3LDTA

Crystal structure of an outer membrane protein(ompa)from legionella pneumophila
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
147
structure length
144
Chain Sequence
GLVASIYRDSKRKIIRDLQKQDIQYVEYGDTRTLIIPTDKYFMSSPRLNEICYPGLNNVIRLLNFYPQSTIYVAGFTDNVGSRKRKLSQAQAETMMTFLWANGIAAKRLKAEGYGDKNAISDNAIIHGSAQNRRIEIQWFTSEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an Outer membrane protein(OmpA)from Legionella pneumophila
rcsb
source organism Legionella pneumophila
molecule tags Membrane protein
molecule keywords Outer membrane protein, OmpA family protein
total genus 42
structure length 144
sequence length 147
ec nomenclature
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3ldtA00
3S06A 2L26A 1R1MA 3S0YA 2K1SA 4PWTA 3KHNA 3CYQA 3TD5A 1OAPA 4G4YA 4G4WA 3LDTA 2LCAA 3TD3A 4G4XA 2MQEA 2LBTA 2ZF8A 3WPXA 4ZHVA 4G88A 4R40B 4RHAA 3S02A 3WPWA 2W8BC 4B5CA 2AIZP 5EB0A 5EB1B 5EAZA 2N48A 2KGWA 2HQSC 3S03A 3IMPA 3S0HA 2ZVZA 4ERHA 4G4VA 2ZOVA 4ZHYB 3OONA 3TD4A 4B62A 4ZHWA 3S0WA 2ZVYA 3CYPB 4G4ZA
chains in the Genus database with same CATH superfamily
3UT5A 2L26A 3IKEA 3ZO8A 1GZ0A 3KHNA 3WGMA 4G4YA 2Z1EA 1J7HA 3OBWA 3WJQA 2H6LA 2NMUA 3I55F 3RA6A 5J2UB 5C8YB 2GZLA 1K8AH 4IHJA 3OONA 2AIFA 3MBMA 1W581 4NQ3A 2Z1TA 3S0WA 1VQLF 5J2TA 3LWPC 3KJKA 4IHJB 2ZVYA 3HAXD 3NMUC 4LNUA 3FFMA 5IJ9B 3LWRC 3JAKB 5GONA 3CCVF 1U43A 3LWVC 3CCQF 4FFBA 2R6R1 1VQ9F 1XRGA 5MN5A 2F9ZC 1VQ6F 5KX5A 5EAZA 3KJJA 3S0HA 3MCAB 1YQNA 5HP8A 1YGYA 2BTQB 5GINC 4X1KA 3JARA 1FNKA 4O2BA 4TUYB 1M1KH 3GYQA 2H8CA 3KIZA 3WGJA 4ZOLA 5IYZA 4TV9B 5C8YA 4F6RB 3ERNA 3LMEA 3K0TA 2BO1A 1VK3A 4BVRA 4R40B 2YYEA 4YJ3B 1VH8A 3O85A 3SIVA 3S02A 4X1IA 4FFBB 1PXWA 4WBNA 2VXYA 5BMVB 3S03A 3CCEF 2ZVZA 3MDOA 4ZHYB 4ZI7B 1W40A 2ZODA 3JALB 4EI9A 3C9SA 3E1YA 4BVSA 1ONIA 3M1XA 4X20A 3QUWA 3RYCA 5CA1B 2BTUA 2HP0A 3WJPA 1VQ7F 1XBIA 3CC2F 1GO0A 3L7QA 2KG4A 5AVMA 3G71F 1QD9A 1Q8RA 1W41A 1CN7A 3WGLA 3M84A 3TD3A 3BYQA 3CCRF 1W57A 3HKBA 2IAFA 4TZZA 3E20B 2VAMA 5FNVA 4X1YA 3WGKA 1YIJF 5LXTB 1SA0A 2G9IA 1H7MA 1KNKA 2HX0A 1KQSF 3M4SA 5LOVA 2RHHA 3IEQA 1TUBA 2UYKA 2RHJA 2UZHA 2I6RA 5A2QM 2CW4A 4KWEA 2OHWA 3VTIC 2MQEA 2PHNA 1NMUB 5HWEA 3E22A 3P10A 4TV9A 2FC3A 1YJ9F 3IMPA 3F0DA 2PMPA 1W5EA 3GHZA 3I7TA 4B46A 2R751 3CD6F 3CXCF 3Q8HA 3HJWC 5G4UC 2EWCA 2UYPA 5BMVA 3JARB 3JASA 1ODEA 3WPWA 3CCUF 3D54A 1H48A 4YJ3A 3LWOC 3T80A 2Q1YA 3LDTA 3OW2F 1VQMF 3HKCA 1Q7YH 3HTNA 3N2KB 1VHAA 3NK6A 4BT3A 5HY1A 3JAKA 1W5BA 3HKDB 5LA6A 1NJIH 2W8BC 1SDSA 5LYJB 3I3FA 1QU9A 3VYTC 3F0FA 2KGWA 4HNAB 3HKBB 2UYNA 1IV1A 3R0PA 5EYPA 4U39A 3CPWF 2RHLA 3MQWA 2H8EA 4O2BB 3V4DA 4C82A 3N4YA 3JAWB 1VQ8F 4BT6A 3WXMB 3CB2A 1U3LA 2LCAA 4EI7A 3LYBA 3P4EA 3LFOA 1Z5WA 1RA4A 3F6MA 3VOAA 1W5AA 3WPXA 2YXZA 3K2XA 3WJRA 5KX5B 5GAPK 4NUTA 1Z5VA 5IJ9A 4BT5A 3G4SF 1XHOA 5HY2A 3EORA 4I4TA 4O4IA 1FFXB 3J80M 3N4ZA 1NQ3A 1X7OA 3JAMM 4TV8B 4C8IA 2ALEA 2HP3A 3AGKA 3CYQA 5LYJA 4O4HB 5JCOC 3J81M 4WBNB 2GVIA 1TVKB 3B6NA 4BVQA 2VAWA 5GONB 5HY4A 3VYUC 3RE3A 1KC8H 2HQSC 1W2BF 2Z01A 3ON1A 5LOVB 3KE1A 4YJ2B 3SIUA 5HY0A 3MCQA 3TD4A 1KD1H 4E6EA 5ITZA 2QTPA 5FJ4C 3WGNA 2UYNB 5MN6A 4TV8A 1JY8A 2VAPA 1W59A 3V7QA 1Q82H 1OAPA 3ESJA 3P0ZA 1K9MH 2ZF8A 1IV2A 5JQGA 4G88A 1N8RH 2OTMA 4BT7A 2HRYA 3QTYA 3HWUA 2ZAUA 1QVGF 4BVTA 4DRXA 1VQOF 1X52A 1W55A 4O4LB 1TVKA 5CA0B 5HXUA 5EWRA 1T0KB 1QAHA 1W5FA 1FNJA 3NVIB 5LP6B 5G4VC 3JASB 4YJ2A 4B45A 3CMEF 1JN1A 1SA0B 1FSZA 1IPAA 3GTZA 1GO1A 3S06A 3IR9A 3JATB 3S0YA 4O4JA 2K1SA 3FPIA 1M90H 5GIOC 4G4WA 4X1YB 3E22B 1COMA 4O2AB 3VIUA 1OFUA 3C8LA 4C4WC 1YJNF 2HVYD 3OBYA 5DCVA 5LP6C 3JVHA 5IJ0A 1YHQF 3UT5B 2VGNA 3CCLF 3VCZA 4U3JA 2GLZA 4I50B 2HRUA 4O4LA 4ZK7A 1RQ2A 2OTLF 5LP6A 2Z1FA 3N2GA 3PAFA 1U3PA 3C9UA 4X1IB 3G6EF 4DRXB 4C8GA 5LXTA 4F6RA 2I6DA 2LBWA 2BTOA 1XV2A 1X25A 5EB1B 5JH7A 1VQ5F 5IT9M 2Z1UA 4ZHQB 1PF5A 2HS0A 2ZOVA 5CA1A 2LBXA 1TUBB 4M8IA 4NWOB 3K14A 2IG8A 4ZI7A 3PLAC 3JALA 1K73H 3K12A 5EZYB 3RYFA 3CMAF 4U3JB 3CCJF 4BY9D 5JVDB 3DC2A 4C8EA 3V3TA 2QI2A 4LNUB 2CHTA 5HP7A 3NVKE 4I50A 3FD6A 2JNBA 3IEWA 3QHDA 5EIBD 2DYYA 3D00A 4EB6B 4B62A 2HS4A 5B8FA 5GANK 4ZHQA 4HNAA 3CC7F 1RLUA 4X1KB 3CCMF 3F0GA 4LCKA 4PWTA 2HS3A 4TUYA 3TD5A 3HKDA 2CSLA 5LA6B 3ZP7A 3D01A 4I4TB 2LBTA 3HKEB 3VI6A 4IIJB 5CB4B 1DBFA 1JJ2F 1W42A 1RLGA 4RQOA 1E7KA 5EB0A 2P6YA 3N2GB 3NK7A 1QVFF 4XCQA 2RB9A 5J2TB 5EZYA 5CA0A 3V7EA 4BW0B 1SZQA 2RHOA 3JAWA 5JH7B 3VMFB 1ZWZA 1DT9A 2B33A 2IQQA 3VOBA 2OZBA 3U0OA 1R1MA 1JFFB 5JQGB 5EIBC 3RYIB 1GX1A 3CPQA 4O2AA 2WALA 3CCSF 1VQPF 2KTVA 5J2UA 1VQKF 1RQ7A 1JD1A 3HKCB 4X3MA 3HKEA 2AIZP 1YI2F 2N48A 5ITZB 5FLXM 3I56F 4IIJA 5CB4A 3VO8A 1X7PA 3RYFB 2Q1XA 3RYHA 5KMGB 2QA4F 5IJ0B 2CWJA 1IV3A 4ZHWA 2VGMA 1CLIA 1H47A 5KMGA 5GIPC 2UYJA 1S72F 3ZOPA 2DT4A 1YJWF 5HXZA 3F0EA 2AMTA 3ZP4A 3RYIA 4ZHVA 2KTUA 3JCMM 1KNJA 3CG6A 1YITF 5EO3A 4B5CA 5JVDA 1Q81H 3IKFA 4X3LA 2CZWA 1VQVA 3JATA 3C9RA 3RA5A 2CHSA 4I55A 5JCOA 4O4IB 4C81A 3LWQC 1W3EX 4I55B 3RYHB 3C9TA 2QEXF 1UI9A 1U40A 1VQ4F 3CC4F 4G4XA 4EI8A 3J7AR 1Q86H 4BT2A 5FNVB 4RHAA 3FD5A 3DDNA 1JFFA 4O4HA 1VQNF 4ZOLB 5IYZB 2OTJF 2FGYA 4BT4A 5EYPB 3N2KA 4DXDA 4X20B 3VYSC 4ERHA 3RYCB 4G4VA 2HP0B 3FBAA 4O4JB 5MN4A 1T0AA 1CK2A 1UFYA 1IV4A 4EB6A 2V9YA 1FFXA 3CYPB 3ELCA 2CVLA 4G4ZA
chains in the Genus database with same CATH topology
3S06A 2L26A 1R1MA 3S0YA 2K1SA 4PWTA 3KHNA 3CYQA 3TD5A 1OAPA 4G4YA 4G4WA 3LDTA 2LCAA 3TD3A 4G4XA 2MQEA 2LBTA 2ZF8A 3WPXA 4ZHVA 4G88A 4R40B 4RHAA 3S02A 3WPWA 2W8BC 4B5CA 2AIZP 5EB0A 5EB1B 5EAZA 2N48A 2KGWA 2HQSC 3S03A 3IMPA 3S0HA 2ZVZA 4ERHA 4G4VA 2ZOVA 4ZHYB 3OONA 3TD4A 4B62A 4ZHWA 3S0WA 2ZVYA 3CYPB 4G4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S06 A;  2L26 A;  1R1M A;  3S0Y A;  2K1S A;  4PWT A;  3KHN A;  3CYQ A;  3TD5 A;  1OAP A;  4G4Y A;  4G4W A;  3LDT A;  2LCA A;  3TD3 A;  4G4X A;  2MQE A;  2LBT A;  2ZF8 A;  3WPX A;  4ZHV A;  4G88 A;  4R40 B;  4RHA A;  3S02 A;  3WPW A;  2W8B C;  4B5C A;  2AIZ P;  5EB0 A;  5EB1 B;  5EAZ A;  2N48 A;  2KGW A;  2HQS C;  3S03 A;  3IMP A;  3S0H A;  2ZVZ A;  4ERH A;  4G4V A;  2ZOV A;  4ZHY B;  3OON A;  3TD4 A;  4B62 A;  4ZHW A;  3S0W A;  2ZVY A;  3CYP B;  4G4Z A; 
#chains in the Genus database with same CATH topology
 3UT5 A;  2L26 A;  3IKE A;  3ZO8 A;  1GZ0 A;  3KHN A;  3WGM A;  4G4Y A;  2Z1E A;  1J7H A;  3OBW A;  3WJQ A;  2H6L A;  2NMU A;  3I55 F;  3RA6 A;  5J2U B;  5C8Y B;  2GZL A;  1K8A H;  4IHJ A;  3OON A;  2AIF A;  3MBM A;  1W58 1;  4NQ3 A;  2Z1T A;  3S0W A;  1VQL F;  5J2T A;  3LWP C;  3KJK A;  4IHJ B;  2ZVY A;  3HAX D;  3NMU C;  4LNU A;  3FFM A;  5IJ9 B;  3LWR C;  3JAK B;  5GON A;  3CCV F;  1U43 A;  3LWV C;  3CCQ F;  4FFB A;  2R6R 1;  1VQ9 F;  1XRG A;  5MN5 A;  2F9Z C;  1VQ6 F;  5KX5 A;  5EAZ A;  3KJJ A;  3S0H A;  3MCA B;  1YQN A;  5HP8 A;  1YGY A;  2BTQ B;  5GIN C;  4X1K A;  3JAR A;  1FNK A;  4O2B A;  4TUY B;  1M1K H;  3GYQ A;  2H8C A;  3KIZ A;  3WGJ A;  4ZOL A;  5IYZ A;  4TV9 B;  5C8Y A;  4F6R B;  3ERN A;  3LME A;  3K0T A;  2BO1 A;  1VK3 A;  4BVR A;  4R40 B;  2YYE A;  4YJ3 B;  1VH8 A;  3O85 A;  3SIV A;  3S02 A;  4X1I A;  4FFB B;  1PXW A;  4WBN A;  2VXY A;  5BMV B;  3S03 A;  3CCE F;  2ZVZ A;  3MDO A;  4ZHY B;  4ZI7 B;  1W40 A;  2ZOD A;  3JAL B;  4EI9 A;  3C9S A;  3E1Y A;  4BVS A;  1ONI A;  3M1X A;  4X20 A;  3QUW A;  3RYC A;  5CA1 B;  2BTU A;  2HP0 A;  3WJP A;  1VQ7 F;  1XBI A;  3CC2 F;  1GO0 A;  3L7Q A;  2KG4 A;  5AVM A;  3G71 F;  1QD9 A;  1Q8R A;  1W41 A;  1CN7 A;  3WGL A;  3M84 A;  3TD3 A;  3BYQ A;  3CCR F;  1W57 A;  3HKB A;  2IAF A;  4TZZ A;  3E20 B;  2VAM A;  5FNV A;  4X1Y A;  3WGK A;  1YIJ F;  5LXT B;  1SA0 A;  2G9I A;  1H7M A;  1KNK A;  2HX0 A;  1KQS F;  3M4S A;  5LOV A;  2RHH A;  3IEQ A;  1TUB A;  2UYK A;  2RHJ A;  2UZH A;  2I6R A;  5A2Q M;  2CW4 A;  4KWE A;  2OHW A;  3VTI C;  2MQE A;  2PHN A;  1NMU B;  5HWE A;  3E22 A;  3P10 A;  4TV9 A;  2FC3 A;  1YJ9 F;  3IMP A;  3F0D A;  2PMP A;  1W5E A;  3GHZ A;  3I7T A;  4B46 A;  2R75 1;  3CD6 F;  3CXC F;  3Q8H A;  3HJW C;  5G4U C;  2EWC A;  2UYP A;  5BMV A;  3JAR B;  3JAS A;  1ODE A;  3WPW A;  3CCU F;  3D54 A;  1H48 A;  4YJ3 A;  3LWO C;  3T80 A;  2Q1Y A;  3LDT A;  3OW2 F;  1VQM F;  3HKC A;  1Q7Y H;  3HTN A;  3N2K B;  1VHA A;  3NK6 A;  4BT3 A;  5HY1 A;  3JAK A;  1W5B A;  3HKD B;  5LA6 A;  1NJI H;  2W8B C;  1SDS A;  5LYJ B;  3I3F A;  1QU9 A;  3VYT C;  3F0F A;  2KGW A;  4HNA B;  3HKB B;  2UYN A;  1IV1 A;  3R0P A;  5EYP A;  4U39 A;  3CPW F;  2RHL A;  3MQW A;  2H8E A;  4O2B B;  3V4D A;  4C82 A;  3N4Y A;  3JAW B;  1VQ8 F;  4BT6 A;  3WXM B;  3CB2 A;  1U3L A;  2LCA A;  4EI7 A;  3LYB A;  3P4E A;  3LFO A;  1Z5W A;  1RA4 A;  3F6M A;  3VOA A;  1W5A A;  3WPX A;  2YXZ A;  3K2X A;  3WJR A;  5KX5 B;  5GAP K;  4NUT A;  1Z5V A;  5IJ9 A;  4BT5 A;  3G4S F;  1XHO A;  5HY2 A;  3EOR A;  4I4T A;  4O4I A;  1FFX B;  3J80 M;  3N4Z A;  1NQ3 A;  1X7O A;  3JAM M;  4TV8 B;  4C8I A;  2ALE A;  2HP3 A;  3AGK A;  3CYQ A;  5LYJ A;  4O4H B;  5JCO C;  3J81 M;  4WBN B;  2GVI A;  1TVK B;  3B6N A;  4BVQ A;  2VAW A;  5GON B;  5HY4 A;  3VYU C;  3RE3 A;  1KC8 H;  2HQS C;  1W2B F;  2Z01 A;  3ON1 A;  5LOV B;  3KE1 A;  4YJ2 B;  3SIU A;  5HY0 A;  3MCQ A;  3TD4 A;  1KD1 H;  4E6E A;  5ITZ A;  2QTP A;  5FJ4 C;  3WGN A;  2UYN B;  5MN6 A;  4TV8 A;  1JY8 A;  2VAP A;  1W59 A;  3V7Q A;  1Q82 H;  1OAP A;  3ESJ A;  3P0Z A;  1K9M H;  2ZF8 A;  1IV2 A;  5JQG A;  4G88 A;  1N8R H;  2OTM A;  4BT7 A;  2HRY A;  3QTY A;  3HWU A;  2ZAU A;  1QVG F;  4BVT A;  4DRX A;  1VQO F;  1X52 A;  1W55 A;  4O4L B;  1TVK A;  5CA0 B;  5HXU A;  5EWR A;  1T0K B;  1QAH A;  1W5F A;  1FNJ A;  3NVI B;  5LP6 B;  5G4V C;  3JAS B;  4YJ2 A;  4B45 A;  3CME F;  1JN1 A;  1SA0 B;  1FSZ A;  1IPA A;  3GTZ A;  1GO1 A;  3S06 A;  3IR9 A;  3JAT B;  3S0Y A;  4O4J A;  2K1S A;  3FPI A;  1M90 H;  5GIO C;  4G4W A;  4X1Y B;  3E22 B;  1COM A;  4O2A B;  3VIU A;  1OFU A;  3C8L A;  4C4W C;  1YJN F;  2HVY D;  3OBY A;  5DCV A;  5LP6 C;  3JVH A;  5IJ0 A;  1YHQ F;  3UT5 B;  2VGN A;  3CCL F;  3VCZ A;  4U3J A;  2GLZ A;  4I50 B;  2HRU A;  4O4L A;  4ZK7 A;  1RQ2 A;  2OTL F;  5LP6 A;  2Z1F A;  3N2G A;  3PAF A;  1U3P A;  3C9U A;  4X1I B;  3G6E F;  4DRX B;  4C8G A;  5LXT A;  4F6R A;  2I6D A;  2LBW A;  2BTO A;  1XV2 A;  1X25 A;  5EB1 B;  5JH7 A;  1VQ5 F;  5IT9 M;  2Z1U A;  4ZHQ B;  1PF5 A;  2HS0 A;  2ZOV A;  5CA1 A;  2LBX A;  1TUB B;  4M8I A;  4NWO B;  3K14 A;  2IG8 A;  4ZI7 A;  3PLA C;  3JAL A;  1K73 H;  3K12 A;  5EZY B;  3RYF A;  3CMA F;  4U3J B;  3CCJ F;  4BY9 D;  5JVD B;  3DC2 A;  4C8E A;  3V3T A;  2QI2 A;  4LNU B;  2CHT A;  5HP7 A;  3NVK E;  4I50 A;  3FD6 A;  2JNB A;  3IEW A;  3QHD A;  5EIB D;  2DYY A;  3D00 A;  4EB6 B;  4B62 A;  2HS4 A;  5B8F A;  5GAN K;  4ZHQ A;  4HNA A;  3CC7 F;  1RLU A;  4X1K B;  3CCM F;  3F0G A;  4LCK A;  4PWT A;  2HS3 A;  4TUY A;  3TD5 A;  3HKD A;  2CSL A;  5LA6 B;  3ZP7 A;  3D01 A;  4I4T B;  2LBT A;  3HKE B;  3VI6 A;  4IIJ B;  5CB4 B;  1DBF A;  1JJ2 F;  1W42 A;  1RLG A;  4RQO A;  1E7K A;  5EB0 A;  2P6Y A;  3N2G B;  3NK7 A;  1QVF F;  4XCQ A;  2RB9 A;  5J2T B;  5EZY A;  5CA0 A;  3V7E A;  4BW0 B;  1SZQ A;  2RHO A;  3JAW A;  5JH7 B;  3VMF B;  1ZWZ A;  1DT9 A;  2B33 A;  2IQQ A;  3VOB A;  2OZB A;  3U0O A;  1R1M A;  1JFF B;  5JQG B;  5EIB C;  3RYI B;  1GX1 A;  3CPQ A;  4O2A A;  2WAL A;  3CCS F;  1VQP F;  2KTV A;  5J2U A;  1VQK F;  1RQ7 A;  1JD1 A;  3HKC B;  4X3M A;  3HKE A;  2AIZ P;  1YI2 F;  2N48 A;  5ITZ B;  5FLX M;  3I56 F;  4IIJ A;  5CB4 A;  3VO8 A;  1X7P A;  3RYF B;  2Q1X A;  3RYH A;  5KMG B;  2QA4 F;  5IJ0 B;  2CWJ A;  1IV3 A;  4ZHW A;  2VGM A;  1CLI A;  1H47 A;  5KMG A;  5GIP C;  2UYJ A;  1S72 F;  3ZOP A;  2DT4 A;  1YJW F;  5HXZ A;  3F0E A;  2AMT A;  3ZP4 A;  3RYI A;  4ZHV A;  2KTU A;  3JCM M;  1KNJ A;  3CG6 A;  1YIT F;  5EO3 A;  4B5C A;  5JVD A;  1Q81 H;  3IKF A;  4X3L A;  2CZW A;  1VQV A;  3JAT A;  3C9R A;  3RA5 A;  2CHS A;  4I55 A;  5JCO A;  4O4I B;  4C81 A;  3LWQ C;  1W3E X;  4I55 B;  3RYH B;  3C9T A;  2QEX F;  1UI9 A;  1U40 A;  1VQ4 F;  3CC4 F;  4G4X A;  4EI8 A;  3J7A R;  1Q86 H;  4BT2 A;  5FNV B;  4RHA A;  3FD5 A;  3DDN A;  1JFF A;  4O4H A;  1VQN F;  4ZOL B;  5IYZ B;  2OTJ F;  2FGY A;  4BT4 A;  5EYP B;  3N2K A;  4DXD A;  4X20 B;  3VYS C;  4ERH A;  3RYC B;  4G4V A;  2HP0 B;  3FBA A;  4O4J B;  5MN4 A;  1T0A A;  1CK2 A;  1UFY A;  1IV4 A;  4EB6 A;  2V9Y A;  1FFX A;  3CYP B;  3ELC A;  2CVL A;  4G4Z A; 
#chains in the Genus database with same CATH homology
 3S06 A;  2L26 A;  1R1M A;  3S0Y A;  2K1S A;  4PWT A;  3KHN A;  3CYQ A;  3TD5 A;  1OAP A;  4G4Y A;  4G4W A;  3LDT A;  2LCA A;  3TD3 A;  4G4X A;  2MQE A;  2LBT A;  2ZF8 A;  3WPX A;  4ZHV A;  4G88 A;  4R40 B;  4RHA A;  3S02 A;  3WPW A;  2W8B C;  4B5C A;  2AIZ P;  5EB0 A;  5EB1 B;  5EAZ A;  2N48 A;  2KGW A;  2HQS C;  3S03 A;  3IMP A;  3S0H A;  2ZVZ A;  4ERH A;  4G4V A;  2ZOV A;  4ZHY B;  3OON A;  3TD4 A;  4B62 A;  4ZHW A;  3S0W A;  2ZVY A;  3CYP B;  4G4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...