C8E A;  2HRU A;  3ZP4 A;  3FBA A;  4KWE A;  4C81 A;  5JVD A;  3V7E A;  3KJK A;  1YI2 F;  5KMG A;  1GZ0 A;  2AIZ P;  5KX5 B;  4B5C A;  1CK2 A;  2AMT A;  2KTV A;  5KX5 A;  1FNJ A;  3N2K B;  3OON A;  2CSL A;  1VQ5 F;  2VAP A; 
#chains in the Genus database with same CATH homology
 4ZHV A;  2HQS C;  3S0H A;  2ZOV A;  3WPW A;  3LDT A;  3WPX A;  1OAP A;  4ZHY B;  3IMP A;  4PWT A;  5EB0 A;  4G4W A;  5EB1 B;  5EAZ A;  2KGW A;  4RHA A;  3S02 A;  2L26 A;  3TD4 A;  4B62 A;  3CYQ A;  2ZF8 A;  2ZVY A;  2K1S A;  2MQE A;  2LCA A;  2W8B C;  4ZHW A;  3S06 A;  3TD3 A;  2LBT A;  3TD5 A;  3KHN A;  2AIZ P;  4B5C A;  4G4X A;  2ZVZ A;  4R40 B;  2N48 A;  3CYP B;  4G4Y A;  3S03 A;  4ERH A;  3S0Y A;  4G88 A;  1R1M A;  3OON A;  4G4Z A;  3S0W A;  4G4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...