2ZVYA

Structure of the periplasmic domain of motb from salmonella (crystal form ii)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
183
structure length
183
Chain Sequence
b'EKQPNIDELKKRMEQSRLNKLRGDLDQLIESDPKLRALRPHLKIDLVQEGLRIQIIDSQNRPMFKTGSAEVEPYMRDILRAIAPVLNGIPNRISLAGHTDDFPYANGEKGYSNWELSADRANASRRELVAGGLDNGKVLRVVGMAATMRLSDRGPDDAINRRISLLVLNKQAEQAILHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein motB
molecule tags Membrane protein
source organism Salmonella typhimurium
publication title Stator assembly and activation mechanism of the flagellar motor by the periplasmic region of MotB
pubmed doi rcsb
total genus 64
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2zvyA00
4ERHA 2HQSC 1OAPA 2W8BC 4G4YA 2AIZP 3WPWA 2ZVZA 5EAZA 2LCAA 4ZHVA 4G4WA 4ZHWA 3S0HA 2N48A 4B62A 3S02A 3OONA 3S06A 3LDTA 3IMPA 1R1MA 4ZHYB 2MQEA 4RHAA 4R40B 2KGWA 4G4ZA 3S0YA 3WPXA 2K1SA 2ZOVA 3S03A 4B5CA 3CYQA 4G88A 5EB1B 3TD4A 2ZF8A 2LBTA 3KHNA 3CYPB 4PWTA 3TD3A 3TD5A 2L26A 2ZVYA 4G4VA 3S0WA 4G4XA 5EB0A
chains in the Genus database with same CATH superfamily
3OBYA 3DC2A 2AIZP 3CPQA 1KNJA 2LCAA 5IYZA 2H8CA 5JH7B 2LBWA 3VOAA 1W5EA 3N2GB 2Q1YA 5JCOA 4NWOB 4ZHYB 4RHAA 1U43A 3N4ZA 3L7QA 5JH7A 3BYQA 5MN6A 2ZODA 3I55F 2ZOVA 5JVDB 3FD6A 4I50A 3I3FA 1FFXA 2CW4A 3CCUF 4I4TA 1DBFA 1E7KA 5IJ0A 4O2AB 2HS0A 2ZVZA 3D01A 3FBAA 2Z1FA 2UYPA 1N8RH 3OONA 1VQKF 4KWEA 5MN5A 3LWVC 1SDSA 1R1MA 1VHAA 2R6R1 3ON1A 4LNUB 4EB6A 3CC2F 3MCAB 3KJJA 1FNKA 3HKDA 1GO1A 3ERNA 3R0PA 4IHJB 5GONB 4X1IA 5CB4A 4ZHQA 1CN7A 4X1IB 1JFFB 3CCSF 4BVTA 3E1YA 1YQNA 3HKBB 3K2XA 2HX0A 3JAWB 1SA0A 2RB9A 3G71F 1W5AA 4G4YA 3QTYA 2GZLA 5FNVB 2IQQA 4DRXA 3OBWA 3JAWA 1ODEA 2OZBA 3OW2F 1M90H 1JY8A 3KIZA 3S0YA 4C82A 3SIUA 2BO1A 1X52A 2HP3A 2VAWA 2VAPA 3F0GA 3V3TA 4EI7A 1QD9A 2UYKA 5J2TA 1YGYA 2VGNA 2L26A 1W2BF 5JVDA 2RHOA 1KQSF 5IT9M 4F6RA 3F6MA 2HS3A 2WALA 5EB0A 1GO0A 2W8BC 2RHHA 3J81M 3ZO8A 4B46A 5CA0B 4I4TB 1W42A 1VQPF 3CCRF 4C8GA 4O4HA 2I6RA 3IKEA 4O4IB 3KE1A 3ESJA 1X7PA 3NVIB 3D00A 3NMUC 2FC3A 3U0OA 1XHOA 3IEQA 4BT6A 1X25A 1KC8H 3SIVA 3CPWF 1U3LA 1UFYA 1YHQF 5HP7A 2OTJF 1NMUB 2UZHA 3M4SA 1Q7YH 5JCOC 2QEXF 4ZOLB 3V7EA 3E22B 5MN4A 5LP6B 4IIJB 4B45A 4DRXB 2HVYD 1W5BA 3VYUC 5FNVA 5GAPK 5EYPA 3FD5A 4YJ2A 5GIPC 4TUYA 3ZOPA 4X20A 1VQ8F 5EWRA 3PAFA 3JVHA 5IJ9A 2CVLA 2Z1EA 2DYYA 4O2BA 3WPWA 3CC7F 4ZK7A 4G4WA 4O2BB 2GVIA 2N48A 3I7TA 3IR9A 5ITZB 3K14A 5LOVB 1RLGA 4C8EA 1K9MH 5J2UA 5DCVA 2QI2A 4R40B 5GANK 4YJ3B 4BVSA 4U3JB 4IHJA 5HXUA 3JAMM 4X3LA 1VQVA 4TUYB 3UT5A 2RHLA 5AVMA 4YJ3A 3V7QA 2VGMA 5LP6C 3CYPB 4NUTA 3CCQF 5LP6A 4O4LA 5EIBC 1OAPA 4TV9B 1IPAA 2PHNA 1QU9A 2IG8A 1RA4A 2EWCA 3G6EF 4BT2A 1K73H 3JARA 1IV3A 4EB6B 1FFXB 1FSZA 5GINC 1VQ5F 3CCJF 3HAXD 2JNBA 3NK6A 2KTUA 5B8FA 4BY9D 4BW0B 1TVKB 3WGNA 5IJ0B 1YJWF 3KHNA 3LYBA 3C9RA 2G9IA 4G4VA 1UI9A 4X3MA 1DT9A 5CA0A 3G4SF 2HQSC 4I50B 3VYSC 5IYZB 3QUWA 2HS4A 1VH8A 1COMA 5KMGA 1VQMF 3FFMA 3I56F 1QAHA 1GX1A 2DT4A 3DDNA 5HP8A 5J2TB 3C8LA 2KTVA 1CLIA 3N2KA 2OHWA 1VQNF 5LXTA 1YI2F 5FLXM 4WBNB 1Q86H 3J7AR 3HKEB 3TD4A 4HNAB 5LYJA 3TD5A 2QTPA 1H7MA 1S72F 3N4YA 3RYIA 2I6DA 2P6YA 3EORA 3JAKB 3LFOA 4O4LB 2UYJA 3O85A 3C9UA 3JASA 5EZYB 1JJ2F 2R751 3JASB 5EZYA 3CXCF 4NQ3A 2MQEA 3JAKA 3NVKE 3RYCB 3D54A 4I55A 2UYNA 3MQWA 1W40A 3S03A 2Z1TA 3VTIC 5HY0A 2Z01A 4LNUA 1W55A 3FPIA 2LBTA 3MDOA 1VQOF 4G4XA 3T80A 5HY2A 4E6EA 3VI6A 2BTQB 4ZHWA 5IJ9B 1RQ7A 3WJPA 3RYCA 3HKCA 1W41A 3JALA 3LDTA 5LYJB 3K12A 2OTLF 3PLAC 4BT7A 1K8AH 2CSLA 3HKEA 1RQ2A 3F0EA 3WPXA 1W581 2BTOA 4X1YB 4XCQA 2HRUA 5FJ4C 3VCZA 2YYEA 3HTNA 2V9YA 3Q8HA 2LBXA 1VQ6F 2ZVYA 5JQGB 1Q81H 3N2GA 4BVQA 3P4EA 3GTZA 3KJKA 4ZI7B 1U40A 4ZI7A 2ALEA 3S0HA 3CMEF 5JQGA 3CCVF 2Z1UA 2YXZA 3WXMB 3S06A 3HKCB 3JALB 3GYQA 5KX5B 3V4DA 3JARB 3RA6A 1W57A 4EI9A 4TZZA 3VOBA 1PF5A 3LMEA 4BT4A 2VXYA 4O4IA 2HRYA 3CYQA 1Z5WA 5EO3A 4DXDA 4O4JA 5EB1B 5CA1A 3TD3A 4BVRA 2CHSA 3ELCA 2Q1XA 2QA4F 2B33A 3P0ZA 1H48A 1JD1A 1TUBA 3CD6F 3CG6A 2UYNB 3LWPC 4X1KA 4X1YA 2FGYA 1QVGF 3RE3A 5LA6A 4C8IA 4C81A 3WGLA 1KNKA 5A2QM 3GHZA 4O4HB 1W59A 4M8IA 5EIBD 1H47A 2HP0B 3M84A 3WJRA 3VMFB 2F9ZC 5HWEA 4BT5A 1SA0B 2CHTA 3CCLF 1T0AA 2NMUA 4G88A 4TV8A 5G4UC 1X7OA 4U3JA 1Q82H 4F6RB 3CC4F 2KG4A 4C4WC 3F0FA 2H8EA 3HKDB 5LA6B 2OTMA 1IV2A 3WGJA 3RYFB 4EI8A 4ZHVA 3UT5B 3RYIB 2PMPA 2BTUA 3E22A 1ZWZA 4ZOLA 5GIOC 5J2UB 4FFBB 2RHJA 4X20B 4O4JB 5CA1B 4WBNA 1W5FA 5HXZA 1Z5VA 5HY4A 3RYHA 4RQOA 4B5CA 3E20B 2IAFA 1CK2A 3LWOC 3ZP7A 1TVKA 5KMGB 5CB4B 3VO8A 3QHDA 1SZQA 4O2AA 3IKFA 3N2KB 3WGMA 4BT3A 1OFUA 5EYPB 4LCKA 1VQLF 4U39A 4IIJA 3C9TA 1VQ7F 3MCQA 1IV4A 1NQ3A 1XRGA 1T0KB 3HWUA 3RYHB 1YJNF 1M1KH 3VYTC 2ZF8A 3JATB 3C9SA 1KD1H 3HJWC 1Q8RA 3F0DA 3WGKA 3K0TA 4I55B 5EAZA 4TV9A 1JN1A 2H6LA 3P10A 4B62A 3MBMA 3M1XA 5LOVA 1VQ4F 3CB2A 3WJQA 1VK3A 3IMPA 1YITF 1RLUA 4G4ZA 2K1SA 3HKBA 1IV1A 3JCMM 4FFBA 1JFFA 1PXWA 1VQ9F 3J80M 1YJ9F 2CZWA 4HNAA 3CCEF 1U3PA 3RA5A 5HY1A 1YIJF 2GLZA 5C8YA 4PWTA 2CWJA 5ITZA 5LXTB 2ZAUA 3ZP4A 4ERHA 3LWRC 5BMVA 4YJ2B 1FNJA 2AIFA 3RYFA 5BMVB 4X1KB 1XBIA 5C8YB 3LWQC 3S02A 1W3EX 1TUBB 1J7HA 1ONIA 2VAMA 4ZHQB 3CCMF 4TV8B 5GONA 2KGWA 3VIUA 1NJIH 5G4VC 1XV2A 3CMAF 3B6NA 3JATA 2HP0A 1GZ0A 3NK7A 2AMTA 1QVFF 3AGKA 5KX5A 3IEWA 3S0WA
chains in the Genus database with same CATH topology
4ERHA 2HQSC 1OAPA 2W8BC 4G4YA 2AIZP 3WPWA 2ZVZA 5EAZA 2LCAA 4ZHVA 4G4WA 4ZHWA 3S0HA 2N48A 4B62A 3S02A 3OONA 3S06A 3LDTA 3IMPA 1R1MA 4ZHYB 2MQEA 4RHAA 4R40B 2KGWA 4G4ZA 3S0YA 3WPXA 2K1SA 2ZOVA 3S03A 4B5CA 3CYQA 4G88A 5EB1B 3TD4A 2ZF8A 2LBTA 3KHNA 3CYPB 4PWTA 3TD3A 3TD5A 2L26A 2ZVYA 4G4VA 3S0WA 4G4XA 5EB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ERH A;  2HQS C;  1OAP A;  2W8B C;  4G4Y A;  2AIZ P;  3WPW A;  2ZVZ A;  5EAZ A;  2LCA A;  4ZHV A;  4G4W A;  4ZHW A;  3S0H A;  2N48 A;  4B62 A;  3S02 A;  3OON A;  3S06 A;  3LDT A;  3IMP A;  1R1M A;  4ZHY B;  2MQE A;  4RHA A;  4R40 B;  2KGW A;  4G4Z A;  3S0Y A;  3WPX A;  2K1S A;  2ZOV A;  3S03 A;  4B5C A;  3CYQ A;  4G88 A;  5EB1 B;  3TD4 A;  2ZF8 A;  2LBT A;  3KHN A;  3CYP B;  4PWT A;  3TD3 A;  3TD5 A;  2L26 A;  2ZVY A;  4G4V A;  3S0W A;  4G4X A;  5EB0 A; 
#chains in the Genus database with same CATH topology
 3OBY A;  3DC2 A;  2AIZ P;  3CPQ A;  1KNJ A;  2LCA A;  5IYZ A;  2H8C A;  5JH7 B;  2LBW A;  3VOA A;  1W5E A;  3N2G B;  2Q1Y A;  5JCO A;  4NWO B;  4ZHY B;  4RHA A;  1U43 A;  3N4Z A;  3L7Q A;  5JH7 A;  3BYQ A;  5MN6 A;  2ZOD A;  3I55 F;  2ZOV A;  5JVD B;  3FD6 A;  4I50 A;  3I3F A;  1FFX A;  2CW4 A;  3CCU F;  4I4T A;  1DBF A;  1E7K A;  5IJ0 A;  4O2A B;  2HS0 A;  2ZVZ A;  3D01 A;  3FBA A;  2Z1F A;  2UYP A;  1N8R H;  3OON A;  1VQK F;  4KWE A;  5MN5 A;  3LWV C;  1SDS A;  1R1M A;  1VHA A;  2R6R 1;  3ON1 A;  4LNU B;  4EB6 A;  3CC2 F;  3MCA B;  3KJJ A;  1FNK A;  3HKD A;  1GO1 A;  3ERN A;  3R0P A;  4IHJ B;  5GON B;  4X1I A;  5CB4 A;  4ZHQ A;  1CN7 A;  4X1I B;  1JFF B;  3CCS F;  4BVT A;  3E1Y A;  1YQN A;  3HKB B;  3K2X A;  2HX0 A;  3JAW B;  1SA0 A;  2RB9 A;  3G71 F;  1W5A A;  4G4Y A;  3QTY A;  2GZL A;  5FNV B;  2IQQ A;  4DRX A;  3OBW A;  3JAW A;  1ODE A;  2OZB A;  3OW2 F;  1M90 H;  1JY8 A;  3KIZ A;  3S0Y A;  4C82 A;  3SIU A;  2BO1 A;  1X52 A;  2HP3 A;  2VAW A;  2VAP A;  3F0G A;  3V3T A;  4EI7 A;  1QD9 A;  2UYK A;  5J2T A;  1YGY A;  2VGN A;  2L26 A;  1W2B F;  5JVD A;  2RHO A;  1KQS F;  5IT9 M;  4F6R A;  3F6M A;  2HS3 A;  2WAL A;  5EB0 A;  1GO0 A;  2W8B C;  2RHH A;  3J81 M;  3ZO8 A;  4B46 A;  5CA0 B;  4I4T B;  1W42 A;  1VQP F;  3CCR F;  4C8G A;  4O4H A;  2I6R A;  3IKE A;  4O4I B;  3KE1 A;  3ESJ A;  1X7P A;  3NVI B;  3D00 A;  3NMU C;  2FC3 A;  3U0O A;  1XHO A;  3IEQ A;  4BT6 A;  1X25 A;  1KC8 H;  3SIV A;  3CPW F;  1U3L A;  1UFY A;  1YHQ F;  5HP7 A;  2OTJ F;  1NMU B;  2UZH A;  3M4S A;  1Q7Y H;  5JCO C;  2QEX F;  4ZOL B;  3V7E A;  3E22 B;  5MN4 A;  5LP6 B;  4IIJ B;  4B45 A;  4DRX B;  2HVY D;  1W5B A;  3VYU C;  5FNV A;  5GAP K;  5EYP A;  3FD5 A;  4YJ2 A;  5GIP C;  4TUY A;  3ZOP A;  4X20 A;  1VQ8 F;  5EWR A;  3PAF A;  3JVH A;  5IJ9 A;  2CVL A;  2Z1E A;  2DYY A;  4O2B A;  3WPW A;  3CC7 F;  4ZK7 A;  4G4W A;  4O2B B;  2GVI A;  2N48 A;  3I7T A;  3IR9 A;  5ITZ B;  3K14 A;  5LOV B;  1RLG A;  4C8E A;  1K9M H;  5J2U A;  5DCV A;  2QI2 A;  4R40 B;  5GAN K;  4YJ3 B;  4BVS A;  4U3J B;  4IHJ A;  5HXU A;  3JAM M;  4X3L A;  1VQV A;  4TUY B;  3UT5 A;  2RHL A;  5AVM A;  4YJ3 A;  3V7Q A;  2VGM A;  5LP6 C;  3CYP B;  4NUT A;  3CCQ F;  5LP6 A;  4O4L A;  5EIB C;  1OAP A;  4TV9 B;  1IPA A;  2PHN A;  1QU9 A;  2IG8 A;  1RA4 A;  2EWC A;  3G6E F;  4BT2 A;  1K73 H;  3JAR A;  1IV3 A;  4EB6 B;  1FFX B;  1FSZ A;  5GIN C;  1VQ5 F;  3CCJ F;  3HAX D;  2JNB A;  3NK6 A;  2KTU A;  5B8F A;  4BY9 D;  4BW0 B;  1TVK B;  3WGN A;  5IJ0 B;  1YJW F;  3KHN A;  3LYB A;  3C9R A;  2G9I A;  4G4V A;  1UI9 A;  4X3M A;  1DT9 A;  5CA0 A;  3G4S F;  2HQS C;  4I50 B;  3VYS C;  5IYZ B;  3QUW A;  2HS4 A;  1VH8 A;  1COM A;  5KMG A;  1VQM F;  3FFM A;  3I56 F;  1QAH A;  1GX1 A;  2DT4 A;  3DDN A;  5HP8 A;  5J2T B;  3C8L A;  2KTV A;  1CLI A;  3N2K A;  2OHW A;  1VQN F;  5LXT A;  1YI2 F;  5FLX M;  4WBN B;  1Q86 H;  3J7A R;  3HKE B;  3TD4 A;  4HNA B;  5LYJ A;  3TD5 A;  2QTP A;  1H7M A;  1S72 F;  3N4Y A;  3RYI A;  2I6D A;  2P6Y A;  3EOR A;  3JAK B;  3LFO A;  4O4L B;  2UYJ A;  3O85 A;  3C9U A;  3JAS A;  5EZY B;  1JJ2 F;  2R75 1;  3JAS B;  5EZY A;  3CXC F;  4NQ3 A;  2MQE A;  3JAK A;  3NVK E;  3RYC B;  3D54 A;  4I55 A;  2UYN A;  3MQW A;  1W40 A;  3S03 A;  2Z1T A;  3VTI C;  5HY0 A;  2Z01 A;  4LNU A;  1W55 A;  3FPI A;  2LBT A;  3MDO A;  1VQO F;  4G4X A;  3T80 A;  5HY2 A;  4E6E A;  3VI6 A;  2BTQ B;  4ZHW A;  5IJ9 B;  1RQ7 A;  3WJP A;  3RYC A;  3HKC A;  1W41 A;  3JAL A;  3LDT A;  5LYJ B;  3K12 A;  2OTL F;  3PLA C;  4BT7 A;  1K8A H;  2CSL A;  3HKE A;  1RQ2 A;  3F0E A;  3WPX A;  1W58 1;  2BTO A;  4X1Y B;  4XCQ A;  2HRU A;  5FJ4 C;  3VCZ A;  2YYE A;  3HTN A;  2V9Y A;  3Q8H A;  2LBX A;  1VQ6 F;  2ZVY A;  5JQG B;  1Q81 H;  3N2G A;  4BVQ A;  3P4E A;  3GTZ A;  3KJK A;  4ZI7 B;  1U40 A;  4ZI7 A;  2ALE A;  3S0H A;  3CME F;  5JQG A;  3CCV F;  2Z1U A;  2YXZ A;  3WXM B;  3S06 A;  3HKC B;  3JAL B;  3GYQ A;  5KX5 B;  3V4D A;  3JAR B;  3RA6 A;  1W57 A;  4EI9 A;  4TZZ A;  3VOB A;  1PF5 A;  3LME A;  4BT4 A;  2VXY A;  4O4I A;  2HRY A;  3CYQ A;  1Z5W A;  5EO3 A;  4DXD A;  4O4J A;  5EB1 B;  5CA1 A;  3TD3 A;  4BVR A;  2CHS A;  3ELC A;  2Q1X A;  2QA4 F;  2B33 A;  3P0Z A;  1H48 A;  1JD1 A;  1TUB A;  3CD6 F;  3CG6 A;  2UYN B;  3LWP C;  4X1K A;  4X1Y A;  2FGY A;  1QVG F;  3RE3 A;  5LA6 A;  4C8I A;  4C81 A;  3WGL A;  1KNK A;  5A2Q M;  3GHZ A;  4O4H B;  1W59 A;  4M8I A;  5EIB D;  1H47 A;  2HP0 B;  3M84 A;  3WJR A;  3VMF B;  2F9Z C;  5HWE A;  4BT5 A;  1SA0 B;  2CHT A;  3CCL F;  1T0A A;  2NMU A;  4G88 A;  4TV8 A;  5G4U C;  1X7O A;  4U3J A;  1Q82 H;  4F6R B;  3CC4 F;  2KG4 A;  4C4W C;  3F0F A;  2H8E A;  3HKD B;  5LA6 B;  2OTM A;  1IV2 A;  3WGJ A;  3RYF B;  4EI8 A;  4ZHV A;  3UT5 B;  3RYI B;  2PMP A;  2BTU A;  3E22 A;  1ZWZ A;  4ZOL A;  5GIO C;  5J2U B;  4FFB B;  2RHJ A;  4X20 B;  4O4J B;  5CA1 B;  4WBN A;  1W5F A;  5HXZ A;  1Z5V A;  5HY4 A;  3RYH A;  4RQO A;  4B5C A;  3E20 B;  2IAF A;  1CK2 A;  3LWO C;  3ZP7 A;  1TVK A;  5KMG B;  5CB4 B;  3VO8 A;  3QHD A;  1SZQ A;  4O2A A;  3IKF A;  3N2K B;  3WGM A;  4BT3 A;  1OFU A;  5EYP B;  4LCK A;  1VQL F;  4U39 A;  4IIJ A;  3C9T A;  1VQ7 F;  3MCQ A;  1IV4 A;  1NQ3 A;  1XRG A;  1T0K B;  3HWU A;  3RYH B;  1YJN F;  1M1K H;  3VYT C;  2ZF8 A;  3JAT B;  3C9S A;  1KD1 H;  3HJW C;  1Q8R A;  3F0D A;  3WGK A;  3K0T A;  4I55 B;  5EAZ A;  4TV9 A;  1JN1 A;  2H6L A;  3P10 A;  4B62 A;  3MBM A;  3M1X A;  5LOV A;  1VQ4 F;  3CB2 A;  3WJQ A;  1VK3 A;  3IMP A;  1YIT F;  1RLU A;  4G4Z A;  2K1S A;  3HKB A;  1IV1 A;  3JCM M;  4FFB A;  1JFF A;  1PXW A;  1VQ9 F;  3J80 M;  1YJ9 F;  2CZW A;  4HNA A;  3CCE F;  1U3P A;  3RA5 A;  5HY1 A;  1YIJ F;  2GLZ A;  5C8Y A;  4PWT A;  2CWJ A;  5ITZ A;  5LXT B;  2ZAU A;  3ZP4 A;  4ERH A;  3LWR C;  5BMV A;  4YJ2 B;  1FNJ A;  2AIF A;  3RYF A;  5BMV B;  4X1K B;  1XBI A;  5C8Y B;  3LWQ C;  3S02 A;  1W3E X;  1TUB B;  1J7H A;  1ONI A;  2VAM A;  4ZHQ B;  3CCM F;  4TV8 B;  5GON A;  2KGW A;  3VIU A;  1NJI H;  5G4V C;  1XV2 A;  3CMA F;  3B6N A;  3JAT A;  2HP0 A;  1GZ0 A;  3NK7 A;  2AMT A;  1QVF F;  3AGK A;  5KX5 A;  3IEW A;  3S0W A; 
#chains in the Genus database with same CATH homology
 4ERH A;  2HQS C;  1OAP A;  2W8B C;  4G4Y A;  2AIZ P;  3WPW A;  2ZVZ A;  5EAZ A;  2LCA A;  4ZHV A;  4G4W A;  4ZHW A;  3S0H A;  2N48 A;  4B62 A;  3S02 A;  3OON A;  3S06 A;  3LDT A;  3IMP A;  1R1M A;  4ZHY B;  2MQE A;  4RHA A;  4R40 B;  2KGW A;  4G4Z A;  3S0Y A;  3WPX A;  2K1S A;  2ZOV A;  3S03 A;  4B5C A;  3CYQ A;  4G88 A;  5EB1 B;  3TD4 A;  2ZF8 A;  2LBT A;  3KHN A;  3CYP B;  4PWT A;  3TD3 A;  3TD5 A;  2L26 A;  2ZVY A;  4G4V A;  3S0W A;  4G4X A;  5EB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...