3QHDA

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei bound to cytidine, fol795 and fol955
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
159
structure length
159
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 50
structure length 159
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3qhdA00
3GHZA 3P0ZA 1JY8A 3EORA 1KNKA 3FPIA 1H48A 3ELCA 4C82A 1U3PA 3KE1A 3ERNA 2GZLA 1IV1A 3IEQA 2UZHA 2AMTA 3MBMA 1KNJA 1IV3A 1IV4A 3RE3A 1U40A 4C81A 3JVHA 4C8EA 1W57A 1U43A 1VH8A 1W55A 3FBAA 1JN1A 3K2XA 3B6NA 3F0FA 3Q8HA 3T80A 3IKFA 1GX1A 1H47A 4C8GA 3F6MA 1IV2A 3IKEA 3QHDA 3F0EA 3F0DA 3K14A 2PMPA 1YQNA 1VHAA 5B8FA 1U3LA 1T0AA 4C8IA 3F0GA 3ESJA 3IEWA 3P10A
chains in the Genus database with same CATH superfamily
3VYSC 4ZOLA 2CW4A 1PXWA 2OTJF 3E20B 3RYFA 1H48A 3I3FA 4EI8A 2KGWA 2H6LA 4DRXB 4O4IB 1CK2A 4IHJB 5FNVA 3IMPA 4X3MA 1Z5WA 4PWTA 4C8EA 3KIZA 3WXMB 5LP6A 3FBAA 3T80A 1W2BF 2I6RA 3Q8HA 3K0TA 4O4HA 3IKFA 3S03A 4ZHQA 5HP8A 3CCRF 4EI7A 3UT5A 2CZWA 1VK3A 2WALA 5EZYA 5JVDB 5G4VC 2ZF8A 1VQ6F 3RE3A 4G4ZA 1W5FA 2JNBA 2LBWA 4TV9A 3LWQC 5DCVA 5G4UC 3V3TA 4EI9A 4KWEA 4B45A 1K73H 4M8IA 2OTLF 3IEQA 3AGKA 1TUBA 1XRGA 1IV3A 1JJ2F 3U0OA 5CA1B 1GO0A 4C81A 3CCSF 3CC7F 3JVHA 4LNUB 1ONIA 4DXDA 3JAMM 3WJQA 3RYIA 2RHLA 3ZOPA 3CYPB 3WGMA 5CB4B 2HVYD 3S0WA 3ZP4A 2H8EA 3N2GA 3JCMM 4BVSA 3F0GA 1QD9A 3TD4A 1JY8A 4I55B 3CC2F 1M1KH 4G88A 3I7TA 2R6R1 3KHNA 2YXZA 4ZOLB 1W5AA 2KTVA 3D00A 3RA6A 3VCZA 3JALA 3RYFB 1N8RH 3V7EA 3VYUC 5IJ9A 2BTUA 2ZODA 5FNVB 3F0FA 1M90H 1SZQA 3NK6A 2Z1EA 3S0HA 3HTNA 3K12A 3QTYA 5LP6B 3K14A 4O4HB 1YQNA 3CYQA 1H7MA 4ZHQB 2N48A 3UT5B 4TUYA 1FNJA 1W5EA 3VTIC 5EZYB 1W41A 3FPIA 3NK7A 3VO8A 4C82A 3LFOA 3SIUA 2LBTA 5GIOC 4RHAA 1X25A 4I50B 4TV9B 3HAXD 3J80M 1KNJA 3KJJA 5EAZA 1TUBB 2ALEA 3RA5A 2Z1UA 3F6MA 3IR9A 2HP3A 3RYIB 1GZ0A 5HY0A 1OFUA 3HKDA 3C9SA 2HX0A 2OZBA 4BVQA 3CXCF 4X1IA 3N2GB 3HWUA 3HJWC 3KE1A 3J7AR 2V9YA 3JATA 3ERNA 3VOAA 2HS3A 2GZLA 4LNUA 2VAWA 2OTMA 5AVMA 1W59A 3P4EA 1SDSA 3JASB 3JALB 1W581 3V4DA 3HKEB 1Z5VA 2HQSC 1DBFA 3N2KA 3CCMF 1Q81H 1QAHA 4C4WC 5IJ9B 3JAWA 5LOVA 3F0EA 1VQLF 5GONA 2QTPA 2EWCA 2DT4A 2NMUA 4C8IA 4NQ3A 3IEWA 3OONA 1ZWZA 3OBWA 2VAPA 4BT3A 1VQ7F 2GVIA 4TUYB 1JFFA 4NWOB 3WJPA 2HP0A 2HRYA 2UZHA 1COMA 3G4SF 4BVRA 4I4TA 3LDTA 4F6RA 5JCOA 3E22A 2ZVYA 3J81M 1R1MA 4ERHA 2MQEA 3LYBA 2FGYA 4ZHWA 2Q1YA 4BT6A 3LMEA 3LWOC 1IPAA 3HKDB 4BT4A 4I50A 3E1YA 5CA0A 1Q8RA 3WJRA 4ZHYB 4X1IB 2LBXA 3M4SA 3MBMA 3TD3A 4ZHVA 1PF5A 1YI2F 3WGLA 2RHOA 3JATB 3S0YA 3CMEF 1Q7YH 3CCQF 3NVKE 3I55F 3ZP7A 5IT9M 2KG4A 1VQMF 3QHDA 4G4VA 1GO1A 5LYJA 4BT5A 5LXTA 1RLGA 1VHAA 3N4ZA 3O85A 1VQNF 3N2KB 2VGNA 4BW0B 3WGNA 4XCQA 1Q86H 3JAWB 5LOVB 5GONB 2UYJA 1VQ9F 3HKCA 2Z1FA 5EO3A 3CCUF 3DC2A 3JASA 1IV4A 3CPQA 3HKEA 1JFFB 2KTUA 1W55A 2HP0B 2P6YA 4B5CA 2RHHA 1KD1H 1CN7A 1GX1A 4O2AA 3S06A 4I4TB 2FC3A 3F0DA 3L7QA 4IIJA 4O4JA 1DT9A 2HRUA 4F6RB 3E22B 4G4YA 5C8YA 5FLXM 3LWVC 5BMVA 4B62A 3CPWF 3LWPC 4O2BA 4RQOA 5CA0B 1XBIA 4BT7A 3GYQA 2CWJA 1W57A 1UI9A 1VQOF 5A2QM 3R0PA 2BO1A 2IG8A 3FFMA 2Q1XA 4E6EA 1T0AA 1W40A 4ZK7A 5LYJB 4WBNA 5LXTB 1JD1A 3CB2A 3P0ZA 3S02A 3VIUA 2ZOVA 3QUWA 2DYYA 3HKCB 3WGKA 5MN6A 3MDOA 1QVGF 2CHSA 1KC8H 2YYEA 2IAFA 1U43A 5LA6A 5J2TA 2G9IA 1KQSF 3C9UA 3MCQA 1TVKA 3G71F 1NQ3A 2Z01A 2UYNA 3VI6A 4O2AB 1X52A 2RB9A 5HY4A 1RQ2A 3C9RA 4U3JA 3JARA 3PAFA 4IIJB 4O4JB 5HWEA 5JCOC 3NMUC 5C8YB 1VQVA 3KJKA 2IQQA 1FFXB 3ELCA 5IYZA 1Q82H 1VQ5F 1FSZA 3RYCA 3G6EF 3CCVF 5BMVB 1SA0A 2B33A 1E7KA 2VXYA 4U39A 4EB6A 2BTOA 1YJ9F 4O2BB 3ON1A 3M84A 5EIBD 4HNAA 4O4LB 5MN4A 2OHWA 3P10A 3JAKA 5J2UA 1YJNF 5EIBC 3M1XA 1RQ7A 4WBNB 3WPXA 3I56F 5IJ0A 4G4XA 2UYPA 2AMTA 2QI2A 2Z1TA 3VMFB 2CHTA 3RYHB 4FFBA 3WGJA 5HXZA 2W8BC 1X7OA 2ZAUA 5ITZA 2QA4F 4C8GA 4TV8A 5JH7A 1RLUA 2I6DA 5LA6B 3CCEF 5J2TB 2PMPA 2H8CA 1ODEA 1TVKB 2UYNB 5KMGA 1QVFF 2LCAA 4YJ2B 1NJIH 1W5BA 3CCJF 4U3JB 3HKBA 3JARB 1VQ4F 1UFYA 4BVTA 1RA4A 5IYZB 1U40A 3RYCB 3D54A 5HP7A 1VH8A 1YGYA 5EB1B 1SA0B 3CG6A 1H47A 5EB0A 4EB6B 5KX5A 3SIVA 1VQPF 4ZI7A 5FJ4C 1W3EX 2PHNA 3CD6F 1XV2A 1VQ8F 4X20A 1YJWF 2CVLA 4BY9D 1NMUB 1W42A 4HNAB 5GIPC 5GANK 3CMAF 1FFXA 2F9ZC 3GTZA 1XHOA 3EORA 1YITF 3N4YA 1KNKA 5GINC 5JQGA 5MN5A 3JAKB 5J2UB 4R40B 3LWRC 3D01A 3C9TA 1IV1A 1X7PA 4YJ3A 2L26A 2ZVZA 3BYQA 5IJ0B 3V7QA 4X1YA 5EYPA 3K2XA 2BTQB 3B6NA 4X1KA 4O4LA 1YIJF 1K8AH 3TD5A 4FFBB 1IV2A 2K1SA 5ITZB 4TV8B 5JH7B 2UYKA 1FNKA 3GHZA 3NVIB 3PLAC 4DRXA 4O4IA 3OBYA 4IHJA 5GAPK 3CCLF 1YHQF 5KMGB 2GLZA 2HS0A 3OW2F 3RYHA 3HKBB 3ZO8A 2AIZP 1JN1A 1QU9A 3C8LA 3WPWA 4LCKA 5JVDA 4G4WA 3IKEA 2R751 4NUTA 1S72F 3CC4F 3DDNA 3MCAB 5EWRA 5KX5B 2QEXF 4ZI7B 4YJ2A 1CLIA 2VGMA 4X20B 4TZZA 1OAPA 4BT2A 2RHJA 1U3PA 5CA1A 2HS4A 5JQGB 2CSLA 3FD6A 3VYTC 1VQKF 5CB4A 3FD5A 4YJ3B 5HXUA 2AIFA 4X3LA 3VOBA 1K9MH 3MQWA 5HY2A 4X1YB 1T0KB 5EYPB 4X1KB 5HY1A 4B46A 2VAMA 4I55A 5B8FA 1U3LA 5LP6C 1J7HA 3ESJA
chains in the Genus database with same CATH topology
3GHZA 3P0ZA 1JY8A 3EORA 1KNKA 3FPIA 1H48A 3ELCA 4C82A 1U3PA 3KE1A 3ERNA 2GZLA 1IV1A 3IEQA 2UZHA 2AMTA 3MBMA 1KNJA 1IV3A 1IV4A 3RE3A 1U40A 4C81A 3JVHA 4C8EA 1W57A 1U43A 1VH8A 1W55A 3FBAA 1JN1A 3K2XA 3B6NA 3F0FA 3Q8HA 3T80A 3IKFA 1GX1A 1H47A 4C8GA 3F6MA 1IV2A 3IKEA 3QHDA 3F0EA 3F0DA 3K14A 2PMPA 1YQNA 1VHAA 5B8FA 1U3LA 1T0AA 4C8IA 3F0GA 3ESJA 3IEWA 3P10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GHZ A;  3P0Z A;  1JY8 A;  3EOR A;  1KNK A;  3FPI A;  1H48 A;  3ELC A;  4C82 A;  1U3P A;  3KE1 A;  3ERN A;  2GZL A;  1IV1 A;  3IEQ A;  2UZH A;  2AMT A;  3MBM A;  1KNJ A;  1IV3 A;  1IV4 A;  3RE3 A;  1U40 A;  4C81 A;  3JVH A;  4C8E A;  1W57 A;  1U43 A;  1VH8 A;  1W55 A;  3FBA A;  1JN1 A;  3K2X A;  3B6N A;  3F0F A;  3Q8H A;  3T80 A;  3IKF A;  1GX1 A;  1H47 A;  4C8G A;  3F6M A;  1IV2 A;  3IKE A;  3QHD A;  3F0E A;  3F0D A;  3K14 A;  2PMP A;  1YQN A;  1VHA A;  5B8F A;  1U3L A;  1T0A A;  4C8I A;  3F0G A;  3ESJ A;  3IEW A;  3P10 A; 
#chains in the Genus database with same CATH topology
 3VYS C;  4ZOL A;  2CW4 A;  1PXW A;  2OTJ F;  3E20 B;  3RYF A;  1H48 A;  3I3F A;  4EI8 A;  2KGW A;  2H6L A;  4DRX B;  4O4I B;  1CK2 A;  4IHJ B;  5FNV A;  3IMP A;  4X3M A;  1Z5W A;  4PWT A;  4C8E A;  3KIZ A;  3WXM B;  5LP6 A;  3FBA A;  3T80 A;  1W2B F;  2I6R A;  3Q8H A;  3K0T A;  4O4H A;  3IKF A;  3S03 A;  4ZHQ A;  5HP8 A;  3CCR F;  4EI7 A;  3UT5 A;  2CZW A;  1VK3 A;  2WAL A;  5EZY A;  5JVD B;  5G4V C;  2ZF8 A;  1VQ6 F;  3RE3 A;  4G4Z A;  1W5F A;  2JNB A;  2LBW A;  4TV9 A;  3LWQ C;  5DCV A;  5G4U C;  3V3T A;  4EI9 A;  4KWE A;  4B45 A;  1K73 H;  4M8I A;  2OTL F;  3IEQ A;  3AGK A;  1TUB A;  1XRG A;  1IV3 A;  1JJ2 F;  3U0O A;  5CA1 B;  1GO0 A;  4C81 A;  3CCS F;  3CC7 F;  3JVH A;  4LNU B;  1ONI A;  4DXD A;  3JAM M;  3WJQ A;  3RYI A;  2RHL A;  3ZOP A;  3CYP B;  3WGM A;  5CB4 B;  2HVY D;  3S0W A;  3ZP4 A;  2H8E A;  3N2G A;  3JCM M;  4BVS A;  3F0G A;  1QD9 A;  3TD4 A;  1JY8 A;  4I55 B;  3CC2 F;  1M1K H;  4G88 A;  3I7T A;  2R6R 1;  3KHN A;  2YXZ A;  4ZOL B;  1W5A A;  2KTV A;  3D00 A;  3RA6 A;  3VCZ A;  3JAL A;  3RYF B;  1N8R H;  3V7E A;  3VYU C;  5IJ9 A;  2BTU A;  2ZOD A;  5FNV B;  3F0F A;  1M90 H;  1SZQ A;  3NK6 A;  2Z1E A;  3S0H A;  3HTN A;  3K12 A;  3QTY A;  5LP6 B;  3K14 A;  4O4H B;  1YQN A;  3CYQ A;  1H7M A;  4ZHQ B;  2N48 A;  3UT5 B;  4TUY A;  1FNJ A;  1W5E A;  3VTI C;  5EZY B;  1W41 A;  3FPI A;  3NK7 A;  3VO8 A;  4C82 A;  3LFO A;  3SIU A;  2LBT A;  5GIO C;  4RHA A;  1X25 A;  4I50 B;  4TV9 B;  3HAX D;  3J80 M;  1KNJ A;  3KJJ A;  5EAZ A;  1TUB B;  2ALE A;  3RA5 A;  2Z1U A;  3F6M A;  3IR9 A;  2HP3 A;  3RYI B;  1GZ0 A;  5HY0 A;  1OFU A;  3HKD A;  3C9S A;  2HX0 A;  2OZB A;  4BVQ A;  3CXC F;  4X1I A;  3N2G B;  3HWU A;  3HJW C;  3KE1 A;  3J7A R;  2V9Y A;  3JAT A;  3ERN A;  3VOA A;  2HS3 A;  2GZL A;  4LNU A;  2VAW A;  2OTM A;  5AVM A;  1W59 A;  3P4E A;  1SDS A;  3JAS B;  3JAL B;  1W58 1;  3V4D A;  3HKE B;  1Z5V A;  2HQS C;  1DBF A;  3N2K A;  3CCM F;  1Q81 H;  1QAH A;  4C4W C;  5IJ9 B;  3JAW A;  5LOV A;  3F0E A;  1VQL F;  5GON A;  2QTP A;  2EWC A;  2DT4 A;  2NMU A;  4C8I A;  4NQ3 A;  3IEW A;  3OON A;  1ZWZ A;  3OBW A;  2VAP A;  4BT3 A;  1VQ7 F;  2GVI A;  4TUY B;  1JFF A;  4NWO B;  3WJP A;  2HP0 A;  2HRY A;  2UZH A;  1COM A;  3G4S F;  4BVR A;  4I4T A;  3LDT A;  4F6R A;  5JCO A;  3E22 A;  2ZVY A;  3J81 M;  1R1M A;  4ERH A;  2MQE A;  3LYB A;  2FGY A;  4ZHW A;  2Q1Y A;  4BT6 A;  3LME A;  3LWO C;  1IPA A;  3HKD B;  4BT4 A;  4I50 A;  3E1Y A;  5CA0 A;  1Q8R A;  3WJR A;  4ZHY B;  4X1I B;  2LBX A;  3M4S A;  3MBM A;  3TD3 A;  4ZHV A;  1PF5 A;  1YI2 F;  3WGL A;  2RHO A;  3JAT B;  3S0Y A;  3CME F;  1Q7Y H;  3CCQ F;  3NVK E;  3I55 F;  3ZP7 A;  5IT9 M;  2KG4 A;  1VQM F;  3QHD A;  4G4V A;  1GO1 A;  5LYJ A;  4BT5 A;  5LXT A;  1RLG A;  1VHA A;  3N4Z A;  3O85 A;  1VQN F;  3N2K B;  2VGN A;  4BW0 B;  3WGN A;  4XCQ A;  1Q86 H;  3JAW B;  5LOV B;  5GON B;  2UYJ A;  1VQ9 F;  3HKC A;  2Z1F A;  5EO3 A;  3CCU F;  3DC2 A;  3JAS A;  1IV4 A;  3CPQ A;  3HKE A;  1JFF B;  2KTU A;  1W55 A;  2HP0 B;  2P6Y A;  4B5C A;  2RHH A;  1KD1 H;  1CN7 A;  1GX1 A;  4O2A A;  3S06 A;  4I4T B;  2FC3 A;  3F0D A;  3L7Q A;  4IIJ A;  4O4J A;  1DT9 A;  2HRU A;  4F6R B;  3E22 B;  4G4Y A;  5C8Y A;  5FLX M;  3LWV C;  5BMV A;  4B62 A;  3CPW F;  3LWP C;  4O2B A;  4RQO A;  5CA0 B;  1XBI A;  4BT7 A;  3GYQ A;  2CWJ A;  1W57 A;  1UI9 A;  1VQO F;  5A2Q M;  3R0P A;  2BO1 A;  2IG8 A;  3FFM A;  2Q1X A;  4E6E A;  1T0A A;  1W40 A;  4ZK7 A;  5LYJ B;  4WBN A;  5LXT B;  1JD1 A;  3CB2 A;  3P0Z A;  3S02 A;  3VIU A;  2ZOV A;  3QUW A;  2DYY A;  3HKC B;  3WGK A;  5MN6 A;  3MDO A;  1QVG F;  2CHS A;  1KC8 H;  2YYE A;  2IAF A;  1U43 A;  5LA6 A;  5J2T A;  2G9I A;  1KQS F;  3C9U A;  3MCQ A;  1TVK A;  3G71 F;  1NQ3 A;  2Z01 A;  2UYN A;  3VI6 A;  4O2A B;  1X52 A;  2RB9 A;  5HY4 A;  1RQ2 A;  3C9R A;  4U3J A;  3JAR A;  3PAF A;  4IIJ B;  4O4J B;  5HWE A;  5JCO C;  3NMU C;  5C8Y B;  1VQV A;  3KJK A;  2IQQ A;  1FFX B;  3ELC A;  5IYZ A;  1Q82 H;  1VQ5 F;  1FSZ A;  3RYC A;  3G6E F;  3CCV F;  5BMV B;  1SA0 A;  2B33 A;  1E7K A;  2VXY A;  4U39 A;  4EB6 A;  2BTO A;  1YJ9 F;  4O2B B;  3ON1 A;  3M84 A;  5EIB D;  4HNA A;  4O4L B;  5MN4 A;  2OHW A;  3P10 A;  3JAK A;  5J2U A;  1YJN F;  5EIB C;  3M1X A;  1RQ7 A;  4WBN B;  3WPX A;  3I56 F;  5IJ0 A;  4G4X A;  2UYP A;  2AMT A;  2QI2 A;  2Z1T A;  3VMF B;  2CHT A;  3RYH B;  4FFB A;  3WGJ A;  5HXZ A;  2W8B C;  1X7O A;  2ZAU A;  5ITZ A;  2QA4 F;  4C8G A;  4TV8 A;  5JH7 A;  1RLU A;  2I6D A;  5LA6 B;  3CCE F;  5J2T B;  2PMP A;  2H8C A;  1ODE A;  1TVK B;  2UYN B;  5KMG A;  1QVF F;  2LCA A;  4YJ2 B;  1NJI H;  1W5B A;  3CCJ F;  4U3J B;  3HKB A;  3JAR B;  1VQ4 F;  1UFY A;  4BVT A;  1RA4 A;  5IYZ B;  1U40 A;  3RYC B;  3D54 A;  5HP7 A;  1VH8 A;  1YGY A;  5EB1 B;  1SA0 B;  3CG6 A;  1H47 A;  5EB0 A;  4EB6 B;  5KX5 A;  3SIV A;  1VQP F;  4ZI7 A;  5FJ4 C;  1W3E X;  2PHN A;  3CD6 F;  1XV2 A;  1VQ8 F;  4X20 A;  1YJW F;  2CVL A;  4BY9 D;  1NMU B;  1W42 A;  4HNA B;  5GIP C;  5GAN K;  3CMA F;  1FFX A;  2F9Z C;  3GTZ A;  1XHO A;  3EOR A;  1YIT F;  3N4Y A;  1KNK A;  5GIN C;  5JQG A;  5MN5 A;  3JAK B;  5J2U B;  4R40 B;  3LWR C;  3D01 A;  3C9T A;  1IV1 A;  1X7P A;  4YJ3 A;  2L26 A;  2ZVZ A;  3BYQ A;  5IJ0 B;  3V7Q A;  4X1Y A;  5EYP A;  3K2X A;  2BTQ B;  3B6N A;  4X1K A;  4O4L A;  1YIJ F;  1K8A H;  3TD5 A;  4FFB B;  1IV2 A;  2K1S A;  5ITZ B;  4TV8 B;  5JH7 B;  2UYK A;  1FNK A;  3GHZ A;  3NVI B;  3PLA C;  4DRX A;  4O4I A;  3OBY A;  4IHJ A;  5GAP K;  3CCL F;  1YHQ F;  5KMG B;  2GLZ A;  2HS0 A;  3OW2 F;  3RYH A;  3HKB B;  3ZO8 A;  2AIZ P;  1JN1 A;  1QU9 A;  3C8L A;  3WPW A;  4LCK A;  5JVD A;  4G4W A;  3IKE A;  2R75 1;  4NUT A;  1S72 F;  3CC4 F;  3DDN A;  3MCA B;  5EWR A;  5KX5 B;  2QEX F;  4ZI7 B;  4YJ2 A;  1CLI A;  2VGM A;  4X20 B;  4TZZ A;  1OAP A;  4BT2 A;  2RHJ A;  1U3P A;  5CA1 A;  2HS4 A;  5JQG B;  2CSL A;  3FD6 A;  3VYT C;  1VQK F;  5CB4 A;  3FD5 A;  4YJ3 B;  5HXU A;  2AIF A;  4X3L A;  3VOB A;  1K9M H;  3MQW A;  5HY2 A;  4X1Y B;  1T0K B;  5EYP B;  4X1K B;  5HY1 A;  4B46 A;  2VAM A;  4I55 A;  5B8F A;  1U3L A;  5LP6 C;  1J7H A;  3ESJ A; 
#chains in the Genus database with same CATH homology
 3GHZ A;  3P0Z A;  1JY8 A;  3EOR A;  1KNK A;  3FPI A;  1H48 A;  3ELC A;  4C82 A;  1U3P A;  3KE1 A;  3ERN A;  2GZL A;  1IV1 A;  3IEQ A;  2UZH A;  2AMT A;  3MBM A;  1KNJ A;  1IV3 A;  1IV4 A;  3RE3 A;  1U40 A;  4C81 A;  3JVH A;  4C8E A;  1W57 A;  1U43 A;  1VH8 A;  1W55 A;  3FBA A;  1JN1 A;  3K2X A;  3B6N A;  3F0F A;  3Q8H A;  3T80 A;  3IKF A;  1GX1 A;  1H47 A;  4C8G A;  3F6M A;  1IV2 A;  3IKE A;  3QHD A;  3F0E A;  3F0D A;  3K14 A;  2PMP A;  1YQN A;  1VHA A;  5B8F A;  1U3L A;  1T0A A;  4C8I A;  3F0G A;  3ESJ A;  3IEW A;  3P10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...