3QHDA

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei bound to cytidine, fol795 and fol955
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
159
structure length
159
Chain Sequence
b'MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
molecule tags Lyase
source organism Burkholderia pseudomallei
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
total genus 50
structure length 159
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3qhdA00
1VHAA 3ELCA 4C8IA 1VH8A 3QHDA 2PMPA 3MBMA 3K14A 3EORA 1U3PA 3ERNA 2AMTA 3ESJA 1GX1A 3F0GA 3KE1A 3GHZA 3RE3A 1YQNA 3T80A 3F6MA 4C81A 1U43A 4C82A 1JY8A 5B8FA 3B6NA 3P10A 4C8EA 1KNKA 3FPIA 1IV4A 3IKEA 1IV3A 1W55A 3JVHA 3P0ZA 1IV1A 1U40A 3IKFA 1H47A 3K2XA 3F0FA 2UZHA 3IEQA 4C8GA 2GZLA 1T0AA 1IV2A 1U3LA 1W57A 3Q8HA 3FBAA 1JN1A 1KNJA 3F0DA 3IEWA 1H48A 3F0EA
chains in the Genus database with same CATH superfamily
1X7PA 4O2AA 3I56F 3HKCA 3JAWB 5FLXM 1U3PA 4I55B 3G71F 1W42A 2KTVA 3VCZA 4X1KB 4BT7A 2H8EA 1OFUA 3WJPA 4U3JA 3KHNA 1KNKA 3IKEA 4B5CA 1M1KH 3VIUA 1Z5VA 3FD5A 2UYNB 1X25A 2VAPA 5JQGB 4ZOLB 3G4SF 1GO1A 3LWOC 1IPAA 4PWTA 3C9SA 5HXZA 4ZHQB 3JAMM 1N8RH 3CB2A 4I50A 4O2BB 3F0GA 1CN7A 3HAXD 1GZ0A 5HY4A 3LDTA 3CC7F 3JASB 2L26A 4BT4A 1QVGF 4ZHQA 3WPWA 3N2GA 5HY2A 2RB9A 3HKEA 3LWVC 3J80M 4O2BA 5MN4A 4EB6A 5IYZB 3S03A 1YJ9F 2GLZA 2LCAA 4X20B 1H48A 3IMPA 4IHJB 5LXTB 3VMFB 1VHAA 3E22A 3QHDA 3C9TA 3BYQA 4TV8B 3DDNA 2AMTA 2CSLA 1SZQA 3GHZA 5CA1A 2K1SA 4WBNB 3JAKB 4U3JB 2ZVYA 2ZVZA 3QUWA 1S72F 5J2UB 3L7QA 1VQPF 1K9MH 2HQSC 1U40A 3IKFA 3ZP4A 1RLGA 1IV2A 3VYUC 1PXWA 4BT5A 4YJ3B 3RYHB 4LNUA 5C8YB 1VQ7F 3HKDB 3WGKA 5G4UC 4EI8A 4EI7A 3JASA 4TUYA 4I50B 2P6YA 1YQNA 3S0WA 3P4EA 2VXYA 4FFBA 4YJ2A 4U39A 2GVIA 3P0ZA 3NK6A 4ZI7A 4O4IB 5LOVA 3CG6A 1W59A 5LOVB 1QD9A 1VQOF 3Q8HA 3F0DA 3KIZA 5KX5B 5HP7A 4ERHA 5LA6B 3CPQA 3ELCA 3CCVF 1KD1H 3K12A 1W3EX 1QVFF 2R751 5EB1B 1Q82H 2FGYA 3AGKA 1R1MA 1YGYA 4G4WA 3UT5B 1H47A 1VQNF 3D54A 2HP0B 2VGNA 4F6RB 1QAHA 5BMVB 4C8GA 5EYPB 3CMEF 2ZF8A 3GYQA 1SDSA 4O4HB 5MN6A 1VQ9F 3NVKE 2PHNA 5KMGB 4X3MA 4ZOLA 2Z1FA 4BVSA 3EORA 3S02A 3D00A 4HNAA 3M1XA 5AVMA 4C81A 1U43A 3IR9A 4X1IB 1W40A 3LWPC 1RQ2A 1FFXA 2OZBA 2VGMA 3MCQA 5JCOA 4O4IA 3JATA 2OTMA 4EB6B 1DBFA 3E22B 1W57A 2V9YA 5EAZA 4NUTA 5GONB 4O4JB 2QA4F 1VQKF 2HP0A 3M84A 2HRUA 3ZP7A 4F6RA 4TUYB 3S0HA 1JJ2F 5LP6C 1JD1A 4C8IA 5IYZA 2UYKA 3V7QA 3HTNA 3HKDA 3K14A 2FC3A 4O4JA 3E1YA 3LYBA 1VQMF 3TD5A 2RHHA 2YXZA 3CCSF 3MQWA 2CVLA 3JATB 2LBXA 3CCLF 5EO3A 2CW4A 5KX5A 3KJJA 1FFXB 3E20B 2NMUA 3U0OA 3CCEF 3VI6A 5J2TA 2WALA 2BO1A 2MQEA 3C8LA 5KMGA 4FFBB 4EI9A 2UYNA 1XHOA 5JCOC 1Z5WA 5FJ4C 4DXDA 1E7KA 1NQ3A 1XRGA 3ERNA 3D01A 4BT3A 2HRYA 3FD6A 2LBWA 3N2KB 1ODEA 4RHAA 2Q1XA 5HY0A 1IV4A 2G9IA 3CYPB 1VK3A 2QTPA 3JVHA 3JALA 3QTYA 5JVDB 2UZHA 2ZODA 3IEQA 3ZOPA 3RYCB 3V7EA 1T0AA 2H8CA 5ITZA 3HWUA 1SA0A 2Q1YA 3F0EA 2CZWA 3FFMA 3I7TA 1K8AH 3LMEA 1VH8A 4X3LA 5LP6B 1Q86H 2YYEA 3NK7A 5GONA 4C4WC 3DC2A 3CMAF 3ZO8A 5CA1B 4TV9B 1W2BF 3JAKA 2VAMA 4B46A 5B8FA 5EZYB 4G4XA 3M4SA 4NQ3A 2F9ZC 1FNJA 5J2TB 4O4LB 2DT4A 4O4HA 3F0FA 2CHTA 4X1KA 2AIZP 2IQQA 1YI2F 2JNBA 1PF5A 4DRXB 5GINC 3OBWA 4ZHWA 4ZK7A 4G4ZA 3VYTC 3VYSC 4LCKA 3SIUA 3RYFB 1TVKB 3HKEB 4O2AB 1TVKA 3RYCA 4BVRA 5JVDA 3MCAB 1YJNF 4IIJA 3RYIA 3MDOA 1JY8A 1XV2A 4C8EA 3NMUC 3V3TA 1IV1A 2OHWA 2HVYD 1Q81H 1TUBB 1T0KB 2Z1UA 3G6EF 3FBAA 1JN1A 1KNJA 3IEWA 4TV8A 4RQOA 4X1YB 5CB4A 4WBNA 2OTLF 4E6EA 5LA6A 5EZYA 2LBTA 3OONA 2HX0A 5GAPK 1W5AA 3KE1A 3OBYA 2UYJA 5LXTA 3RE3A 1K73H 4IHJA 2IG8A 3SIVA 3S0YA 3LWQC 3FPIA 3JCMM 1FNKA 1KQSF 2HS4A 1CK2A 3C9UA 4I55A 2HS3A 1VQLF 2RHOA 3CD6F 5ITZB 4BT6A 1QU9A 2BTUA 2I6RA 5IJ0A 1FSZA 5EYPA 2GZLA 3N2GB 5BMVA 4YJ3A 3JARA 5HP8A 5MN5A 5G4VC 1YJWF 2HS0A 1YIJF 2CHSA 4M8IA 4IIJB 3RYIB 3C9RA 1W581 1GO0A 4TZZA 3N2KA 2Z1TA 5EIBC 2AIFA 3JARB 4BVTA 3LWRC 2ALEA 3RYHA 5EIBD 3RYFA 1W5BA 3ESJA 2CWJA 1VQ4F 2R6R1 4BY9D 3PAFA 5EB0A 2KGWA 1W5FA 3N4YA 1KC8H 2EWCA 1JFFA 4G4VA 3WPXA 1VQVA 3CPWF 1ZWZA 1VQ6F 5CA0A 1ONIA 2RHJA 3LFOA 5FNVA 3WGJA 5GANK 5CB4B 4BW0B 5GIPC 3TD3A 3VTIC 4X20A 1NJIH 1VQ5F 1JFFB 2Z1EA 3T80A 2W8BC 4C82A 2DYYA 5HWEA 5IT9M 2ZOVA 1IV3A 4ZHYB 4B45A 1W55A 5LYJA 1J7HA 3K2XA 3CCJF 1RA4A 1W5EA 3JALB 3WGLA 2I6DA 2BTOA 3R0PA 3OW2F 3CXCF 2OTJF 5J2UA 4DRXA 3VO8A 4NWOB 1W41A 5DCVA 4I4TB 3CCQF 1VQ8F 3K0TA 2QI2A 1CLIA 1GX1A 4HNAB 3RA5A 3S06A 4O4LA 3F6MA 4X1IA 4YJ2B 1OAPA 2UYPA 2H6LA 3PLAC 3V4DA 4G88A 1YITF 3WGNA 3WXMB 3CCUF 1U3LA 3CC4F 2KTUA 3JAWA 2KG4A 3UT5A 1Q8RA 4X1YA 4ZHVA 1UI9A 5HXUA 1COMA 5EWRA 1H7MA 4BT2A 2PMPA 3MBMA 1M90H 5LYJB 5JH7A 3CYQA 3VOAA 3WJRA 5IJ0B 5A2QM 1RQ7A 3KJKA 3P10A 4BVQA 5GIOC 4KWEA 4R40B 3CCMF 5JQGA 2HP3A 3HKBA 2ZAUA 3HKBB 5IJ9B 1XBIA 1UFYA 2Z01A 5CA0B 2N48A 3GTZA 3WJQA 3HJWC 5FNVB 4I4TA 3TD4A 4TV9A 2B33A 1YHQF 3VOBA 5IJ9A 3RA6A 4ZI7B 3CCRF 3ON1A 4G4YA 1DT9A 3WGMA 5LP6A 3HKCB 3I3FA 1TUBA 3I55F 4B62A 3CC2F 3NVIB 2VAWA 3B6NA 1X52A 2QEXF 2IAFA 1SA0B 3O85A 5HY1A 1RLUA 4LNUB 5C8YA 2BTQB 3J7AR 3J81M 1NMUB 4XCQA 1X7OA 5JH7B 3N4ZA 2RHLA 1Q7YH
chains in the Genus database with same CATH topology
1VHAA 3ELCA 4C8IA 1VH8A 3QHDA 2PMPA 3MBMA 3K14A 3EORA 1U3PA 3ERNA 2AMTA 3ESJA 1GX1A 3F0GA 3KE1A 3GHZA 3RE3A 1YQNA 3T80A 3F6MA 4C81A 1U43A 4C82A 1JY8A 5B8FA 3B6NA 3P10A 4C8EA 1KNKA 3FPIA 1IV4A 3IKEA 1IV3A 1W55A 3JVHA 3P0ZA 1IV1A 1U40A 3IKFA 1H47A 3K2XA 3F0FA 2UZHA 3IEQA 4C8GA 2GZLA 1T0AA 1IV2A 1U3LA 1W57A 3Q8HA 3FBAA 1JN1A 1KNJA 3F0DA 3IEWA 1H48A 3F0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VHA A;  3ELC A;  4C8I A;  1VH8 A;  3QHD A;  2PMP A;  3MBM A;  3K14 A;  3EOR A;  1U3P A;  3ERN A;  2AMT A;  3ESJ A;  1GX1 A;  3F0G A;  3KE1 A;  3GHZ A;  3RE3 A;  1YQN A;  3T80 A;  3F6M A;  4C81 A;  1U43 A;  4C82 A;  1JY8 A;  5B8F A;  3B6N A;  3P10 A;  4C8E A;  1KNK A;  3FPI A;  1IV4 A;  3IKE A;  1IV3 A;  1W55 A;  3JVH A;  3P0Z A;  1IV1 A;  1U40 A;  3IKF A;  1H47 A;  3K2X A;  3F0F A;  2UZH A;  3IEQ A;  4C8G A;  2GZL A;  1T0A A;  1IV2 A;  1U3L A;  1W57 A;  3Q8H A;  3FBA A;  1JN1 A;  1KNJ A;  3F0D A;  3IEW A;  1H48 A;  3F0E A; 
#chains in the Genus database with same CATH topology
 1X7P A;  4O2A A;  3I56 F;  3HKC A;  3JAW B;  5FLX M;  1U3P A;  4I55 B;  3G71 F;  1W42 A;  2KTV A;  3VCZ A;  4X1K B;  4BT7 A;  2H8E A;  1OFU A;  3WJP A;  4U3J A;  3KHN A;  1KNK A;  3IKE A;  4B5C A;  1M1K H;  3VIU A;  1Z5V A;  3FD5 A;  2UYN B;  1X25 A;  2VAP A;  5JQG B;  4ZOL B;  3G4S F;  1GO1 A;  3LWO C;  1IPA A;  4PWT A;  3C9S A;  5HXZ A;  4ZHQ B;  3JAM M;  1N8R H;  3CB2 A;  4I50 A;  4O2B B;  3F0G A;  1CN7 A;  3HAX D;  1GZ0 A;  5HY4 A;  3LDT A;  3CC7 F;  3JAS B;  2L26 A;  4BT4 A;  1QVG F;  4ZHQ A;  3WPW A;  3N2G A;  5HY2 A;  2RB9 A;  3HKE A;  3LWV C;  3J80 M;  4O2B A;  5MN4 A;  4EB6 A;  5IYZ B;  3S03 A;  1YJ9 F;  2GLZ A;  2LCA A;  4X20 B;  1H48 A;  3IMP A;  4IHJ B;  5LXT B;  3VMF B;  1VHA A;  3E22 A;  3QHD A;  3C9T A;  3BYQ A;  4TV8 B;  3DDN A;  2AMT A;  2CSL A;  1SZQ A;  3GHZ A;  5CA1 A;  2K1S A;  4WBN B;  3JAK B;  4U3J B;  2ZVY A;  2ZVZ A;  3QUW A;  1S72 F;  5J2U B;  3L7Q A;  1VQP F;  1K9M H;  2HQS C;  1U40 A;  3IKF A;  3ZP4 A;  1RLG A;  1IV2 A;  3VYU C;  1PXW A;  4BT5 A;  4YJ3 B;  3RYH B;  4LNU A;  5C8Y B;  1VQ7 F;  3HKD B;  3WGK A;  5G4U C;  4EI8 A;  4EI7 A;  3JAS A;  4TUY A;  4I50 B;  2P6Y A;  1YQN A;  3S0W A;  3P4E A;  2VXY A;  4FFB A;  4YJ2 A;  4U39 A;  2GVI A;  3P0Z A;  3NK6 A;  4ZI7 A;  4O4I B;  5LOV A;  3CG6 A;  1W59 A;  5LOV B;  1QD9 A;  1VQO F;  3Q8H A;  3F0D A;  3KIZ A;  5KX5 B;  5HP7 A;  4ERH A;  5LA6 B;  3CPQ A;  3ELC A;  3CCV F;  1KD1 H;  3K12 A;  1W3E X;  1QVF F;  2R75 1;  5EB1 B;  1Q82 H;  2FGY A;  3AGK A;  1R1M A;  1YGY A;  4G4W A;  3UT5 B;  1H47 A;  1VQN F;  3D54 A;  2HP0 B;  2VGN A;  4F6R B;  1QAH A;  5BMV B;  4C8G A;  5EYP B;  3CME F;  2ZF8 A;  3GYQ A;  1SDS A;  4O4H B;  5MN6 A;  1VQ9 F;  3NVK E;  2PHN A;  5KMG B;  4X3M A;  4ZOL A;  2Z1F A;  4BVS A;  3EOR A;  3S02 A;  3D00 A;  4HNA A;  3M1X A;  5AVM A;  4C81 A;  1U43 A;  3IR9 A;  4X1I B;  1W40 A;  3LWP C;  1RQ2 A;  1FFX A;  2OZB A;  2VGM A;  3MCQ A;  5JCO A;  4O4I A;  3JAT A;  2OTM A;  4EB6 B;  1DBF A;  3E22 B;  1W57 A;  2V9Y A;  5EAZ A;  4NUT A;  5GON B;  4O4J B;  2QA4 F;  1VQK F;  2HP0 A;  3M84 A;  2HRU A;  3ZP7 A;  4F6R A;  4TUY B;  3S0H A;  1JJ2 F;  5LP6 C;  1JD1 A;  4C8I A;  5IYZ A;  2UYK A;  3V7Q A;  3HTN A;  3HKD A;  3K14 A;  2FC3 A;  4O4J A;  3E1Y A;  3LYB A;  1VQM F;  3TD5 A;  2RHH A;  2YXZ A;  3CCS F;  3MQW A;  2CVL A;  3JAT B;  2LBX A;  3CCL F;  5EO3 A;  2CW4 A;  5KX5 A;  3KJJ A;  1FFX B;  3E20 B;  2NMU A;  3U0O A;  3CCE F;  3VI6 A;  5J2T A;  2WAL A;  2BO1 A;  2MQE A;  3C8L A;  5KMG A;  4FFB B;  4EI9 A;  2UYN A;  1XHO A;  5JCO C;  1Z5W A;  5FJ4 C;  4DXD A;  1E7K A;  1NQ3 A;  1XRG A;  3ERN A;  3D01 A;  4BT3 A;  2HRY A;  3FD6 A;  2LBW A;  3N2K B;  1ODE A;  4RHA A;  2Q1X A;  5HY0 A;  1IV4 A;  2G9I A;  3CYP B;  1VK3 A;  2QTP A;  3JVH A;  3JAL A;  3QTY A;  5JVD B;  2UZH A;  2ZOD A;  3IEQ A;  3ZOP A;  3RYC B;  3V7E A;  1T0A A;  2H8C A;  5ITZ A;  3HWU A;  1SA0 A;  2Q1Y A;  3F0E A;  2CZW A;  3FFM A;  3I7T A;  1K8A H;  3LME A;  1VH8 A;  4X3L A;  5LP6 B;  1Q86 H;  2YYE A;  3NK7 A;  5GON A;  4C4W C;  3DC2 A;  3CMA F;  3ZO8 A;  5CA1 B;  4TV9 B;  1W2B F;  3JAK A;  2VAM A;  4B46 A;  5B8F A;  5EZY B;  4G4X A;  3M4S A;  4NQ3 A;  2F9Z C;  1FNJ A;  5J2T B;  4O4L B;  2DT4 A;  4O4H A;  3F0F A;  2CHT A;  4X1K A;  2AIZ P;  2IQQ A;  1YI2 F;  2JNB A;  1PF5 A;  4DRX B;  5GIN C;  3OBW A;  4ZHW A;  4ZK7 A;  4G4Z A;  3VYT C;  3VYS C;  4LCK A;  3SIU A;  3RYF B;  1TVK B;  3HKE B;  4O2A B;  1TVK A;  3RYC A;  4BVR A;  5JVD A;  3MCA B;  1YJN F;  4IIJ A;  3RYI A;  3MDO A;  1JY8 A;  1XV2 A;  4C8E A;  3NMU C;  3V3T A;  1IV1 A;  2OHW A;  2HVY D;  1Q81 H;  1TUB B;  1T0K B;  2Z1U A;  3G6E F;  3FBA A;  1JN1 A;  1KNJ A;  3IEW A;  4TV8 A;  4RQO A;  4X1Y B;  5CB4 A;  4WBN A;  2OTL F;  4E6E A;  5LA6 A;  5EZY A;  2LBT A;  3OON A;  2HX0 A;  5GAP K;  1W5A A;  3KE1 A;  3OBY A;  2UYJ A;  5LXT A;  3RE3 A;  1K73 H;  4IHJ A;  2IG8 A;  3SIV A;  3S0Y A;  3LWQ C;  3FPI A;  3JCM M;  1FNK A;  1KQS F;  2HS4 A;  1CK2 A;  3C9U A;  4I55 A;  2HS3 A;  1VQL F;  2RHO A;  3CD6 F;  5ITZ B;  4BT6 A;  1QU9 A;  2BTU A;  2I6R A;  5IJ0 A;  1FSZ A;  5EYP A;  2GZL A;  3N2G B;  5BMV A;  4YJ3 A;  3JAR A;  5HP8 A;  5MN5 A;  5G4V C;  1YJW F;  2HS0 A;  1YIJ F;  2CHS A;  4M8I A;  4IIJ B;  3RYI B;  3C9R A;  1W58 1;  1GO0 A;  4TZZ A;  3N2K A;  2Z1T A;  5EIB C;  2AIF A;  3JAR B;  4BVT A;  3LWR C;  2ALE A;  3RYH A;  5EIB D;  3RYF A;  1W5B A;  3ESJ A;  2CWJ A;  1VQ4 F;  2R6R 1;  4BY9 D;  3PAF A;  5EB0 A;  2KGW A;  1W5F A;  3N4Y A;  1KC8 H;  2EWC A;  1JFF A;  4G4V A;  3WPX A;  1VQV A;  3CPW F;  1ZWZ A;  1VQ6 F;  5CA0 A;  1ONI A;  2RHJ A;  3LFO A;  5FNV A;  3WGJ A;  5GAN K;  5CB4 B;  4BW0 B;  5GIP C;  3TD3 A;  3VTI C;  4X20 A;  1NJI H;  1VQ5 F;  1JFF B;  2Z1E A;  3T80 A;  2W8B C;  4C82 A;  2DYY A;  5HWE A;  5IT9 M;  2ZOV A;  1IV3 A;  4ZHY B;  4B45 A;  1W55 A;  5LYJ A;  1J7H A;  3K2X A;  3CCJ F;  1RA4 A;  1W5E A;  3JAL B;  3WGL A;  2I6D A;  2BTO A;  3R0P A;  3OW2 F;  3CXC F;  2OTJ F;  5J2U A;  4DRX A;  3VO8 A;  4NWO B;  1W41 A;  5DCV A;  4I4T B;  3CCQ F;  1VQ8 F;  3K0T A;  2QI2 A;  1CLI A;  1GX1 A;  4HNA B;  3RA5 A;  3S06 A;  4O4L A;  3F6M A;  4X1I A;  4YJ2 B;  1OAP A;  2UYP A;  2H6L A;  3PLA C;  3V4D A;  4G88 A;  1YIT F;  3WGN A;  3WXM B;  3CCU F;  1U3L A;  3CC4 F;  2KTU A;  3JAW A;  2KG4 A;  3UT5 A;  1Q8R A;  4X1Y A;  4ZHV A;  1UI9 A;  5HXU A;  1COM A;  5EWR A;  1H7M A;  4BT2 A;  2PMP A;  3MBM A;  1M90 H;  5LYJ B;  5JH7 A;  3CYQ A;  3VOA A;  3WJR A;  5IJ0 B;  5A2Q M;  1RQ7 A;  3KJK A;  3P10 A;  4BVQ A;  5GIO C;  4KWE A;  4R40 B;  3CCM F;  5JQG A;  2HP3 A;  3HKB A;  2ZAU A;  3HKB B;  5IJ9 B;  1XBI A;  1UFY A;  2Z01 A;  5CA0 B;  2N48 A;  3GTZ A;  3WJQ A;  3HJW C;  5FNV B;  4I4T A;  3TD4 A;  4TV9 A;  2B33 A;  1YHQ F;  3VOB A;  5IJ9 A;  3RA6 A;  4ZI7 B;  3CCR F;  3ON1 A;  4G4Y A;  1DT9 A;  3WGM A;  5LP6 A;  3HKC B;  3I3F A;  1TUB A;  3I55 F;  4B62 A;  3CC2 F;  3NVI B;  2VAW A;  3B6N A;  1X52 A;  2QEX F;  2IAF A;  1SA0 B;  3O85 A;  5HY1 A;  1RLU A;  4LNU B;  5C8Y A;  2BTQ B;  3J7A R;  3J81 M;  1NMU B;  4XCQ A;  1X7O A;  5JH7 B;  3N4Z A;  2RHL A;  1Q7Y H; 
#chains in the Genus database with same CATH homology
 1VHA A;  3ELC A;  4C8I A;  1VH8 A;  3QHD A;  2PMP A;  3MBM A;  3K14 A;  3EOR A;  1U3P A;  3ERN A;  2AMT A;  3ESJ A;  1GX1 A;  3F0G A;  3KE1 A;  3GHZ A;  3RE3 A;  1YQN A;  3T80 A;  3F6M A;  4C81 A;  1U43 A;  4C82 A;  1JY8 A;  5B8F A;  3B6N A;  3P10 A;  4C8E A;  1KNK A;  3FPI A;  1IV4 A;  3IKE A;  1IV3 A;  1W55 A;  3JVH A;  3P0Z A;  1IV1 A;  1U40 A;  3IKF A;  1H47 A;  3K2X A;  3F0F A;  2UZH A;  3IEQ A;  4C8G A;  2GZL A;  1T0A A;  1IV2 A;  1U3L A;  1W57 A;  3Q8H A;  3FBA A;  1JN1 A;  1KNJ A;  3F0D A;  3IEW A;  1H48 A;  3F0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...