2ZVYA

Structure of the periplasmic domain of motb from salmonella (crystal form ii)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
183
structure length
183
Chain Sequence
EKQPNIDELKKRMEQSRLNKLRGDLDQLIESDPKLRALRPHLKIDLVQEGLRIQIIDSQNRPMFKTGSAEVEPYMRDILRAIAPVLNGIPNRISLAGHTDDFPYANGEKGYSNWELSADRANASRRELVAGGLDNGKVLRVVGMAATMRLSDRGPDDAINRRISLLVLNKQAEQAILHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein motB
publication title Stator assembly and activation mechanism of the flagellar motor by the periplasmic region of MotB
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Membrane protein
total genus 64
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2zvyA00
1OAPA 4ZHYB 4RHAA 2ZF8A 3LDTA 4ERHA 4G4XA 4G4VA 1R1MA 2ZOVA 3S0HA 3CYQA 5EAZA 2MQEA 2KGWA 4PWTA 3KHNA 5EB1B 2ZVZA 2ZVYA 2L26A 3S06A 2LBTA 3S02A 4ZHWA 4G88A 3OONA 3CYPB 3IMPA 4G4WA 3WPWA 4B62A 3S0WA 3S03A 2N48A 2K1SA 2AIZP 3S0YA 5EB0A 4ZHVA 3TD4A 3TD5A 3TD3A 4R40B 2W8BC 4B5CA 4G4YA 4G4ZA 2LCAA 2HQSC 3WPXA
chains in the Genus database with same CATH superfamily
3RA5A 5HY1A 5JCOC 1IV2A 5LA6B 5J2UA 3CYQA 2AMTA 1VQLF 2VXYA 3FD5A 4NUTA 4C81A 4FFBA 4LNUA 3RYIA 3CPWF 5MN6A 4G4WA 3JCMM 5AVMA 3D54A 4C4WC 2HS3A 3CMEF 5EB0A 3RYHA 1VQ9F 1TVKB 2VGMA 4XCQA 4B5CA 2RHHA 3JATA 4G4ZA 2HQSC 2HRYA 1RLUA 1ONIA 3T80A 1R1MA 1X25A 4YJ2B 3LMEA 3CCVF 2Z01A 2VGNA 3F0DA 3HKEB 3KJKA 1W581 3S06A 3HKBA 5LA6A 1IV1A 3ESJA 1JFFB 3GTZA 5G4UC 3S0WA 5GONA 2DYYA 2V9YA 3IEQA 1XV2A 3CB2A 1S72F 5CA0A 3TD3A 4R40B 2Z1EA 3FFMA 3IEWA 1OFUA 2RHOA 2LCAA 4PWTA 3WPXA 3N4YA 3ZP4A 2QTPA 4ERHA 4G4VA 5CA1B 2Q1XA 2BTUA 2VAWA 1YIJF 2YXZA 4EB6B 3NK7A 2UYJA 4TZZA 5CB4B 1YITF 5KX5A 1NMUB 1QU9A 4G88A 3VYUC 4YJ2A 3AGKA 3WPWA 1T0KB 3JAMM 3F0EA 3MCAB 2N48A 3JAKA 3TD5A 1KNJA 3WJPA 2H8CA 2HRUA 4NWOB 1JFFA 2FC3A 3V3TA 3VO8A 2HX0A 1COMA 3JARB 3JASB 3IKEA 3N2KA 1FFXB 1GZ0A 3EORA 3HKCB 3G6EF 5GAPK 3I7TA 1VQOF 1YI2F 5GIOC 1H48A 5CA1A 1QAHA 4EI8A 3P10A 3G71F 1QD9A 4EB6A 2Q1YA 3GHZA 1SDSA 3QTYA 3S03A 2PHNA 3WGKA 5JVDB 4O4LB 2KG4A 5LP6B 2VAMA 3OBYA 4BVQA 1RLGA 4HNAB 1NJIH 5GIPC 5MN5A 2P6YA 3SIUA 2VAPA 3NK6A 3ON1A 1M90H 5FNVB 2Z1UA 4FFBB 3KHNA 2KTVA 3JASA 5J2TB 1VQ4F 2QA4F 3CD6F 2QEXF 3D01A 3UT5B 3HKCA 3J80M 1H7MA 3I3FA 3RA6A 2KTUA 2G9IA 3DDNA 4ZOLB 2OHWA 1FSZA 3QUWA 3ZOPA 1IPAA 4DXDA 1TUBA 4BVRA 3NMUC 4O4LA 5LP6A 1VQ8F 1Q8RA 4X1IB 1W57A 3HKBB 2UYNA 3HKDA 4HNAA 4O4HB 1JD1A 1NQ3A 5GONB 1DBFA 3WGJA 4B46A 1KC8H 3VYTC 4ZHWA 1GO0A 5CA0B 3WGMA 2OZBA 5FNVA 4X1KA 3WGNA 2AIZP 5J2TA 2DT4A 1M1KH 1VHAA 1SA0B 3UT5A 5FLXM 1XHOA 3V4DA 3HAXD 3VTIC 2R751 5JCOA 3N2GB 3V7EA 2IG8A 4ZHYB 4ZOLA 5HP8A 1Q7YH 1W41A 2RB9A 5IJ9B 5ITZB 5KX5B 3MBMA 2B33A 2WALA 3FD6A 4BT7A 1E7KA 3CCMF 1VQKF 1YHQF 4I4TB 1KNKA 4I55B 4IHJA 3RYCB 3C9RA 1VQPF 3JAKB 2PMPA 4X1IA 3WJRA 1W5AA 3VYSC 4B62A 5HWEA 1VQ6F 2RHJA 1U43A 1YQNA 4O4HA 3CG6A 3TD4A 4TV8B 5IT9M 3N2KB 1PF5A 4X3MA 3RYFB 1KQSF 4C8IA 5IJ0B 1OAPA 1SA0A 2CVLA 4X3LA 5JH7B 2KGWA 2LBXA 3CXCF 4BVTA 3N2GA 3LWVC 3OBWA 1QVFF 2NMUA 5IJ9A 5ITZA 5HXUA 3HWUA 3CC4F 5LOVB 1W40A 5EO3A 4I4TA 2K1SA 4I55A 3RYCA 3CC2F 3M84A 4U3JB 1XRGA 4O4IA 3IKFA 1RA4A 1CK2A 3P0ZA 3LWQC 4ZHQB 4TV8A 2IQQA 2OTJF 3WGLA 3ERNA 3MDOA 5EAZA 5KMGB 2MQEA 3U0OA 4BT6A 3RYFA 3L7QA 5IJ0A 4NQ3A 4X20B 1U3PA 4M8IA 1Z5VA 4BT5A 3JVHA 4EI7A 4O2BA 5JH7A 1VQMF 1W3EX 1TUBB 4I50A 4EI9A 2BTQB 3E1YA 3ZP7A 1VH8A 2W8BC 5LOVA 2UYNB 5IYZB 3PAFA 4BT4A 3HKDB 3LWPC 3ELCA 3K0TA 1QVGF 4U3JA 2ZOVA 3C9TA 3GYQA 2GLZA 4X1KB 4ZHQA 3LWRC 3CCUF 3P4EA 1ZWZA 4WBNA 1FNKA 1RQ2A 4LCKA 5KMGA 3M4SA 2ALEA 3C9SA 4X20A 5GINC 1PXWA 3F0FA 3K2XA 4G4YA 5B8FA 5LP6C 4C8EA 4G4XA 2CSLA 4DRXB 4IHJB 2Z1FA 5IYZA 4O2AB 1Q82H 4BW0B 2HP3A 2Z1TA 3R0PA 3CCLF 1T0AA 3F0GA 3E20B 1K8AH 4C8GA 3I55F 1VQ7F 2GZLA 3VMFB 2UZHA 4ZI7B 4U39A 1W5FA 3S0HA 1J7HA 1Z5WA 2EWCA 5DCVA 2GVIA 2OTLF 1VQ5F 2ZVZA 3DC2A 4DRXA 3E22A 4YJ3B 2F9ZC 5C8YB 2CZWA 1GX1A 3LYBA 4O2AA 4O4IB 3B6NA 4BT3A 3LWOC 3HTNA 1JY8A 5EZYB 3OW2F 3Q8HA 2UYPA 3KE1A 4RHAA 5EIBD 3CCSF 3LDTA 4O4JA 1VQNF 2LBWA 1VQVA 3KIZA 1VK3A 3K14A 3BYQA 4O2BB 2JNBA 3MQWA 4ZI7A 1X7OA 3QHDA 3C8LA 4I50B 4IIJB 3CPQA 1W55A 5EWRA 3RE3A 1U3LA 1KD1H 4B45A 1XBIA 3VI6A 2RHLA 3M1XA 3JAWB 3S0YA 1H47A 5A2QM 4TUYB 2YYEA 1W5BA 1YJ9F 2QI2A 3VIUA 2CHSA 4YJ3A 5C8YA 3FBAA 5G4VC 3I56F 2CW4A 5HY0A 2IAFA 3IR9A 3VOAA 4F6RB 1Q81H 1TVKA 2H8EA 2ZF8A 3MCQA 4X1YB 2HP0B 1W59A 4TV9B 4BT2A 2ZODA 4C82A 4WBNB 2H6LA 1GO1A 5EZYA 5FJ4C 5HY2A 3CCEF 4ZK7A 3CCJF 3LFOA 3WJQA 3NVKE 1Q86H 5GANK 3OONA 1CN7A 3PLAC 3K12A 5HY4A 1W5EA 2I6DA 3VCZA 3HKEA 4ZHVA 3N4ZA 4IIJA 2CWJA 5MN4A 1SZQA 2OTMA 1RQ7A 1YGYA 3JAWA 2UYKA 3C9UA 4TUYA 1U40A 3VOBA 5EYPB 3FPIA 5HXZA 1JJ2F 3JALB 2HS0A 3J7AR 4F6RA 5BMVB 5LYJB 1X7PA 2ZAUA 2BTOA 3F6MA 4X1YA 2HP0A 4TV9A 3S02A 4BY9D 3KJJA 1K9MH 3IMPA 5LXTB 5CB4A 5JQGB 4RQOA 1K73H 2AIFA 3ZO8A 2HVYD 1JN1A 3J81M 1DT9A 5J2UB 3G4SF 1UFYA 3CMAF 1X52A 1IV3A 1FNJA 3HJWC 2FGYA 1YJNF 3WXMB 1IV4A 3E22B 4LNUB 3RYIB 1W2BF 1N8RH 3O85A 2HS4A 4BVSA 3JARA 3CCRF 1W42A 3SIVA 4KWEA 5EB1B 2ZVYA 1YJWF 2L26A 5EYPA 4E6EA 2LBTA 1FFXA 3JALA 3RYHB 3CYPB 3D00A 5EIBC 5BMVA 3JATB 5LYJA 3V7QA 3NVIB 3CC7F 2I6RA 2CHTA 1ODEA 1UI9A 5HP7A 4O4JB 2BO1A 1CLIA 5LXTA 2R6R1 5JQGA 3CCQF 5JVDA
chains in the Genus database with same CATH topology
1OAPA 4ZHYB 4RHAA 2ZF8A 3LDTA 4ERHA 4G4XA 4G4VA 1R1MA 2ZOVA 3S0HA 3CYQA 5EAZA 2MQEA 2KGWA 4PWTA 3KHNA 5EB1B 2ZVZA 2ZVYA 2L26A 3S06A 2LBTA 3S02A 4ZHWA 4G88A 3OONA 3CYPB 3IMPA 4G4WA 3WPWA 4B62A 3S0WA 3S03A 2N48A 2K1SA 2AIZP 3S0YA 5EB0A 4ZHVA 3TD4A 3TD5A 3TD3A 4R40B 2W8BC 4B5CA 4G4YA 4G4ZA 2LCAA 2HQSC 3WPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OAP A;  4ZHY B;  4RHA A;  2ZF8 A;  3LDT A;  4ERH A;  4G4X A;  4G4V A;  1R1M A;  2ZOV A;  3S0H A;  3CYQ A;  5EAZ A;  2MQE A;  2KGW A;  4PWT A;  3KHN A;  5EB1 B;  2ZVZ A;  2ZVY A;  2L26 A;  3S06 A;  2LBT A;  3S02 A;  4ZHW A;  4G88 A;  3OON A;  3CYP B;  3IMP A;  4G4W A;  3WPW A;  4B62 A;  3S0W A;  3S03 A;  2N48 A;  2K1S A;  2AIZ P;  3S0Y A;  5EB0 A;  4ZHV A;  3TD4 A;  3TD5 A;  3TD3 A;  4R40 B;  2W8B C;  4B5C A;  4G4Y A;  4G4Z A;  2LCA A;  2HQS C;  3WPX A; 
#chains in the Genus database with same CATH topology
 3RA5 A;  5HY1 A;  5JCO C;  1IV2 A;  5LA6 B;  5J2U A;  3CYQ A;  2AMT A;  1VQL F;  2VXY A;  3FD5 A;  4NUT A;  4C81 A;  4FFB A;  4LNU A;  3RYI A;  3CPW F;  5MN6 A;  4G4W A;  3JCM M;  5AVM A;  3D54 A;  4C4W C;  2HS3 A;  3CME F;  5EB0 A;  3RYH A;  1VQ9 F;  1TVK B;  2VGM A;  4XCQ A;  4B5C A;  2RHH A;  3JAT A;  4G4Z A;  2HQS C;  2HRY A;  1RLU A;  1ONI A;  3T80 A;  1R1M A;  1X25 A;  4YJ2 B;  3LME A;  3CCV F;  2Z01 A;  2VGN A;  3F0D A;  3HKE B;  3KJK A;  1W58 1;  3S06 A;  3HKB A;  5LA6 A;  1IV1 A;  3ESJ A;  1JFF B;  3GTZ A;  5G4U C;  3S0W A;  5GON A;  2DYY A;  2V9Y A;  3IEQ A;  1XV2 A;  3CB2 A;  1S72 F;  5CA0 A;  3TD3 A;  4R40 B;  2Z1E A;  3FFM A;  3IEW A;  1OFU A;  2RHO A;  2LCA A;  4PWT A;  3WPX A;  3N4Y A;  3ZP4 A;  2QTP A;  4ERH A;  4G4V A;  5CA1 B;  2Q1X A;  2BTU A;  2VAW A;  1YIJ F;  2YXZ A;  4EB6 B;  3NK7 A;  2UYJ A;  4TZZ A;  5CB4 B;  1YIT F;  5KX5 A;  1NMU B;  1QU9 A;  4G88 A;  3VYU C;  4YJ2 A;  3AGK A;  3WPW A;  1T0K B;  3JAM M;  3F0E A;  3MCA B;  2N48 A;  3JAK A;  3TD5 A;  1KNJ A;  3WJP A;  2H8C A;  2HRU A;  4NWO B;  1JFF A;  2FC3 A;  3V3T A;  3VO8 A;  2HX0 A;  1COM A;  3JAR B;  3JAS B;  3IKE A;  3N2K A;  1FFX B;  1GZ0 A;  3EOR A;  3HKC B;  3G6E F;  5GAP K;  3I7T A;  1VQO F;  1YI2 F;  5GIO C;  1H48 A;  5CA1 A;  1QAH A;  4EI8 A;  3P10 A;  3G71 F;  1QD9 A;  4EB6 A;  2Q1Y A;  3GHZ A;  1SDS A;  3QTY A;  3S03 A;  2PHN A;  3WGK A;  5JVD B;  4O4L B;  2KG4 A;  5LP6 B;  2VAM A;  3OBY A;  4BVQ A;  1RLG A;  4HNA B;  1NJI H;  5GIP C;  5MN5 A;  2P6Y A;  3SIU A;  2VAP A;  3NK6 A;  3ON1 A;  1M90 H;  5FNV B;  2Z1U A;  4FFB B;  3KHN A;  2KTV A;  3JAS A;  5J2T B;  1VQ4 F;  2QA4 F;  3CD6 F;  2QEX F;  3D01 A;  3UT5 B;  3HKC A;  3J80 M;  1H7M A;  3I3F A;  3RA6 A;  2KTU A;  2G9I A;  3DDN A;  4ZOL B;  2OHW A;  1FSZ A;  3QUW A;  3ZOP A;  1IPA A;  4DXD A;  1TUB A;  4BVR A;  3NMU C;  4O4L A;  5LP6 A;  1VQ8 F;  1Q8R A;  4X1I B;  1W57 A;  3HKB B;  2UYN A;  3HKD A;  4HNA A;  4O4H B;  1JD1 A;  1NQ3 A;  5GON B;  1DBF A;  3WGJ A;  4B46 A;  1KC8 H;  3VYT C;  4ZHW A;  1GO0 A;  5CA0 B;  3WGM A;  2OZB A;  5FNV A;  4X1K A;  3WGN A;  2AIZ P;  5J2T A;  2DT4 A;  1M1K H;  1VHA A;  1SA0 B;  3UT5 A;  5FLX M;  1XHO A;  3V4D A;  3HAX D;  3VTI C;  2R75 1;  5JCO A;  3N2G B;  3V7E A;  2IG8 A;  4ZHY B;  4ZOL A;  5HP8 A;  1Q7Y H;  1W41 A;  2RB9 A;  5IJ9 B;  5ITZ B;  5KX5 B;  3MBM A;  2B33 A;  2WAL A;  3FD6 A;  4BT7 A;  1E7K A;  3CCM F;  1VQK F;  1YHQ F;  4I4T B;  1KNK A;  4I55 B;  4IHJ A;  3RYC B;  3C9R A;  1VQP F;  3JAK B;  2PMP A;  4X1I A;  3WJR A;  1W5A A;  3VYS C;  4B62 A;  5HWE A;  1VQ6 F;  2RHJ A;  1U43 A;  1YQN A;  4O4H A;  3CG6 A;  3TD4 A;  4TV8 B;  5IT9 M;  3N2K B;  1PF5 A;  4X3M A;  3RYF B;  1KQS F;  4C8I A;  5IJ0 B;  1OAP A;  1SA0 A;  2CVL A;  4X3L A;  5JH7 B;  2KGW A;  2LBX A;  3CXC F;  4BVT A;  3N2G A;  3LWV C;  3OBW A;  1QVF F;  2NMU A;  5IJ9 A;  5ITZ A;  5HXU A;  3HWU A;  3CC4 F;  5LOV B;  1W40 A;  5EO3 A;  4I4T A;  2K1S A;  4I55 A;  3RYC A;  3CC2 F;  3M84 A;  4U3J B;  1XRG A;  4O4I A;  3IKF A;  1RA4 A;  1CK2 A;  3P0Z A;  3LWQ C;  4ZHQ B;  4TV8 A;  2IQQ A;  2OTJ F;  3WGL A;  3ERN A;  3MDO A;  5EAZ A;  5KMG B;  2MQE A;  3U0O A;  4BT6 A;  3RYF A;  3L7Q A;  5IJ0 A;  4NQ3 A;  4X20 B;  1U3P A;  4M8I A;  1Z5V A;  4BT5 A;  3JVH A;  4EI7 A;  4O2B A;  5JH7 A;  1VQM F;  1W3E X;  1TUB B;  4I50 A;  4EI9 A;  2BTQ B;  3E1Y A;  3ZP7 A;  1VH8 A;  2W8B C;  5LOV A;  2UYN B;  5IYZ B;  3PAF A;  4BT4 A;  3HKD B;  3LWP C;  3ELC A;  3K0T A;  1QVG F;  4U3J A;  2ZOV A;  3C9T A;  3GYQ A;  2GLZ A;  4X1K B;  4ZHQ A;  3LWR C;  3CCU F;  3P4E A;  1ZWZ A;  4WBN A;  1FNK A;  1RQ2 A;  4LCK A;  5KMG A;  3M4S A;  2ALE A;  3C9S A;  4X20 A;  5GIN C;  1PXW A;  3F0F A;  3K2X A;  4G4Y A;  5B8F A;  5LP6 C;  4C8E A;  4G4X A;  2CSL A;  4DRX B;  4IHJ B;  2Z1F A;  5IYZ A;  4O2A B;  1Q82 H;  4BW0 B;  2HP3 A;  2Z1T A;  3R0P A;  3CCL F;  1T0A A;  3F0G A;  3E20 B;  1K8A H;  4C8G A;  3I55 F;  1VQ7 F;  2GZL A;  3VMF B;  2UZH A;  4ZI7 B;  4U39 A;  1W5F A;  3S0H A;  1J7H A;  1Z5W A;  2EWC A;  5DCV A;  2GVI A;  2OTL F;  1VQ5 F;  2ZVZ A;  3DC2 A;  4DRX A;  3E22 A;  4YJ3 B;  2F9Z C;  5C8Y B;  2CZW A;  1GX1 A;  3LYB A;  4O2A A;  4O4I B;  3B6N A;  4BT3 A;  3LWO C;  3HTN A;  1JY8 A;  5EZY B;  3OW2 F;  3Q8H A;  2UYP A;  3KE1 A;  4RHA A;  5EIB D;  3CCS F;  3LDT A;  4O4J A;  1VQN F;  2LBW A;  1VQV A;  3KIZ A;  1VK3 A;  3K14 A;  3BYQ A;  4O2B B;  2JNB A;  3MQW A;  4ZI7 A;  1X7O A;  3QHD A;  3C8L A;  4I50 B;  4IIJ B;  3CPQ A;  1W55 A;  5EWR A;  3RE3 A;  1U3L A;  1KD1 H;  4B45 A;  1XBI A;  3VI6 A;  2RHL A;  3M1X A;  3JAW B;  3S0Y A;  1H47 A;  5A2Q M;  4TUY B;  2YYE A;  1W5B A;  1YJ9 F;  2QI2 A;  3VIU A;  2CHS A;  4YJ3 A;  5C8Y A;  3FBA A;  5G4V C;  3I56 F;  2CW4 A;  5HY0 A;  2IAF A;  3IR9 A;  3VOA A;  4F6R B;  1Q81 H;  1TVK A;  2H8E A;  2ZF8 A;  3MCQ A;  4X1Y B;  2HP0 B;  1W59 A;  4TV9 B;  4BT2 A;  2ZOD A;  4C82 A;  4WBN B;  2H6L A;  1GO1 A;  5EZY A;  5FJ4 C;  5HY2 A;  3CCE F;  4ZK7 A;  3CCJ F;  3LFO A;  3WJQ A;  3NVK E;  1Q86 H;  5GAN K;  3OON A;  1CN7 A;  3PLA C;  3K12 A;  5HY4 A;  1W5E A;  2I6D A;  3VCZ A;  3HKE A;  4ZHV A;  3N4Z A;  4IIJ A;  2CWJ A;  5MN4 A;  1SZQ A;  2OTM A;  1RQ7 A;  1YGY A;  3JAW A;  2UYK A;  3C9U A;  4TUY A;  1U40 A;  3VOB A;  5EYP B;  3FPI A;  5HXZ A;  1JJ2 F;  3JAL B;  2HS0 A;  3J7A R;  4F6R A;  5BMV B;  5LYJ B;  1X7P A;  2ZAU A;  2BTO A;  3F6M A;  4X1Y A;  2HP0 A;  4TV9 A;  3S02 A;  4BY9 D;  3KJJ A;  1K9M H;  3IMP A;  5LXT B;  5CB4 A;  5JQG B;  4RQO A;  1K73 H;  2AIF A;  3ZO8 A;  2HVY D;  1JN1 A;  3J81 M;  1DT9 A;  5J2U B;  3G4S F;  1UFY A;  3CMA F;  1X52 A;  1IV3 A;  1FNJ A;  3HJW C;  2FGY A;  1YJN F;  3WXM B;  1IV4 A;  3E22 B;  4LNU B;  3RYI B;  1W2B F;  1N8R H;  3O85 A;  2HS4 A;  4BVS A;  3JAR A;  3CCR F;  1W42 A;  3SIV A;  4KWE A;  5EB1 B;  2ZVY A;  1YJW F;  2L26 A;  5EYP A;  4E6E A;  2LBT A;  1FFX A;  3JAL A;  3RYH B;  3CYP B;  3D00 A;  5EIB C;  5BMV A;  3JAT B;  5LYJ A;  3V7Q A;  3NVI B;  3CC7 F;  2I6R A;  2CHT A;  1ODE A;  1UI9 A;  5HP7 A;  4O4J B;  2BO1 A;  1CLI A;  5LXT A;  2R6R 1;  5JQG A;  3CCQ F;  5JVD A; 
#chains in the Genus database with same CATH homology
 1OAP A;  4ZHY B;  4RHA A;  2ZF8 A;  3LDT A;  4ERH A;  4G4X A;  4G4V A;  1R1M A;  2ZOV A;  3S0H A;  3CYQ A;  5EAZ A;  2MQE A;  2KGW A;  4PWT A;  3KHN A;  5EB1 B;  2ZVZ A;  2ZVY A;  2L26 A;  3S06 A;  2LBT A;  3S02 A;  4ZHW A;  4G88 A;  3OON A;  3CYP B;  3IMP A;  4G4W A;  3WPW A;  4B62 A;  3S0W A;  3S03 A;  2N48 A;  2K1S A;  2AIZ P;  3S0Y A;  5EB0 A;  4ZHV A;  3TD4 A;  3TD5 A;  3TD3 A;  4R40 B;  2W8B C;  4B5C A;  4G4Y A;  4G4Z A;  2LCA A;  2HQS C;  3WPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...