3QHDA

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei bound to cytidine, fol795 and fol955
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
159
structure length
159
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
molecule tags Lyase
source organism Burkholderia pseudomallei
total genus 50
structure length 159
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3qhdA00
3F0GA 1YQNA 4C8IA 3F0FA 1IV1A 3KE1A 1KNKA 2UZHA 1U43A 1W57A 1IV3A 3FBAA 1T0AA 5B8FA 1IV2A 1VHAA 3K14A 3RE3A 1IV4A 1H47A 2PMPA 1GX1A 1JN1A 3P10A 2AMTA 3ESJA 4C8GA 2GZLA 1JY8A 3QHDA 4C82A 1KNJA 3GHZA 3MBMA 3Q8HA 3FPIA 1H48A 3JVHA 1U3LA 1U40A 3ERNA 3IKEA 3T80A 1W55A 3IEQA 3ELCA 3F0DA 4C8EA 3IKFA 1U3PA 3F6MA 3P0ZA 4C81A 1VH8A 3F0EA 3IEWA 3EORA 3K2XA 3B6NA
chains in the Genus database with same CATH superfamily
2CHSA 3N2KA 3V7QA 3CCQF 5BMVA 4B5CA 1X7PA 3I56F 1W5AA 2ZODA 5LA6A 3CMEF 2N48A 1KQSF 4O4IA 4I55B 4EI7A 3Q8HA 3FPIA 3C9TA 3C9SA 4DXDA 3EORA 3RYFB 5HY1A 3PAFA 4NUTA 4NQ3A 5CA1A 4I4TA 4ZHYB 1CLIA 1IV3A 3VTIC 1X25A 3RYCB 4IHJB 1IV4A 1H47A 1QVFF 1CN7A 1TUBA 3ZO8A 3UT5A 3JALA 3AGKA 3VOBA 4BVQA 3I3FA 3K12A 3IKEA 2HP0A 4X1KB 3F6MA 3J80M 3I55F 5EIBD 4ZOLA 3S0HA 1VQ9F 3N2GB 4TV8B 3RYFA 4KWEA 2RHJA 3KHNA 3VYUC 3G6EF 2CWJA 4BT6A 1W42A 2YYEA 1T0AA 3S0YA 1YIJF 2ZVZA 2BTUA 3RE3A 2IQQA 3RYCA 4I50A 4BVRA 3JARB 1GZ0A 2OTMA 3VIUA 2QEXF 2OTLF 4NWOB 4YJ3A 4ZI7B 3I7TA 1M90H 4O2BB 4O2AA 1H48A 2AIZP 3LWVC 3JVHA 1YGYA 4O4LB 2CSLA 3CCVF 1VQMF 1IPAA 4DRXB 1TVKB 3U0OA 5LOVB 1QVGF 3HWUA 4O4JA 2OTJF 4X20B 3N2GA 4TV8A 3S06A 5EO3A 2RHHA 3CCMF 1Q81H 1VHAA 3V4DA 5HY4A 5CB4B 5JH7A 1OFUA 1JFFB 5IJ0B 4U3JB 1W5FA 5DCVA 1R1MA 3P4EA 3LYBA 2F9ZC 2QI2A 1VQ4F 2DT4A 4LNUB 2NMUA 1E7KA 3HKDA 5A2QM 1ZWZA 3L7QA 4O2BA 1W55A 3CPQA 3F0DA 3ZP7A 4O4LA 1Q82H 1VH8A 3FFMA 1CK2A 5EWRA 5EZYB 3TD3A 5KX5B 3V3TA 3HTNA 1TVKA 3IMPA 2HS4A 3N2KB 5LOVA 1XV2A 1NQ3A 2UZHA 1U43A 4X20A 1ONIA 5J2TB 1SA0B 1W5BA 5CB4A 2P6YA 1JFFA 5IJ0A 2UYNB 4U3JA 3J81M 3GTZA 4O4IB 5JCOC 3ESJA 1K73H 1VQ6F 5C8YB 3CXCF 5JVDA 2H6LA 2KG4A 3MBMA 2OHWA 2RHOA 3O85A 2BO1A 3OBYA 2BTQB 3MDOA 4LNUA 4X3LA 4BT7A 2ZF8A 1VQNF 3CB2A 1W581 3WGJA 2B33A 4EI8A 2VGNA 2GLZA 2G9IA 1Z5VA 2CZWA 3DDNA 3M84A 5IYZB 5KX5A 3MCQA 1H7MA 4HNAB 4I4TB 3RA5A 5CA1B 4ERHA 3VO8A 3GYQA 1W57A 5J2TA 3WGKA 3MQWA 1FSZA 1SA0A 2LBXA 1TUBB 1VQLF 5EAZA 5JCOA 3UT5B 4C8GA 1NMUB 2UYNA 3VYSC 3JALB 5LYJB 5GONA 1K9MH 3OONA 5C8YA 3C9UA 3ERNA 4G4ZA 3J7AR 2HP0B 3E22A 4BT2A 3P0ZA 3G4SF 4ZOLB 2HRYA 3CC7F 1RQ7A 5G4VC 1YJNF 1VQ7F 1QU9A 1IV1A 5IYZA 4HNAA 4B45A 1OAPA 4M8IA 5EYPB 1VQPF 2VAWA 3E20B 2UYPA 2R6R1 4I50B 3LFOA 3R0PA 2UYJA 2ZAUA 3ZP4A 2AIFA 5ITZA 1JY8A 4YJ3B 5LYJA 2KTUA 4O2AB 1VQOF 3NVIB 4BVTA 5MN5A 3IEQA 3M4SA 1VK3A 1KD1H 3RYHA 1GO1A 2HQSC 4O4JB 1YQNA 3CC4F 1W2BF 4B62A 4X1YA 2Z1UA 4O4HA 2LBTA 3VCZA 3IR9A 3WJPA 5EYPA 5JH7B 3CC2F 3N4YA 3KIZA 2JNBA 2V9YA 4YJ2B 4G4WA 4WBNB 4BT3A 3HKDB 4TUYB 1M1KH 4G88A 4C81A 3JATA 3CMAF 2CVLA 2R751 5MN4A 3M1XA 1YITF 4C8IA 3ON1A 3VMFB 2RHLA 4TV9A 3HJWC 2H8EA 1Q8RA 1UFYA 5J2UA 2ALEA 4XCQA 5LXTB 3ZOPA 2FC3A 3LWPC 5GIOC 1QD9A 2VXYA 3P10A 4RQOA 3WGNA 3OBWA 5JVDB 3QHDA 4LCKA 2ZOVA 4YJ2A 5G4UC 2WALA 4WBNA 4IIJA 3T80A 2HRUA 4TUYA 3S0WA 2HVYD 5AVMA 3WGMA 3CCEF 2I6RA 3HKBA 3BYQA 2QA4F 3KE1A 2YXZA 4R40B 3CCJF 5IJ9A 1KC8H 2Z01A 4X3MA 3NK7A 1JD1A 2Z1EA 3V7EA 1COMA 3QUWA 5LXTA 5EB0A 2VAMA 5MN6A 1FNKA 2DYYA 5GAPK 1FNJA 5GONB 1YHQF 1XBIA 1PF5A 2LBWA 3E22B 3K0TA 1T0KB 1XRGA 1U3PA 4EB6A 3B6NA 2W8BC 4C4WC 3HKEB 2Z1FA 2Q1XA 3F0FA 2H8CA 3CCRF 3TD4A 3K14A 4X1IA 3WGLA 1YJWF 2Z1TA 5ITZB 2HS3A 3JAMM 1K8AH 3PLAC 2HX0A 5HY0A 3QTYA 4U39A 3SIUA 2L26A 4BT4A 1W3EX 3RYHB 3HAXD 5LP6C 3F0GA 2Q1YA 2IG8A 1VQ5F 3HKCB 4X1YB 1KNKA 4O4HB 1N8RH 3HKEA 3G71F 3LWQC 3D01A 3RA6A 1RA4A 3CG6A 3CD6F 3NVKE 3KJJA 1W41A 1SZQA 1W5EA 3VI6A 2GZLA 1PXWA 3D54A 2EWCA 5FNVA 5GANK 3OW2F 4G4XA 5CA0B 1YJ9F 3VYTC 3LMEA 4ZHVA 3IKFA 3JATB 3CCSF 2CHTA 3WJQA 3JAWB 5LP6A 2K1SA 3WJRA 1VQVA 1ODEA 4TV9B 3JASB 3HKCA 5J2UB 4BW0B 1IV2A 3CYPB 3WXMB 1VQKF 5HXZA 4PWTA 4TZZA 3S02A 5HP7A 1JN1A 1X52A 3CCUF 2AMTA 1NJIH 4I55A 4ZHQB 4ZHWA 1S72F 2VAPA 2BTOA 4IIJB 1U3LA 1DT9A 4C8EA 5CA0A 1FFXB 1RLUA 3WPWA 3IEWA 3KJKA 4BVSA 3HKBB 1SDSA 3LWRC 2HS0A 3JAWA 3C9RA 1VQ8F 2QTPA 5IJ9B 5FJ4C 2IAFA 3JAKB 1DBFA 3FBAA 3JASA 4G4YA 4RHAA 5GIPC 3LWOC 1Q86H 3E1YA 2KGWA 1JJ2F 1W59A 2UYKA 3S03A 2PMPA 4IHJA 1GX1A 3NK6A 3WPXA 3CCLF 3FD5A 5IT9M 5HXUA 5EIBC 1KNJA 5HWEA 4ZHQA 5KMGB 1U40A 1QAHA 4BT5A 4BY9D 4X1KA 5FLXM 4EB6B 3K2XA 1RQ2A 1FFXA 3MCAB 4F6RB 3VOAA 2HP3A 5JQGB 2KTVA 4FFBB 3N4ZA 4X1IB 1Z5WA 3JAKA 1GO0A 4EI9A 3RYIB 3JARA 2FGYA 1YI2F 4C82A 1Q7YH 3GHZA 4ZI7A 5HP8A 2I6DA 3CPWF 1X7OA 1RLGA 5KMGA 4E6EA 5EB1B 1J7HA 3C8LA 4G4VA 4B46A 3F0EA 4DRXA 2CW4A 5HY2A 3DC2A 2PHNA 4F6RA 3NMUC 2GVIA 5BMVB 1XHOA 5JQGA 2RB9A 5B8FA 4FFBA 5GINC 5LA6B 3TD5A 3D00A 2OZBA 4ZK7A 3SIVA 3LDTA 2LCAA 2MQEA 3RYIA 1W40A 2VGMA 5FNVB 3FD6A 3JCMM 3ELCA 1UI9A 2ZVYA 5EZYA 5LP6B 3CYQA
chains in the Genus database with same CATH topology
3F0GA 1YQNA 4C8IA 3F0FA 1IV1A 3KE1A 1KNKA 2UZHA 1U43A 1W57A 1IV3A 3FBAA 1T0AA 5B8FA 1IV2A 1VHAA 3K14A 3RE3A 1IV4A 1H47A 2PMPA 1GX1A 1JN1A 3P10A 2AMTA 3ESJA 4C8GA 2GZLA 1JY8A 3QHDA 4C82A 1KNJA 3GHZA 3MBMA 3Q8HA 3FPIA 1H48A 3JVHA 1U3LA 1U40A 3ERNA 3IKEA 3T80A 1W55A 3IEQA 3ELCA 3F0DA 4C8EA 3IKFA 1U3PA 3F6MA 3P0ZA 4C81A 1VH8A 3F0EA 3IEWA 3EORA 3K2XA 3B6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0G A;  1YQN A;  4C8I A;  3F0F A;  1IV1 A;  3KE1 A;  1KNK A;  2UZH A;  1U43 A;  1W57 A;  1IV3 A;  3FBA A;  1T0A A;  5B8F A;  1IV2 A;  1VHA A;  3K14 A;  3RE3 A;  1IV4 A;  1H47 A;  2PMP A;  1GX1 A;  1JN1 A;  3P10 A;  2AMT A;  3ESJ A;  4C8G A;  2GZL A;  1JY8 A;  3QHD A;  4C82 A;  1KNJ A;  3GHZ A;  3MBM A;  3Q8H A;  3FPI A;  1H48 A;  3JVH A;  1U3L A;  1U40 A;  3ERN A;  3IKE A;  3T80 A;  1W55 A;  3IEQ A;  3ELC A;  3F0D A;  4C8E A;  3IKF A;  1U3P A;  3F6M A;  3P0Z A;  4C81 A;  1VH8 A;  3F0E A;  3IEW A;  3EOR A;  3K2X A;  3B6N A; 
#chains in the Genus database with same CATH topology
 2CHS A;  3N2K A;  3V7Q A;  3CCQ F;  5BMV A;  4B5C A;  1X7P A;  3I56 F;  1W5A A;  2ZOD A;  5LA6 A;  3CME F;  2N48 A;  1KQS F;  4O4I A;  4I55 B;  4EI7 A;  3Q8H A;  3FPI A;  3C9T A;  3C9S A;  4DXD A;  3EOR A;  3RYF B;  5HY1 A;  3PAF A;  4NUT A;  4NQ3 A;  5CA1 A;  4I4T A;  4ZHY B;  1CLI A;  1IV3 A;  3VTI C;  1X25 A;  3RYC B;  4IHJ B;  1IV4 A;  1H47 A;  1QVF F;  1CN7 A;  1TUB A;  3ZO8 A;  3UT5 A;  3JAL A;  3AGK A;  3VOB A;  4BVQ A;  3I3F A;  3K12 A;  3IKE A;  2HP0 A;  4X1K B;  3F6M A;  3J80 M;  3I55 F;  5EIB D;  4ZOL A;  3S0H A;  1VQ9 F;  3N2G B;  4TV8 B;  3RYF A;  4KWE A;  2RHJ A;  3KHN A;  3VYU C;  3G6E F;  2CWJ A;  4BT6 A;  1W42 A;  2YYE A;  1T0A A;  3S0Y A;  1YIJ F;  2ZVZ A;  2BTU A;  3RE3 A;  2IQQ A;  3RYC A;  4I50 A;  4BVR A;  3JAR B;  1GZ0 A;  2OTM A;  3VIU A;  2QEX F;  2OTL F;  4NWO B;  4YJ3 A;  4ZI7 B;  3I7T A;  1M90 H;  4O2B B;  4O2A A;  1H48 A;  2AIZ P;  3LWV C;  3JVH A;  1YGY A;  4O4L B;  2CSL A;  3CCV F;  1VQM F;  1IPA A;  4DRX B;  1TVK B;  3U0O A;  5LOV B;  1QVG F;  3HWU A;  4O4J A;  2OTJ F;  4X20 B;  3N2G A;  4TV8 A;  3S06 A;  5EO3 A;  2RHH A;  3CCM F;  1Q81 H;  1VHA A;  3V4D A;  5HY4 A;  5CB4 B;  5JH7 A;  1OFU A;  1JFF B;  5IJ0 B;  4U3J B;  1W5F A;  5DCV A;  1R1M A;  3P4E A;  3LYB A;  2F9Z C;  2QI2 A;  1VQ4 F;  2DT4 A;  4LNU B;  2NMU A;  1E7K A;  3HKD A;  5A2Q M;  1ZWZ A;  3L7Q A;  4O2B A;  1W55 A;  3CPQ A;  3F0D A;  3ZP7 A;  4O4L A;  1Q82 H;  1VH8 A;  3FFM A;  1CK2 A;  5EWR A;  5EZY B;  3TD3 A;  5KX5 B;  3V3T A;  3HTN A;  1TVK A;  3IMP A;  2HS4 A;  3N2K B;  5LOV A;  1XV2 A;  1NQ3 A;  2UZH A;  1U43 A;  4X20 A;  1ONI A;  5J2T B;  1SA0 B;  1W5B A;  5CB4 A;  2P6Y A;  1JFF A;  5IJ0 A;  2UYN B;  4U3J A;  3J81 M;  3GTZ A;  4O4I B;  5JCO C;  3ESJ A;  1K73 H;  1VQ6 F;  5C8Y B;  3CXC F;  5JVD A;  2H6L A;  2KG4 A;  3MBM A;  2OHW A;  2RHO A;  3O85 A;  2BO1 A;  3OBY A;  2BTQ B;  3MDO A;  4LNU A;  4X3L A;  4BT7 A;  2ZF8 A;  1VQN F;  3CB2 A;  1W58 1;  3WGJ A;  2B33 A;  4EI8 A;  2VGN A;  2GLZ A;  2G9I A;  1Z5V A;  2CZW A;  3DDN A;  3M84 A;  5IYZ B;  5KX5 A;  3MCQ A;  1H7M A;  4HNA B;  4I4T B;  3RA5 A;  5CA1 B;  4ERH A;  3VO8 A;  3GYQ A;  1W57 A;  5J2T A;  3WGK A;  3MQW A;  1FSZ A;  1SA0 A;  2LBX A;  1TUB B;  1VQL F;  5EAZ A;  5JCO A;  3UT5 B;  4C8G A;  1NMU B;  2UYN A;  3VYS C;  3JAL B;  5LYJ B;  5GON A;  1K9M H;  3OON A;  5C8Y A;  3C9U A;  3ERN A;  4G4Z A;  3J7A R;  2HP0 B;  3E22 A;  4BT2 A;  3P0Z A;  3G4S F;  4ZOL B;  2HRY A;  3CC7 F;  1RQ7 A;  5G4V C;  1YJN F;  1VQ7 F;  1QU9 A;  1IV1 A;  5IYZ A;  4HNA A;  4B45 A;  1OAP A;  4M8I A;  5EYP B;  1VQP F;  2VAW A;  3E20 B;  2UYP A;  2R6R 1;  4I50 B;  3LFO A;  3R0P A;  2UYJ A;  2ZAU A;  3ZP4 A;  2AIF A;  5ITZ A;  1JY8 A;  4YJ3 B;  5LYJ A;  2KTU A;  4O2A B;  1VQO F;  3NVI B;  4BVT A;  5MN5 A;  3IEQ A;  3M4S A;  1VK3 A;  1KD1 H;  3RYH A;  1GO1 A;  2HQS C;  4O4J B;  1YQN A;  3CC4 F;  1W2B F;  4B62 A;  4X1Y A;  2Z1U A;  4O4H A;  2LBT A;  3VCZ A;  3IR9 A;  3WJP A;  5EYP A;  5JH7 B;  3CC2 F;  3N4Y A;  3KIZ A;  2JNB A;  2V9Y A;  4YJ2 B;  4G4W A;  4WBN B;  4BT3 A;  3HKD B;  4TUY B;  1M1K H;  4G88 A;  4C81 A;  3JAT A;  3CMA F;  2CVL A;  2R75 1;  5MN4 A;  3M1X A;  1YIT F;  4C8I A;  3ON1 A;  3VMF B;  2RHL A;  4TV9 A;  3HJW C;  2H8E A;  1Q8R A;  1UFY A;  5J2U A;  2ALE A;  4XCQ A;  5LXT B;  3ZOP A;  2FC3 A;  3LWP C;  5GIO C;  1QD9 A;  2VXY A;  3P10 A;  4RQO A;  3WGN A;  3OBW A;  5JVD B;  3QHD A;  4LCK A;  2ZOV A;  4YJ2 A;  5G4U C;  2WAL A;  4WBN A;  4IIJ A;  3T80 A;  2HRU A;  4TUY A;  3S0W A;  2HVY D;  5AVM A;  3WGM A;  3CCE F;  2I6R A;  3HKB A;  3BYQ A;  2QA4 F;  3KE1 A;  2YXZ A;  4R40 B;  3CCJ F;  5IJ9 A;  1KC8 H;  2Z01 A;  4X3M A;  3NK7 A;  1JD1 A;  2Z1E A;  3V7E A;  1COM A;  3QUW A;  5LXT A;  5EB0 A;  2VAM A;  5MN6 A;  1FNK A;  2DYY A;  5GAP K;  1FNJ A;  5GON B;  1YHQ F;  1XBI A;  1PF5 A;  2LBW A;  3E22 B;  3K0T A;  1T0K B;  1XRG A;  1U3P A;  4EB6 A;  3B6N A;  2W8B C;  4C4W C;  3HKE B;  2Z1F A;  2Q1X A;  3F0F A;  2H8C A;  3CCR F;  3TD4 A;  3K14 A;  4X1I A;  3WGL A;  1YJW F;  2Z1T A;  5ITZ B;  2HS3 A;  3JAM M;  1K8A H;  3PLA C;  2HX0 A;  5HY0 A;  3QTY A;  4U39 A;  3SIU A;  2L26 A;  4BT4 A;  1W3E X;  3RYH B;  3HAX D;  5LP6 C;  3F0G A;  2Q1Y A;  2IG8 A;  1VQ5 F;  3HKC B;  4X1Y B;  1KNK A;  4O4H B;  1N8R H;  3HKE A;  3G71 F;  3LWQ C;  3D01 A;  3RA6 A;  1RA4 A;  3CG6 A;  3CD6 F;  3NVK E;  3KJJ A;  1W41 A;  1SZQ A;  1W5E A;  3VI6 A;  2GZL A;  1PXW A;  3D54 A;  2EWC A;  5FNV A;  5GAN K;  3OW2 F;  4G4X A;  5CA0 B;  1YJ9 F;  3VYT C;  3LME A;  4ZHV A;  3IKF A;  3JAT B;  3CCS F;  2CHT A;  3WJQ A;  3JAW B;  5LP6 A;  2K1S A;  3WJR A;  1VQV A;  1ODE A;  4TV9 B;  3JAS B;  3HKC A;  5J2U B;  4BW0 B;  1IV2 A;  3CYP B;  3WXM B;  1VQK F;  5HXZ A;  4PWT A;  4TZZ A;  3S02 A;  5HP7 A;  1JN1 A;  1X52 A;  3CCU F;  2AMT A;  1NJI H;  4I55 A;  4ZHQ B;  4ZHW A;  1S72 F;  2VAP A;  2BTO A;  4IIJ B;  1U3L A;  1DT9 A;  4C8E A;  5CA0 A;  1FFX B;  1RLU A;  3WPW A;  3IEW A;  3KJK A;  4BVS A;  3HKB B;  1SDS A;  3LWR C;  2HS0 A;  3JAW A;  3C9R A;  1VQ8 F;  2QTP A;  5IJ9 B;  5FJ4 C;  2IAF A;  3JAK B;  1DBF A;  3FBA A;  3JAS A;  4G4Y A;  4RHA A;  5GIP C;  3LWO C;  1Q86 H;  3E1Y A;  2KGW A;  1JJ2 F;  1W59 A;  2UYK A;  3S03 A;  2PMP A;  4IHJ A;  1GX1 A;  3NK6 A;  3WPX A;  3CCL F;  3FD5 A;  5IT9 M;  5HXU A;  5EIB C;  1KNJ A;  5HWE A;  4ZHQ A;  5KMG B;  1U40 A;  1QAH A;  4BT5 A;  4BY9 D;  4X1K A;  5FLX M;  4EB6 B;  3K2X A;  1RQ2 A;  1FFX A;  3MCA B;  4F6R B;  3VOA A;  2HP3 A;  5JQG B;  2KTV A;  4FFB B;  3N4Z A;  4X1I B;  1Z5W A;  3JAK A;  1GO0 A;  4EI9 A;  3RYI B;  3JAR A;  2FGY A;  1YI2 F;  4C82 A;  1Q7Y H;  3GHZ A;  4ZI7 A;  5HP8 A;  2I6D A;  3CPW F;  1X7O A;  1RLG A;  5KMG A;  4E6E A;  5EB1 B;  1J7H A;  3C8L A;  4G4V A;  4B46 A;  3F0E A;  4DRX A;  2CW4 A;  5HY2 A;  3DC2 A;  2PHN A;  4F6R A;  3NMU C;  2GVI A;  5BMV B;  1XHO A;  5JQG A;  2RB9 A;  5B8F A;  4FFB A;  5GIN C;  5LA6 B;  3TD5 A;  3D00 A;  2OZB A;  4ZK7 A;  3SIV A;  3LDT A;  2LCA A;  2MQE A;  3RYI A;  1W40 A;  2VGM A;  5FNV B;  3FD6 A;  3JCM M;  3ELC A;  1UI9 A;  2ZVY A;  5EZY A;  5LP6 B;  3CYQ A; 
#chains in the Genus database with same CATH homology
 3F0G A;  1YQN A;  4C8I A;  3F0F A;  1IV1 A;  3KE1 A;  1KNK A;  2UZH A;  1U43 A;  1W57 A;  1IV3 A;  3FBA A;  1T0A A;  5B8F A;  1IV2 A;  1VHA A;  3K14 A;  3RE3 A;  1IV4 A;  1H47 A;  2PMP A;  1GX1 A;  1JN1 A;  3P10 A;  2AMT A;  3ESJ A;  4C8G A;  2GZL A;  1JY8 A;  3QHD A;  4C82 A;  1KNJ A;  3GHZ A;  3MBM A;  3Q8H A;  3FPI A;  1H48 A;  3JVH A;  1U3L A;  1U40 A;  3ERN A;  3IKE A;  3T80 A;  1W55 A;  3IEQ A;  3ELC A;  3F0D A;  4C8E A;  3IKF A;  1U3P A;  3F6M A;  3P0Z A;  4C81 A;  1VH8 A;  3F0E A;  3IEW A;  3EOR A;  3K2X A;  3B6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...