5IJ0B

Cryo em density of microtubule assembled from human tubb3
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
426
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
publication title Mutations in Human Tubulin Proximal to the Kinesin-Binding Site Alter Dynamic Instability at Microtubule Plus- and Minus-Ends.
pubmed doi rcsb
source organism Homo sapiens
total genus 143
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2016-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5ij0B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5ij0B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5ij0B01
5IJ0B 5EIBD 3RYCB 3ZBQA 4I50B 4IIJA 3N2GB 4O4JA 5JCOA 5CB4B 3ZIDA 1TVKB 5FNVA 4EB6A 4F6RB 3RYIA 4WBNB 5JQGB 3JATB 5JH7B 5EZYB 1FFXB 4U3JB 3C8LA 4E6EA 5MN6A 2VXYA 4O2AA 2VAPA 5EYPB 5CA1B 3M8KA 4YJ3B 3HKCA 3WGMA 2VAMA 4O2BA 2R751 1W5EA 2Q1YA 3HKBA 1W59A 5JVDA 2XKBA 3N2KA 5KX5B 3HKDA 5CA0B 3VO8A 3HKEA 4X1IB 4LNUB 4TUYB 4YJ2B 5LA6A 5M7EA 4B46A 3RB8A 4TV9B 4TV8A 4O4HA 1SA0A 4X20B 5GONA 3VOBA 5MN4A 3VO9A 2XKAA 5LOVA 3JAKB 4DRXB 4ZOLA 5J2UB 4ZHQA 5IYZA 1JFFA 4I50A 3RYFA 5J2TA 3JARB 5CB4A 3JALB 2BTQB 2BTOA 1W5FA 4X1KB 1W5BA 3RYHB 5LYJA 5LXTB 3JASB 4HNAA 5BMVB 5C8YB 5ITZA 5LP6B 1RLUA 4IHJB 1TUBB 4U3JA 3JAWA 1W5AA 3ZBPA 3UT5A 4U39A 4O4LB 4IIJB 4O4IA 4O4JB 4I4TA 5KMGA 2R6R1 4EI7A 5IJ9B 5KX5A 3WGNA 2GVIA 4X1YA 5CA0A 3RYIB 4YJ2A 4FFBA 5IJ0A 1FSZA 2RHJA 2VAWA 4M8IA 1W581 3RYCA 3N2GA 1OFUA 4I55B 3HKCB 4ZI7B 5MN5A 1TVKA 4O2BB 2RHOA 3HKBB 3E22B 5JVDB 4F6RA 3N2KB 3VPAA 3HKDB 3RYHA 4WBNA 3JATA 5JQGA 5LXTA 5JH7A 3VOAA 5EZYA 1FFXA 5C8YA 5LA6B 1RQ7A 4IHJA 4TV8B 4O4HB 1SA0B 4EI9A 5EYPA 5CA1A 1TUBA 5LOVB 3WGJA 4YJ3A 4ZOLB 4ZHQB 3CB2A 5IYZB 1JFFB 4O4LA 3RYFB 5J2TB 5FNVB 4EB6B 5IJ9A 4EI8A 1Z5WA 4LNUA 4TUYA 4X1IA 5LYJB 3M89A 5EIBC 4TV9A 3WGLA 4X20A 2RHHA 4HNAB 5ITZB 3JAKA 5LP6C 4DRXA 2RHLA 2Q1XA 4O2AB 5J2UA 4KWEA 4DXDA 3R4VA 3JAWB 3JARA 3JALA 2BTQA 4I55A 3UT5B 3V3TA 4O4IB 4ZI7A 4I4TB 4X1KA 5JCOC 5KMGB 1Z5VA 4XCQA 3E22A 3HKEB 3JASA 5BMVA 4X1YB 1RQ2A 5LP6A 5GONB 4B45A 3WGKA 4FFBB
chains in the Genus database with same CATH superfamily
3DNPA 2W70A 2XKJE 5ESXA 3NH9A 4KL8S 4HGQA 3L92A 4EY5A 4I50F 4Z1MD 3OJCA 3TLBA 3K35A 1VC2A 1G0NA 5CYFA 1B06A 3LVBA 5EPUA 4EHIA 1J33A 1CZNA 3H9QA 3NDBB 5DXFA 3ED5A 3RFUA 1T5IA 5EZ6B 3WIBA 3QVUA 3RHSA 4P38A 3HHEA 1X25A 3QVTA 2L69A 4TQFA 3NVMB 2Q5LA 4W5QA 3GJSA 2VLBA 5DBFA 3IIEA 2OENG 3B8NA 3BWVA 3T3GA 1RJWA 1U7DA 3HUUA 4GSKA 1UI9A 2J3IA 3K59A 3CZMA 5EHZA 3DD1A 2YN0A 3AETA 1RYYA 3AHFA 4PDMA 3F4LA 3L1IA 4B45A 821PA 5G0VA 5IWAB 7MHTA 4MVSA 3WYFA 4CGYA 1M57B 3BMCA 4W7IA 1E69A 1H2BA 5FFMA 5AVTA 4CKBA 1I94O 1TZJA 2H1WA 2IYPA 2B7LA 4M7WA 4CMBA 5L3VA 3TQFA 3PJGA 3K5HA 2Q5CA 4G23A 3RS4A 2D7JA 3ES9A 1L7NA 2NUPA 1NF9A 2IH1C 4Y2QA 2B83A 3EPKA 1B16A 3W9YA 4P3KA 1N5IA 4P8RA 3SOPA 1FXSA 4HATA 4YJ2A 1O5TA 2ADQB 1PG0A 2YUAA 3V34A 4OHKA 1XU7A 1OXSC 1CUWA 4YRDA 4V0MA 1I2MA 2ZSHA 1TAGA 5FTNA 1YVUA 3LCVB 3KE8A 3N8NA 2CNDA 3I3FA 5LMNB 2JLWA 1E1RG 1UMKA 3BKWA 2J0VA 5EJ9A 4ALLA 1JEQB 2P9BA 1QHIA 2CN1A 3N58A 5DCYA 1A27A 1E6KA 5LLTA 2V55B 2AUTA 3I30X 4Q3DA 4EUNA 2IFTA 1ATZA 3DDWA 4PFSA 3OIGA 3A9CA 3BAFA 3U6KA 1DTOA 1RM0A 2IHTA 3BE6A 5E6UA 3Q9UA 2W6JG 3MJFA 4HAXA 4J0JA 4Y6GB 3UXHA 1X7OA 1W0KA 2BV3A 2CVQA 4R7ZA 3P0ZA 1SQGA 4YIPA 2RQ6A 3Q7TA 4B1FA 3EC1A 3FB7C 3QXXA 1MB4A 5G1PA 1N2OA 4AL4A 3EE6A 2E4ZA 4RVNA 1NAIA 5KOJA 1JU3A 1SBNE 3ZZNA 3LBHA 3I01M 3UCFA 5JH7A 1P1HA 1CUCA 3I55V 2VPXA 1F5NA 2FB9A 4NBVA 2VDLB 3T5BA 5JHGB 2HMSA 5TT1A 1E66A 2QE7D 3A2NA 4EO4A 4DV7B 4DC9A 1NPDA 4X91A 1E89A 2GESA 3G0OA 2BTEA 2QKSA 3PQ8A 5JJ5A 3OSZA 1M5TA 1A76A 2ZRKA 4M55A 1Z73A 4NZMA 5LL6P 2WUDA 3C9TA 2H4XA 4OD0A 2B30A 3NAZA 1DX6A 3R6TA 1X7XA 3IYLW 4Q3LA 4IHAA 3TBKA 1X15A 2XDWA 4M87A 3OX4A 3MGAA 3WXMB 2VAXA 3KQYA 3EYWA 5DW3A 2RSLA 1C8BA 1Y6RA 3T0FA 1ORTA 1ZS9A 1PI3A 2ST1A 4DVJA 1BDHA 3BYZA 1PV4A 3UWKA 1QU3A 1HTWA 2DYRC 2EIMB 3DE7X 2Q9LA 1QCCA 2IYSA 1K8AW 4JA0A 1KQNA 1G9TA 2F9FA 2H31A 1YMUA 4L3OA 2HR1A 2YV2A 3MINB 3VPAA 1DG9A 4RV4A 1AHPA 1JXQA 4EG5A 3VZBA 2HU7A 1QK3A 1QGDA 3K2EA 4XR4A 5BT8A 1Q43A 1OXVA 3WGLA 2X19A 1R4MA 3P9KA 1QB7A 1YCIA 2JAUA 3C41J 3L1VA 4X1YB 5JQWA 1JI3A 3L4JA 2ZB7A 4YCBA 3DKVA 1DTWA 1VHWA 3IVAA 4F8YA 4PYKA 4J3NA 1K6JA 4XOIA 4DQVA 3HR8A 2ZRLA 3HVKA 3TWOA 1WW8A 4XH9B 3RS5A 3KHKA 4G4GA 3BGIA 3KR9A 2QIPA 3F8TA 4KPEC 3CVUA 4CYMA 3OFND 3O8QA 1YR2A 4ZVNA 4U39A 2E87A 4NJEA 5B1HA 3WAJA 3HCNA 4DV2O 1JQKA 4WKNA 5IJ0A 2ZKOA 5DHUA 4ZQHA 3PDUA 3IC5A 3IEIA 4WNYA 1VQ6V 1WKBA 2J1LA 1LLQA 2V0GA 5GAJA 5HJEA 3KLBA 1Y5NA 1ZW6A 1W2BU 1U2EA 3OY2A 1WJZA 4OVKA 1P7YA 4IEIA 2C20A 3W6NA 2R1VB 1PX0A 2QVZX 1L8DA 3PUKA 1EP9A 3SC6A 1YQQA 3IELA 4M1MA 3SJCC 1KFBB 1NFQA 2VJLA 3PCTA 4POOA 3SX2A 4KHPO 4WWHA 5KPJA 4AYWA 4R1OA 4DLWA 5CFPA 2CDBA 1NR7A 4UVGA 3VGJA 1VBKA 3FZYA 1YR8A 2XJ9A 1Y6QA 2QPOA 3U9SA 4EITA 4EQZA 3C3AA 4YXWG 2A0WA 1JA8A 5AHXA 1F8GA 4FK8A 1WPRA 3I55F 4NYJQ 4ALMA 1XEXB 2Z1DA 3I04A 1C7FA 1SQ0A 3IKJA 4YRGA 2W6NA 3LPDA 2AC4A 3SEQA 3UVEA 2CXXA 3C8HA 3DC7A 3ZCUA 2XV1A 1WRBA 5DWVA 3PNMA 3DB2A 3OZGA 4PTLA 4QX6A 2O4CA 4EI9A 1Q1NA 3P9CA 4HG2A 1EFRD 3HWUA 5TJHA 4RXMA 2W22A 1BVHA 5F3RA 4R01A 4Z99A 1QHHB 4ND5A 4BO2A 4I1IA 2J33A 3X1WA 2VDRB 4XZ3A 3CKKA 1YCHA 1WZEA 3BICA 4UREA 4CTMA 3DT9A 1YR3A 4LY3A 3E3NA 3GCXA 4MQUA 1PIWA 3RJ9A 4MKZA 4NCJA 4JN6B 4ZMRA 2GKOA 1TT5B 3MSXA 3LT1A 4AKTA 1UFOA 2HPZA 1W36B 3O4GA 1R3KC 3NUGA 4B6FA 1NQ5A 2ZJ3A 3L41A 3KJNA 3REQB 1S7GA 2AMLA 1NIJA 4B82A 3QA3E 3W8RA 3LAWA 2BFWA 2LZ0A 4H08A 2PIDA 3WA7A 5EWMA 3LMEA 2GJ8A 1RQNA 2VQEB 2EBFX 4WFFA 1SQ6A 2RGEA 2XZLA 3UF0A 5JRZA 4ZI7B 1P1CA 3T0GA 2BFNA 3R24A 3T12A 3K30A 3U0BA 3D6MA 1KQFA 4EX6A 3NVKE 4HLUC 5BQ3A 2P0EA 4J7ZA 4M9CA 1QIIA 4EKNB 3CMEV 2PKQP 4I3GA 2HIAA 5H3CA 1GFSA 4QDZA 1BTOA 1A8HA 4R8KA 3WFVA 3L77A 2I6FA 2IGTA 2PSEA 2UXDB 1PU2A 4ARIA 2ADOA 2CJWB 2VQSA 2A9JA 4H18A 4TSFD 3C43A 2DOSA 1JW9B 2V1XA 2XUPA 3FLAA 4MR8B 3QMVA 4JYCA 3M1IA 5IYDO 5CBFA 4HNTA 1QRTA 2Z0MA 4C7OA 2PBFA 4C0LA 1EM1A 4WXPA 2BMJA 4BLVA 4JQYA 4EUEA 2OAEA 1G2IA 2UUBB 3KFVA 1TW2A 1VQ6F 2VHZA 3CUTA 2D00A 4CCYB 2HA5A 1JDNA 4H1WA 4X3PA 2P6UA 4KQEA 2C4VA 3LPLA 3HP7A 3NIGB 2M2IA 4FFWA 4REQA 1OFVA 2QL9A 1WCIB 1XIVA 1QH8B 4AUNA 1OZFA 3X2QB 4P4SA 4DSNA 2H2IA 3OM3B 4F1KA 3FYCA 1Z35A 4TLBA 2NV2B 2I8AA 1Q91A 3ETLA 5TRTA 4HYEA 1E7QA 1HKUA 3B6ZA 2ZDQA 2GBFA 4RXUA 4MS1A 2CXQA 5IXSA 1NVAA 4RIFA 4UCRA 1F38A 1RRVA 4DG8A 1EFLA 2O3QA 4ENWA 2MMCA 2EFYA 2QW8A 5KSYA 3DVAB 3LT2A 5E4TA 1D2NA 4D8TA 3GPIA 3UG7A 5MN4A 2NX2A 1NTZH 4C4RA 4Z3KA 1XWIA 1SXGA 4TT3D 2DVMA 2NUTA 1AGRA 3V48A 3B36A 2Z5GA 3B3QA 5KDLA 3EF3A 4L3WA 1E0JA 1C0EA 1ZICA 5EPOA 3ZK7A 3DE4X 2J5RA 3G8BA 2IYWA 1XPRA 2VDWB 4Q15A 1V4BA 1ZCZA 4YXFA 4BMSA 2AZDA 2BUCA 4JY7A 4XKJA 3B40A 3WB9A 1KOGA 1M2NA 3E9NA 1GAWA 4H16A 1HDOA 1UFKA 4LV6A 3S2GA 3SZGA 2YTZA 4G01B 3RIHA 5AK5A 1TPYA 3B8HA 1EVLA 3A1VA 1S3IA 4RQFA 1WTAA 4KAFA 4M7RA 3WSWA 2XAFA 1F2UB 4PO8A 1JT9A 1WKVA 5HK9A 5AWFC 1K4MA 1SUAA 5E2IA 4YASA 2F3SA 2VRCA 1TVKB 3AXSA 1E5TA 4H4EA 3RTEA 5C1IA 5CB4F 2P2DA 1Z06A 2OFPA 4MWBA 3ZCXA 1VQ8F 5EL0A 1UMBA 1KZ6A 3QE2A 2PE5A 2C2YA 4V39A 2GN6A 4YT4A 5DTIA 1G20A 4LS3A 2CTWA 3SE7A 3ZRWA 3X1KA 2VWJA 3HI6A 1XMOO 4M98A 2PS0A 1EX1A 4PTZA 5A6SB 3CMEF 3TVYA 4A8JA 4XSVA 4KE9A 3AKYA 1LBSA 4XYMA 4CXMA 1Q50A 5JROA 2XAJA 3UH0A 4G1MB 1KARA 1H4TA 4LDQA 4ER7A 1UQTA 5D3MB 3OR7C 4D4MA 8AT1A 3KYDB 4UV8A 2YC2C 4INPA 1U0EA 3PEUA 4AI8A 4XCXA 4QXMA 2D1TA 2IWRA 2A3NA 4KN5A 3E05A 1QFYA 5KUKA 3ORYA 5AVXA 2A86A 4ES6A 5IT5A 1O08A 4LXIA 3F3KA 1FMCA 1JEJA 3PLRA 1NUTA 1Y5MA 4P82A 3A0RA 4ONEA 4ZN6A 4GEKA 1KP2A 1X9IA 3AB7A 4MUXA 3WYDA 5EXEA 4ANFA 4F3YA 1X7DA 2XKKA 3KQMA 4UE2A 3DBRB 1J0CA 4BW5A 1KP3A 1H2AS 1GKYA 5ENVA 3DFUA 4IZOA 3K79A 2QZPA 2ZK7A 4TTSA 1WP9A 4FLMA 2F3TA 2WTBA 1X0VA 1Z4NA 2YJ6A 4E5NA 1OCZC 5IY5B 2EARA 3CGWA 1XYVA 5JCJD 4D0NA 2ZWIA 3O38A 3VAYA 5CBHA 3SMVA 1QE0A 2O7SA 4B3SO 2WU8A 1PNMA 5BVHB 2ZIVB 2KGWA 521PA 3GCWA 1JLRA 1FUEA 1JWAB 4Z4HA 1AXEA 3N74A 3GFRA 1D2EA 2H6EA 1TCUA 5FHRA 3NRBA 1OA1A 1RS0A 2C5AA 1M2FA 4Z6KA 3EHEA 3NK6A 3GFTA 5EC2C 1VM6A 5G0UA 3K5NA 3M6FA 3P0IA 4EJFA 2O2GA 4BFWA 2VHVA 1HF3A 3HCAA 1SF9A 1Q3KA 4PIVA 2VDJA 4HDQB 1O6BA 4JGSA 4GKJO 1AR1B 3D5QA 1KZ1A 2CSXA 2VI5A 4WFGA 4OA8A 4XD2A 3PEVA 4ASUG 2QWNB 2FW8A 4TLEA 4BB5A 2JD0A 3ZBPA 2EGHA 4CNBA 4MCJA 4DDVA 1JP7A 1LVHA 4OAQA 3NTUA 4YMHA 3AETB 5K05A 4WOJA 2ZPAA 2QJWA 1KAMA 5JFGA 5TMDA 1DC6A 4QTYA 4BZZA 1SVOA 4UE3S 1TUBA 2G5CA 2B8TA 6REQB 1II0A 1SB9A 2R8YA 2OBBA 4JSTA 3FAVA 3BMCB 3HN6A 4UTRA 1UJ4A 4X00A 4M7PA 1CE8A 3A4LA 2D06A 1NF8A 4BC0A 4HQOA 1Y3BE 2QSAA 2QN3A 3LT5A 1ZC3A 1Y3IA 2KWIA 2LCAA 3M4ZA 4HQRA 2IYYA 1GGEA 2NUPB 3D4BA 3GJ0A 3SVTA 4U4AA 2FEXA 1QGAA 2H06A 2OOKA 2OK7A 4RD3A 2CHTA 3ITDA 4YJ2B 3DBIA 4QWWA 4U7DA 1NJ6A 1CLUA 3ETJA 5TDHA 5CITA 1EDDA 2D62A 3IDAA 1GQFA 4HOYA 4W1QA 2FFHA 1U8YA 4BT7A 1TEHA 2VLIA 1N8KA 3KYBA 3PCRB 4M7OA 5EUQB 2PYDA 2XVZA 4MGEA 3V32A 3MT0A 1FXUA 2A9FA 1JLSA 2Q0QA 2XI4A 1VJ1A 4DSAA 4GKVA 4PQYA 4W9NC 4LDZA 3TB6A 3RWMB 5I9MA 2I87A 3B70A 3RGGA 4GMKA 4CQMD 5M3BA 3ETQA 1ES9A 4BQEA 3CTMA 5JAUA 5KZMB 2C92A 4RLQA 3ZI7A 1F0KA 1N2HA 4GMDA 1H2YA 4FFBB 3VFDA 1QGZA 1C0IA 1UEXC 3WBKA 3LIIA 3LUFA 3DKPA 4U6SA 3RUFA 3TW6A 3ZMVA 1JAXA 3RC3A 3UICA 3C3CA 4Z1VA 4R7TA 2JJ2A 4V2IA 5HFLA 2G4LA 4NYMQ 5LB2A 2MSDB 1VJGA 3UYLA 1JIUA 4E14A 3ENZA 1XD2A 1Z12A 2GFIA 3T4EA 4R1TA 3EZ7A 3GI1A 4UNRA 4E0BA 4MTOA 1ZGAA 1D2RA 2WKRA 1T6YA 3DGEA 1U4OA 2YJGA 1GPJA 4NAHA 2JW5A 3EX7C 3ZHYA 4KYVA 3D2CA 4TLAA 3C98A 2XUZA 1X7XB 1AUVA 1CY1A 3P0HA 3EBLA 4P3PA 1JLHA 1LW7A 3W2HA 3PGLA 1G8YA 1L4MA 4KITB 1JR6A 3O8LA 4O0MA 4G0VA 4EW1A 1VP3A 4V0KA 4MLDA 1JR9A 1QANA 1UMDA 3I64A 4FDAA 4BT5A 3LLSA 4ROSA 4HDAA 3CGGA 5F3DA 4UHJA 4BVAA 2CXNA 3CO0S 4PYJA 2QENA 4EPXA 2WB2A 4M1ZA 1F0NA 4DR1O 1I7DA 4EI7A 3KQPA 1M8PA 4BRSA 1Z2AA 2N74A 2W2LA 2PYIA 4MDHA 1O54A 2CNWA 2WT9A 1DRJA 2JGAA 2ZODA 2YW9A 4URFA 1K3FA 3MLAA 1R37A 1NQVA 1TB4A 3ODPA 1IBKB 1Z2EA 2B37A 2JKVA 3I9JA 1OX5A 1A97A 5LUAA 5AVUA 5K3SA 4QDOA 2WSSD 4S24A 5B2EA 3QP9A 2XVXA 2Q5QA 1QIEA 4Q02A 2WIJA 3H6HA 2JLVA 4O2BF 1NDUA 2OZEA 3KKLA 4EG1A 4YRNA 4RIEA 4KQGA 2I91A 2QTFA 3HZZA 4BMOB 1D1PA 5DEIA 4QYSA 1ZD5A 1QOZA 2CJXA 5DX1A 2ZIEA 4Y2YA 4NJEB 1P0MA 3WLQA 3R6GA 3B6MA 1XNGA 4G5YA 2WKSA 1FD9A 2AFIE 1ILWA 3RVDA 2FMUA 5EXDA 4X5OA 3TK1A 2AOUB 3RPEA 4GLLA 5BMVB 2FN9A 2ZI6A 1I1NA 5C4MA 1REQA 1KAHA 4Q6BA 1XAHA 4RJKA 2X7HA 4J3FA 1PJZA 4BXOA 3ZGYA 1EINA 4DR4O 1ECPA 1MG0A 5EE0A 5IT4A 3NPMA 4A2PA 3PT5A 2JVDA 3KEQA 4ZIRA 5FL7G 2ZM6O 5SV2A 2Y3IA 2R68A 3I6YA 4RMNA 3RBAA 2O57A 2QGZA 3JVUA 1T9BA 1AI6A 4C6HA 3HJGA 4WFJA 4CS4A 3K31A 4Q4HA 3ONFA 4LVUA 1OFHA 3CCCA 4OK3A 5CMUA 4RTOA 1E3WB 2VHCA 2J87A 4RANA 1Y7TA 1N0VC 1GAJA 2PD4A 1GRRA 4CC5A 5IYZF 1RWNA 3FPEA 4H7HA 3PHCA 5JDIC 1PXWA 3KJFA 4TVKA 2MQEA 1JDSA 4CDGA 3LPMA 5AVSA 4M9SA 4MPDA 1YJWF 2ZCJA 1H0KA 1H3FA 5JADA 3QOXA 4RVDA 3IJRA 2W9XA 1Y3HA 4MUKA 4JAVC 4MVJG 1QH1B 4IDOA 4TLCA 1RBQA 3FDIA 4F21A 4J94A 1FBTA 1W1IA 4DGQA 5EVJA 4YONB 1T3ZA 2H54A 1WS6A 4M9ZA 1ONIA 1JYSA 4XBFA 2QL7A 1E9AA 1S72V 4OBXA 2AR9A 1J1ZA 1R4AA 3I62A 2IYQA 5GVRA 1CSEE 3PI7A 3OHMA 2IHKA 1L3BA 1LPPA 4D7AA 2EZOA 3RA6A 4JWKA 2PKRA 4MVOA 4HDKA 3FB8C 2I76A 2I1VB 4IYHA 3IT0A 2JIZA 3Q0EA 3CR7A 5HWEA 3X3HA 3K0TA 4LXYA 3GGDA 4ZOLF 3Q3JB 4J7AA 2OCCC 4KDRA 5EJGA 4HQNA 1ZBDA 1PL7A 1YVEI 2FPIB 4QPNA 3L18A 2V6MA 3ZIUA 3F9CA 5C8DA 1II9A 3II6X 3OTFA 5JNUA 2F48A 1KETA 4OM8A 5HMLA 1SXPA 4KXRA 3S02A 1PK9A 1NE2A 1EX6A 4MVRA 2BKAA 1CJBA 7GPBA 4U2FA 2UXCO 4N3BA 4CBVA 5JBQA 1SKYB 2PY6A 3CSUA 5TSDA 4GVXA 3IUYA 1PFUA 4JIMA 2YMMA 2XTNA 3T5AA 4DJEC 4HDMB 3CCMV 2Q9UA 5I5GA 3W5IA 1EN4A 3CVVA 3F6YA 2ZBEA 1YOBA 2PPVA 1EEXB 4BVLA 3F5TA 2O5VA 1GGMA 4Q9KA 3TDKA 2FPKA 5SYAA 3PNYA 3HMQA 2XGOA 4AJ1A 4H0CA 3JWIA 5BQXA 1VSQA 2GDJA 5JNLA 2FUG6 2QQ5A 3O6VA 2IYAA 3ILHA 1KR5A 2H08A 2R60A 3BAZA 1T1JA 2G9ZA 1U0NA 2XDYA 2D1QA 2YWHA 4JBHA 1ZISA 2YZKA 2C7GA 4P4SB 3PHIA 1C9NA 4GYJA 3ZKAA 2Z4TA 1DWUA 2P68A 4NOLA 4MRAA 3RBZA 4L8WB 1BQ0A 1DC4A 5KYTA 4KO2S 3QELB 1CHDA 3BZWA 3V42A 4BLQA 1XWFA 4GT1A 1UP6A 4TQAA 3UEOA 1MJFA 1EAMA 3D54D 2QL6A 4JYMA 1JNYA 2YWEA 4F93B 2DYSC 2I8LA 3FFQA 1Y1TA 1ZAUA 1S2IA 2ZCVA 2BI7A 4I4TB 1XF9A 1B93A 3ER6A 4PR3A 2RH9B 3X2FA 4I4LA 5LFAA 3EH1A 3IAS6 1ZVMA 3T7IA 3LF1A 3A14A 2VKTA 5HKAA 2HRUA 1P9NA 4OHXA 3GN1A 1CYDA 2GXAA 1RM3A 3DF9A 1EDEA 3THYB 4FLZA 4RKQA 3H0EA 3SPXA 2AMVA 1VG0B 3I5AA 1HDIA 4M8KA 3DMNA 5ALFA 5GONA 2BOBC 3WXBA 5FA6A 4DNOA 3JTMA 1XELA 1N8RH 1Q0PA 1AKVA 3HPRA 2R65A 4DR5B 1UT8A 3F9IA 2CUKA 3P9QA 1Y82A 1NI8A 1G9SA 3MWEB 1YKSA 4DUPA 3O9VA 2N75A 1GZ7A 1QBZA 4W5HA 1F4VA 1ABFA 4ZFNA 4UOQA 4IVNA 4Q7LA 1ZM7A 4QUKA 5HIMA 3U49A 3ZMUA 2GZAA 3QEMA 3MHSC 1XHZA 3PJFA 2CVLA 3WL3A 1RKUA 1BXGB 2XVAA 4X85A 3MIIA 1LLCA 1UMBB 4BNJA 1QAHA 1FLVA 5EMHA 3V1UA 3WR5A 2DGDA 1AT1A 3H75A 3T3PB 2NN4A 4JLPA 3BA9A 3RU7A 4N3AA 3ZRWB 4MVJE 3WJAA 4AU1A 2IH4A 5J2TF 2RNBA 3AINA 5K8VA 3E9EA 2I6TA 3MLEA 1BSVA 4CKWA 3QKRA 5FPYA 5EFOA 1ORHA 2CMHA 3BE8A 3N2EA 2C84A 2DY0A 4KPGA 1NP3A 5LOVA 3EOZA 3CMAF 3K0HA 2C4UA 4C6SA 3NHJA 1TQ4A 3MQFA 3RS7A 3VTIC 1BWQA 4J49A 5JQGF 4BU0A 5LMUO 2E4YA 1W7AA 4RIGA 4LMAA 4PGFA 1JQ3A 3UA4A 3ZE9A 5AHOA 2FSVC 3CIFA 3FSJX 2Q4BA 4MXDA 4MLCA 1B6SA 3QEJA 2ZIXB 1G55A 1MH1A 4KO8A 3I3OA 3HCWA 3E0XA 1IRXA 3TTTA 2B1RA 1NYQA 3W90A 4X88A 4FNOA 3CUUA 3A0RB 1BHSA 4MQFB 2YRXA 1BE6A 1BJTA 3B1YA 3EIUA 4ZGWA 5BSKA 1RBYA 2NU6A 2G6TA 2WA4A 5G02A 2FZKA 3OF2A 5BSEA 1R0BA 4ZDIA 3K0CC 3ZGXA 1PDWA 1VRWA 2PMKA 3QPWA 1VGRA 3OLXA 4MP3A 3UY4A 1V1RA 2JFGA 3SFVA 4EELA 3CSXA 2OMEA 1KH1A 5JNSA 3LKBA 2KLBA 2P4HX 3SZMA 3T95A 2FWJA 2NXWA 2J5QA 3K05A 4C4YA 4NBSA 3UAYA 3L6BA 1DKOA 3DAHA 4L5AA 4LNHA 5L3DA 4OPAA 1ROPA 5A04A 1OHHA 2KKWA 3OUUA 1JH9A 5BSTA 2O8EB 1G5PA 1T6XA 1UODA 4MJXA 2VYCA 2ABWA 1D2MA 4YMTA 4MEBA 3BK1A 1YC5A 3AOEC 2ZDIC 4A6XA 4NYJR 4TTAA 3CNOA 1YTUA 2IYVA 2VJCA 4EGJA 3L2OB 4CS3A 3ZNPA 3FSGA 2K2WA 4GI3A 3CTPA 4RJ2A 2OGUA 1FUKA 2MSCB 4AD8A 3VR4A 1IQUA 3L5OA 3R0VA 2AQHA 3V4DA 2BONA 4I1SA 3G80A 3QMMA 1Y89A 3SQWA 1PWXA 4EBFA 1ZQ1A 4M8NE 2WIKA 5K5EA 4GE0A 2AK3A 3G4SV 1IUNA 2ATEA 1RWQA 1XV5A 4QJ5A 2QDOA 5IC6A 5LLSA 4WASA 1KKMA 1KNXA 2M6KA 1EVEA 2EERA 2FZVA 3NIWA 2R8OA 2J3EA 2IXTA 4Y6OA 7ADHA 4CLOA 4K05A 3P4UA 4ODIA 2AW5A 4C30A 2W6PA 4C7UA 1Q3EA 1TUBB 3PXEA 5T7BA 2JKYA 4IIJB 4LQDA 2CVZA 5A0FA 3RTCA 1A8SA 1TRKA 1SCUA 4PBRA 2RKBA 2RHGB 1QWOA 1CE8B 4FNAA 3TJMA 4BPBA 4ZO9A 1MCZA 3V7QA 4LZLA 2DBRA 1VJCA 4E33A 5LU9A 5JLJA 3W3AH 1UJ2A 4EF4A 2BKEA 2KSQA 2RJOA 3LOQA 3W78A 1JJIA 3TTWA 4NZOA 1KEVA 1CS4C 1EK6A 4XCQA 2PBLA 1W6RA 2VPPA 3D0OA 1IZ8A 1PGOA 2E5LB 3BHJA 1Z6GA 1F2VA 4BFUA 1L5GB 4TKMA 5LC1A 4N0DA 1O87A 1GEGA 4XX0A 1GU7A 4FCTA 1NW3A 1Q6YA 5T64A 3LVRE 3ANLA 3PHBE 2PRZA 2H0RA 1OC2A 4RZ2A 2FSGA 5ESRA 2WHPA 4RWZA 3KU1A 3EXG1 5AK6A 1UBRS 1J06A 1ZIPA 1KY4A 2ZVQX 5CH5A 3AEUA 2ZIMA 1QQ7A 5BNFA 5KQRA 4LN1A 5EIEA 3BTUA 1JEYB 1L1QA 5T6MA 4BVEA 3IUBA 1T5TA 2AG8A 3NETA 4NS1A 2NOAA 4OXYA 1E1YA 2VK4A 5AO9A 2IQQA 3IHLA 3HLKA 4GP6A 3IERA 5FKJA 3COSA 2BFPA 4MIOA 4U2DA 2HF2A 3I4CA 4OQPA 3TLMA 2NXCA 4WVLA 4B9EA 4XEUA 1JRLA 2PFKA 4BFZA 3L0BA 3WA6A 2EIMC 5EAZA 4ENTA 5ICSA 3N28A 5AVOA 2JAWA 1P4HA 5IJAA 3ICQB 2P35A 2YCLA 3VKGA 2YZ7A 2I2FA 1KMIY 3FNBA 3EZXA 2W8BC 1O57A 4UM5A 2ZRJA 1BH2A 2AVDA 3ONVA 3PS9A 2P3SA 2PLAA 3K6JA 2GI4A 3KQKA 2FG7C 3GLIB 3Q7QA 1FNNA 5DW0A 1BOFA 4HZGA 2ZXUA 3TUZC 3I2KA 4A6EA 3CIOA 3LQFA 1JJVA 3A9RA 5EEGA 4Y8VA 3LHFA 3LVQE 5BV7A 3NJRA 1KDZA 4WK4B 4JI5B 1ZVVA 4UMDA 1JA1A 3PX2A 3AR8A 3TNFA 3G4SF 2IYUA 3GQBA 2ZIWB 4UUJC 4OQXA 3MS2A 4EW2A 2J0EA 4ZRDA 4KXLA 3PD7A 4XIYA 5EKSA 1JHPA 2C7RA 3PJEA 3SIVA 2H11A 4N6OA 5EMJA 4A4DA 3PTAA 2PRJA 5LYJF 1JSXA 2W2MA 5AW3A 5HKKA 3EJ6A 2DKNA 3MGBA 3MQ2A 5LMNO 2HKOA 1ZMOA 2C98A 2GHRA 1AILA 2Q4DA 2ZS8A 1UKEA 1M7BA 2RGNA 1H2KA 1SUWA 3N7AA 4BAUA 3GG2A 2D1FA 3QO8A 4J9VA 5AI6A 2ID4A 4AWXA 2W2XA 1R9JA 4ZJPA 3AZPA 5IVHA 4RZXA 3URMA 2Q69A 4ENUA 2Z1FA 3FNEA 2QQ0A 1ZSNA 4V0LA 2YMQA 4J10A 2OCBA 1SUDA 2PQ6A 3TZQA 3BF8A 8GPBA 4J03A 1I7LA 1JZSA 4PC3A 1PGJA 1IE3A 3I1YA 3HJRA 3G0GA 1BVRA 3O4RA 5KUTA 1QP7A 4L4RA 4S0ZA 1Y7PA 1KWKA 2Y05A 1P1IA 3E9YA 4C4OA 4ECEA 4MR7B 4FP9A 4AYTA 3WNVA 2VHXA 3L0IB 1J56A 2JGUA 3A9SA 3GUZA 1REQB 4GOMD 1YZUA 2IS4A 5F2VO 2QXYA 4HZ3A 4BXOB 1Y6ZA 2Q3DA 2OHXA 3MRVA 2VHQA 3I2YX 4RKYA 3IKVA 4Q7QA 1LB1B 2B5VA 3GBVA 1KEKA 4DLKA 2VDUE 3ZRXA 4RGQA 4BKRA 2WHQA 3KV3O 1E1CA 4RDIA 2NMVA 3P26A 1JR2A 1K06A 1X8XA 3FXAA 3CONA 5J4LA 1W36C 1H8EA 1T15A 2VDNB 3LFOA 5FWAA 4FMCF 4I2NA 4BVKA 3L7KA 3DEKA 3B85A 2FWNA 2V5VA 1R8XA 1E3LA 3FTNA 3UJ8A 2XRMA 4U2BA 4DC1A 2B5OA 1T2VA 1P5ZB 4P9OA 3PITA 2NP7A 3BIJA 2M1ZA 4MQ5A 3ZP4A 3ESZA 4XA8A 2QUBA 5KUMA 4NXMO 4W1PA 1NJGA 1AI5A 3PUYA 3OQMA 2RCYA 1T3TA 2DBZA 4QGFA 1RP7A 2JEZA 3EIXA 3S0HA 1TTHA 3BIOA 3ZGZA 3DB1A 1RYEA 4DR3O 3RYTC 1O9BA 1ZZEA 3ABRB 1I6LA 2EIJC 4QAQA 2GZMA 3AR5A 1WUJS 1E2DA 2G7ZA 3U62A 3VJKA 3N59A 5I7VA 1G8AA 1EQAA 1NL3A 2C2GA 2XUJA 1CNEA 1PVVA 1QTRA 3D8RA 1M83A 3O26A 3OCZA 4DR7B 2HQSC 1XV2A 5B4TA 3O0DA 1L7AA 3JD4A 5KTOA 2NVOA 3JYLA 4MVXA 3EIWA 3ETDA 2ISCA 2HRRA 2JBWA 4LWOA 2R1UA 1DQZA 1HPLA 2DWEC 1P3Y1 5JMOA 1UAYA 5E0OA 2FPRA 1VQ7F 1C3LA 1OTYA 4CKYA 4M99A 3ZXSA 3LOUA 3ROPA 3ESQA 1EBFA 1RPAA 1B1AA 2CXRA 2YQ5A 1V0JA 2R5NA 4G1CA 2BE7A 3F5MA 1TKCA 3NC0C 2DPLA 4DADA 1YQDA 4MVMA 2LRHA 3J7AC 4XI9A 1K3UB 3SS7X 3VO1A 4Y1GA 3O3CA 4FR5A 3LYHA 1C3EA 5HY4A 4EFEA 1CF4A 1H5QA 1T36A 3EGEA 2YI9A 2JNWA 1KD1W 2O50A 4V0RA 5C18A 3KM0A 1T29A 1OFUA 3USZA 1HQYE 1E1DA 3OUTA 1VKRA 2IQ5A 5FOUA 5HF8A 5B1EA 4QOSA 2GPNA 3AR6A 5JZBA 2A0FA 2YHUA 4IW3B 4U2CA 4KIGA 4LCUC 4N5IX 3M6IA 5K0LA 3RRFA 1GVNB 2FFBA 3KALA 4JZGA 4E5KA 1Z4JA 1E3EA 3H4TA 2A9KA 3DTUB 2P2ZA 5KYUB 1YZQA 2RAUA 1ZHOA 4IJKA 2ONYA 5LZ4A 1ID8A 4OP2A 3PC8A 1VQMV 1QIGA 3JW8A 2HV8A 1Z82A 4TX1A 1FXHA 4UCWA 4M38A 3ELWA 4MS4B 1BRTA 4YGXB 5GIPC 3RVRA 2O8DB 3H0KA 2D8AA 3NEYA 4ME6A 4PRYA 1OI4A 4PZZA 2G80A 3FTFA 3LA6A 4FZ3A 4BTVA 3GV0A 1YU6A 3TSWA 2IF2A 1AKTA 2WC1A 2PL1A 2HVKC 1XA0A 5JFOA 1KKLA 2G04A 4NYMR 3BGOS 4ESHA 2PUTA 4PQRA 1SWVA 1EP1B 3SPHA 4IH4A 3SZ3A 4CM1A 2NU9A 1N5RA 5KJCA 4U8HA 2JGIA 3OIYA 2CE7A 1EK0A 2AVNA 1HDZA 3JY6A 5HIAA 3QFTA 3DEFA 4OHBA 3ZW9A 4IGGA 2R6DA 3MJ4A 1T5HX 2O6HA 2BN4A 1EMDA 3B1KA 1M5RA 2Q2NA 5JSKA 3WGIA 5GONB 3KT0A 3F97A 5LA6F 2B9ZA 4L87A 1E1KA 2OD2A 1F3OA 3G0CA 1EUDA 3AHCA 3IQZA 1B0UA 1N0NA 2EFEB 3C8UA 5J43A 2VZEA 4BGDA 1QP0A 2ZAIA 1Q1AA 3GEMA 4FCCA 3EXFA 4UUPA 2HCJB 4I1UA 5AVZA 3NT5A 4CC6A 3ELBA 3RVSA 2ALEA 4M88A 5A7FA 5I7AA 3QEMB 3E9CA 2QTHA 3VDXA 4X66B 3PWZA 3TI9A 5B5SA 3FVWA 3B9QA 2PZMA 5JWOA 1BFDA 1W4BA 4OI4A 3ZYCA 4CODB 4R0VA 4EB3A 2CDCA 4PW0A 1CJMA 2XWPA 4HQLA 5F64A 4EMUA 1GSAA 4GRAA 2ZJ7A 4HK4A 3R3WA 1VZ2A 3QWAA 2Q0XA 4Q01A 4KWTA 2I65A 2YDYA 3QKRB 4ZHVA 2K5UA 2Q8QA 3VDQA 1V8FA 2ZR9A 2HS3A 3QIAA 2WHRA 4V02A 3SJQC 2H4WA 2H2HA 2WTEA 5A4AA 2ZOSA 3W1EA 4FQ8A 2OEPA 1SCQA 2DB3A 3ZBHA 5CFLA 3CPEA 1RPZA 1GNLA 1SBQA 4QPCA 3IPAA 4JXZA 2Z1EA 1MA1A 3B9BA 3QQPA 3WQRA 5A6VA 4KXVA 2GYYA 4OLHA 1C8VB 4W63A 2YXBA 1KMNA 1H2ZA 3OOSA 3OBYA 4NB5A 4REOA 4A27A 2DJ5A 3LUJA 3NAMA 1DAHA 1IJKA 4MQBA 2R6R1 5AKLA 4DB4A 1YDHA 1UK9A 2EJCA 3G2MA 2ZOVA 1T91A 1JQ0A 2WG2A 3OCUA 1U0LA 2A9OA 4BB6A 3HZRA 3WX0A 1CZHA 2OHWA 4JBLA 1GXSA 4A5SA 2BOVA 4DCGA 2IY7A 3MGCA 3I8OA 1AKUA 1UOEA 1SRQA 3HB4X 3NHYA 3R3VA 3SF8B 1V1RB 3NV9A 3IDZA 1VQMF 4YRFA 4Y6LA 2PZJA 3H11A 2KQXA 4QICA 3JALA 3KLNA 2O2DA 1EWVA 3ZK9A 4C82A 4BO5A 1NSFA 1QCZA 2JFFA 4RH3A 2R7LA 4RVGA 1LXCA 1M76A 3GN2A 1OWOA 3BD9A 2RMKB 1IAVA 4QBHA 2R751 4NUTA 4J91A 3FTQA 3KT6A 4ZEXA 1W46A 4BNWA 3ZKWA 3ADCA 2ZRIA 2ZP1A 2IAFA 2GERA 4ZDJA 1JQLB 1KSFX 5CFRA 6LDHA 1Y6XA 2NG1A 5KWJA 1K8QA 4AY6A 5AJZA 3A06A 3ZQ4A 2B4QA 1XTJA 3FPSA 4ESOA 3EMKA 4MHSA 1B1CA 1VE9A 2XA9A 3VZPA 5KC8A 3VR2D 1DS6A 2PJUA 2MU1A 1NJIW 1Z8HA 4A03A 2AX3A 3CSDA 3IAAA 4JBXA 3FF1A 1HP8A 2KG4A 2JFVA 3D2BA 4KIFA 3LX6A 4LSZA 4QDJA 3ULKA 2A58A 2J30A 1Q7YH 2CJYA 2I55A 2NTYC 4FWIB 3BSWA 1OZGA 3T5TA 3PGMA 4CLOB 3K4QA 4B3MO 3CHYA 1X19A 4HVCA 4J9YB 2GN2A 5AIAA 2QWQB 1JIIA 1UBMS 5F33A 4G88A 2C2AA 2VXCA 5IKXA 5HQ3A 3LWRC 5M5BA 1JBEA 2VPZA 1SCUB 1QJCA 1VQ8V 1OVGA 1UDAA 2AF4C 3KJGA 4HDRA 5IAOA 2NU8A 3WJQA 2PGAA 1ANKA 1ATIA 5EJ7A 1CRPA 3HYCA 2G8LA 1IRIA 4UEWA 2GSDA 4HEA1 3NT2A 1L7VC 1M2JA 3DM9B 2VBFA 1P7BA 1CP2A 3U0ZA 2RKOA 2ZS9A 1VPLA 4E07A 1Y8QA 1JDZA 2NGRA 3R9WA 5TV2A 4EGCB 4DBLE 3WMRA 5ITZB 3L7LA 2DCUA 3L7YA 5DBGA 3EBPA 2GVNA 1L8LA 3GYBA 1M0SA 2GUWA 1JKJA 1Z3IX 2WHXA 4TGLA 3I1IA 1AR5A 4LKOA 3WB2A 1QWSA 3UM7A 3G82C 4M1YA 2UXBO 1Z5UA 4YPOA 1U0SY 3BFJA 3TD2A 3CC4F 3U4HA 3QE3A 2XNKA 1TKRA 1DAFA 1DXOA 1RZRD 5AW2A 2RGGA 1BGVA 1EE2A 5AI0A 3GD5A 1TQ6A 3BEDA 2C5EA 3H1IH 3TX2A 5CRIA 1JPXA 1NLYA 2VP2A 3W7VA 2Z5VA 3AKCA 3BMQA 2FFAA 3F7TA 4AS1A 3RKRA 3BKXA 1XVTA 2NXNA 3G0BA 1US8A 4GC9A 3AJDA 3JQBA 2YEVB 3A6HA 4KPYA 3DJYA 4C08A 1OXBB 1K7XB 3GLHB 3KSAC 1Z8FA 2LIPA 5AJUA 2FQWA 1HLFA 1COMA 4P7JA 1OJHA 4RESA 1GJRA 4Q7JB 4C03A 5KA5A 3OTOO 2LO1A 3IIMA 3HPLC 3L82B 3ZMSA 3KFXA 3STLC 2VA8A 1AJNA 4ZGBA 4OUDA 2AD5A 2OVBA 3P9YA 2CBZA 1U2SA 1R8QA 4ENPA 4D80A 3UAGA 3H5NA 3KTAA 3IHKA 1M1NB 4YREA 5BPHA 3IE0A 4JVNA 3CVOA 2PKEA 3WHPA 4GI7A 1U5BA 2BLLA 1U3UA 4UXJA 2XGMA 2V7EA 4G67A 2Q5HA 1M10A 1O89A 4E2ZA 4C14A 4QLBA 1DX4A 1HFEL 1VG8A 2X4DA 3IO5A 2CC2A 1SS3A 3ZX6A 4MMZB 4XUEA 1GTVA 3MTJA 1DT9A 3N8GA 4LBWA 1WUKS 2JJ1D 1NBAA 5GTIZ 2WJVA 3SHQA 3ZE2B 4BBZA 4W4KA 4Q00A 2E5FA 4O2RA 3HWSA 2AMTA 1AI4A 3JQFC 1TM5E 4A73A 4YJHB 3ZDAA 2ZIFA 4E51A 2H3EA 2O8FB 2EP7A 1L7MA 4QARA 4FMDB 3SBXA 4D4IA 3UV7A 5ALHA 1L6IA 4WNAA 3P7MA 4YALA 1BC5A 2D2XA 2HA6A 3IMEA 4RHCA 4PN3A 1Z4LA 2IEIA 5KQPA 2Z2IA 2WYWA 3IGFA 4IM7A 2C7BA 2A0KA 4Z1MA 3KR1A 2GYUA 1XBLA 3H5TA 4KUEA 4FMBB 3E23A 1GR1A 1QVGU 1PLJA 4B76A 2VAWA 1AY0A 4HYYA 4N6GA 3V2GA 1I2CA 3L7OA 2Q3BA 3N05A 3KDPA 5FPKA 1XLTA 1KEPA 1U8TA 3KZMA 4N8SA 5J59A 1L5LA 3W05A 2JLXA 1ORDA 4IS3A 3D3EA 5GP1A 2GK3A 1QZUA 4TV9A 1DMRA 4R40B 4KAXA 3I9FA 3OEHA 5EJEA 4Z3OA 2AIRA 2ZWPA 3B3JA 1A5AB 4C3ZA 3ZJUA 3OJFA 2J3KA 2RAFA 1IHUA 2LGWA 2JH3A 2H0QA 3SD7A 4MI1A 1Y9AA 1XBTA 3PL1A 5T8KA 1E1CB 2DBQA 3RWOA 1NWCA 5KLVH 2BSQA 4URVR 4KWCA 3RB8A 1CRLA 3BQMB 1U28A 2V3CC 1NJ2A 3CBQA 5K3OA 4EVRA 2WLIB 4K28A 1IWOA 3OPNA 4OMUA 1G5RA 4S04A 3LKZA 2UVQA 4CWAA 1XQWA 3FAKA 3FFAA 1H85A 2WPNA 2Y93A 3I28A 2GYWA 2OXEA 4UD2A 3RYHA 1LJUA 3U40A 3KAQA 3PNPA 2BFEA 1M4UA 3ORFA 3H5OA 1TUEA 4B17A 2ALJA 3KWFA 3BULA 4TLDA 3V3KA 5DGCA 3DC5A 1XZEA 3L0CA 1U1CA 5DMXA 1KBQA 2XT6A 1G6KA 1N36O 3ZWBA 4K26A 3JVVA 3SM9A 4KDEA 3CVXA 5FWYA 2P7HA 2O5CA 4GKKO 3FFTA 3GZ4A 3V7UA 1R12A 3BYQA 4HPWA 1M34A 5IX8A 3L4BC 2P27A 3K72B 3PXUA 4XVUA 2A6PA 3DOUA 3MMNA 3M6WA 3ZE7A 2FMLA 5HRAA 3AKDA 3CLSD 4QECA 4E88A 2AOXA 4Q9DA 3G2QA 3GLSA 1EG2A 2IBSA 4QHYA 4QJ4A 3R0IA 3ESBA 1T3SA 4AG6A 1B73A 3SG0A 1JQDA 1NUUA 4YMWA 2ZYDA 4CKBB 4TRRA 4XUGB 4I5GA 4RQUA 4J8PA 1F2TA 3U7QA 5EKDA 3BREA 3LY5A 3ZDRA 3FGNA 4JKOA 4WL0A 4MZXA 5G0TA 1QKKA 3MD0A 1XL0A 3WK9A 3ZJVA 3UV6A 4BWGA 1RAIA 1DINA 2HRDA 4KFMA 3GIDA 4FOOA 2WLNA 3T3IA 5B30A 4AY3A 2QE7A 1H3NA 4DMUB 5AKKA 1N4CA 3D6AA 3NASA 2HMYB 1NLFA 2F4VB 4WPGA 3M70A 5FPPA 1RYMA 1SXJD 3T7EA 2G9VA 1ZIDA 3ZTYA 3M1AA 1H6DA 1IJEA 4C5BA 2QRLA 4QFDA 5LKAA 4GXQA 4OBWA 4UCQA 3SHOA 1OCEA 1BHAA 2VYND 1B41A 2HF7A 1EFCA 2C9MA 3P0EA 4UNNA 2V65A 4GQAA 4C76A 3BWMA 5E6UB 2G9QA 2PLRA 1W42A 4ECAA 2JIQA 3IP3A 1II8A 1Z7WA 5IK2A 4K9KA 2KX7A 4RAQA 4ERNA 2PX8A 5AVWA 2VRZA 1Y1QA 4AP5A 5SZIA 1QO9A 5ECWA 4Y0AA 4ZAGA 3Q4GA 2A5GA 1H48A 1JIKA 1U6KA 2Q4TA 5AR1A 1MC5A 3BD7A 1ZH8A 2WJHA 2JZOA 5KOJB 3ZH2A 2GCOA 2YXPX 1V5IA 5JH7B 1K7CA 2WP0A 4K8XA 1LBQA 5IVIA 1FDIA 2FF5A 3IDOA 4L6AA 3ED1A 5ILGA 3QY0A 3QKWA 3SR3A 2F93B 3A9TA 1RYBA 4ZPXA 3PEEA 4UCTA 4PE5B 1H2LA 3IR5A 2WM3A 3EA4A 3QX7A 4ZVLA 3WPXA 4LJ6A 4BIUA 1YJWV 4OQEA 2WUGA 2NU9B 1VG1A 3C6QA 3HR4A 1EDBA 2FYUH 4BMCA 1UZUA 2DQ0A 5F35A 4AO7A 3QVWA 1AIPA 1XEAA 4PG4A 4PXAA 3OZSA 4KE6A 5FUMA 5JXHA 5CCEA 1RU3A 3A1FA 1WPGA 3OFNA 3OE1A 1PWHA 3H1FA 4BNLA 1H6CA 4OUKX 3BH0A 1YH3A 2I03A 2B8JA 1E3QA 4JL8A 3MTQA 4C0QC 2VQ3A 3P9PA 1RZ3A 1EXMA 3GNQA 3LY7A 1DBRA 4QOIA 5B5EZ 3V8NA 4X8AA 1DJLA 1IBCA 1RYFA 2AF3C 2CB9A 5BRAA 3QVGA 1KDTA 3AJRA 3EXFB 4B09A 5AW9A 1LTHR 4ZXFA 2BL4A 2DWCA 2G6BA 1HORA 1XMXA 1VOTA 3DHWC 2I7TA 5TVKA 1YJ5A 3HKCA 5CU7A 2E1RA 4P22A 1I3KA 2XIQA 1R4MB 3CPHA 1XVAA 4JI3O 2UUAB 3O83A 4RS3A 4WZ6A 1U9JA 2Q28A 1RXEA 3PT9A 3F3MA 1RACA 1P44A 4EVQA 1DTWB 5GMOA 2A1TS 2PRSA 2XBLA 5KA6A 4H7JA 2B9EA 1TOAA 3EWNA 1Y1LA 4FBGA 3X1MA 2XADA 5EP3A 5KTTA 4FFDA 3QUAA 3NYIA 2QTSA 4UOEA 3IUQA 3ELCA 3UCXA 3DO5A 3FBAA 3WLLA 1GQOA 4FOPA 4DCCA 3KP1A 3ZLTA 3O8QB 4C2BA 4P7FA 3CE2A 4Q34A 5JCOC 1G6UA 1NM5C 3MBMA 2XGGA 1QFJA 1EFRA 4PLZA 4KN9S 5IJ0B 5A3VA 4FHFA 5EWJA 4DZTA 2O0KA 3KPVA 3BGWA 4MULA 5DNUA 3M33A 3FAZA 4OLJA 3ZCCA 1Z62A 2WALA 3PBKA 3O73A 2O48X 2ZWOA 3E6AA 2FSPA 5CJPA 1KMQA 4YPFA 3FIJA 1Z6TA 3CLRD 3N0XA 2RAVA 5K8UA 4K88A 4ABTA 3LRXA 4AWBA 4ZIBA 4F85A 4ZHYB 3EPHA 3OMWA 4UVAA 1SR8A 2IP4A 1U7ZA 4AM8A 4QBFA 1QNFA 2IWHA 1DEHA 5BWBA 3RGWS 4HH0A 3UKJA 4OXQA 4W8OA 5AM1A 1F5SA 1SUSA 2P62A 5HZMA 4L16A 1Q22A 2W2PA 1HETA 3KB8A 2OTCA 3J80M 1NPYA 1XD9A 1HDJA 1KK1A 5KYGA 4D4JA 2PKQO 4JR1A 3FWNA 1Y4UA 1OYYA 2DM6A 3VPBA 2PBRA 3G2LA 1NKSA 3JR3A 3NVKI 4UHEA 2JCSA 3B1JA 2LFRA 3WZMA 4Q47A 2ZUSA 4NHOA 2XA2A 1CUSA 5JZVA 3ZZTA 2VF4X 3O8BA 4IX1A 1DLBA 3B8MA 3WRXC 3MRSA 4WINA 3D4OA 4PRLA 5L3CA 4RD1A 3KUCA 3MWFA 2LDXA 3ZBUA 4HB0A 2PWPA 1LV7A 1O95D 3L7AA 3WISA 1CUJA 3N1UA 1NVVQ 4PX3A 1LY1A 4IHJA 1LX6A 3K1JA 3ZIAA 5HQJA 2II6A 1TEVA 1GCGA 3REOA 2JHPA 4XTRA 1U7TA 5EWMB 2H51A 3DCJA 2JF0A 4UEQA 1U8ZA 3EVKA 5HQ3B 4PQEA 4NTWA 2ILTA 4G8BA 4KLAA 1OB2A 1ZRHA 3LFUA 2XNHA 3GJRA 3QLTA 1F4NA 2PI4A 5IW8A 3RRJA 1YXBA 2CHVA 2Q6TA 2WKQA 4F2DA 2FSSA 4HDRB 3U19A 4KSYA 4KRYA 2NU7A 4X62B 4G1FA 3W9UA 3FWYA 2CVFA 2CFTA 1CULC 4HFJA 4ZYZA 5AVMA 2EWCA 2I6XA 3F74A 1QAOA 3D7LA 1E7RA 4DPKA 1OXUA 3CMAV 4TQ9A 3OLVA 1SOAA 1SVIA 2R62A 3TNDA 3VQTA 3UMSA 1HRDA 1FSZA 3EZ2A 4HNHA 4TT3A 4E5VA 3R3YA 4C7OB 4ALNA 2X0IA 1YI1A 3WGQA 1JKJB 5K8JB 4QHSA 4AZSA 3UCSC 2JFBA 1T0PA 2FRXA 1ADJA 2G0AA 4WRRA 1GRJA 1B6RA 2LBWA 4QELA 4JYAO 2IKQA 3KKNA 1SKVA 3KOYA 4REQB 5C9ZA 3G68A 3M4NA 4LQCA 4BUCA 4GNRA 4GOOD 3LWNA 3LRPA 2QPTA 4PR0A 4J80A 1OFIA 5IAAA 1DUSA 3BMQB 4R50A 1D2AA 5KTSA 4M1QA 1L4HA 1YRQA 5A9GA 3ZYZA 5KSPA 1GO0A 1WZUA 2F6RA 4MS1B 3H3JA 2AE2A 3P9IA 1VL5A 4FE3A 3VZSA 1UM8A 3P9ZA 2IHNA 3WAGA 1XOIA 3AT1A 1IIBA 4N9WA 4W9RA 2EDAA 4L78A 3TE7A 4HEQA 3VBBA 3ZHOA 3Q6IA 1QQ5A 2ZW9A 2NZWA 1N32B 3RAGA 3LIPA 3LWDA 4LG1A 1O1YA 5EZYA 4TTRA 1NQUA 2X0JA 1FS4A 3GVPA 2NUTB 4R1SA 4MQEA 5B36A 1V96A 3O90A 3DZDA 3LX8A 4WKBA 1VB3A 4BYGA 3UJNA 1U8AA 3O1LA 4YH1A 1DT3A 1MORA 1ZGCA 1P45A 4CF7A 2I1QA 3FNRA 5LQRA 1SQPH 1KOFA 4Q9IA 2G38A 4E22A 1IMJA 2EJRA 2OCXA 3R3SA 3WQHA 3SK0A 1KU6A 4Y1FA 2DPXA 1TGOA 3AVQA 1LVGA 3ABLC 4CM7A 3JWEA 5JV5A 3MUEA 4F4LA 3RV3A 4OEHA 3O9ZA 1EHIA 1VSTA 2FF7A 5AM2A 3KJKA 1RI4A 2IEYA 3A9VA 2I3AA 2HK6A 1DV2A 1FW6A 1HO3A 1PR2A 3ZHSA 4FX5A 2H5LA 3T4UA 1G63A 1G20B 4YMGA 1PNQA 4O1MA 3A6ZA 6AT1A 3Q3VA 1RSOA 4WNAB 1W3EX 1UEIA 2K4MA 3LGSA 3E89A 5JJCA 4A8JB 2CAZC 2Y1CA 1YHYA 2G1KA 2GZRA 3WRVA 3IVCA 2UVDA 5EJ8A 2J8ZA 2PVSA 3LM8A 4NU5A 5A5VA 2I2WA 4QEDA 3I9V6 5CBPA 2FJPA 5B2ZA 3JS5A 4FT2A 4S2UA 1KTIA 1T2EA 4Q66C 3RVZA 3LQQA 3HUFA 1PEKE 1NHWA 1FQKA 2XYQA 2AJLI 3QFRA 2QDXA 2Q21A 1VLZA 1KNJA 2BD0A 1KIMA 1T3GA 3UIEA 3E03A 3TQHA 3BBLA 4BTLA 1S2NA 1Q82W 3ZWVA 5JYEA 3EG5A 4B2YA 3DM5A 3DKKA 4F38A 2IOQA 2P79A 4IQ0A 5IM4F 4BB9A 5J2UA 3FB4A 5JAQA 1ZJ4A 3ZVKA 4BBJA 2AG1A 3C1UA 1CNFA 2XNDG 1XA3A 3OEYA 2VHTA 4LF8B 4F92B 3AFIA 3QX8A 1GL7A 1E4EA 3FX2A 3DULA 1O0CA 3N4YA 2QP9X 5DLEA 1M57C 3MXTA 2V4MA 3R20A 1EDZA 5IBQA 3QA9A 3K4PA 3RYHB 3CA8A 2QRQA 1DIBA 4FHDA 2ECPA 3BH7A 1TUEB 3LI2A 2FTKE 3F4BA 1W19A 3ROKA 2VXOA 4WESA 2FMTA 3QIVA 2R3SA 4AW9A 2V7VA 1HXHA 3OD1A 4D4LA 1QHSA 2QN8A 2YMPA 4TYPA 1LJ8A 1NTOA 2VDKB 2PX5A 1WF3A 1PKEA 1E79A 5FWYB 5WRFA 1QYDA 2ZI3A 4DT1A 4MTGA 2WAOA 5K2OA 4G5GA 4KWHA 3WDKA 4CQMA 1V7ZA 3S2YA 2FWPA 1SG0A 3TI7A 4LW8A 3S5JA 4KLCA 3D3WA 2QQFA 5AW5A 4QGBA 3A2LA 3VR5A 2FQXA 3EGOA 1KI9A 4XARA 1PS0A 4OXKA 1NTRA 3FAVB 1PL8A 3JCZA 1QG2A 2ZRNA 1G98A 2EEZA 2SHKA 1JIQA 1POXA 1DUVG 3VQXA 3CY6A 1H2WA 4IBOA 1UAAA 2VT2A 4QE9A 4PG7A 4A5UB 3JVIA 3T52A 1GCAA 2QZSA 1TMOA 2OFFA 1L4YA 2FZGA 4YAIA 2WHEA 3KAJA 3W3AD 3BXOA 3QBTA 3C6XA 2Z8ZA 4C0SA 5AVJA 4CL0A 5G4UC 1BXZA 2YUIA 1AD2A 3S1SA 2O2YA 2V03A 2OHOA 2IDZA 1U0JA 5CDSA 3OCWA 2FEAA 1ZM9A 1A9OA 2MHCA 1V41E 4RQBA 3OEEG 1Q6UA 3ZWPA 1IHPA 1PYGA 5KNBA 2CLMB 1SD1A 3G6KA 4DLVA 1C50A 5K09A 2HW8A 2IOHA 3DF7A 4UHFA 1B0ZA 4AJEA 4C7JA 2WMYA 3W79A 3O2SB 1LF0A 4NKGB 1FFYA 1ZP6A 3SC2A 4K2HA 4U5XA 1C81A 4ZU1X 5IT0A 1O03A 4QTZA 2ZRCA 3B6JA 4LHXA 1N0JA 2UYCA 2OTJF 2DPYA 2QPAA 1YHQF 5JCXA 4U7GA 2WSMA 3QV1A 1VMKA 1NVWQ 3X1XA 4FHZA 2X1MA 2Q5FA 3CNQS 4YNBA 4CFYA 3KKOA 4BRZA 1II8B 3TEFA 3GZNA 2O20A 4D9JA 3TLGA 2WNIA 1P0QA 4ZVPA 1XCBA 1E64A 1UH5A 2DYKA 2ANBA 5CVDA 3L79A 4GRDA 2PYJA 1OFTA 4BVRA 3QJ5A 4RQOA 3NZEA 3T9CA 1XD2B 2GCOB 1TYZA 1SZPA 3DV0A 1VGQA 4NCHA 5KYVA 4JOSA 3LC1O 1PFYA 3G7NA 4BMNA 1NDHA 4AZ0A 2PZGA 1YQUA 4R1LA 2FSFA 1XQ8A 2WSSA 3OONA 1JG6A 2J3MA 3NGXA 3AB8A 4EEXA 3INTA 4DR7O 5IWAO 4D2IA 2BFDA 1WQ3A 4UE6A 5KEIA 4QGAA 1UPGA 3RKUA 5LGNA 4OX9B 2A0XA 5M29A 4ZC1A 2ERXA 2P75A 1UBUS 4QOJA 1YFLA 4WV3A 4X63A 5KCZA 4FYIA 4A0HA 1Z0UA 2V45A 4UM9B 2EBHX 5A3SA 4CCWA 1DAGA 2VO1A 1IDOA 2QTAA 4P4GA 3DKRA 4TSRA 3KPUA 4GF5A 3RU9A 5BWMA 4KREA 1UMDB 2FB5A 4KQ9A 3NIFB 3OQJA 4ENQA 1XZNA 3FTDA 1ZKDA 2EX0A 4FLTA 3ZJYA 3ZWMA 2KG7A 1I08A 2X4LA 4AMVA 5D84A 2BI4A 3RANA 1DB3A 1Y42X 3FN4A 2F17A 4ZQFA 5SY9A 4N03A 2C5SA 4NTZA 3NALA 4Q9AA 4XW2A 1VQ7V 4DW0A 2IS6A 2IV2X 2I7DA 4JODA 4X3MA 4RADA 4HRXA 1RRCA 1EGMB 4XDKA 2P6NA 2EKZA 3TNLA 2QTZA 2HF9A 1S3SA 3T06B 3BZBA 3HG7A 4MSUA 5AK0A 1PEYA 3BA1A 2BIFA 1KY2A 5AHWA 2WE7A 3RYFA 3B3GA 3D31A 3ORRA 3K58A 5E0KB 1B8VA 1YBAA 2F43A 5KSWB 3OIFA 1U9IC 3AG6A 1YAJA 3NKLA 3G0DA 5ES4B 3GDWA 4XGQA 3A0UA 3S3XA 2O7NA 3IP7A 1XCMA 1P2FA 4OHVA 4BGEA 2D5CA 3VUFA 4H59A 2ZYUX 4AJJA 3HN7A 5JAMA 5CA1A 1CLEA 3E8HA 3C6YA 3RA5A 2GPSA 3NEJA 5FXMA 3DTVA 2ZAYA 4F4DA 1HEYA 3I5XA 3HO1A 1L8AA 5FUVA 4DXHA 3MK31 3VYTB 4DV7O 2FFQA 3G8DA 1DX9A 4ZIRB 1NBMD 2BEUA 3U13A 1T5BA 3KIZA 1D2CA 3FPLA 2C94A 2J3DA 1MSWD 1H4QA 3K03A 4TMXA 4Q4HB 3A6GA 1O97C 4Y6QA 2ZRAA 2WJIA 2GARA 2VG8A 4HKTA 4XTCS 4BVFA 1KY5A 3VSBA 4R1NA 5U1PA 2A1TR 1G8GA 3O94A 4WGFA 2D2FA 3K1AA 3LQ2A 4IDBA 5HYVA 5CGQB 1JQ5A 4A0FA 2PL3A 2Y4NA 4F72A 2OXTA 4LHZA 1HG0A 1RFGE 5LLDA 2DN9A 1WEHA 4CHTA 5IZ4A 3WLKX 5T4HA 1TADA 3U3MA 2DUJA 5JS8A 3GWGA 4MLZA 4X3CA 3T3HA 4F9GA 1OH8A 4YT5A 4PU0A 1HKHA 3EXAA 3N7TA 4B84A 1QLEB 1M2KA 5L3GA 3JPYA 2Q46A 2J6CA 5IS2A 2ZTHA 1ITZA 1MJGA 4EM6A 2B4AA 1H3EA 3PPWA 1LQ2A 2JFOA 2ZR0A 1KP9A 5TGDA 4RNCA 2GAAA 3JYNA 3OM8A 5EHIA 2GNAA 5I9NA 1UZLA 3B9PA 4BEVA 1IWPB 4J0HA 3D7RA 3AJ9A 2ZJ6A 2DX7A 3JRXA 1NLZA 4RJIA 3ZEIA 2NR5A 3RJ5A 4M54A 4MSWC 2QT9A 2V5UA 1VHAA 1Z6PA 2R8ZA 5KS2A 4LV8B 2JL1A 4MIYA 1ZK1A 4YUWA 1OREA 1P7ZA 5JJIA 4HDKB 4IHJB 1ENYA 2YWBA 4C2UA 4R98A 3NAQA 2IZ5A 1R0RE 5IC5A 3ZWXA 4IO0A 4ER5A 1LI4A 3FYEB 4RY0A 1O6GA 4PSUA 1ZONA 2XUDA 2Y76A 3L40A 3M34A 5L3FA 2HV9A 2N1MA 4Z49A 3I9NA 5THXA 3H97A 1K5GA 3GAMA 4BNIA 2CW5A 4Q39A 2FR0A 5EIBC 3X2QC 4F3NA 1XT6A 1JILA 5J5CA 4JUCA 4FOLA 1P4RA 1DKNA 2Y1XA 3BD8A 2OVFA 2OZLA 2G1JA 1VI6A 3LYLA 2CLCX 3GD7A 3EVNA 4D9MA 1SFRA 4UCFA 1A9XA 2GCPA 2YVKA 3G9XA 4YIKA 1QU2A 2NO9A 3ZQUA 3R0JA 2AL7A 1UWKA 1RQXA 2XPCA 3HUTA 2WLTA 5JPDA 1Q1QA 4U8GA 3BWBA 5EI5A 2O2JA 3EC7A 1IV1A 2KM1A 1K63A 2OGSA 3H1HH 3AFGA 1QYVA 4IOLA 1CEEA 3LQKA 3D6HA 4I5EA 4R41A 1R66A 1W581 4FS3A 2WTUA 3E82A 2P06A 5BUZA 1VJ0A 1IEWA 1Q90D 3RIMA 3OM0A 5BMVF 4RSGA 2IS2A 3RC9A 3W5VA 3AK4A 3OCYA 1W57A 1NMEA 3ZTWA 3IKLA 4YUAA 2ZZMA 1P75A 4WZBE 3OT7A 2XD9A 3CWQA 1JSLA 5BRJA 1CT9A 1QD9A 1R88A 1G7RA 3SQMA 1H8HG 3W7WA 2GEDA 4N01A 3I04M 3JWJA 2KHZA 1ZH0A 3BL6A 3BN3A 4J9ZB 4WCDA 1R3UA 1JXOA 4EL0A 3S0YA 1I4LD 3DVSX 3DL7A 1WXDA 2JKZA 1TLFA 1SVNA 2K1SA 3PXCX 2I6QA 3M7IA 4A92A 4JGIA 4UU8A 3OKFA 1GN4A 5AJTA 2H1SA 1VA5A 3AHHA 1PTJA 3CF4G 3SDZA 2PO5A 4DXWA 1W85A 2HOQA 2X4GA 3NHBA 3FB6C 4G0OA 4MVJI 4RHYA 1S4MA 5DN9A 4XAQA 1L7QA 4OYYA 1B6TA 3TZEA 3A7EA 4J6EA 4MQEB 5ED0A 2VPYA 4RL4A 4DCSA 5TGTA 4MVJH 8OHMA 2VQEO 2NNWB 3CNNA 4K7JA 3OJEA 3OD5A 2QJ1A 3ZDZB 2YBDA 1EQ2A 4MINA 1ORVA 4A7PA 2Q2VA 1L5OA 2GXSA 2FCRA 3DBVO 4W5WA 1Y5LA 5ALZA 3W4JA 2PRKA 2YRFA 1ESCA 2ZBFA 2UXDO 3K5OA 4MEAA 4E21A 1Y37A 2PYZA 1KO1A 4ZQGA 1XZMA 3EXEA 2WPDD 5EC8A 4XIGS 2X22A 1E9SA 1FP2A 5H68A 3TDMA 1MJ5A 2B0CA 3BCUA 3HXOA 3L9DA 4YV2A 1XALA 1F60A 3VC3A 5ILOA 5H5NA 1IXBA 2UUBO 4BP9A 1PE0A 1RSOB 3KQWA 2BZ0A 5F7JA 3AM3A 3EGXA 3HA2A 3M3DA 2EKPA 4U3FH 4CKWB 1IOWA 4FDMA 1D9ZA 4LXTA 3VVLA 1XLVA 7MDHA 5IY5C 5EUBA 3SQXA 2XWBF 4UCSA 2J67A 2OCHA 5LOVB 1LWOA 2EP8A 3U48A 3DDOA 1P7GA 1JXMA 1PL6A 1I3CA 1WUIS 3M89A 4XDGA 3RK0A 1F1BA 1HE5A 1XCPA 1EU1A 4P34A 3BOSA 2BDUA 3QWFA 2ZJ4A 1ZD2P 1LK7A 4UBOA 2I34A 2BGNA 4EG4A 1MAHA 1J2YA 3AU9A 2NWQA 2GBPA 5F4BA 1Z25A 4YYZA 1Z6YA 1EI9A 5DM70 1D6SA 5M7EA 3CC4V 1T2UA 3OPYA 1Q0QA 4MVUA 2VHUA 5LKRA 5JJJB 3UAOA 3I3SR 4L1KA 2NU6B 2R11A 4J42A 4DIOA 2K9PA 4KXMA 3PGVA 3HA3A 1MNGA 2O0JA 4EUHA 3OZCA 3AYXB 4WN3A 4DM3A 3UT6A 3BG5A 2IX3A 4CI9A 2Y92A 1IV3A 1G3RA 3O8CA 1EK5A 4Q3AA 4FGJA 4IUDS 3DUFA 4V38A 4A8HA 3FPJA 2C9ZA 3JD0A 1KVQA 4CV0A 2GLZA 2PUFA 4XYGA 2BJHA 2EW8A 5JC1A 3GAFA 3C3PA 3V5NA 1HW7A 3EXIA 3A9UA 3NOVA 1YOVA 2VH2A 5IDQA 3HL0A 2IJGX 3PV0A 3NRJA 5A7GA 1Y1PA 1M2GA 4AJ2A 2XAAA 1L5FA 1D5CA 2QRNA 1TJNA 4XJTA 4WESB 3U11A 2VL7A 4I4TF 4RFLA 3LP6A 1RCFA 2P30A 2UYYA 2BTOA 1R5BA 1OT5A 4IL6Z 2WYOA 4LGVA 3ZWQA 3CX8A 1D03A 2OSVA 1N34B 1RAAA 4PS1A 2DHEA 3K70B 1KFKB 3VM6A 2GFHA 2ZRMA 1BS3A 1JMVA 3UMMA 1JJ2U 1X1BA 5A4MS 4EIWA 3T4DA 1RWWA 4YMIA 4DM7A 4DT1B 4AY2A 3BE5A 4QUHA 4CEIA 4JVMA 3UOAB 1TKAA 1KO4A 4BW0B 4WXHA 2BMDA 3D64A 4BN0A 1SO8A 5B1OA 3A32A 5H1YA 3D3WB 4JC5A 5EJ4A 1DEXA 3K09C 4P3OA 3OC0A 1M1YE 2H1OA 4UTOA 1XROA 2BP7A 3QGMA 2O8VA 1NVVR 3DCIA 2B0JA 4Z3DA 1OH6A 1GNRA 1RXYA 1C9DB 3PFFA 2IHBA 4BFXA 4PX5A 2FPWA 2IM9A 2ZYIA 1ZHFA 2AIFA 4C1NA 5K0NA 2DMRA 3WWDA 4NCNA 3A2FA 5FWDA 5DH9A 2CK3A 4JBNA 4EMSA 1GRNA 3OHPA 5K45A 1C7ZA 2DQ3A 3QHAA 1T34A 2AXNA 4WW0A 4PLVA 3IGAC 5KJ1A 4MS3A 1OU0A 3SY8A 4I1PA 2W6MA 1JQEA 4I1VA 4UQLA 2V6FA 4J16A 2O2HA 4EARA 1H93A 2VK8A 3OT5A 3OOYA 1V16A 3HCRA 1ZX3A 2CBGA 5DN6G 4XX0B 2CLKB 2HO4A 4Q1CA 1V1JA 1YS1X 4W5TA 1UQUA 2VT3A 4MRNA 4RHFA 3WFZA 2B2XA 5K3AA 3QKUA 3ZGOA 3FB5C 2WHPB 4DVGA 4GI2A 3EAGA 2V9CA 3QZUA 3MWYW 4JBGA 1T0AA 4NZPA 4UATA 3AEUB 3ZK8A 5GVSA 4CV3A 1OLSA 4MW5A 1P4GA 3IQHX 1KO5A 1NNUA 1GDHA 1BDJA 4BASA 4DO2A 2F55A 2G25A 1I1OA 2DFVA 2IE0A 5K0TA 3RT9A 3QLEA 1EX7A 4V1CI 5EJAA 2OTLV 2AUNA 4K2AA 3UO8B 3E5NA 3NQ41 2P90A 3AM5A 2PRIA 3SQDA 3P9NA 2PPLA 3G6BA 4LYAA 1J25A 2Q8PA 5KX5F 3FKSG 1GGFA 5IANA 3KB1A 1NWHA 1C3VA 2QLJA 3OIWA 1VLVA 4XWKA 2H8PC 1FFAA 1T8YA 1K0UA 2YV5A 1X7PA 3FFWA 3KKKA 2B36A 2HJGA 3WWOA 4PM4A 4KEAA 4M8IA 3DV0B 3OZTA 3B09A 4DQDA 1P80A 3HDYA 4ZKDA 2P7IA 3OGCC 2QRGA 4NARA 1X39A 1HYHA 1TYCA 2WD9A 3L6RA 5GM1A 4OOFA 5AKJA 2WJ3A 2ZF8A 3FG9A 5FOVA 4BZXA 1RAGA 4PSKA 1ZA2A 3I58A 3J81k 1ZUNA 2QPLA 1G7CA 3LQ4A 4L76A 2BFDB 2RIRA 1QLWA 5CH3A 4ZO7A 4MDYA 1ST3A 1SC4A 5CJJA 4MUBA 4WLUA 2JEYA 2DR2A 4CU2A 5CPFA 2W0SA 4LGYA 5FLXN 1JEAA 4PBSA 5DM4A 5H2FZ 5B7QA 1GWNA 3SIWA 1RAHA 2YRWA 2RK6A 2VS1A 5L3SA 4P1ZA 1S01A 3KHUA 2A9PA 1JMKC 4IFTA 3STHA 3QITA 4J7CA 4IIEA 3GQBB 4YMUA 1XLUA 3CC7F 1CF9A 4LF4B 2DFDA 4RUEA 1ZCAA 2HP8A 4OKSA 2PZFA 1QAMA 4Z7QB 3RUEA 2DQSA 2GO1A 3GA7A 1MSDA 1YMVA 3O1IC 1WQ1R 3OTHA 2H94A 4F2PA 1YIJV 2WSIA 5CTAA 1N8NA 1W93A 1Y4DE 3F6BX 3THRA 2PTGA 4LVOA 4PICA 1FLDA 1JS1X 5B58T 4IIJF 1KY3A 1IY0A 4YBZA 3UM9A 3SEZA 5B3AA 4BN4A 3FOCA 1PT6A 3CS5A 1FNSA 2FLKA 2O0HA 4XD7D 3I61A 3RCBA 1P3DA 5HKOA 2IU6A 4FLUA 1GSIA 4MB2A 4FKZA 4MW9A 2W71A 1VLJA 5JNRA 1I4WA 2GM4A 2L18A 2VTVA 4U5QA 2BCJQ 3KOXA 4D3ZA 4M49A 4KLRA 5DK6A 1R1MA 3KT8A 3HU3A 3RUPA 5L6MB 1OXMA 1KAOA 5EZSA 3MWLA 5FI0B 3F5WC 5G0SA 3ICPA 4YRSA 3IPCA 10MHA 5LU8A 4CL3A 1NU6A 3CLUD 1YKGA 1HSZA 3D5EA 1PAUA 3H6GA 2BFCA 4POAA 4QULA 3ROTA 3DDZX 1WW2A 2OTLF 2GLUA 1Z17A 3ZV7A 2Q62A 2C9YA 1VRVA 2BEUB 3VHLB 1YDFA 4R83A 1V6SA 3ROZA 1R15A 1XE3A 3AUAA 2ZYSA 1B2LA 3OE7D 1P39A 3QU4A 3QO5A 4TWZA 3CCEF 4C8EA 2GM5A 3B1ZA 2GCEA 4HNSA 2I4MA 5ED4A 2IZ7A 5AI4A 5AKHA 2ZTMA 3LQYA 1UR5A 4DQ0A 1M6YA 1TTPB 1R5NA 5AG2A 3D2LA 2LCIA 3FRJA 2Z09A 2JC3A 3MB5A 2IJKA 1OE0A 3PCXA 2F1OA 3RTAA 4HS9A 4C4XA 5T4EA 3U37A 5D85A 2CL0X 4QRIA 3QU2A 1IK4A 1MO6A 1QVAA 4H9GA 2V3WA 3TDNA 4L0DA 2PDAA 4DIEA 1RP1A 5DLDA 3G0HA 3IMKA 4UTXA 1DLJA 3H2ZA 4MWTA 4Q7KA 1ODEA 2EC5A 2IV7A 1P4JA 4RE5A 3RVJA 3ZY4A 1S2LA 4B5CA 1E1QG 4Q9HA 3LHKA 2Q1SA 1IBKO 3QU7A 5IXYA 4LRUA 3WLSA 3FY4A 3IMFA 4QGHA 4QHTA 4C4WC 2C9DA 4MMXB 5DOZA 1ZUHA 2R66A 4E1VA 2M32A 2C8JA 2HSWA 4PIPA 2PUCA 1Y1RA 4NU6A 2QEQA 4HH4A 1OI7A 2IRWA 3RSSA 3UG6A 1VG9B 1NW6A 4ZZIA 4PA4A 2VZ9A 3RSGA 4M8SA 1YIJF 1R64A 5AJXA 2YJTD 3F2VA 1K5HA 4DV4B 1W2HA 4QG7A 1FDWA 1R9GA 2UYOA 3PWTA 3AF3A 1IZ7A 1MO2A 3HE3A 3QVVA 3W2TA 1NNSA 2JI7A 4H6VA 4DEXA 5HIKA 2OZLB 3LXRA 3LUAA 4QE3A 5HOEA 2YOGA 1E6EA 4IJWA 2Z5LA 2WJYA 1T36B 4Q20A 1A9XB 1JHZA 4JCOA 1V7CA 2EV9A 3R0QA 2B69A 5FUQA 1E9EA 3GC6A 3RQIA 4JGBA 1XTQA 3CINA 1NF3A 4G37A 2I6UA 4I1OA 5KHHA 2VGMA 2H7XA 2P9FA 3U2QA 4UAJA 2C0PA 4BLOA 1R9MA 2CEKA 3OLYA 1UJBA 4CIWA 1ZNQO 1JKMA 3GVCA 4AURA 3WTBA 3IKFA 3HWWA 2I6SA 2XGSA 3HJNA 1F3LA 5J23A 2PSFA 5K20A 4JJIA 1X80A 1GZVA 1LBIA 2RHJA 2OV2A 3AILA 1BGYH 5KDDA 1HMYA 4KQCA 3T7TA 3EMBA 4YJFA 4FJ2A 2ZS7A 1PJ2A 1YMQA 1TFRA 5E6SA 3IQFA 3QHQA 1C0KA 1EWKA 2VNAA 4CT4B 4AF8A 1YJAA 5LPNA 3HNPA 3G9UA 2Z01A 1NFFA 4LQ4A 4TWKA 1JHOA 4GPEA 1A7UA 5I4KA 3HCDA 4KHZA 5CFOA 3QUCA 2H0AA 4E2YA 2R7NA 1J8FA 3KEGA 2CF6A 3OD4A 1GLVA 1JR4A 2UU9B 2XZTA 3ZRVA 2QZ9A 3FCCA 4WDQA 2JLCA 1W85B 3L06A 1QG4A 1ZYUA 1J1IA 1O58A 3HB1A 2VEDA 3OJ0A 1J7HA 2RG1A 1W1WA 3GUHA 2EP5A 2GTSA 4AN0A 2YDEA 2YDXA 2HRBA 4A8JC 3MRXA 1I5EA 5DYNA 4BX8A 3S4YA 3E53A 1U65A 3WGUA 4NEHB 2TSYB 3E1KA 1NLMA 1LLFA 1EUDB 1VKZA 4X62O 1EP2B 4L9AA 2FUEA 1CUDA 1GTRA 5P21A 1E2IA 1S3FA 4LCKA 4CM3A 1YNSA 1VJRA 4B31A 3DDNA 1UFIA 5HXAA 1P18A 3P3NA 2FQ1A 3K92A 4JR0A 3SS8A 3PA6A 4L8JA 2A9QA 1E9DA 4YB8A 3MERA 4N6NA 5C8VA 5L4SA 2OD9A 3HYSA 2V3VA 3W5CA 2X6CA 3FVQA 3E48A 2IVZA 2WYUA 1P1FA 2Y0DA 4UZSA 3CPWF 3F6PA 4RZQA 3CCLF 1VHJA 4RWUA 1S1CA 2V6JA 4RPKA 3P1JA 2XZOA 1SG9A 2VTEA 3N9IA 4IIBA 5FIUA 3SIPA 1AV6A 5JXIA 1LSUA 1KQSF 4D82A 5CX4A 4COOA 4Z7JA 1NF2A 3SZLA 4OYHA 5TPZD 1AJQA 1K2WA 5JNTA 4I2VA 1JSCA 1BL8A 3SPJA 3RTDA 3OW2U 1G1XB 3N8HA 1O4VA 3HCBA 4X41A 1ZUD1 2ZREA 1H2GA 3Q1KA 2PWZA 1P0PA 4AO8A 1RRPA 2E9SA 3DVQX 2AKYA 4O1HA 4AZVA 5KO2A 4E4YA 3I2HA 3DMHA 5CUQA 4A2WA 4X71A 2RH8A 3L02A 5IP5A 4JHLA 3I5DA 2OXIA 3IURA 2BCGY 2KB0A 4JQSA 1BXKA 4OGGA 3U3RA 2EZTA 3UGJA 2IEDA 1E1RD 2O05A 4UKDA 1U3WA 4YCNA 4HR7A 1VZ3A 4E3WA 3PWSA 3LFTA 5FLXA 3GBSA 4ENSA 1UJ5A 2XMQA 1GXSB 1GUFA 3KXDA 4G4WA 1KJWA 2JFZA 2H17A 3IQGX 4YUVA 3L0YA 1XL4A 2IIBA 2O5EA 3K8YA 2PUBA 4II7A 1BS2A 3H11B 3HBMA 3JALB 3QEBZ 3LFHA 1Z0IA 4MQLA 4H1VA 5BP7A 1SZTA 4CUZA 5BNWA 1Z7GA 4PO3X 2UDPA 4I5IA 1ZU4A 1NZJA 3B8EA 4PZLA 4P5DA 2QM7A 4PO1A 3TQOA 4DR5O 4MGYR 3CN9A 3I2GA 2OV4A 1W9MA 2WG1A 4WFKA 1OGYA 3NFYA 3EXIB 3ZKWB 3IOCA 1ZOSA 4YP0A 4MUIA 4YR7A 3QY9A 2FGKA 1N77A 3ZE6A 2ODMA 2ZSDA 3CKLA 4JFRA 4BT2A 4CLXA 1XVUA 4TSFA 2QX8A 1K9MW 1KTVA 3O85A 3VYVA 1FFBA 3U26A 3E7PA 1HDYA 2WVAA 3Q6MA 3PNVA 2C2OA 3NBKA 5EQJB 5LDDC 2V7WA 4G5FA 4LAFA 1QVFU 4URHA 3VZDA 1Z63A 3KQQA 3V8BA 1Y63A 2XSZD 5A4KA 1Q84A 4MJLA 4ZKIA 3T5MA 5TQ0A 4W1RA 3IQIX 3EGVA 1T1EA 2VJQA 2WLSA 4PAQA 1X7YA 4LX8A 1X42A 2OKCA 4BNGA 1JIVA 1O7JA 4UNIA 4IIYA 1TO2E 3E2MA 1JB9A 5B37A 2QLBA 1FRVA 1JZTA 3PUZA 4NABA 2R79A 2AG6A 5FBVB 1FA9A 5HUJA 1T4CA 1A5SB 4L2IA 1NZDA 4KR9A 4WKCA 3L3BA 2JIMA 2QTGA 2I1WA 4HNGA 2NU8B 1PD1A 1I9CA 2YMLA 5B1SA 5CDTA 1UKYA 2ZJ5A 3UOGA 3D59A 3LOPA 1AROP 1FF9A 3O82A 1C7JA 1VDMA 3L9WA 1NY6A 3KD3A 4ZYVA 3ISJA 1NVDA 3AL3A 1GZHB 5DPMA 3GBPA 4ZD6A 1H05A 4D4GA 1JAIA 3AUKA 3EC2A 3QYPA 4IVQA 4FS8A 2ZSBA 2N3ZA 1EGQA 5H02A 4FJ0A 4ICGA 5T3YA 3AUJB 2JDID 4HXGA 1Y8QB 2CDRA 1MABA 5JVDA 2PIAA 3MA0A 2VFAA 1V16B 4ISCA 5B1AB 4IX9A 2CD7A 5ALWA 4B48A 2R9IA 3TEMA 3DGEC 4X9XA 4RPGA 2C29D 4ZVTA 2AQ8A 2ERYA 3GO4A 3CVJA 4G6ZA 1TC1A 3DZIA 3OPMA 5A2QM 1GV1A 3TFWA 1VJ5A 1LGYA 5EA2A 4R2LA 4BY9E 2DC1A 1KMHA 4OCZA 3ESCA 3I1FA 3TCNA 4FYPA 4FNMA 8ADHA 3PQEA 4EPRA 1JWLA 3F7YC 1WV0A 1CYEA 2BGUA 1RQLA 1RBZA 1CBUA 3JQAD 2AX4A 4KYUA 1I4DD 3KKPA 1R3LC 3GLGA 4Z53A 4LY0A 1Q15A 2VAVA 4DJFC 3G1WA 1US8B 3Q72A 2HDOA 1NQ3A 4Y6PA 1Z7BA 4DY4A 4MV4A 2E4AA 1TIPA 3TXXA 2PZSA 1GTOA 4RDCA 5ABPA 4NRDA 4YXWD 1NY5A 3AEXA 1CIVA 5TS2A 3NT4A 2X0FA 2BFBA 2HBQA 1PQYA 4KIUA 3ENVA 2LD4A 4OUDB 2GJAA 1ZUNB 3PYMA 3ET5A 3UJCA 3KTAB 4S0XA 1M2VA 3X1DA 4MUNA 3VU1A 2QP4A 3ABZA 2YUTA 3BGVA 5KHIA 1YQWA