2ZVYA

Structure of the periplasmic domain of motb from salmonella (crystal form ii)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
183
structure length
183
Chain Sequence
EKQPNIDELKKRMEQSRLNKLRGDLDQLIESDPKLRALRPHLKIDLVQEGLRIQIIDSQNRPMFKTGSAEVEPYMRDILRAIAPVLNGIPNRISLAGHTDDFPYANGEKGYSNWELSADRANASRRELVAGGLDNGKVLRVVGMAATMRLSDRGPDDAINRRISLLVLNKQAEQAILHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Chemotaxis protein motB
publication title Stator assembly and activation mechanism of the flagellar motor by the periplasmic region of MotB
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 64
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2zvyA00
4PWTA 5EB0A 3LDTA 3WPXA 4G4WA 2W8BC 2ZVYA 3S03A 4RHAA 1R1MA 4G4ZA 3S02A 4G88A 4G4YA 3S0HA 2ZVZA 4G4XA 2ZF8A 2HQSC 4ZHVA 4R40B 4G4VA 3TD4A 3S06A 2L26A 2AIZP 2LBTA 4B5CA 4ERHA 3TD5A 5EAZA 2MQEA 3IMPA 3KHNA 2KGWA 1OAPA 3CYPB 3OONA 5EB1B 3S0YA 4ZHYB 3TD3A 4ZHWA 2LCAA 3WPWA 4B62A 2N48A 3CYQA 2K1SA 2ZOVA 3S0WA
chains in the Genus database with same CATH superfamily
4TV9A 1FSZA 3VOAA 2Z1EA 3OBYA 2YXZA 3E22B 5CA0B 4U39A 1M90H 3ZOPA 4ZHVA 3HWUA 3G6EF 1W40A 2VGNA 2CW4A 3VYTC 4RQOA 4ZI7B 3CCQF 4X1IA 3MBMA 1W3EX 2BTQB 4ZHQA 2IG8A 3DDNA 4ZHYB 5IJ9B 5LXTA 5GAPK 3T80A 3WPWA 4NQ3A 1YI2F 2KG4A 3RYIB 2AIFA 4FFBB 3D00A 2I6DA 5CB4B 3F0EA 3PLAC 3WGJA 3RYFA 5JVDA 1N8RH 1K8AH 3LWRC 3S06A 4O4JA 4BVSA 3JALA 1W42A 3VYSC 4ZOLA 3C9UA 4IHJB 2Q1YA 3CXCF 5IYZA 2GLZA 4ZHWA 2QEXF 3GHZA 5CA1A 2ALEA 2R6R1 1YJWF 4I4TA 1VQ5F 5JH7A 4IIJA 1NMUB 4EI9A 3VCZA 3Q8HA 3M1XA 1ODEA 2HX0A 1FFXB 1NJIH 1RLUA 1Q86H 5MN4A 2QTPA 3J81M 3WXMB 3NMUC 5FJ4C 5JCOA 2VAWA 4F6RB 1NQ3A 4C8EA 3V3TA 1W5FA 3CC7F 3IR9A 3QUWA 3KHNA 3C9RA 3KJKA 4C8GA 5HXUA 2OTMA 2PMPA 3JAKA 4U3JA 5C8YA 2V9YA 3HKEA 4X1KA 1JY8A 4B62A 1H7MA 2FC3A 1QVGF 3K12A 1S72F 1T0KB 1R1MA 5ITZA 4O4LB 3N4ZA 3P10A 1YGYA 5HY4A 3CCLF 1Z5WA 1X7OA 3RYHB 1Q7YH 1U3LA 3IEQA 3K0TA 2WALA 2UYKA 2CSLA 3CB2A 3HKDB 1VQMF 5EIBD 3HJWC 3CC2F 5J2UB 1SZQA 3TD3A 2HP0A 2UYJA 1U40A 2N48A 1QVFF 4HNAA 1KD1H 3G71F 5CA0A 2Z1TA 4X3LA 5FNVB 4BT4A 4O4IB 4X20A 5AVMA 3S0HA 3VOBA 2I6RA 3M4SA 2Z01A 2H8CA 2OTLF 4O2BA 4ZI7A 2DT4A 3VYUC 3VO8A 3IKFA 3V4DA 1M1KH 5JCOC 5IJ9A 2CHTA 1SA0B 4TV8A 3RYIA 3VMFB 2BO1A 2VAPA 2DYYA 3F0DA 1K73H 4FFBA 4TUYB 4BVRA 4O4HB 5CB4A 5GONB 3N2GA 1XHOA 3ON1A 5EWRA 3K14A 1H48A 1W57A 4O2AB 1XV2A 1W581 4G4YA 4G4XA 5EO3A 1GZ0A 1FNJA 3P4EA 3CCUF 1JD1A 4IHJA 3RYCB 1H47A 4M8IA 4DRXB 4EB6A 3F0GA 1W2BF 3FFMA 3CYQA 2ZOVA 3VI6A 1FFXA 3JATB 5HY2A 4G4WA 5MN6A 3LWPC 4G88A 4F6RA 3C8LA 1YHQF 1CN7A 3WGLA 5EZYB 1UFYA 1IV1A 3NVKE 5EAZA 3JAWB 5LYJB 3G4SF 1W55A 5LA6B 1XBIA 1Z5VA 2ZAUA 4BVTA 4WBNA 3HKBB 4KWEA 3LDTA 5J2TB 4O4LA 4TV9B 3S03A 1JFFB 2Z1FA 1W5AA 4LCKA 3RYHA 3P0ZA 1IV3A 5GINC 2RHJA 4BT3A 3SIVA 4LNUB 3CCJF 4R40B 1IV4A 3HKDA 5LP6B 1SDSA 4YJ2B 1VQVA 3TD5A 3I56F 2OZBA 5J2UA 1KC8H 3CD6F 4C8IA 1X7PA 2JNBA 3CYPB 3OONA 3J7AR 1KNKA 5HY0A 3SIUA 3RA6A 3KJJA 3QTYA 3HAXD 3QHDA 3LWVC 3CMEF 2CZWA 3M84A 5BMVB 4O4IA 3KIZA 2IQQA 4B45A 2GVIA 1YITF 3MCAB 4E6EA 2UYNB 3FBAA 3GYQA 3VIUA 5B8FA 5KX5B 2HVYD 3JASB 3FD6A 1SA0A 5EYPB 1Q81H 3CG6A 3WJQA 4TUYA 2RHHA 4O4HA 5IJ0B 5GONA 4I4TB 4O2AA 2UZHA 3AGKA 3B6NA 5KMGB 3LFOA 3E22A 3K2XA 3RA5A 2F9ZC 3LWOC 2G9IA 3CPQA 2ZVZA 3C9SA 1E7KA 3V7EA 3OBWA 2H8EA 1RLGA 1U3PA 3F0FA 3PAFA 1X25A 4B5CA 1VQLF 1ZWZA 4DRXA 2BTUA 2UYPA 3S0YA 1U43A 2CWJA 1VHAA 4DXDA 3DC2A 3JATA 3MQWA 3MDOA 4ZK7A 2K1SA 3S0WA 3N2KB 4X1KB 4BT6A 1CLIA 2W8BC 3HTNA 3NK6A 3R0PA 5GIPC 4G4ZA 1QU9A 1KNJA 2RHLA 2HRUA 3FPIA 1TUBB 4I50B 3JAWA 1JN1A 5LYJA 2PHNA 3JAMM 5LOVB 1VQNF 2H6LA 3F6MA 3UT5B 4B46A 2OTJF 2KTVA 2P6YA 2KGWA 1DT9A 4BW0B 3ZO8A 3L7QA 1UI9A 4X1YB 5IT9M 1VQ9F 3HKBA 5EIBC 1YIJF 3ERNA 5J2TA 3IKEA 3WPXA 3N4YA 1VQ6F 5GIOC 1JFFA 5EB0A 3O85A 3CCEF 1YJNF 4HNAB 2ZVYA 5FLXM 3HKCB 4C82A 4LNUA 2EWCA 2QA4F 3J80M 1RQ2A 4BVQA 5LP6A 3JARB 4X20B 1TVKB 4YJ2A 1GO0A 4NUTA 4O2BB 4G4VA 3V7QA 2AIZP 2LBTA 4ERHA 4I55B 1XRGA 3D01A 3ZP7A 5JQGB 2VGMA 1K9MH 1T0AA 2LBXA 4X3MA 4C4WC 3CCVF 5HY1A 1W5EA 2BTOA 4TV8B 1VQ7F 5BMVA 3WGMA 4PWTA 4YJ3B 3WJPA 3LWQC 3I55F 1VQ8F 3RE3A 5A2QM 1IV2A 3IEWA 3N2GB 1FNKA 4BY9D 3ZP4A 2IAFA 2GZLA 2UYNA 1QAHA 1RQ7A 5MN5A 3JVHA 5KX5A 2NMUA 3JASA 3ELCA 5EYPA 1VH8A 2L26A 5GANK 3NVIB 3IMPA 2YYEA 5EB1B 5IJ0A 4X1IB 2LBWA 2B33A 3CCSF 2AMTA 1OFUA 2LCAA 4ZHQB 3NK7A 5KMGA 1VQPF 1DBFA 3WJRA 4EB6B 5LXTB 2HP3A 1QD9A 5FNVA 4EI8A 2VAMA 1IPAA 3S02A 1W5BA 1PXWA 3RYFB 2VXYA 2RHOA 5JVDB 3VTIC 4EI7A 1VQ4F 5HP8A 3D54A 5LP6C 1PF5A 1ONIA 1YQNA 3ESJA 4O4JB 3BYQA 4XCQA 3JALB 1VQOF 4NWOB 2HS4A 2QI2A 2FGYA 3N2KA 4ZOLB 3MCQA 2OHWA 1GO1A 2CVLA 5IYZB 5G4VC 3CCMF 3WGKA 5CA1B 4BT2A 4WBNB 5G4UC 1W59A 5JH7B 1VK3A 4IIJB 1VQKF 5DCVA 4BT7A 1COMA 2Q1XA 2RB9A 1GX1A 1YJ9F 4BT5A 1TUBA 2ZF8A 4I50A 1X52A 5LOVA 3UT5A 3OW2F 3CCRF 3CMAF 2HS0A 3RYCA 1J7HA 2MQEA 4X1YA 2HRYA 3CPWF 2R751 3FD5A 1Q82H 4C81A 4TZZA 3KE1A 3I3FA 3E20B 3CC4F 1OAPA 3JAKB 4U3JB 1Q8RA 5C8YB 3HKCA 3HKEB 1JJ2F 1CK2A 4RHAA 1W41A 3JARA 1TVKA 2CHSA 2ZODA 3E1YA 3LYBA 3GTZA 3LMEA 5HP7A 5HWEA 2KTUA 3EORA 2HQSC 5EZYA 3WGNA 5ITZB 4I55A 3TD4A 5JQGA 3JCMM 5LA6A 1RA4A 2Z1UA 2HS3A 5HXZA 4YJ3A 3I7TA 1KQSF 3C9TA 3U0OA 2HP0B
chains in the Genus database with same CATH topology
4PWTA 5EB0A 3LDTA 3WPXA 4G4WA 2W8BC 2ZVYA 3S03A 4RHAA 1R1MA 4G4ZA 3S02A 4G88A 4G4YA 3S0HA 2ZVZA 4G4XA 2ZF8A 2HQSC 4ZHVA 4R40B 4G4VA 3TD4A 3S06A 2L26A 2AIZP 2LBTA 4B5CA 4ERHA 3TD5A 5EAZA 2MQEA 3IMPA 3KHNA 2KGWA 1OAPA 3CYPB 3OONA 5EB1B 3S0YA 4ZHYB 3TD3A 4ZHWA 2LCAA 3WPWA 4B62A 2N48A 3CYQA 2K1SA 2ZOVA 3S0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PWT A;  5EB0 A;  3LDT A;  3WPX A;  4G4W A;  2W8B C;  2ZVY A;  3S03 A;  4RHA A;  1R1M A;  4G4Z A;  3S02 A;  4G88 A;  4G4Y A;  3S0H A;  2ZVZ A;  4G4X A;  2ZF8 A;  2HQS C;  4ZHV A;  4R40 B;  4G4V A;  3TD4 A;  3S06 A;  2L26 A;  2AIZ P;  2LBT A;  4B5C A;  4ERH A;  3TD5 A;  5EAZ A;  2MQE A;  3IMP A;  3KHN A;  2KGW A;  1OAP A;  3CYP B;  3OON A;  5EB1 B;  3S0Y A;  4ZHY B;  3TD3 A;  4ZHW A;  2LCA A;  3WPW A;  4B62 A;  2N48 A;  3CYQ A;  2K1S A;  2ZOV A;  3S0W A; 
#chains in the Genus database with same CATH topology
 4TV9 A;  1FSZ A;  3VOA A;  2Z1E A;  3OBY A;  2YXZ A;  3E22 B;  5CA0 B;  4U39 A;  1M90 H;  3ZOP A;  4ZHV A;  3HWU A;  3G6E F;  1W40 A;  2VGN A;  2CW4 A;  3VYT C;  4RQO A;  4ZI7 B;  3CCQ F;  4X1I A;  3MBM A;  1W3E X;  2BTQ B;  4ZHQ A;  2IG8 A;  3DDN A;  4ZHY B;  5IJ9 B;  5LXT A;  5GAP K;  3T80 A;  3WPW A;  4NQ3 A;  1YI2 F;  2KG4 A;  3RYI B;  2AIF A;  4FFB B;  3D00 A;  2I6D A;  5CB4 B;  3F0E A;  3PLA C;  3WGJ A;  3RYF A;  5JVD A;  1N8R H;  1K8A H;  3LWR C;  3S06 A;  4O4J A;  4BVS A;  3JAL A;  1W42 A;  3VYS C;  4ZOL A;  3C9U A;  4IHJ B;  2Q1Y A;  3CXC F;  5IYZ A;  2GLZ A;  4ZHW A;  2QEX F;  3GHZ A;  5CA1 A;  2ALE A;  2R6R 1;  1YJW F;  4I4T A;  1VQ5 F;  5JH7 A;  4IIJ A;  1NMU B;  4EI9 A;  3VCZ A;  3Q8H A;  3M1X A;  1ODE A;  2HX0 A;  1FFX B;  1NJI H;  1RLU A;  1Q86 H;  5MN4 A;  2QTP A;  3J81 M;  3WXM B;  3NMU C;  5FJ4 C;  5JCO A;  2VAW A;  4F6R B;  1NQ3 A;  4C8E A;  3V3T A;  1W5F A;  3CC7 F;  3IR9 A;  3QUW A;  3KHN A;  3C9R A;  3KJK A;  4C8G A;  5HXU A;  2OTM A;  2PMP A;  3JAK A;  4U3J A;  5C8Y A;  2V9Y A;  3HKE A;  4X1K A;  1JY8 A;  4B62 A;  1H7M A;  2FC3 A;  1QVG F;  3K12 A;  1S72 F;  1T0K B;  1R1M A;  5ITZ A;  4O4L B;  3N4Z A;  3P10 A;  1YGY A;  5HY4 A;  3CCL F;  1Z5W A;  1X7O A;  3RYH B;  1Q7Y H;  1U3L A;  3IEQ A;  3K0T A;  2WAL A;  2UYK A;  2CSL A;  3CB2 A;  3HKD B;  1VQM F;  5EIB D;  3HJW C;  3CC2 F;  5J2U B;  1SZQ A;  3TD3 A;  2HP0 A;  2UYJ A;  1U40 A;  2N48 A;  1QVF F;  4HNA A;  1KD1 H;  3G71 F;  5CA0 A;  2Z1T A;  4X3L A;  5FNV B;  4BT4 A;  4O4I B;  4X20 A;  5AVM A;  3S0H A;  3VOB A;  2I6R A;  3M4S A;  2Z01 A;  2H8C A;  2OTL F;  4O2B A;  4ZI7 A;  2DT4 A;  3VYU C;  3VO8 A;  3IKF A;  3V4D A;  1M1K H;  5JCO C;  5IJ9 A;  2CHT A;  1SA0 B;  4TV8 A;  3RYI A;  3VMF B;  2BO1 A;  2VAP A;  2DYY A;  3F0D A;  1K73 H;  4FFB A;  4TUY B;  4BVR A;  4O4H B;  5CB4 A;  5GON B;  3N2G A;  1XHO A;  3ON1 A;  5EWR A;  3K14 A;  1H48 A;  1W57 A;  4O2A B;  1XV2 A;  1W58 1;  4G4Y A;  4G4X A;  5EO3 A;  1GZ0 A;  1FNJ A;  3P4E A;  3CCU F;  1JD1 A;  4IHJ A;  3RYC B;  1H47 A;  4M8I A;  4DRX B;  4EB6 A;  3F0G A;  1W2B F;  3FFM A;  3CYQ A;  2ZOV A;  3VI6 A;  1FFX A;  3JAT B;  5HY2 A;  4G4W A;  5MN6 A;  3LWP C;  4G88 A;  4F6R A;  3C8L A;  1YHQ F;  1CN7 A;  3WGL A;  5EZY B;  1UFY A;  1IV1 A;  3NVK E;  5EAZ A;  3JAW B;  5LYJ B;  3G4S F;  1W55 A;  5LA6 B;  1XBI A;  1Z5V A;  2ZAU A;  4BVT A;  4WBN A;  3HKB B;  4KWE A;  3LDT A;  5J2T B;  4O4L A;  4TV9 B;  3S03 A;  1JFF B;  2Z1F A;  1W5A A;  4LCK A;  3RYH A;  3P0Z A;  1IV3 A;  5GIN C;  2RHJ A;  4BT3 A;  3SIV A;  4LNU B;  3CCJ F;  4R40 B;  1IV4 A;  3HKD A;  5LP6 B;  1SDS A;  4YJ2 B;  1VQV A;  3TD5 A;  3I56 F;  2OZB A;  5J2U A;  1KC8 H;  3CD6 F;  4C8I A;  1X7P A;  2JNB A;  3CYP B;  3OON A;  3J7A R;  1KNK A;  5HY0 A;  3SIU A;  3RA6 A;  3KJJ A;  3QTY A;  3HAX D;  3QHD A;  3LWV C;  3CME F;  2CZW A;  3M84 A;  5BMV B;  4O4I A;  3KIZ A;  2IQQ A;  4B45 A;  2GVI A;  1YIT F;  3MCA B;  4E6E A;  2UYN B;  3FBA A;  3GYQ A;  3VIU A;  5B8F A;  5KX5 B;  2HVY D;  3JAS B;  3FD6 A;  1SA0 A;  5EYP B;  1Q81 H;  3CG6 A;  3WJQ A;  4TUY A;  2RHH A;  4O4H A;  5IJ0 B;  5GON A;  4I4T B;  4O2A A;  2UZH A;  3AGK A;  3B6N A;  5KMG B;  3LFO A;  3E22 A;  3K2X A;  3RA5 A;  2F9Z C;  3LWO C;  2G9I A;  3CPQ A;  2ZVZ A;  3C9S A;  1E7K A;  3V7E A;  3OBW A;  2H8E A;  1RLG A;  1U3P A;  3F0F A;  3PAF A;  1X25 A;  4B5C A;  1VQL F;  1ZWZ A;  4DRX A;  2BTU A;  2UYP A;  3S0Y A;  1U43 A;  2CWJ A;  1VHA A;  4DXD A;  3DC2 A;  3JAT A;  3MQW A;  3MDO A;  4ZK7 A;  2K1S A;  3S0W A;  3N2K B;  4X1K B;  4BT6 A;  1CLI A;  2W8B C;  3HTN A;  3NK6 A;  3R0P A;  5GIP C;  4G4Z A;  1QU9 A;  1KNJ A;  2RHL A;  2HRU A;  3FPI A;  1TUB B;  4I50 B;  3JAW A;  1JN1 A;  5LYJ A;  2PHN A;  3JAM M;  5LOV B;  1VQN F;  2H6L A;  3F6M A;  3UT5 B;  4B46 A;  2OTJ F;  2KTV A;  2P6Y A;  2KGW A;  1DT9 A;  4BW0 B;  3ZO8 A;  3L7Q A;  1UI9 A;  4X1Y B;  5IT9 M;  1VQ9 F;  3HKB A;  5EIB C;  1YIJ F;  3ERN A;  5J2T A;  3IKE A;  3WPX A;  3N4Y A;  1VQ6 F;  5GIO C;  1JFF A;  5EB0 A;  3O85 A;  3CCE F;  1YJN F;  4HNA B;  2ZVY A;  5FLX M;  3HKC B;  4C82 A;  4LNU A;  2EWC A;  2QA4 F;  3J80 M;  1RQ2 A;  4BVQ A;  5LP6 A;  3JAR B;  4X20 B;  1TVK B;  4YJ2 A;  1GO0 A;  4NUT A;  4O2B B;  4G4V A;  3V7Q A;  2AIZ P;  2LBT A;  4ERH A;  4I55 B;  1XRG A;  3D01 A;  3ZP7 A;  5JQG B;  2VGM A;  1K9M H;  1T0A A;  2LBX A;  4X3M A;  4C4W C;  3CCV F;  5HY1 A;  1W5E A;  2BTO A;  4TV8 B;  1VQ7 F;  5BMV A;  3WGM A;  4PWT A;  4YJ3 B;  3WJP A;  3LWQ C;  3I55 F;  1VQ8 F;  3RE3 A;  5A2Q M;  1IV2 A;  3IEW A;  3N2G B;  1FNK A;  4BY9 D;  3ZP4 A;  2IAF A;  2GZL A;  2UYN A;  1QAH A;  1RQ7 A;  5MN5 A;  3JVH A;  5KX5 A;  2NMU A;  3JAS A;  3ELC A;  5EYP A;  1VH8 A;  2L26 A;  5GAN K;  3NVI B;  3IMP A;  2YYE A;  5EB1 B;  5IJ0 A;  4X1I B;  2LBW A;  2B33 A;  3CCS F;  2AMT A;  1OFU A;  2LCA A;  4ZHQ B;  3NK7 A;  5KMG A;  1VQP F;  1DBF A;  3WJR A;  4EB6 B;  5LXT B;  2HP3 A;  1QD9 A;  5FNV A;  4EI8 A;  2VAM A;  1IPA A;  3S02 A;  1W5B A;  1PXW A;  3RYF B;  2VXY A;  2RHO A;  5JVD B;  3VTI C;  4EI7 A;  1VQ4 F;  5HP8 A;  3D54 A;  5LP6 C;  1PF5 A;  1ONI A;  1YQN A;  3ESJ A;  4O4J B;  3BYQ A;  4XCQ A;  3JAL B;  1VQO F;  4NWO B;  2HS4 A;  2QI2 A;  2FGY A;  3N2K A;  4ZOL B;  3MCQ A;  2OHW A;  1GO1 A;  2CVL A;  5IYZ B;  5G4V C;  3CCM F;  3WGK A;  5CA1 B;  4BT2 A;  4WBN B;  5G4U C;  1W59 A;  5JH7 B;  1VK3 A;  4IIJ B;  1VQK F;  5DCV A;  4BT7 A;  1COM A;  2Q1X A;  2RB9 A;  1GX1 A;  1YJ9 F;  4BT5 A;  1TUB A;  2ZF8 A;  4I50 A;  1X52 A;  5LOV A;  3UT5 A;  3OW2 F;  3CCR F;  3CMA F;  2HS0 A;  3RYC A;  1J7H A;  2MQE A;  4X1Y A;  2HRY A;  3CPW F;  2R75 1;  3FD5 A;  1Q82 H;  4C81 A;  4TZZ A;  3KE1 A;  3I3F A;  3E20 B;  3CC4 F;  1OAP A;  3JAK B;  4U3J B;  1Q8R A;  5C8Y B;  3HKC A;  3HKE B;  1JJ2 F;  1CK2 A;  4RHA A;  1W41 A;  3JAR A;  1TVK A;  2CHS A;  2ZOD A;  3E1Y A;  3LYB A;  3GTZ A;  3LME A;  5HP7 A;  5HWE A;  2KTU A;  3EOR A;  2HQS C;  5EZY A;  3WGN A;  5ITZ B;  4I55 A;  3TD4 A;  5JQG A;  3JCM M;  5LA6 A;  1RA4 A;  2Z1U A;  2HS3 A;  5HXZ A;  4YJ3 A;  3I7T A;  1KQS F;  3C9T A;  3U0O A;  2HP0 B; 
#chains in the Genus database with same CATH homology
 4PWT A;  5EB0 A;  3LDT A;  3WPX A;  4G4W A;  2W8B C;  2ZVY A;  3S03 A;  4RHA A;  1R1M A;  4G4Z A;  3S02 A;  4G88 A;  4G4Y A;  3S0H A;  2ZVZ A;  4G4X A;  2ZF8 A;  2HQS C;  4ZHV A;  4R40 B;  4G4V A;  3TD4 A;  3S06 A;  2L26 A;  2AIZ P;  2LBT A;  4B5C A;  4ERH A;  3TD5 A;  5EAZ A;  2MQE A;  3IMP A;  3KHN A;  2KGW A;  1OAP A;  3CYP B;  3OON A;  5EB1 B;  3S0Y A;  4ZHY B;  3TD3 A;  4ZHW A;  2LCA A;  3WPW A;  4B62 A;  2N48 A;  3CYQ A;  2K1S A;  2ZOV A;  3S0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...