5IJ0B

Cryo em density of microtubule assembled from human tubb3
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
426
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Mutations in Human Tubulin Proximal to the Kinesin-Binding Site Alter Dynamic Instability at Microtubule Plus- and Minus-Ends.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 143
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2016-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5ij0B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5ij0B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5ij0B01
4TV8A 5CB4A 4YJ2A 1JFFA 3WGKA 4DRXB 1Z5VA 4F6RA 5LOVB 3HKEA 3WGMA 3RB8A 4LNUB 3E22B 2R751 1TVKA 3N2KA 5EIBD 5IYZB 5KMGA 2Q1XA 2R6R1 3N2GB 4I55B 1W5AA 5BMVA 3HKDA 4YJ3A 3UT5A 4X1IA 4U39A 4O4JA 4TV9B 4U3JA 5JQGB 3JATB 4O4HB 4ZI7B 5KX5B 4HNAA 1W5EA 4O4LB 5IJ0B 2RHOA 1OFUA 3VOAA 5LP6C 3RYIB 5GONB 5JCOA 4EB6A 5FNVA 2RHJA 3C8LA 3RYFA 3ZBPA 1FFXA 1FSZA 3JALB 4EI9A 5C8YA 4EI7A 3JAWA 5J2TB 4KWEA 4I4TB 4X20A 3CB2A 3V3TA 5ITZB 4I50A 4O2AB 4O2BA 4O4IA 5LP6A 4TV8B 4YJ2B 1W5FA 1JFFB 2XKAA 4F6RB 2BTQA 3HKEB 1TUBA 4WBNA 4M8IA 1SA0A 3N2KB 5KMGB 2VAPA 3HKDB 4YJ3B 3UT5B 4B45A 4O4JB 4U3JB 4TUYA 5LYJA 4ZHQA 2Q1YA 2RHLA 4HNAB 1RQ2A 5JVDA 4IIJA 3RYHA 3JAKA 2VAMA 5FNVB 3RYFB 2VAWA 1FFXB 3M8KA 5EZYA 5EIBC 1W59A 3JASA 3JARA 5C8YB 3JAWB 4ZOLA 5CA0A 5J2UA 5IJ9A 2RHHA 3RYCB 5M7EA 4X1YA 5CA1A 4X20B 4I50B 4IHJA 5CB4B 5JH7A 4X1KA 3M89A 4O2BB 5LA6A 3R4VA 5LP6B 3JATA 3VO9A 4FFBA 5MN5A 3HKCA 2BTQB 1TVKB 1TUBB 4WBNB 1SA0B 3HKBA 5BMVB 3ZBQA 4X1IB 5LXTA 5EYPA 4TUYB 3WGJA 4ZHQB 5LYJB 1W581 5ITZA 3VO8A 4EB6B 5JVDB 4DRXA 4IIJB 3RYHB 3JAKB 5LOVA 4B46A 3VPAA 1RLUA 2VXYA 4DXDA 4EI8A 4LNUA 2BTOA 3E22A 5JCOC 5EZYB 3JASB 5IYZA 3JARB 3N2GA 1Z5WA 4I55A 4ZOLB 3WGNA 5J2UB 5CA0B 5IJ9B 2GVIA 4TV9A 4X1YB 5CA1B 4O4IB 5JQGA 4O4HA 4IHJB 4ZI7A 5JH7B 4X1KB 5KX5A 1RQ7A 4O4LA 5LA6B 5IJ0A 5MN6A 4XCQA 2XKBA 3RYIA 5GONA 3VOBA 4FFBB 3HKCB 4E6EA 3ZIDA 3JALA 5MN4A 3HKBB 1W5BA 5LXTB 5EYPB 5J2TA 4I4TA 4O2AA 3RYCA 3WGLA
chains in the Genus database with same CATH superfamily
1S1MA 1P0QA 2PYJA 3K5OA 2QD3A 1MABB 4PX9A 1IXYA 3B40A 2JCXA 1ECJA 1KZYC 1XEWX 5NLLA 4LYHA 1Q81W 4BE4A 3ZDDA 5BURA 5AOAA 3CY6A 5E4YA 3R0IA 1FC0A 1L8OA 4MULA 5FPPA 4RD6A 4YT4A 4UBMA 1VG9B 3W3AD 4HPJB 1YDXA 3JWPA 3VNAA 3AY3A 4BKQA 4B7CA 4XARA 5G0VA 1A72A 4PINA 3NQ41 2H4JA 2J9RA 5A6SB 1N7GA 2I67A 4PTLA 2PTMA 1F0KA 4H7EA 1JE1A 2OBMA 1OV6A 3IBTA 2V1DA 3OUZA 5JAHA 2CFSA 4NOLA 3ZWKA 3P94A 3ASVA 1DRKA 4EG5A 5IM5A 2Z4TA 1DJOA 3CPSA 5D51S 5ULLA 3VR2A 3ZU4A 3E9CA 1FIUA 2IPMA 1IUKA 3I1YA 4ZI3A 1ZD2P 5NULA 3A28A 1PRYA 3WQBA 4V03A 3GI1A 4JYAO 2CLSA 2WNSA 4E08A 1S77D 1BKSB 1J2EA 4MWOA 2ZE5A 1AB3A 2QRUA 2VYNA 2ODEA 1X0XA 3OPQA 1TO2E 4MX8A 3E1YA 1H85A 4M54A 4NCJA 2ANBA 1N3BA 4N7RA 4YO7A 4GX0A 3D6UA 1I2AA 3KUKA 4S0XA 3S81A 3ZGOA 4BBPA 3QLEA 1KTIA 5JVDA 4BNXA 2KPOA 4WY2A 2R9AA 2FNAA 2I8AA 4ARZB 1WZIA 1GL7A 1BQEA 3P32A 2OCKA 3D64A 3RVSA 4ZCQA 5BXQC 3V97A 1VJGA 2CMKA 3RS0A 3VVCA 4PZCA 3LYUA 3P0FA 3ASZA 4KUGA 2P9JA 1CJUC 5IKPA 1EWVA 3VNQA 3ILXA 1L6IA 3ETGA 4EY5A 4LCKA 1U6IA 2Z2KA 3ABTA 1Z9BA 3OKFA 5B2FA 1QVGU 3AY0A 3GBSA 2P79A 2NU8B 2H51A 1YS4A 3CO0S 1TZMA 1G5RA 4RFSA 1REQA 4PGHA 1O1YA 5KTYA 2GEVA 1IQRA 1MJNA 1Y6JA 2K2WA 4UB8Z 3ZN0A 5DBFA 1IB6A 3WV4A 4TVOA 4BHTA 3FYSA 3B12A 3DA8A 1YHYA 2CWWA 3B1KA 3FA2A 3LRXA 1IBSA 1HWYA 3NO4A 5CAEA 5HS6A 1OLXB 3QEMA 3WK8A 2DVMA 2QTWB 3EPHA 3E7PA 3E9NA 3ZU6A 3IQDB 1U6JA 5CVVA 4UV9A 1BE3H 1SZTA 3RT3C 4W8HA 2X5JO 4HQFA 3A9UA 4YJFA 1T2AA 1J06A 3QTCA 1MVNA 1M56B 4DNQA 3U7FB 3IEQA 4CLXA 2DM6A 4L0CA 2I2CA 4PXSA 4K81B 4M9XA 2PRIA 1YJ8A 3ORSA 1R3LC 2Q8PA 3PGLA 2YBDA 1WPXA 4R8KA 3UG6A 3IERA 4FFBB 1AHIA 4JC0A 4R69A 3EFBA 3DM9B 1YRYE 3G8DA 1JEQB 1FNJA 5DK4A 3V2UA 1E6CA 3ZVNA 3LF1A 2NXCA 1P45A 2ZRFA 5REQA 521PA 2HO4A 1NR7A 1HZZA 3HWWA 1Q5OA 4RPIA 5BSTA 2HSEA 5F2OA 1OXBB 5E1AC 2J33A 1G8SA 1BQ3A 2IH2A 3FGZA 2C54A 3G6WA 4U63A 4DV2B 1PNTA 3RI3A 2XMDA 1UMBA 4NDAA 2VT2A 1Q3KA 5L4NA 4AYWA 4DW0A 3HY6A 3GAAA 3ZIAG 5H80A 1OFVA 3GA7A 1PDWA 2Q5JA 1DWOA 3AVPA 1ODKA 4RTSA 1JAIA 2P35A 2P4HX 3RIEA 5LR6A 5K0NA 1JU4A 4UM9B 2HNAA 3MTAA 2AWNA 4PI2A 3ABOB 4CZ2A 3W5IA 5IWAB 2AW9A 3LQFA 2FMTA 5D86A 2EFEB 4M9SA 3F90A 1IN6A 4D9FA 3AG4B 4LF7B 2DF8A 2QQ5A 4B3RO 1Q81H 2PVSA 2XUIA 4P8RA 3JPWA 4G2NA 3BX1A 2FPMA 2IKQA 4V0ME 1KC3A 1U0FA 3T80A 2REQB 4OQQA 1NOKA 4BC0A 2HDHA 4WESB 3RUDA 1T1GA 1H8EG 2GQ0A 1M9NA 4MS1A 2YS8A 2FZCA 2E3JA 2BD0A 3OW2U 5JAQA 3SNKA 2DCMA 3SBOA 3KSBC 3RABA 1SA0A 2GNOA 2WLMA 4ETMA 4KPUA 4KO4S 3BHMA 1T8WA 3ENZA 3KLNA 4TLDA 3OAAG 3IE1A 1ZCBA 3NOVA 3P9RA 1VQ4F 2HCFA 2DR2A 2XIJA 1DIOB 1SIOA 3B6JA 4X1YA 3VR6D 1G59A 2FP4B 3UTCA 4KPYA 1JJ2U 2Z43A 3E82A 1W94A 1SK8A 3DB1A 1T35A 2QA4V 4KFUA 2GRUA 4IV0A 1Q82W 1U9CA 3ZIAA 4MQMA 4KSCA 4Y9UA 4FZ5A 3GV0A 3WLRA 1JRLA 4G97A 4RQBA 3W05A 4HNGA 2B4RO 4M0UA 2WP8J 5EJIA 3UZUA 3BE6A 4C03A 2AOTA 3VHXB 1Q2UA 1ZD3A 1A1SA 5I8ZA 8OHMA 4LGVA 2JHCA 1UM8A 1P44A 2ATVA 4YMHA 1KH2A 1XYYA 2ENUA 3IB3A 3K59A 3TSZA 2WJIA 2AH5A 2NO7A 1XK6A 2ISSD 4QX6A 1WQ1R 3K2QA 4IL5A 3ORQA 4Z7OB 4OQYA 5K8TA 2GM3A 1JDPA 5BNZA 2E4ZA 4DGQA 1MJHA 4TS9A 4UUOA 5DRTA 2ERYA 3HDYA 5K5EA 2C20A 3OAAA 6ABPA 3NKVA 2C29D 2D7CA 2JH8A 3EQ7A 2QTOA 3VYWA 2XR1A 2OLEA 1USKA 1O94C 5EZ6B 3GOQA 3O82A 4TXMA 3ZY3A 1FDUA 1Z28A 1LSUA 3MWDB 3RVOA 2AOWA 4FINA 4UHEA 3PD7A 1FNCA 1PTKA 5J2TA 1QP4A 4WX2B 3IAEA 2XOKG 3GYQA 1YUNA 4MAAA 2CNDA 2JBAA 1DMRA 1R3JC 2XOXA 4OK5A 2MK3A 3ZS8A 4EFBA 4HGNA 2GBIA 1AG9A 2P22C 4MGIR 4YGYA 2BKEA 3FUUA 2ARKA 1U3UA 5E7IA 1D2AA 1DLIA 4DEVA 5FUWA 3V5NA 5CXXA 1GRQA 4OX9B 4B5KA 5G1OA 3UHPA 1TU4A 1W55A 3JVIA 2Y0CA 5BSWA 3PG5A 4JI1B 1V5EA 1AA9A 2ATKC 4I1OA 4EI2A 4X20B 3WLIA 2O2YA 4MQ5A 1K98A 1CF4A 3CLTD 2CZGA 2DR3A 4XD7D 4ZK6A 4M7OA 4JEIA 4DLSA 2X0EA 3PX3A 5EIXA 4YMWA 2Z1NA 2JGDB 3V1LA 1Z63A 3M5PA 1IULA 2ZYWX 3KCYA 3TQFA 1S5HC 2MT9A 2QRKA 3DUWA 1WB4A 3CCRF 4G0ZA 3A6GA 4P5PA 3H0CA 2HDNB 4NULA 4XUEA 4P08A 4GRDA 4XQCA 5CDFA 2WJYA 4BB6A 1BCSB 3HR0A 2OXIA 3AG7A 3DVRX 3IE0A 2CE2X 5KYTA 2XOKA 5ALNA 2X8LA 4O59O 4W5JA 4ZPJA 3NMUF 3F78A 3OT1B 1WLSA 1UADA 5FORA 5JROA 5A5GA 3Q3CA 3KJQA 1PZGA 2IXAA 2RIPA 3EHEA 1SCIA 1TJNA 1WD5A 5EHIA 4QDJA 4O4LF 1EVEA 2JEOA 4MLZA 1GRCA 3OD5A 1HA3A 4QBIA 4BUJA 1NN5A 1NVKA 2ZRGA 2FZLA 3WZMA 1ODLA 2KB0A 5JNVA 1GFZA 1L5HB 1SC6A 3IDQA 2ES4A 4J10A 3PE3A 1BN7A 4PA4A 3JAMN 2P7TC 3NOOA 2BHSA 1JWAB 1RAIA 1OC4A 3CNLA 1XMIA 1JOYA 4JLKA 4A3SA 2D5AA 4PX5A 3GFSA 2ZNIA 1V5WA 1BN6A 3CB4A 2IUUA 1SVWA 5HUQA 5E2AA 3VOBA 1Z8HA 5MFZA 3TZQA 3PQCA 3OFKA 1VSQA 4LJYA 4LOHA 2IAFA 2QVYX 5I8PA 1L5GB 1F51A 2WLLB 5JS7A 3STLC 3DZIA 4LV6A 1MOSA 2RE8A 3OOWA 4B6GA 1E1NA 3E2EA 3ONVA 2VYQA 2YN2A 4AZ3B 3OM0A 1Y3AA 1ZCJA 1IG0A 3D54D 4RX1A 1ZFNA 4I5GA 1PG0A 5DBIA 4Y2YA 1DQNA 2O05A 4IDQA 3UFXA 1JDUA 1G17A 2WDPA 1EFCA 5KVVA 1Q82H 3OCZA 1U8CB 2WWGA 3GC6A 1YJCA 3IJ5A 1UC4B 1J95A 2IU4A 5TMEA 3CKMA 1BCCH 2ZCUA 3QU9A 3VGJA 2VG8A 2BOBC 1AK1A 4CFZA 4ROSA 3WGYA 4U3FH 3WA7A 3R65A 2NQ8A 2AJBA 2EKQA 2C42A 2EIHA 2RD2A 1RC0A 3UOAB 2HKOA 3CX8A 3EE6A 3V4VB 4KDFA 5SZHB 2O20A 4HWOA 1IOWA 3ABMC 2F93B 2PF4E 4NBLA 3QHAA 3RIXA 4G0QA 4RKWA 4PCUA 1FS4A 3LUJA 2AEFA 5EHGA 2HQRA 2ZWVA 3HZHA 3AFGA 1BDHA 1Q22A 4AI8A 2RCVA 3DL2A 3E20B 2HRCA 2QMQA 3AHCA 5TJHA 3KZCA 4WOBA 4EZEA 4AJ2A 2WWXA 1A95A 1E1CB 2JLYA 3DGEC 1SUSA 2ZT6A 3RUCA 1TMYA 4FZJA 3IKLA 4FI3F 4DLWA 2HEGA 1XNQO 2VPYA 2CMHA 1DEAA 4Z4GA 1I5EA 4J07A 3O9OA 4IRXA 1PL4A 3HL0A 1OAPA 3DUFB 2QD5A 3TJTA 5TV2A 1LPNA 3Q4GA 4KR0A 3CKKA 4GYKA 3PQ8A 5F73A 5IT5A 1QPZA 1XV5A 1NW5A 3B6NA 2AXEA 3KE9A 4FBLA 2VF5X 2YVAA 4C76A 4RUEA 4X0EA 1OWNA 3AFOA 5EMLA 4URFA 2WSSD 3HU3A 3LZCA 3WQSB 3BWEA 3E9RA 4FIZA 5JDIC 2WHEA 2NR5A 3DLPX 4Q24A 4MINA 3AH8A 5C0OE 5AVSA 1PGNA 4B80A 1UDCA 1G8PA 4A7PA 5K3FA 3I23A 1Y1KE 1H2XA 2ZETA 1H9CA 1UZNA 2QP4A 2V4MA 4UBOA 3CKLA 4RSRA 4WBXC 3SJBA 3BSWA 1FPQA 2AN3A 3DKKA 5FLKA 2RGNC 4FM9A 2Q3DA 3BMQA 1ESMA 2H2IA 2PANA 4ZYLA 2KQUA 5B2ZA 1PP9H 2IBTA 1EWKA 1GG5A 1ONPA 1GUDA 2IV7A 1BWRA 4BFWA 2DYSC 2LW1A 1RAGA 2WJZB 2XAQA 1RRVA 4NBSA 3TOSA 1ZJJA 1Q1NA 4DZZA 2N04A 2Z98A 3K6SA 3AHHA 3G3EA 4PZAA 3K0GA 5K01A 2A6PA 1G21E 4IYRA 1VKHA 1IG3A 1MVOA 2WTAA 1PW7A 4CC6A 3KKZA 2IEAA 4DR5B 3IOYA 3UAVA 4WZAA 5EMJA 4CS4A 4DS3A 3FVWA 2AZMA 4OLJA 4MEJA 1ID1A 4EI7A 4QASA 4IVRA 1GV0A 2EP5A 1H8HD 2JEXA 3ROFA 3I30X 4BRZA 5CK4A 3ANNA 1FCJA 5HIMA 2PUTA 4EYQA 4KRYA 3ZMUA 1MRNA 5A5EA 2C9ZA 1E6WA 3C1OA 5IJWA 2VJPA 3SIXA 3C3YA 5LC1A 4YX9A 2EIXA 1BVUA 2HLPA 2Q6VA 3OE4A 2VNSA 3LHKA 2NZWA 2H85A 3JSLA 2C3OA 2H9AA 3OE1A 4CV2A 1D2EA 2BEUA 5H83A 1NE7A 3S0HA 3RHFA 3B9BA 2Y1GA 3NPMA 4L7VA 4IX1A 5THKA 3VYSC 1EGAA 3CHXA 2I87A 5K09A 3EORA 4R2JA 3I8XA 3PUIA 4R1TA 4ZO4A 1QE3A 3ZVMA 5ALIA 2Q5HA 1EE1A 1OAOA 1KU0A 3RRJA 4PQRA 1TUGA 4EYKA 3FPCA 1P1JA 2J9FA 2LO1A 4HI0E 4KKVA 3K09C 3PNSA 2Z9BA 4YXFA 1HEUA 3K70B 2YW9A 1SELA 2D2FA 1FFDA 1UBGA 2HWWA 1L5QA 1EJBA 2ZK7A 4AIRA 4E07A 4RY0A 2EHJA 2OT5A 4RMJA 4J0CA 4Y2JA 1PQ4A 4F21A 4RS4A 2Q5EA 1T5DX 1OQAA 2GPBA 4YRRA 1SVKA 3OWHA 2EEPA 1DWUA 2BKAA 1YS1X 2B2NA 1ZUNA 3RRMA 2Q7XA 2QYSA 1NBIA 3MHHC 4GKVA 1WA8A 3OEYA 2NZYA 1WBBA 1Y1TA 3KZOA 4L57A 2W6IG 3MIIA 1QBZA 3TD5A 1OR8A 2PLRA 3QVMA 3Q5DA 2C2HA 1FS5A 5JBQA 5DXFA 1NLMA 3KB1A 2QY6A 2C4VA 1G3MA 1XQWA 4G26A 2K6GA 2P9TA 4TPKA 2P2NA 3SZGA 3CPEA 1E1KA 5EIBD 2GESA 3RFFA 4ARVA 4ACBA 4NC9A 1GNQA 3ZP4A 3SZUA 4K9SA 1EVLA 1H22A 1V8DA 3LE8A 1FDOA 4IHJF 1ISRA 1OFUX 1OH5A 4BO4A 3ONNA 4M8SA 4FSXA 2NYUA 1P3JA 4NXNB 3TLKA 3L8MA 6YASA 2FEMA 1P5ZB 3USCS 1E5TA 2ECFA 3WL6A 3L7DA 1HOTA 1EYZA 1YCFA 3R7AA 1ITZA 1XDUA 1NLFA 3B2EA 5I7WA 5JZBA 3ZW7A 1WXFA 1E64A 5FHRA 2PGIA 3TETA 4HBGA 2ZRPA 4BRUA 4CHTA 3DSRA 1SVOA 2CYAA 4BO6A 1JDSA 1PEYA 1QIEA 2XKKA 2YI9A 1N6IA 4KXUA 2BZ0A 1GTSA 4URWR 4I08A 5FKJA 2PGOA 1YRBA 3CSDA 1QZZA 1TJ5A 4ON9A 3I6QA 1U2GA 2WQ6A 3KU1A 4M0LA 3SR2C 3DLIA 2L6LA 1E9DA 5IZ4A 2BT4A 1FXUA 4BATA 2H63A 1PF5A 1BW9B 1TPZA 2B36A 4B82A 1C9NA 1ETHA 4ODIA 3X1YA 4UQPA 2I3DA 1UXIA 2D2EA 1F20A 1NV9A 2H31A 2ZR2A 3OTOB 4MWBA 4DV2O 5HIJA 1SMKA 4XQGA 5AW1A 4DLUA 3KZIZ 2QTGA 3P2MA 2NN4A 4H6XA 3W6NA 3NEPX 1Z25A 3TQRA 1WSDA 2VCHA 1AHHA 1XTBA 3Q3GE 3O4RA 5JXIA 1Q1GA 2PR7A 2C59A 2OYSA 5IWAO 2COEA 1FUUA 1JHPA 4LF7O 2NZ2A 3FWKA 4GKJB 3OFSA 5G41A 4D9JA 3PC2A 3DHNA 4BFVA 4AF7A 3GWGA 5L3QA 2QA4F 1F3OA 2H7XA 1JJBA 5D2CA 1TF5A 2VPTA 4FYMA 2JGEA 4F4JA 4BO3A 2C0CA 2LGJA 3JQAD 4TRMA 4ND3A 3ZHQA 3ONWA 3LT0A 2V3WA 3KTOA 1M1YE 2I6FA 4M0FA 4RIHA 3LT1A 1P2SA 4JJFA 1H9AA 1FDVA 2AKEA 5CD1A 3IJPA 2GA9A 3SJCC 1R6VA 1TK9A 1JB9A 3DXFA 4E5SA 3DXRA 4MDYA 3R5SA 2EYUA 1G7SA 4WA7A 3FTEA 3BEDA 5LGTA 2FSSA 4M1WA 1DKRA 1OH6A 2I4NA 1GAXA 4HGPA 4IYHA 1KO5A 2CBZA 3LP6A 3T3DA 2W6OA 5TY0A 4JZKA 2Z2XA 4IDOA 3TGLA 4KBGA 2B7LA 3T99A 5AOCA 1VE9A 4B4VA 1F51E 4S1OA 4TV9A 4MW5A 3CJHA 1P4SA 4JB0A 4JLOA 4QEZA 3PHIA 4U5XA 1U0LA 5FNZA 1D6SA 1B0PA 1THGA 1KU6A 1J1UA 1UEXC 4BNDA 4HAIA 2WLNA 3ENKA 2X14A 3A11A 3GAZA 3HB9A 3G9TA 1N0NA 1F7VA 4DR3O 3RU2A 1U2DA 3Q4HB 5FJIA 3IUMA 3PDCA 5EZYF 4XE5A 3P19A 1AK2A 1V8BA 1DAOA 3P2EA 1C3EA 4WK2B 3HR8A 5K2MA 5FEMA 1MG5A 5K0BA 4TLAA 3KXKA 4K8ZA 3H1AA 2ECQA 2C2XA 5KSPA 2DT8A 3B7WA 4EG4A 1O6FA 1YI0A 4ITVA 2DHRA 1NF3A 1E1DA 4MW3A 1BDMA 3JR3A 3EY4A 3FTNA 2BRUA 3BAFA 3NWPA 1JFTA 1NMYA 1NTOA 1BKYA 4I0XB 4R8SA 2Q45A 3ZVLA 3DNMA 4GKAA 4KOAA 3ZE0B 1T6BY 1UDRA 4KVGA 2LRHA 4A36A 3IILA 2XYHA 4DWOA 2XCIA 2YIAA 3HPQA 1NLYA 3N0RA 1BQ0A 4RTRA 4TWZA 1H6BA 3OIDA 3KXPA 3BCSA 5EG5A 3PC8C 2ZVJA 3NT4A 2YIBA 1CY2A 1J5XA 4O4LB 4B0OA 3QYFA 2FZVA 1UT8A 1SQ5A 2QL6A 1MW8X 2CMDA 1YCIA 1HSOA 1H69A 2XE7A 4MK4A 2D62A 4YQFA 4WFBV 2Y4OA 4HAXA 1P7PA 4JI1O 4EDHA 4P2BA 4MVJD 2EP8A 5FP0A 3UWPA 2RC5A 4BZXA 5ICFA 1CNFA 4E3WA 2I3GA 2XUMA 2YWDA 1QTQA 3AETA 3UVEA 4ZMSA 3OESA 2EBFX 3SQDA 1XA0A 4LV8B 4OH7A 1PLLA 5B1YA 3GT4A 4XDGA 1F48A 2IGBA 3WZ2A 2FN3A 3DWIA 1OAKA 1Y9JA 4DRXA 1AVTA 3G8YA 1J7KA 4RK4A 3VH1A 1Q12A 4O4HA 4GU5A 3D6TB 1TAQA 2OFXA 1AZSC 4GMGA 5H6QA 2IELA 3NM6B 4WEQA 5DV9A 3MJFA 4DJAA 4DJ5X 1N9GB 2DQ0A 4JGGA 4X89A 1FAFA 2NO0A 1T3GA 5IU6A 3W2HA 1NBEA 3BDAA 3NEAA 5AJTA 4JL6A 1UOQA 3TI9A 3ZDBA 1SXJD 3OM1A 3ZQ6A 3ZRWA 1N3LA 1XX6A 4JQZA 3ASNC 1GL6A 4W9NC 5DYWA 1Z0DA 4BU0A 2W90A 3TLAA 5KUTA 5ALLA 4AZ0A 3I0MA 1P5FA 4LY6A 1EJ6A 2AB0A 3CG4A 1UBMS 4RUKA 2XASA 2GVZC 3S2FA 3WGJA 4IQ4A 2JFUA 3A14A 3GN1A 4TZZA 1YR6A 1OE0A 3CEAA 3GYGA 1XLUA 4RHXA 4ZQIA 3P26A 4EWLA 3NC1C 2OCCB 5DHTA 2P67A 4X1KB 2A9OA 4WZAE 2PZBA 4NCHA 5D7NA 1GKLA 2EXXA 5IT9A 1N7IA 4M0CA 4FLXA 1RPOA 1N0UA 4K6GA 2EJWA 5EZSA 3CRNA 4NLLA 1R1BA 2Q27A 4X84A 4CU2A 1CEZA 2CZWA 3I32A 2QIOA 4BAGA 1M34A 4L8LA 3LSUA 1KDOA 1C9YA 4XFDA 4Z4FA 3EGDB 3PGXA 4X5OA 1CUYA 4MVWA 5IKMA 4MQEB 2VPPA 2SBTA 1Z2PX 5T8KC 3HGTA 5KINB 4C0HA 5FI5A 4OUKX 5C3MA 4TTRA 4NH0A 1RCTE 4EHDA 4DIOA 1P4GA 3OJEA 4WVFA 1XP5A 3UUGA 4JWTA 1O7JA 4NXMB 1PZEA 1W75A 1HOXA 2ZSAA 3GLQA 1THZA 3AMVA 4MYHA 2XE8A 3MJCA 2J09A 4UBNA 2UXCO 2IU0A 4ZCSA 1Z6AA 4Y67A 3JQ8A 4G9GA 5FL7G 4KNVA 2E49A 1JG4A 1JLKA 2Z5GA 3TN7A 2KTUA 5HILA 4JZGA 5KAPA 2A0LA 3CZ5A 5ADUS 2EIJC 3LBNA 1ZI6A 1QLWA 3HKDA 2ZM6B 2N74A 5ICMA 5AI8A 5JMWA 4B7EA 3ER6A 1ZSVA 5KNBH 2X1HA 2JEUA 1FFXA 3L6OO 2PUBA 1IONA 2PYDA 2YUAA 2XA1A 4HS4A 4JD5A 4ASUG 3KVRA 2QTHA 3KQNA 4QLOA 4RDXA 5TSDA 1IV1A 4TTTS 3WHLA 1G0OA 1SF9A 5DSTA 3M4ZA 4DMKA 3QU5A 1ADCA 4P5EA 4LWOA 3B6MA 4ZQBA 2QD2A 1JFLA 1QIDA 4UOEA 2VO1A 1B6TA 3F0EA 2CB0A 1Q7YH 4IH9A 1DK1A 1DRWA 3EBOA 1GYPA 2N42A 4G0NA 2JAUA 4UZEA 2QZ4A 1MUUA 4LXHA 2EZUA 1C0KA 4RXUA 3TLJA 3T7TA 1GVNB 1ZK4A 3N76A 3W7BA 3U3DA 2FGKA 3HUTA 1NG1A 3GRZA 3FNFA 1C1HA 4CIDA 4TTIA 1D2GA 4LF8O 5T5QA 4WOPA 3VQXA 5FL7A 1R5OA 3CUWA 4DYDA 1NU6A 4A9AA 2FA9A 1WDLA 5IRCD 4DAOA 4D3DA 1WB9A 2YFKA 1V7CA 2QYHA 1KFKB 5LWHA 2G09A 4NYJQ 2LCIA 3U4MA 1GL9B 1NNSA 1RSOA 5DOZA 1S0VA 2YZMA 1E9AA 3D36A 1VOTA 2OYQA 4CKEA 3T7DA 4D8TA 1PL6A 1YMQA 4ZQGA 3X2SA 3QWBA 2OBBA 3I2FA 2B1QA 4DC9A 3IEVA 3AT1A 1G7TA 2ZJ7A 4H4DA 2JJ1G 3O3NB 4FHGA 2BJHA 2XT9A 3VKVA 4R5HA 5TPWA 3ZHVA 5HDQA 2FPXA 4PYMA 2WI8A 4DR5O 3H9BA 4M2LA 3ZMVA 2CTRA 2AFHA 2Z5VA 3VTAA 1NJIW 2DFPA 1Z68A 1Q95A 2FUNB 3HCBA 3ANXA 3QLUA 4MB6A 4DSAA 3SHFA 3CSXA 4U2DA 3IMEA 2EBOA 4WEOA 4OKNA 4UNPA 1Y3DE 3O94A 2Y68A 4Q12A 4XEHA 1MSDA 2CHEA 2HUPA 1XNGA 1F2UA 2IK8A 4PWTA 4CQNA 5EC8A 3LY5A 2N1MA 3HHPA 4FDAA 3FAKA 2HP3A 2REOA 3N2NA 2ZDQA 3MCWA 1G7RA 1VECA 4RANA 2C5LA 3D0OA 4X97A 4EJ6A 3PDIA 1ZUQA 1C1XB 3B1FA 1QTIA 3D0KA 4YP5A 4TS3A 2CNLA 4XJTA 3G68A 1JEEA 3OQJA 4XSVA 3UJ7A 1DBSA 4G1UC 2NTJA 4EG6A 1IN5A 5B3AA 2JJ1A 3FOZA 3VNBA 4Z1VA 4LWQA 3E7XA 5GINE 3ZN1A 3PLNA 3TL3A 4DG9A 5C7IO 1U7OA 5B3SC 1O5IA 1XEFA 5HK9A 3O2SB 3A06A 3PFIA 1JG7A 4TKUA 2CTPA 5F9HA 1QORA 3AZOA 1N5DA 3DMFA 1I5RA 4DREA 4U8GA 1Y4SA 2I99A 2O3SA 4DK0A 4WE3A 3ASYA 1J56A 2Y1EA 1RZVA 4CEIA 4JITA 1UXJA 2VK1A 1Z8NA 1Z3IX 1BGYH 1NTMH 3AG6A 3UV3A 1JIJA 4GP6A 6REQA 3TPZA 3DMNA 4QRDA 3IYLW 4PSUA 2YH2A 4IPTA 3PRHA 1U80A 1WABA 4L5YA 5C1DA 4ZOCA 3DBHA 3ZHRA 3AKEA 1DTSA 4O2AF 4C2BA 2UYCA 3ZX4A 2IHUA 4U6QA 1HSZA 4P35A 2XQIA 5AKJA 1C5KA 5LKAA 4B6SA 2HP0B 4Q39A 3MS2A 1PGQA 4LVUA 4FJCC 2A2ZA 4S1VA 3K5LA 4OSEA 4NHEA 3KDAA 1JXMA 5JJEB 4MRAA 2D7JA 2V1UA 2VSQA 2W43A 2Q3CA 4YT2A 3T0IA 3I28A 1TT5A 3IUYA 1WU8A 4YTEA 1IHDA 1QWOA 2N0SA 4NXNO 2ZBEA 1XJQA 3K9LA 4Q1FA 5HUJA 4PONA 2G63A 1Y8QB 4K6CA 1U0BB 1EX7A 2H1IA 5IDYA 4WY5A 4ZV9A 3UPTA 3CVYA 1QCDA 2ZPTX 1YZVA 2GTPA 1M2OB 2ZAIA 3OQOA 1GTJ1 2NX2A 1Q77A 1U9IA 4CM4B 1KEKA 1S1CA 5FYDA 3V7UA 2OVFA 4BTLA 4BVAA 2VYND 1QPBA 1YKSA 3GFGA 2NU7A 1RBZA 2DMRA 4LF5O 3A2FA 3EC1A 2Q6TA 1R0WA 4RBNA 2E76B 3UBTA 1WULS 3VUEA 1GTRA 2AKYA 3WNDA 5BSVA 1ZR2A 2ZXEA 2Y1FA 1W5BA 1OGIA 4BXOB 2O4UX 5BR8O 4JELA 1P7YA 2CV0A 5GZ1A 1ZHFA 1AUXA 2XXAB 4GRIA 4C07A 2C7OA 5CDGA 2R6R1 2ORWA 4ZVRA 3OMAB 2CF6A 2E5LB 2OSBA 3RR2A 3KQQA 4NYIQ 5EPOA 4M0PA 4RFLA 3OTOO 1DPGA 3A1TA 4CCAA 4G63A 1QVWA 3IFSA 5CFPA 2A4KA 3BTSA 1JE0A 3K53A 1B00A 1T9HA 2JD2A 2P7IA 3AR6A 1K3FA 2G1KA 4PR3A 3UWDA 2PX5A 5A2QA 4RDCA 5CVUA 3BMNA 1HFWA 1S2OA 4DN6A 2QRLA 5TPZA 2M6LA 4RJKA 3OM9A 4RDIA 2C2GA 3OIWA 2CLFB 3BSSA 4A1OA 3ELYA 4BO7A 1H0RA 2FRXA 5DFAA 1UBTS 1KC1A 2EVWX 5G1PA 3U81A 3KJFA 4ZDIA 1MABG 4ZJYA 4CN9A 2WW8A 3UV6A 5T41A 1LUVA 1G2PA 3PYMA 4D3FA 1Q92A 5H4HA 1V5GA 2X13A 5IULC 1NJIH 1XAHA 1LPOA 3BQMB 1NP3A 4RIEA 5CYOA 4Z4IA 1B2RA 1JNYA 3KOOA 3GLIE 2CLEB 3OJOA 4X8MA 5DM4A 3FBTA 4LBVA 1PNKA 5DLYA 4N40A 2C0QA 4JQSA 3ZV5A 5GM1A 4UEQA 2HRZA 2JEZA 5AW6A 2ZB2A 2PUAA 2GYVA 3CVVA 4D9MA 2AI2A 1PIWA 4ZDWA 3VJLA 1PFWA 4R54A 2ZRQA 4JKOA 3T4XA 4UDOA 5BYKA 4PHTA 1SWVA 1A7UA 3WQQA 4WNAA 2BJWA 5KYXB 2OO5C 3GJQA 1SC4A 4B73A 4J0FA 5LZ5A 1W44A 1O2DA 2BUAA 4K0RA 3RVBA 3IPYA 1PV0A 1K86A 1NKVA 1E2IA 3RTAA 5HK8A 1C3OB 4M7PA 2YZKA 1MABA 4DUYO 3D7KA 1V7ZA 2O59A 4KMSA 4EJFA 1KP2A 3IQWA 4A0QA 3ME5A 1JXAA 2P90A 1RYMA 5A04A 3D6NB 4H9GA 1NYTA 2AMFA 1M8GA 3V8NA 3D3QA 1VXOA 2VH1A 2E4YA 4ZT6A 3I2IA 1ACLA 1Z5PA 1BS3A 5A6SA 3L5KA 1RWOA 1CUEA 3ANSA 5CDSA 4Z0HO 1E6LA 1YNOA 2WA1A 3ZHZA 3TAXA 5AJWA 5GTHZ 4PZZA 5A9RA 3LGAA 1K8XB 3UM9A 5L3EA 5E2BA 2A5GA 5F3DA 3CLRC 1N4AA 5EHZA 5KWSA 3CZCA 1I4EB 1ZGCA 4GXRA 3RW9A 3KU4A 2OWEA 2HDWA 3F6RA 2IVZA 1N8TA 2V6GA 5CNMA 4IS2A 3N0XA 1VF6C 4WKBA 4P4GA 4MP8A 4JR0A 1QSGA 2X23A 1NH2B 3C74A 3E18A 2H2AA 4QRHA 2F9ZC 2EILC 1YBVA 5EUCA 3W1VA 4PW0A 1QFMA 1T1JA 1EVKA 2ZR9A 3J7AU 2XQKA 1KOGA 1U7DA 3BCHA 4JJIA 3Q72A 4RQTA 4IMRA 4DM4A 3U5ZB 1TIBA 2DPGA 4URUR 4ARZA 3F2IA 5CFZA 5LKRA 2XNCA 4RIGA 3ZIAD 2G0AA 4JPRA 1J1IA 4FN5A 2W6ZA 1S8AA 3K5MA 1EHYA 3W9YA 3GPLA 4MVJE 4BECA 4U7JA 5BQ5A 5JJLA 2FYUH 2H48A 4ETWA 5FIUA 1YEWA 3E5HA 1AV7A 2IEBA 1NURA 3C8MA 5CM9C 4MUHA 4CL0A 1VA5A 2CMGA 4UVCA 4JJAA 2QL5A 4R9SA 5ED0A 5A7HA 5IEJA 3CX5F 5KWJA 4H7DA 4OHVA 2NU8A 2OC4A 1R1MA 2QORA 3F7VC 1RQNA 2VH5R 2DTDA 3GRVA 4QGAA 3WKCA 1K5QA 5BUSA 4RXMA 3CZMA 5CFQA 1YZ3A 5MN4A 1JCHA 3OE7G 3MJRA 5G0UA 3WIUA 1VQ5V 1NVVR 1Q0SA 4JLSA 1X7ZB 2O5VA 1E7WA 1OLXA 3D8CA 1HYBA 3OAAD 4AX8A 2AUNA 1GGMA 2BMFA 1W5EA 1N5RA 4MW4A 2QR3A 1SXJE 3D2AA 1NVUQ 1Q7CA 3VC1A 1H2HA 2YCLA 1QONA 2X40A 2HA4A 3KKNA 4P3XA 2B0CA 5B55A 2EG9A 4B45A 3CURA 1EESA 1A50B 2AOXA 3VDMA 4RF4A 2PFGA 1H2GA 2HXSA 1TA4A 4G86A 1ZD8A 2WMOB 1Z8DA 4FFBA 4JEHA 3KR9A 4OHKA 4TL9A 1KKUA 4NBNA 2OTLV 3EPPA 2GT1A 3LHSA 3ZCTA 4XVRA 1JEQA 3NRCA 5EBLC 4RVNA 5KBYA 5DTMA 2R85A 1P7GA 5EGNA 3RQSA 4DLRA 3SC4A 5K6AA 3NOXA 3VZPA 5KKAA 2FW6A 3LXRA 1E4OA 4LRYA 4B3HA 1SQFA 1SIWA 4IIGA 3DF7A 4JOSA 4NICA 1Z5VA 3WHKA 2PTGA 1R4MB 2IZ1A 3I4FA 2C96A 3ZDRA 1B3RA 2OORA 3HR7A 3KHSA 4JGBA 3M5CA 4PU0A 1CP2A 5J5CA 4AJPA 1X1SA 4MR8B 4MWSA 4H2DA 4DA9A 3ZTWA 3OFVA 5EZ5A 5FI3A 3QKSB 4B6OA 1WSAA 4IVQA 1XNHA 1MF7A 3K6RA 3AP3A 2YIDA 4WXMA 1XCPA 3R0PA 2ODMA 1SXIA 5EC1C 4NXMO 3EHBB 2VWKA 4I5IA 5CMLA 2XOKD 1K5HA 5EAZA 3FFBA 1UJNA 2VJDA 1IBMB 1G6HA 3GLHB 4YQYA 2PMWB 4CKZA 4ZJZA 4CT4B 2REQA 2CCJA 2L26A 1G8HA 4WESA 2NVUB 1POWA 1N2OA 1LD3A 4WOKA 4QGBA 3GVXA 2ZM6O 2ZQZA 1MPXA 4HUJA 3DTVB 4CLOB 3UGQA 1SBNE 1K7EB 4NDNE 4AJ9A 3OUUA 2PV0A 1S3SA 2QWNB 1X4TA 1WKCA 5CLGA 2CE4A 1J39A 1U4OA 2YV5A 4YLGA 4O4IA 3EMKA 1LFAA 2FP4A 4JFRA 1HRDA 2JFHA 2GF2A 1K7SN 1E7RA 5EMHA 2J0EA 3WDLA 2YZGA 4DW8A 1E8NA 2IU6A 5TR9A 4CG3A 2HUNA 1EN6A 2NYRA 3LLMA 3FW1A 4AJOA 1Q0QA 2EWVA 3EJWA 2KBFA 1VJTA 5CIQA 2ENWA 1RLUA 3VHQA 3VHXA 3Q0IA 2K1SA 4G4YA 3UN1A 3B09A 1RKUA 5EJ2A 5KDOA 1G4UR 3G2JA 2PLWA 4DR3B 2CJXA 1N6RA 5HKAA 5BORA 3CRAA 1OFTA 3CWBH 4IOKA 1GKYA 3VPCA 1H8EA 4EEZA 4Z4HA 4QDUA 5JNTA 5JR3A 4B3MB 4YMGA 1BVHA 3PBKA 2WDZA 1TUIA 4R05A 2G9ZA 1D0SA 3DVQX 4AKTA 1TMGE 3VC2A 4BAUA 3CPHA 2AIRA 2QRMA 1C0LA 5CJPA 4TYQA 4L8FA 2QL9A 4D9NA 1E79G 3RAFC 4JCCA 3MWDA 2H59A 4MW0A 4D4JA 3P0JA 5LNK1 4LE2A 3PAFA 3ILVA 2HA3A 1BHSA 3JQFC 2IIBA 1IZ7A 3GO4A 4WFAV 1Z4QA 5KHKA 5GGYA 4ENSA 2VS0A 2ZFUA 3BCCH 4UCRA 1LBSA 4FNAA 1F2VA 4A0GA 1Q1QA 1TFRA 1K8RA 3ZIUA 2HKIA 4N9QA 1CERA 4JAUA 4LJSA 1MQAA 3UMBA 1FSFA 1L4YA 3SQMA 4AWBA 3O93A 4QT0A 4Z0NA 4RTPA 4ZOAA 2PGLA 2OZLB 3FD9A 5JQGB 1UFOA 4F2HA 4X20A 2FMIA 2PZFA 3JQGB 3H5WA 5FFMA 2AG1A 4BNKA 4MB2A 4DZTA 4R9VA 1MX3A 1JTEA 1HDZA 4RKFA 4UNQA 4LZAA 3TW6A 2G0TA 4CTMA 1Y66A 4S1TA 3ZE8A 3JAWB 3NM4A 1RABA 1YR8A 3ZR4B 3PITA 4BMOB 2BW0A 1U65A 1W46A 3N2ZB 2B3TA 1E79A 1P60A 4B3CA 5B1IA 4BB0A 3OFJA 3UUEA 1A4XA 4ZTBA 6GPBA 1BCSA 4HDOB 2VN8A 1PVDA 3AI2A 3RWMB 3HCWA 4K3AA 3ESQA 5AM3A 3SYCA 4PPFA 1DCMA 2BGKA 2N48A 1GYQA 4CL8A 3RSQA 4TZKA 1RZ3A 1XZFA 1DBPA 1ST3A 4V24A 3UATA 2XWBF 4FZ0A 4X8LA 1IMOA 1L5HA 2WLHA 1KZ1A 4KWCA 2JKZA 1LTHR 4AKIA 2XVXA 2PD6A 4F7WA 1E9VA 2EGGA 2AZTA 2QENA 3NKFA 4UQOA 4G8DA 3AOGA 4CM6A 1C0EA 4EVRA 1RXUA 5H16A 4MDEA 4GZ3A 4OG2A 4ZYYA 2VL7A 4WRRA 5EXTA 4JXKA 4UHKA 4BIUA 1XMVA 2Z8XA 4IIYA 5KZMB 4A6DA 1JIKA 2XMBA 1KMIZ 5B6IA 3RO7A 1FXKC 3KYIB 1H7MA 2WLLA 1DJPA 3Q1KA 1J9GA 3H1BA 1R4NB 1D8TA 3I72A 5BN4A 5TIIA 4IHQA 5GIPE 3IKFA 2G77B 3JVVA 1GPDG 1XDZA 5H0IA 4AZ3A 2CXHA 3B7GA 3W3ZB 3F1LA 4FFVA 2ZSDA 4YIPA 3EQ8A 3I2KA 3G2KA 5J9PC 1GT6A 4PLPA 4G5SA 2QD4A 1KXZA 1AQ6A 1PNOA 3NHAA 1LDBA 4BZWA 1RJWA 2R5NA 3W9UA 3NHRA 1JDZA 1G1MA 4ND7A 1D4OA 1HDIA 2LDXA 1KDZA 1AROP 1GN9A 1UKVY 4BZPA 4FIPC 1TM1E 1PJCA 3TINA 1QR9A 1SB9A 4B7AA 2NNLD 2UXCB 2PX6A 1OWOA 1YFJA 3IVRA 4FMDF 1TQ4A 1AMUA 2Y92A 4FNGA 1W2BU 1II8B 4GPAA 2ZBGA 3T7AA 3RFUA 2F9LA 1LNQA 1Z38A 1FF9A 3TNFA 4WCVA 1ADFA 4UE2A 2CUGA 4X61A 4TL8A 1E1CA 2E5LO 1F9AA 2FYTA 3HLKA 4QAJA 3RFVA 4Q7EA 4GZRB 4K1LA 2Z1TA 1NTRA 5U9CA 3G5TA 1K2WA 7ADHA 4I7EA 3DUFA 4OHYA 4GX2A 1NSYA 3KWLA 1X15A 5JRZA 3A0RB 2J9YB 4Z7NB 1RA4A 2BGNA 3K8OE 1MGOA 3JSNA 1Q6IA 1XTPA 2QT1A 1S02A 3I1JA 3I9JA 4KPGA 1TQHA 3VSEA 3ZMTA 2HG5C 1G18A 2P9HA 1R2QA 3H87A 1UFYA 2PA3A 2V4ZA 2WUGA 2GUZB 4UUPA 2CVPA 1Y7TA 1AXGA 2JI4A 3WU2Z 4HDCA 4LF8B 1W4CA 3HRIA 2E18A 1W5SA 3E3MA 2I3AA 5K3DA 2KTVA 3MT8A 4KQEA 2Z30A 4GPEA 3WL7A 2C00A 4E5KA 2HSDA 1NMEA 4OSPA 1NJGA 3TTTA 1PSDA 4NE9A 1Z4OA 2E21A 4B33A 1ILWA 4HMQA 4RWEA 4L87A 5ESDA 4P4LA 4KHZA 3D8TA 2OXFA 2PN1A 3CIOA 1LNZA 4C4WC 2BEWB 3K0CC 2X3FA 1L7OA 2PGAA 2YXPX 3N3AC 3P2KA 4BLPA 2X9VA 1Z6YA 4AB1A 1SUDA 4XIJA 2R87A 2VDKB 5CLFA 4I81A 5SZKB 4HXEB 4C9BA 3NYWA 5KSYA 1T5EA 3RF6A 4LRSB 3STWA 2PI5A 3SYKA 2OCXA 2QUIA 2CFRA 5ALHA 1X1DA 4OHRA 3ZI4A 3CBGA 5B5SA 1J2JA 4KXWA 1Q57A 1T4CB 2OUKA 3I01A 4QE9A 4AJIA 1SQQH 1UBRS 3GB9A 2WZCA 1D4ZA 5KI6A 2YWJA 3RTGA 3A3KA 2ORVA 3PVCA 1L2TA 4W63A 5CG2A 3UOWA 2FEXA 1P5RA 3QJGA 3VOAA 4ZV7A 5CN0A 4ETNA 4GVPA 1YVEI 1U8XX 2VSOA 5CBHA 2JJYA 1VQ7V 5A5VA 2F1OA 5ENZA 4MW7A 1KQSU 4NU5A 1KTVA 3IIMA 4CT5A 4M9ZA 1JAXA 3IRVA 3JY6A 3L6DA 1M2KA 4QECA 5SZIA 1C7QA 3OBWA 4BMSA 1EUYA 4R8MA 3FPFA 5ICCA 2VKTA 3LQRA 1N25A 2HWUA 2AXPA 4LCEA 3O8BA 3T7KA 2HPZA 3UC5A 4UTVA 2UZ3A 3I9OA 4BLOA 2FV8A 1E2FA 3FLAA 5BXZA 4NU8X 3DEIA 1IXZA 2QAGC 4J49A 3KUUA 1V55B 5LQSA 4D3YA 3D4BA 4HJRA 4B09A 3ETDA 2AR0A 3RC7A 2VDNB 2DHEA 3CVUA 4MH0R 4X6LA 2G9UA 5CDTA 5KS2A 4R3NA 3E9QA 1EXWA 4MQLA 2OHXA 2OTMA 3T4ZA 2ZIWB 4WH0A 3SD7A 4BO1A 1UL1X 4ZHQF 3F7MA 3C7TA 1FSZA 2PSHA 3OD1A 2RNBA 4D97A 3WLHA 1VQ5F 3M3PA 1R66A 1L4MA 1UK7A 4H18A 1I4LD 1AZLA 3EGOA 3ASOC 4DAEA 1FSGA 4JAVC 2VUHB 3CE2A 2EJRA 4LISA 4AWAA 1FE8A 4EEQA 4A8HA 5BQXA 1E2HA 1ZH0A 4ZBMA 3KB8A 5AHXA 4NQRA 1RADA 4IUYA 3GEIA 2GHRA 2FPPB 4P80A 1NC1A 3HY4A 1HURA 2EWMA 2QY9A 1E77A 4EPVA 1BHO1 1RPTA 1WX1A 1T8PA 4IDFA 2XTZA 2I8CA 2NTYC 2OTLF 3IUEA 3EQ2A 2VHQA 2WLSA 2YINC 2Q3BA 3SPIA 3PFGA 2A1UB 4G5QA 5FWXB 3K31A 2RGYA 3RAGA 3L7OA 3S7TA 4JX9A 2NTVA 5A3SA 2IXEA 2QMZA 1ODIA 1I8TA 3T5GA 4TQFA 3C5EA 2H3HA 2J3IA 3F0DA 1BC5A 3EEQA 1RP7A 4YAIA 3EUEA 1Z7EA 3MRXA 5DI3B 4Q7KA 3DQQA 2YIBD 4LF5B 4BFLA 2CLLB 2G1JA 2DUMA 2QJTA 4O2RA 2W6IA 1ZD5A 2BC9A 1UODA 4Z3KA 2XGMA 2QNBA 1G3RA 4ND2A 5BR8B 4FB4A 5BVHB 4U0KA 1BW9A 4FMCF 4GAEA 4R71A 3D01A 2B2XA 5FRDA 2YSUB 3NFRA 1L0LH 5FPYA 3X1JA 4HQNA 3WGLA 5TNXA 4KIUA 3G59A 5D00A 1QLJA 1CJSA 2XKJE 3ODPA 3C3CA 4BT2A 1VCOA 3QOYA 1QAOA 1MJGA 4YUYA 3JQ9C 4C78A 3IPCA 4F4DA 3I2HA 2DUWA 2HJFC 3GZ4A 4DJJA 1H3NA 5B3LA 2GAFA 5C1OA 3DZGA 3NIBA 5T6BA 3FCCA 2G67A 3WBKA 3KSZO 3S28A 1UK8A 4MWEA 2D2XA 5I5GA 3KHTA 4X63A 4QUDA 2DBQA 2I6TA 4CW7A 3U4GA 3MQWA 2JFQA 3I6YA 2WYVA 5IDQA 5CDFE 1B8UA 1IBMO 1QRUA 1SRRA 1JTFA 1L0BA 4KRGA 3EMVA 4BYGA 4P3PA 2OCYC 4IDEA 1XCOA 2PUWA 1B2LA 5H3CA 3WAKA 2RGBA 1DGSA 1IPEA 3LO5A 1RT9A 4Q7QA 3OETA 5TF0A 5CH5A 2YMQA 3P8ZA 1SG0A 4DUGA 4ZVOA 3NK6A 3G71V 3B85A 2C8LA 1FUIA 2WIKA 2NSDA 4X9QA 2OT3B 3YASA 3ZLVA 3PV0A 1S5JA 4XA8A 4K9DA 3CX3A 2OP1A 5MHTA 3HA3A 4IUDS 4FYYA 2WTXA 3OTHA 4CI0B 4TSKA 3LT2A 3UJDA 2HLNA 1JJAA 3SXUB 2WF8A 3BXHA 1R4AA 5LUAA 4AMZA 5JSFA 4ZCTA 1BJRE 1QHEA 1PXWA 1VEWA 4WXYB 5JAOA 4Q6GA 4HAVA 3QNUA 1GARA 5K4GA 1WRBA 4PC7A 4IFTA 5CX1B 1QK4A 2I6QA 1M73E 5C31A 4C6RA 1Z62A 1YQWA 4DUYB 4PZ9A 4LV5B 5B64A 4FC7A 1E2NA 3U1VA 4DQUA 1A5SB 3HABA 1IOLA 1VQPV 1FU7A 4RA6B 1CX9B 3Q4HA 2P62A 4FKBA 6Q21A 2PSJA 2GRAA 4G1FA 4Y6SA 4YASA 2SKDA 4B3MO 3IA2A 5CK5A 4H7FA 3FPSA 3LYBA 1WHSB 4GSKA 5BMVA 3LK6A 5FI1B 3RVZA 3TMYA 4N5HX 1RYYA 4HKTA 1KZGB 2B2CA 2O57A 1P0CA 4BGIA 3SY8A 2BM1A 2IYUA 3ZWAA 2R84A 5CLLA 4I5FA 5JXHA 1EGVB 3U44B 1B6QA 3V48A 1ND6A 3K4QA 4OXQA 2X6TA 3N4YA 4ZZ0A 4I0XA 1GUFA 3MTGA 2JANA 1SKVA 2WVHA 3GUCA 2PIDA 1M2EA 4FNOA 4DWWA 1AU9A 3HJHA 2PVPA 2CVZA 3BC1A 1K9VF 1J49A 2ZS9A 3CNQS 3CYFA 4FIDA 2F90A 4NEGA 5HFLA 2A79B 4K3VA 3KXIA 1E59A 2C3MA 3IMCA 1XMJA 4O4LA 1NZ6A 3CS3A 2XGGA 3AB7A 5F7XA 3QUWA 4RVGA 1L1RA 2QVZX 4KBYA 3DE0X 4DYLA 1CSEE 3NU1A 1GTOA 5JXJA 2QD1A 1DGQA 1GNPA 5E4FA 5DECA 3L07A 4G4SP 3L5OA 3D43A 4DKJA 1E3TA 3JD2A 1KETA 4U7GA 3UJ8A 4GS5A 6NULA 1ICEA 5I9IA 4YR7A 3TLCA 1XCMA 3FSGA 4PSAA 3ZJ4A 1DI0A 1W7AA 1QAMA 1ONNA 1NBOA 4N0QA 4XQEA 5H81A 1IZZA 4I4TF 1E9CA 1MO6A 4GR4A 3PCRB 3A32A 2QJWA 1R9JA 1UEIA 2VDVE 1A4UA 3A04A 5FL7D 2XZTA 3INNA 1FX0A 1GPWB 5FCDA 3V2IA 3DMYA 2MSEB 1Y5NA 2IS6A 3BFVA 2LUOA 3KZKA 4RQUA 1HDRA 1N9GA 4I0WB 4KGZA 2Y0IA 3HI6A 1U2SA 3NNNA 4G67A 5IABA 3DJFA 1W6RA 3H01A 1OASA 2QDKA 2ECKA 1EJ2A 4UDYX 3GNQA 4RV4A 3IXQA 2NNWB 3GIDA 2Q4BA 4QAQA 4HVTA 5IDJA 1AIPA 3DBVO 2ZVYA 2JRIA 1CQPA 4WOCA 2Y6VA 2HL6A 3ZGYA 2JJ8A 3I8SA 1PM9A 3DG9A 4FM2A 3H2ZA 3P5SA 3OKAA 2P4VA 5B7GA 3A6KA 3VV2A 2FEWB 4ZO8A 4RWUA 2BZ1A 4OJKA 1G8YA 3HG7A 1X9IA 2IH3C 3ZQKA 3WRXA 1Q6HA 3FB5C 3VYUB 4Q4JB 3I0NA 3EAGA 3MYYA 4EX7A 1WJGA 3TXAA 4GP7A 1I0LA 4X1KA 2A57A 3U7RA 5I9LA 2WKRA 2HEIA 4F06A 1FYJA 4KLZA 2J3DA 2WJAA 2C8KA 2OPHA 3SJ7A 3GQBB 3ETLA 4FZRA 4FHDA 1JYSA 1MPTA 2AJLI 5EQDA 5EBWC 2Y1KA 5A1JA 1FD9A 3ZY5A 1NUSA 2NQTA 4DDKA 3EGDA 1TE2A 2DWEC 1KI2A 4LCJA 5IJZA 2VBIA 4ALIA 1PK9A 4MQEA 4BE7B 2O52A 3OZSA 4PD4F 3PNQA 1WEKA 2HVYD 2HHAA 5JIBA 1ENYA 1AH2A 3GJ6A 1EUDB 2I71A 1XIVA 3K32A 2HF8A 2K9PA 3NP9A 4QC2A 2ZJOA 1B16A 3H7IA 1T3TA 2JJ1D 4R7TA 5CB6A 2QLBA 4G8CA 5FO1A 1HYQA 4J4HA 3QVWA 4UUBA 1V11B 2RJOA 4BT3A 4S24A 3HBAA 1L5FA 2C8JA 4J0JA 2AKAB 3U3ZA 3IQXA 2IP2A 2IYSA 4UCSA 2Y67A 1U31A 3T7IA 3LCCA 3RVJA 4D43A 1EWQA 2WAAA 5FWNA 2HV9A 2AHYA 3VJKA 1X42A 3T5DA 5ES3A 4HGRA 4RD2A 4GXNA 1TAHA 1ZKMA 2IHJA 4NARA 1R3IC 3DKPA 1LI4A 3O1LA 3LYAA 1N6OA 1PFQA 2PU7A 1BWSA 5H6RA 3QMWA 5CGZA 4Y1RA 3EIWA 1XPJA 4GL2A 3OC0A 2WQ7A 1WF3A 3IBCA 2Q50A 3KAPA 3T5CA 1PT5A 2DOSA 5KSWB 1TA0A 5KTPA 2W71A 5JSKA 5CFNA 3JQ7B 3TNDA 3OO0A 3SPXA 1AB6A 4KVAA 1Y7PA 2CNOA 4ZAZA 1R9NA 3SYNA 1KI4A 2D59A 1N3IA 5B4TA 1RC8A 4NU0A 4H4CA 3MCQA 4MVXA 4ACAA 3FZEA 4M1SA 1VPTA 4HZIA 4PFKA 3WLJA 2I62A 1O77A 2OHIA 1IQPA 1VLHA 2W2QA 3ANLA 3BVOA 1AO3A 3NTOA 4A2CA 4CM8A 4QYXA 3T9EA 1M2VB 1JJOA 5F78A 2HMUA 1DZ3A 5FV7A 1EK6A 4PA7A 3L6UA 3HB3B 4LWSB 2B7CA 5IC4A 4JT9A 1ISJA 3KOMA 4J1NA 3OBIA 4LAFA 1J0EA 3TW8B 1J21A 4V2IA 2W98A 4GNKA 5GQSA 1UKAA 2PLAA 3UK2A 3B2EE 2Z4SA 3L1KA 1VSVA 2WSMA 1XU7A 1EA7A 4ASUA 2F8SA 1RTKA 3W7XA 4GUNA 1S6YA 4JI2B 3NORA 1L7BA 2I6GA 3OA0A 4GWLA 3DDCA 2GCIA 2CGEA 1KYYA 1Y3CE 4JBLA 5AESA 3A6PC 3ZKWA 4PSDA 3ONEA 4CH4A 1B0AA 5L3CA 2NIPA 2H4FA 1UP4A 1YQDA 1VQ7F 4TXLA 4FD2A 1X7HA 4L76A 2WALA 3G89A 4JYPA 3PKZA 2GJ4A 4TQ9A 1NI3A 2LKCA 4G88A 4R3UC 5ERGB 2VUUA 3FI9A 3TQOA 1Z4KA 4NECA 4KN8A 3BSYA 5A5FA 2AZ4A 5JANA 1JZSA 1N2GA 3BHJA 2H92A 2W2KB 3T3HA 5TPZD 2DYKA 3MAAC 4Z4CA 1HH4A 1Y1PA 5EN4A 1PWYE 1XRQA 3AL3A 1BRTA 1RWVA 4YDQA 4XI9A 3VVBA 4HBZA 2Q4RA 5EKTA 3AGPA 3O9VA 1MP0A 3EUFA 2BUBA 1BWPA 4YHHO 1MTOA 2W0FC 3MJDA 2O2SA 5FO0A 1C1XA 5E3IA 3M6AA 2HT1A 4E31A 2EP7A 3RRNA 1A8UA 4X24A 4CTOA 3CX4A 1XLVA 3I12A 3DVAA 1E9SA 4YLYA 3I58A 4QJ4A 5FPTA 3QBTA 3LDHA 4ALKA 4ZZ1A 3FB7C 4FFKA 4DQ0A 4FHZA 2IYVA 3O4JA 3S29A 3KETA 1XAGA 1EX9A 5KVCA 4IHJB 2RK6A 3DBLB 3GHYA 3H11B 2ITDC 3BD8A 4GRAA 3MINB 5ESXA 4HB3A 1AZTA 3K9AA 4B3JA 4XIGS 5D5HA 3O8RA 2FPUA 8MHTA 3ZD8A 1O57A 2OGZA 2ZUBA 4Q00A 1KSFX 3PCTA 3I9FA 3N2LA 1JJVA 1OCCC 2YFYA 3ZZTA 3MNFA 5LLSA 1Y5RA 2GEFA 1SHTX 1PEKE 2QLMA 1CUGA 3RA5A 4ZZ2A 3GTZA 3VDRA 4XUGB 3R74A 5KWVA 1QHNA 1PS0A 4BWFB 3L8DA 1GPNA 1XPUA 1MOPA 3F5MA 3FBAA 4R8RA 3OT5A 2DQYA 1LRLA 3FNEA 4R9NA 2Q4PA 3F5SA 4AJLA 1B1AA 2GYUA 1MVLA 3A31A 1C7IA 3EF1A 1N77A 4HYEA 3HYRA 1U81A 1E60A 2YL2A 3PUZA 5HZGA 3IC7A 3IDAA 4YRIA 5JBNA 2BI8A 4EYGA 2FN4A 1KP3A 5TEVA 1I9GA 4PGMA 5CB4A 3PX2A 3LWPC 1Q19A 3ZEIA 1Y76B 1Y8QA 4FCCA 3ZE2B 4UVBA 2CDRA 3IUSA 5T4HA 2C95A 4D81A 3VR2D 4YMUA 3L0PA 1E2MA 3VQYA 4YAUA 1YK0A 1M2OA 3FIUA 1KY2A 3CM0A 5T3UA 4QJIA 4EQ6B 4IXDA 3TSYA 1IPFA 1MO3A 2ADOA 4BZZA 2R7LA 2GJKA 4CUKA 1H2KA 4E4RA 4NABA 5DYIA 4D8UA 3UO2A 1GPLA 3SXJA 3AFNA 4TVBA 5K0CA 3WSVA 1VG8A 3BSFA 1AI5A 3U19A 5K3OA 5JNWA 1PNMA 2C2MA 2QMHA 5LSAA 5KAIZ 1EXVA 3TZ6A 1GLVA 4BXOA 4PDVA 4PAMA 5I4IA 2XXAA 1TZ2A 1UFVA 4XD2A 4G4IA 5A4MS 4E5YA 1KO7A 1BX3A 1SD2A 4M0EA 3B2QA 1E58A 2C98A 4HH4A 4L8JA 3MD9A 4FHCA 2YXBA 3I5XA 3VAZA 4BX3A 2HWXA 4DWVA 4IFEA 3DCYA 4PX2A 4XSGA 3NBXX 4I1PA 3M0EA 4Q18A 3A3YA 5AVKA 3KQVA 3OIVA 5FAKA 3DR3A 3LUGA 5KSZA 1EZ4A 2ITCC 1NDUA 1RSZA 5E1MA 3T1NA 1OTXA 4DV6B 2FXIA 5ALEA 3GD5A 2QN3A 2O0LA 1TJYA 2PRSA 3E3OA 3WBBA 2PPLA 3ODGA 2M6KA 1T26A 3T4EA 3HP7A 3JSXA 1NAHA 1XF1A 3S1SA 3UK7A 5IVIA 4IL6Z 3BH0A 3EZFA 2ZDGA 2I2AA 1RYBA 5EZYB 3JASB 3G67A 2FSVC 1Q83A 1YB6A 2C7RA 3N7AA 3V34A 1G3QA 1MB9A 3OMNB 2RH9B 1PV1A 2C1XA 4NY1A 2CE7A 1Z0ZA 1I6KA 2HF9A 4A73A 2H5LA 3AG1B 2XSZA 2E4VA 4NKRA 4O8ZA 1VQPF 5IJ0B 1I80A 1K9SA 2YC4C 2PH3A 2V98A 2CCGA 5KYXA 4EUNA 3L8HA 4EEXA 2Q2WA 3LDGA 2O2CA 4H37A 2GD1O 4AN1A 4ZAWA 2JGKA 1TTHA 3FCXA 4I1RA 1QOPB 4II3A 5ALMA 2IFTA 1C3OA 4D2IA 4C0LA 4HYQA 3SDBA 3F8TA 1MDFA 1M34E 3PZRA 4MKFA 2PY5A 3DEYX 1O95A 2HHLA 2ZDIA 4B3XA 3C3TA 2F2TA 5EIOA 3JZFA 1NIPA 1NDQA 1E8DA 3ACDA 4JGIA 1AKUA 5AJUA 2B5VA 4LRXA 3EF0A 1V3VA 1ZM2A 2XAUA 4UM9D 4G4XA 1JFSA 3IEMA 3MILA 1IRXA 2DCUA 3BK1A 3EBPA 5CLIA 3ZCUA 1QE0A 2UYHA 3V8QA 1THMA 2V6MA 1GLGA 1OA1A 2YHIB 1Y1LA 4I4TB 1KERA 6CHYA 1FKAO 2IXDA 2C4HA 2Q1TA 3RC8A 3SE7A 1H5NA 1RE1A 2HBYA 5CIYA 5K0ZA 2NUTB 1JLHA 5KC9A 2C94A 1LSOA 4M86A 1JPVA 3E0XA 5JDCA 3PC7A 4CV0A 3H04A 3UENA 3LKBA 3HEMA 5EP2A 1I2MA 5I7FA 1KE1A 3MMXA 4UVHA 5BVGB 4CF7A 1E9RA 2JARA 4FYIA 5IH3A 3UAZA 1JBKA 3DZFA 3FMGA 1VC2A 4NFSA 1NT4A 5K8CA 1C2YA 3M5WA 2A9PA 2EZ4A 2O2GA 4C3VA 3QRWA 4NIMA 3G9ZA 4EW2A 4ZJUA 4B32A 4JVMA 5WRFA 4JF3A 2ZEJA 3ZO8A 3CLTC 2NV0A 1JR4A 2VNHA 5HXAA 3NNSA 2VHEA 4Y2PA 3M6UA 3UTDA 1PR4A 3H9VA 1YBHA 1BEEA 4F3RA 3K6KA 4IV5A 4C1BA 1MB2A 3SM3A 1NLUA 3IT2A 4TMZA 1GNLA 4KXMA 4L73A 2FRDA 4GI3A 2QUKA 4J43A 4RYDA 4XJXA 3K04A 3VNUA 1JSZA 2GASA 4UU0A 3BZWA 2I9PA 2VWHA 2PS0A 2PT5A 3AF1A 1QUFA 3COZA 2YXYA 2GR9A 2E7ZA 3TKAA 5AT1A 2WU3A 2WM2A 1H8ED 3KSAC 5HIAA 1Z2OX 3L79A 5IM4A 1E2LA 1ORRA 3EDMA 5G1NA 1Z6ZA 4XM0A 3UJ9A 2GUWA 3IB6A 1X7ZA 1W88B 1MFPA 3TECE 2QX8A 2GNPA 3WNQA 1ZRMA 821PA 3HJAA 4I2VA 1C3LA 1D2HA 3BYQA 1H42A 4ER6A 3HKCB 2V54A 1B42A 2LR0A 2ZI7A 5L9AA 1AI4A 2H1LA 4AROA 1I6WA 3HK2A 1XZJA 2EIMB 1MO4A 4WXRA 3EULA 2GEBA 3BHIA 3EVAA 4Z1OA 1GN3A 4PAQA 4BIZA 3S1LA 2V6FA 4WLVA 4Y6QA 2EIKC 4JBWA 1XP8A 1Q0ZA 1TGYA 2XKAA 5B1AB 2EF1A 1TD9A 1WHTB 4B85A 3RGBA 4QXRA 1J5EB 1ZOOA 3QENA 1EX1A 2I66A 2AFHE 5FPQA 3IVAA 5SY4A 3DR5A 4RKQA 2ZF8A 1XVLA 1FK8A 3NC4A 2OPBA 4RZUA 3G2QA 3LDDA 1DHTA 3CT4A 4GX5A 3O2QB 4O02B 3A6ZA 5L3RA 5JZVA 2Q1SA 3TTSA 1R4MA 5ARDA 4UFOA 2Q6IA 3OE7A 4X64O 2OZBA 3W4JA 1YVUA 5H68A 3ETJA 4J16C 4MR8A 1KY4A 1GAJA 4J1SA 2W93A 4ZK7A 1EFPB 3OCUA 4QM6A 5JFTA 2WSIA 1F2DA 3BL5A 1E79D 3HV2A 5EB1B 3MC1A 4LS3A 2DHDA 3QVVA 3DYBA 3ESJA 2MSKA 2FJPA 2BN4A 5B58T 4N01A 4I55F 2ZZNA 3NW9A 5C1IA 4QNNA 1VIBA 3HQ4O 2WLTA 2H65A 2GDJA 4QXMA 4PIMA 4LK2A 2XA2A 3GLHA 3L0IB 1EG2A 4PPYA 2XMPA 2D06A 1A9QA 1VIYA 2JIMA 4UOQA 5K0TA 1ATZA 1GPKA 3FRIA 2NVUA 1IEVA 1NXQA 1WY5A 2QI9F 3LC2O 2YJNA 3DTVA 5EJ7A 1QIGA 4CLOA 4AY6A 3HA2A 3INRA 3SPHA 4U7PB 4XCQA 2IJHA 5KSOA 3SC6A 4WSOA 3BFXA 2ZRIA 3LPDA 4Y2HA 4NAUA 2HU2A 1FYDA 4LG1A 4A10A 5IP5A 1I3CA 3RB8A 4DV5B 4JLVA 2I7DA 1R64A 5ABPA 3QQPA 4BX8A 4EGSA 1T24A 1TADA 3KPWA 4Z9BA 1XREA 4IH1A 1U8ZA 1DXYA 2VF7A 5H02A 3K2EA 2V97A 4I6JA 2NM0A 5KC8A 4DBLE 4N8EA 4KI0A 4MVQA 3U2QA 1CVLA 2MCFA 3BD9A 5K1ZA 2E9SA 5AI9A 2Z58A 2QQGA 3C5CA 2ADFA 4PN3A 5CDYA 3F97A 1N6HA 4RD0A 4ESEA 3HCNA 5JO9A 1L5OA 2WIJA 5DM1A 2QB5A 2VATA 3J80M 1EDEA 1ZUHA 1RYEA 2P1DA 1ZJYA 2VXYA 2DUJA 4LRUA 1RXVA 2IXTA 3S5JA 5KYYB 3S70A 4OJNA 1Y3BE 2XB8A 1C9KA 3HWUA 1HNWB 5FOWA 5JRDS 5KNCA 1H3EA 3EXHB 3PPYA 3HEAA 1I14A 4BVQA 4QFDA 4TMTA 1T1RA 1V45E 3TWOA 1GAWA 4JI2O 1L8DA 5CHYA 3MPOA 2PKYX 5K8IA 4NYKA 5HS4A 3CWCA 2ZJ5A 3R5JA 3L84A 4EI9A 1YMUA 4JODA 1PL7A 1EEHA 1R0KA 3TTWA 1NUQA 2XHEA 3PHLA 1OA0A 1YS7A 3GVIA 3I2YX 1GN4A 3FHTA 1MHPA 1ZL8B 2ZE8A 4HDAA 5J1TB 4D56A 4JLDA 2H5IA 3UWSA 2EG5A 2OCLA 1M8PA 5EIWA 2KJQA 1Z2CA 1P2BA 3RE3A 1LBEA 3I5AA 1AGNA 1FFHA 4UBIA 4NENB 3K5WA 4Q15A 2PEYA 2WUWE 3K12A 3M1IA 1L7RA 4JBGA 3X1DA 5AQ1A 4B6EA 3ZU3A 2Y77A 4Q20A 4MW8A 3WGNA 2OZLA 5JQGA 5D1HA 1SC1A 1SPBS 5ETJA 1F7UA 2HVJC 1RRCA 1AHNA 3EZ2A 3FUCA 4JYCA 3FYUC 3H1HH 5JPCA 1SN7A 4K05A 3ZTYA 2AVNA 3FR7A 3JQGA 1V5FA 1I51A 1U1IA 1QHGA 2H2WA 2CL6X 3ZK8A 2I4LA 2ZIOA 3MFQA 1BZYA 2P1ZA 2CCKA 2RGUA 2PJDA 2BJVA 2R1VB 3JAWA 2JGDA 4KWEA 4O2AB 3GLGB 5A4KA 2BI7A 2RG7A 1L7PA 1SCUB 4FD3A 2ZS8A 3WX0A 1JPNA 2WPNA 4NBTA 1PR0A 2R6HA 3MTDA 3IVGA 4OLHA 3W4IA 2YVLA 3HBMA 4C5AA 3KLMX 4MV9A 1P75A 4BV3A 4WK0B 1QLHA 3OT1A 2RB5A 1VJRA 3SP1A 1QVAA 1Z22A 1IEWA 4MA5A 3V1TC 4ZYXA 2ATEA 1Z6PA 3KKEA 2O7QA 1W0JG 1H66A 1M0WA 1PR3A 2GCOB 3QXSA 3A0BZ 3FUTA 4ZD6A 3WYNA 4OB7A 2E1PA 4H3VA 2P0YA 1PWHA 2YQ5A 4ZOLF 4UATA 2O3UA 3BS4A 5AJXA 1R10A 4NAVA 2PJUA 1BFUA 1EB8A 2WIBA 2R3SA 4D57A 2UUOA 4F84A 4QE3A 1M8FA 3Q6MA 2FW9A 5ICEA 3LD9A 4Q3NA 2GPAA 3EK2A 2B9EA 2F3QA 5FXMA 3AEUB 4P4UA 2O2HA 1XWIA 2YZ7A 4R1NA 1RBMA 3RUHA 2ASVA 2E4UA 5LQNA 3DTTA 1PBNA 5EIBC 4Q3AA 5ALQA 4X92A 1SQSA 3Q0TA 5B1BB 4C04A 5HY2A 1NMSA 5HSGA 2ODQA 4H7PA 4CMEA 5IXJA 3NIGB 3OBBA 1AUOA 5ARCA 4EO9A 1JSXA 2GXSA 1XXHB 3R3UA 1W0JA 4J7CA 1U0HC 5TVGA 4DA4A 4WV3A 3O85A 2AW5A 2P2YA 3G79A 5EPUA 2OC9A 3OF2A 4B83A 3ENVA 1D2RA 3NBQA 1X1AA 3CCFA 5DISB 3ONFA 4TZ0A 2G07A 5KQRA 2E1RA 5A9SB 1QYCA 1EVZA 4MUJA 2E5WA 4DMUB 1J07A 3DW1X 2Q0OC 1UT5A 5MDHA 3K70D 1KIMA 1HE2A 1MQSA 1DCFA 2FKAA 5AIAA 1I1HA 3NRBA 2DSNA 1II8A 2HIMA 3JWIA 2J46A 4OHWA 4PV7A 3ZBHA 5DM0A 3DXYA 2Q28A 3RFTA 1LGYA 1UM9B 2Y0EA 2W4MA 1KEUA 4BASA 3A10A 4HMPA 2ZUVA 5JZ9A 1OPXA 2G04A 4FDVA 1SXPA 2P65A 2F59A 3B20A 4EFEA 5LYJF 3OZXA 1NUPA 2X76A 2CHFA 1YZKA 5JSYA 1T5IA 4H27A 2F8TA 3SX2A 3PIDA 3TAHA 4CG0A 4HWRA 1XD9A 1E2GA 3HDJA 4AMVA 3TL6A 3A0RA 5IUKC 4H7HA 1MW9X 2GPWA 3NPAA 3MXOA 3FHCB 3SJAA 2WAOA 4Y1GA 2J6CA 1NOJA 1ENOA 4DV6O 3W2GA 1UWKA 1ZAKA 1C0PA 3QF7A 3V8RA 4RPKA 3ADCA 5GTDA 2VP3A 1JG3A 1JEAA 2GUZA 2BGLA 5JHGB 2BFFB 4CNBA 4QKQA 3E9ZA 3CP1A 3G2IA 3L7YA 1TUBB 4P83A 4CIAA 2J5KA 5JS1A 4LOLA 1DRJA 1Y42X 3PTAA 2NU9B 4Q0MA 3UWMA 1AD2A 3BFJA 4EITA 3ZQJA 3H1PA 3J7AR 2P4SA 2H0AA 3V6LA 2IHBA 4LYEA 4LUCA 2Q5QA 1OTYA 1OB2A 3V80A 4EP1A 1PJ3A 3VJRA 2QMUA 4B4WA 3CW8X 4NZZA 5GZ3A 1W36C 2W6ID 2AMTA 5CIWA 4B34A 4KFMA 4E3ZA 4ZANA 4Y6LA 2C9CA 4EHNA 2K7ZA 3GELA 1UQUA 1QQCA 4EYEA 1J0AA 4DOMA 1ULUA 1MTZA 3WNVA 1XTQA 1IEXA 1C3XA 3AHIA 1ZUWA 4BDSA 2V03A 3FPHA 3T41A 1ZOPA 4EVSA 4M0MA 3SZ3A 2VDLB 4AP9A 3I3OA 4DZRA 2FX2A 3MDSA 2GAOA 3MQFA 4JL8A 4M53A 1K6EA 1EFVB 4Y9SA 3ZOPA 1T4CA 3O4FA 4JJ6A 5FBWB 4OL9A 5F4ZA 1K6IA 1XSEA 2NUPB 4DXDA 4BKUA 2GHTA 4FVMA 1SNYA 1Y98A 2QS9A 2ZI9A 3LDAA 1RHRA 3D02A 2BM8A 2QWXA 3GWKC 3HKBB 2YZNA 3OQPA 3UJBA 2B7BA 5DN6G 5I9BA 1USUA 4UPEA 4P9OA 3FNRA 2QTAA 3CF4G 5K4HA 1IXRC 3NUGA 1OV4A 4N18A 1FRNA 4N21A 4YHHB 3RLIA 4GWKA 1QM5A 1CIPA 3C0KA 2B35A 3HDTA 3FBWA 4BNLA 2FEOA 3B51X 2HNBA 4JI8O 2FX5A 4F6RB 4P58A 1A4IA 1GU0A 3D6AA 3BRCA 2JFWA 3DMPA 1HE5A 4DUGD 1SOMA 3SYMA 4AF6A 2B69A 4D8XA 4F92B 3LPNA 2X6BA 3TLMA 3B9RA 4R0MA 4MPRA 4QYMA 4X6XA 5LLTA 3JQEA 4MIEA 2D2VA 4WERA 2C4TA 3JYLA 2C57A 3UIEA 1ZH8A 4J6FA 4I9QA 1J7HA 2FFHA 4KQXA 1XRJA 1K0FA 4BKPA 4FHEA 1P31A 2BLLA 2C4UA 5IANA 4JN6B 2C97A 2YXDA 5EY5B 1AVMA 1PG5A 3K9FC 3KBBA 2QNRA 2GM5A 3LYLA 4WOJA 1L4NA 3T5MA 4DCMA 2QTVB 4FPXA 4GPTA 2D1QA 2P0EA 3M5DA 4TS1A 3VR4H 5DN6A 2QU8A 2YKGA 3E5MA 5T4EA 2G5PA 3W7SA 1E3JA 3CF4A 3OZWA 2P40A 1ONOA 4JUAA 5LZ4A 1JD1A 4CR7A 2VAPA 3KAKA 1PFGA 5DBGA 2VT7A 4RMGA 2X42A 3ITNA 1NX6A 3T52A 2Q5ZA 2QX7A 1OUMA 1XDGA 1QU7A 5I3ZA 2FPPA 3LSTA 3RARA 3KEMA 4DM7A 1SXJC 3E3NA 2ERXA 2PAAA 5DYTA 4FGWA 1Z16A 2ZYGA 4MO9A 4B74A 3N53A 3VSAA 1KB9F 3RVYA 1X1EA 4ABTA 3QVLA 2WAXA 2G1PA 3B6KA 3AY7A 2A1UA 3MS7A 3CLSD 2FPGB 5COQA 1PQUA 3FUXA 4MJLA 3KC2A 2O2ZA 3LV8A 3V1NA 2BCJQ 4XBFA 2I65A 5EJ5A 3MIZA 4LRQA 4I55B 3DDWA 4QQ8A 1FB5A 4DABA 3F6YA 2OXCA 3H4TA 5DI3A 3FGNA 1CUJA 4RVFA 4DEXA 1J5EO 3NCHA 5KKCA 1T1EA 5JYBA 1NG9A 1DDGA 2J9GA 3HBFA 2VZEA 1QRRA 3COJA 1KXJA 3A36A 2PGJA 1WPQA 2ZQ5A 3AWIA 4HX9A 3FPIA 3PXAA 3D7RA 3B13B 2G5GX 1QO9A 4M1KA 2XQFA 5BVHA 1LQUA 4ZWNA 4M83A 1ZTEA 1I7QB 1KHHA 5FLXA 2G72A 4PN7A 4AXXA 3P9CA 3K0SA 5D5PA 1GZ3A 2APJA 1Q16A 4EKEA 3L4BA 1ILEA 3KT6A 1MT0A 3VHLB 2H6EA 4EJSC 1KI9A 1TGOA 4UCQA 4PLTA 2Q3MA 1YQTA 3I2JA 5KHGA 2Q9AA 3U31A 5FWAA 2AI3A 4TRJA 2EBUA 1T9ZA 1D5NA 3H18A 4NYMQ 1UOEA 3C3MA 3D4PA 1WMDA 1JZTA 3KOUA 3KKYA 3ABLB 4KIFA 2YJ4A 1NVPD 1BG6A 1VQ8V 2EULA 3DP9A 1T8RA 1LK0A 4CDNA 4IQ8A 2AX3A 4A0SA 4N7BA 4HN9A 3SKXA 4YBRA 4UAJA 3SIWA 1YMVA 3M1YA 2OV1A 3KLOA 3S2ZA 3FMFA 2OAEA 4M38A 1E2BA 3A9SA 2X5OA 1UKZA 3CEPB 4DV5O 3LQKA 4W6QA 4KP7A 4L75A 1TL7C 2Y1WA 1NZDA 2JS5A 3JD0A 1UBCA 3G13A 3SXUA 3MBMA 4CS2A 5DVZA 5EWJB 4TMYA 3EWAA 2NVOA 2O1WA 2XMRA 1WZUA 1JU3A 4MYDA 2BE9A 1FLAA 5CX1A 2XQJA 4KOEC 1PSWA 3UJPA 4A8JB 3KZMA 1X2EA 5AK3A 1D1TA 2WTUA 4XSHA 5H4GA 3RADC 1VH8A 3GT7A 5A02A 1ZSPA 3QFRA 4ETIA 3P4YA 3MTQA 3H4IA 4RA6A 3A0UA 3KZNA 4CVNA 4UCUA 4MQ6A 1R0CA 3R2JA 4BJ3A 1AKEA 3VPHA 4LWPA 1YB5A 1CLUA 1YT5A 2B92A 1HNWO 1LBHA 2PH7A 1WHSA 3EMBA 5FFNA 1RVDA 4O4JF 3WGOA 1PTJA 4YDHB 4NV3A 1J33A 1M66A 3L8YA 1SEPA 5ALFA 4JC8A 4I6GA 1GCIA 4E5UA 4KZKA 1PCXA 3QM1A 2INGX 3QY9A 3U44A 4CC5A 4WD3A 4BT7A 2JS7A 3G1TA 2GETA 3ZDYB 1FP4B 1CYEA 3ZCSA 1N5IA 2X7RB 2UAGA 4MV8A 4HAZA 4FLWA 1DF4A 3NYRA 5ELXA 4HQLA 3UUFA 2ZZMA 2QW0X 4EUHA 4PELA 2FR1A 2OFFA 3TR6A 4DL9A 1Z5NA 4GZLA 3NHSA 4YRCA 1TYZA 2HJSA 2ZXFA 4AXBA 4FLEA 5AH0A 3W34A 4HAUA 5CT4A 4IJMA 4IS3A 2FSPA 2UYNB 3HUFA 3IR9A 5FADA 1JJ2F 5EE0A 3CR8A 3PRKE 3OX2A 5HTOA 1P0MA 2R8PA 4HJXA 5H70A 5HKBA 1CK4A 5FNVF 2ZJYA 4WKCA 3FNGA 3PFNA 2PFSA 3BGVA 3M6VA 2WJGA 4ZOLB 3ZV4A 2RK3A 1LJ8A 2JLRA 3FY4A 1I7PA 3EWSA 2IYNA 5AKEA 3JWEA 1C30B 4KQ1A 4MTGA 3IT0A 1W41A 3NVDA 2J08A 2HH9A 5CT8A 2ZIAA 3Q3IA 2O8DB 1QGDA 1R9MA 4OU4A 1DF5A 3PXBA 2Y1CA 1LFDB 4IDPA 1EK2A 5JNRA 4FHFA 5LB2A 3L7BA 2DJIA 4HLDA 3IV6A 4TQAA 4QGSA 4GMXA 3AINA 1PAUA 3ZXUB 1HE4A 4OXSA 3V4DA 2FW0A 3V9PA 3V1YA 2VC2B 1ZD4A 2Q69A 3OCJA 2XD9A 3FPBA 2KGWA 4QNRA 4EYOA 5F9MA 5AUPB 1XCBA 4YP9A 3DEAA 4FLTA 2EQ5A 3RIHA 3WG7B 1OCZC 3CLVA 1YA4A 4I5SA 1OXMA 3RWOA 3UGKA 1QO7A 4ASUD 2FQ1A 1DT9A 4OM7A 4TLMB 1J1ZA 1YB1A 1U98A 4UD6A 1CRQA 3UCSC 4B40A 4LJKA 4OFZA 3DTNA 5FV4A 4DIBA 1M1KW 1CUXA 4JUCA 1LF0A 2PUVA 4GLBA 4MEBA 3DV0B 1NONA 3AEQB 1FSSA 2VTVA 3ADOA 2X0IA 2XDWA 3NETA 2NXEA 4POOA 3WL8A 2K5UA 1EHCA 4PICA 4Q4JA 2CSUA 1WUYA 1D5WA 1O6BA 2XWSA 1H2EA 4FMDB 2BGJA 1U8TA 2OP0A 2YX1A 1L8LA 3N2KB 2GARA 5H82A 4LF4B 3KFVA 3GQBA 3DD5A 4TMFA 3GK3A 1RAHA 1X7OA 2V55B 5CEEA 3P0EA 4LCUC 3BORA 4BNZA 4DJDC 5LYJB 4TTSA 4ZO9A 3EGEA 4X64B 4FUQA 3U56A 4BP9A 3BXFA 4R4JA 2ID8A 1EUDA 3O73A 1FYWA 4IVPA 2PZ8A 3MT0A 5EJAA 2X8BA 3A1EA 4UVIA 4EKDA 4XQ0A 4YN3A 1DO8A 3R6WA 2FZ5A 3K9BA 3W3AH 4XEUA 3W7TA 2HZBA 4PAGA 4U39A 1SOVA 1T2UA 4KODA 3AVUA 3GJSA 3KJJA 1G6Q1 5B1DA 3T1YB 1V11A 3ZCVA 1VCIA 4HSGA 1TQDA 1XF9A 3MAQA 3W5VA 3CISA 3LKVA 2G9VA 1LTQA 3CX7A 5JEEA 1R6DA 2V1XA 4RJ2A 4BNWA 4N54A 3TE7A 1WXXA 3R24A 2RJ3A 4XVCA 3ICOA 1ESEA 4G09A 2WAMA 1SCDA 2N1BA 5KHHA 3THWB 4C4AA 3IKVA 3AJ8A 2WZDA 4E0BA 4OM8A 1GTVA 1YTFD 3BBLA 1MEEA 4UAUA 3C9TA 3K0AB 2V59A 5KWEA 4LSZA 1TO1E 2VBGA 3GROA 3NHKA 3GCDA 5COAA 4RIFA 2OCPA 4ZIRB 1JDVA 5DCLA 4CMBA 1RLOA 2DFTA 3DFFA 5A5DA 2IYQA 3UV7A 3JQ7A 3IUQA 3BA6A 2BVNA 5DN9A 5J2UF 2HK7A 3IBYA 3I7TA 3PFKA 3ZWOA 5C7OO 1G9XA 2H4HA 1J70A 3RGGA 1JNXX 1LZLA 2ZRCA 4LDAA 1L5NA 3OF5A 4HL6A 3C90A 2OGSA 4KR2A 4CMJA 2IYAA 3CGGA 1XQYA 4L95C