3KHNA

Crystal structure of putative motb like protein dvu_2228 from desulfovibrio vulgaris.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
162
Chain Sequence
b'RLQRELIEAQRQTYNEMRTYFTVNGVEGVIGAVFDEGVITLRVPSEVLFAPGAVELAPGADRVLATLKDLFIRRREQNINIKGFTDDVQPSANARFKDNWEVSALRSVNVLRYFLGAGIEPARLTATGLGELDPLFPNTSDENRARNRRVEFVLEREGHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MotB protein, putative
molecule tags Structural genomics, unknown function
source organism Desulfovibrio vulgaris str. hildenborough
publication title Crystal structure of putative MotB like protein DVU_2228 from Desulfovibrio vulgaris
rcsb
total genus 54
structure length 162
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3khnA00
2W8BC 2MQEA 2LCAA 4G4YA 4ERHA 4G4WA 3LDTA 1OAPA 3TD4A 3WPWA 4B5CA 2ZVYA 1R1MA 3TD5A 4ZHWA 4ZHVA 4G88A 4R40B 3WPXA 3S0WA 5EAZA 2AIZP 2LBTA 3IMPA 3S0HA 2KGWA 3S03A 4G4VA 3S06A 4RHAA 4PWTA 2K1SA 3TD3A 2ZF8A 3S0YA 3OONA 2ZOVA 3KHNA 3CYQA 5EB1B 4G4ZA 2N48A 4G4XA 3CYPB 3S02A 2ZVZA 5EB0A 4ZHYB 2HQSC 2L26A 4B62A
chains in the Genus database with same CATH superfamily
3CCEF 4NUTA 5JH7A 3HAXD 4X1YA 3CPWF 3KIZA 3QTYA 1T0KB 1W581 4X3LA 5GIPC 3DDNA 4I4TB 2OTJF 5AVMA 4O4JA 1K8AH 1OFUA 4F6RA 3TD5A 5FLXM 5IJ0B 5EZYB 2LBTA 1YITF 3HKCA 3UT5A 5IYZA 4BY9D 3PLAC 2ZOVA 4C8EA 2HS4A 4ZI7A 2I6DA 2HVYD 4IHJB 4ZHYB 3G6EF 1UFYA 2VAPA 5J2UA 5FNVA 3K14A 1GO1A 2GZLA 5HP7A 3WXMB 3J7AR 5G4UC 3ON1A 1OAPA 2P6YA 3CG6A 2FC3A 4FFBB 4G88A 2YYEA 5C8YB 5EYPB 2OTMA 5BMVB 4RHAA 2H8CA 5JH7B 4TV9B 4X1YB 3S0YA 1H48A 3MBMA 5KMGB 3D00A 5HY4A 5MN6A 4KWEA 1RQ7A 4BT6A 3CMEF 3C9SA 2R6R1 2Z1TA 4B46A 5EO3A 5CA1B 5HY2A 3JARA 2Z1FA 2V9YA 3VI6A 1DBFA 2OHWA 1W59A 1PXWA 3IKEA 1U40A 3F0EA 1NJIH 4X1KB 4O4LA 1U3LA 3HKEA 4PWTA 5FNVB 2ALEA 5JVDB 1Q82H 3E1YA 1VQ7F 3JAWB 3J81M 1KNKA 3VCZA 5HY1A 3RYHA 4C4WC 4EI8A 5CA1A 3WGNA 2LCAA 4O4IB 2ZAUA 3HKCB 3UT5B 3RE3A 5LOVB 3ZP7A 3HKDA 4C8IA 3D01A 3VO8A 1KC8H 3N4ZA 5GINC 3IEQA 3HKEB 4BT2A 3RYIA 3KHNA 5IJ0A 1YJNF 1VQVA 3I56F 2BTQB 1VQ6F 3S02A 1YQNA 3VYUC 3FD5A 1SZQA 1XBIA 4BT3A 3M1XA 3JASB 5JQGA 5EIBC 1E7KA 1W42A 1YJ9F 4TUYB 1R1MA 3JAMM 5IT9M 1RLUA 2R751 2EWCA 4YJ2A 2KGWA 5GONA 3V7QA 3CC2F 2G9IA 3OONA 1KNJA 3QHDA 2HP0B 5EB1B 3N2KA 2LBWA 1K73H 4IHJA 2VGNA 2VAMA 3F0GA 3GTZA 4WBNB 2RHHA 3S0WA 3VYTC 1JY8A 3VMFB 1TVKB 2Z1UA 3O85A 2CSLA 3NMUC 1Q8RA 3V4DA 3RYCA 4X20A 3FFMA 4U3JB 2CHSA 4DRXA 3F0DA 4DXDA 4LCKA 3KJKA 1JFFA 2HS3A 3FBAA 1W5FA 3NK7A 1FNKA 1W55A 1YGYA 5EZYA 2QA4F 3WGMA 2Z01A 2N48A 5LXTB 3I3FA 4BT5A 1QAHA 1X25A 3IMPA 3JCMM 4YJ3A 1N8RH 2RB9A 5JCOA 3HTNA 5CA0A 1M90H 5FJ4C 3L7QA 5LYJB 3I7TA 5BMVA 4EB6B 3CD6F 2KTVA 5GANK 1VH8A 5LP6A 2NMUA 3CCMF 3PAFA 1W2BF 4X1IA 5GAPK 5EWRA 3G71F 1JJ2F 3QUWA 2KG4A 3C9TA 2CHTA 4O4HB 1W5BA 4YJ2B 5LP6C 3G4SF 3CYQA 3MCQA 4RQOA 4I50A 3N2GA 3HKBB 1TUBA 2RHOA 4TV8B 1UI9A 3FD6A 2BTUA 2Q1YA 3RA5A 3LDTA 1IV1A 1TUBB 3TD4A 3F6MA 4O4JB 5EAZA 3S0HA 3LWQC 2HRYA 3RYFB 1ONIA 1VQ9F 5IYZB 2ZF8A 5LA6B 5C8YA 1IV4A 3JALA 4ZOLB 3WGKA 4TUYA 3GYQA 1GZ0A 1CLIA 3KJJA 1VQ5F 3F0FA 4M8IA 2IQQA 2CZWA 1VHAA 1FFXB 3D54A 1W5AA 2WALA 1CN7A 3Q8HA 1S72F 2QEXF 4BVQA 4X3MA 3CC7F 2PHNA 3DC2A 3K0TA 3CCSF 3E20B 2FGYA 3JVHA 1YHQF 5KMGA 1H47A 3CPQA 3K12A 4FFBA 3IR9A 3WPXA 1COMA 4BVTA 2BO1A 3LMEA 3U0OA 2CVLA 3M4SA 1VQ4F 1YIJF 4EI7A 2I6RA 1JD1A 3P4EA 3GHZA 4E6EA 2L26A 1KD1H 5JVDA 4O4IA 5IJ9A 3VTIC 1VQMF 2JNBA 2YXZA 3LFOA 5GIOC 4ZHQA 2DT4A 3M84A 1Z5WA 3OBYA 2HX0A 3RYHB 4U39A 3IKFA 1SDSA 4BVRA 3N2KB 1QVGF 3SIUA 4R40B 5CB4A 3HWUA 3HJWC 3S06A 4O2BA 5LYJA 3CCLF 3K2XA 4X1IB 2AMTA 5EB0A 2PMPA 5G4VC 5J2TA 1U43A 5LA6A 5ITZB 2HP3A 4IIJB 4B45A 4ZHQB 2MQEA 1IV3A 3RYIB 2Z1EA 2UZHA 3E22A 2Q1XA 3ERNA 1PF5A 1IV2A 3ZOPA 1VQKF 4ZHWA 2OZBA 4I50B 5LXTA 3CC4F 3ZO8A 3ELCA 5HP8A 3V7EA 3B6NA 2RHLA 4TV9A 3JAKA 5MN4A 4O2BB 3CCJF 5IJ9B 2B33A 2K1SA 3JATB 4WBNA 3C9UA 1W40A 3N2GB 3HKBA 1W41A 3HKDB 5A2QM 2GVIA 1YI2F 1CK2A 2CWJA 1J7HA 3WJPA 3ZP4A 5GONB 5MN5A 4ERHA 1VQLF 1H7MA 1RA4A 3WPWA 2DYYA 3IEWA 3VOAA 3VYSC 1FSZA 3WJQA 5HWEA 1Z5VA 4TZZA 3E22B 2ZODA 4IIJA 3MCAB 1FNJA 2VGMA 3MQWA 1X7OA 2VXYA 1QU9A 3C8LA 3P10A 5KX5B 2UYPA 3R0PA 2CW4A 4EB6A 1GO0A 2UYJA 3BYQA 3AGKA 2OTLF 3I55F 3MDOA 3RYFA 1TVKA 3LWPC 2BTOA 1SA0A 5HXZA 3VIUA 3EORA 2AIZP 4HNAB 3CCQF 1K9MH 4BT7A 1IPAA 4U3JA 5CB4B 1T0AA 4LNUB 3KE1A 4G4XA 4ZI7B 1X52A 2RHJA 3CCUF 2HQSC 5JCOC 2GLZA 1W5EA 3JASA 3V3TA 2H6LA 2IG8A 2QTPA 5HXUA 5JQGB 2W8BC 3WGLA 4G4YA 4O2AA 3JAKB 1YJWF 1VQOF 4TV8A 4X1KA 2ZVYA 5KX5A 4C8GA 1KQSF 1JN1A 3JATA 1QVFF 4I4TA 5DCVA 4G4VA 3ESJA 5CA0B 1XRGA 1VQNF 3NK6A 4C81A 4I55B 4EI9A 3RYCB 3CYPB 3P0ZA 5LP6B 4B62A 3T80A 3NVIB 1JFFB 3CB2A 5EYPA 4X20B 1U3PA 4NWOB 3NVKE 1W57A 4BW0B 1Q86H 1VQ8F 3OBWA 2HP0A 2AIFA 3SIVA 2H8EA 5B8FA 2IAFA 1GX1A 4O2AB 5EIBD 3LYBA 2UYNB 3OW2F 1W3EX 5J2UB 4ZK7A 4BT4A 1DT9A 4G4ZA 3VOBA 1M1KH 2ZVZA 3JAWA 3LWVC 3J80M 2HS0A 4NQ3A 2UYNA 3C9RA 3WGJA 3FPIA 1Q7YH 1RQ2A 4O4HA 3N4YA 3CCRF 2QI2A 4HNAA 1ZWZA 1FFXA 2LBXA 4G4WA 4O4LB 4BVSA 5ITZA 1VK3A 4B5CA 3RA6A 1NMUB 2F9ZC 1RLGA 1Q81H 1QD9A 4C82A 4F6RB 4ZHVA 3LWOC 3JALB 4ZOLA 3LWRC 4LNUA 2VAWA 3JARB 3S03A 1X7PA 2HRUA 1XHOA 4XCQA 1ODEA 2UYKA 3TD3A 1VQPF 4DRXB 4YJ3B 3CCVF 3CXCF 5J2TB 1NQ3A 2KTUA 3CMAF 1SA0B 5HY0A 3WJRA 5LOVA 4I55A 1XV2A
chains in the Genus database with same CATH topology
2W8BC 2MQEA 2LCAA 4G4YA 4ERHA 4G4WA 3LDTA 1OAPA 3TD4A 3WPWA 4B5CA 2ZVYA 1R1MA 3TD5A 4ZHWA 4ZHVA 4G88A 4R40B 3WPXA 3S0WA 5EAZA 2AIZP 2LBTA 3IMPA 3S0HA 2KGWA 3S03A 4G4VA 3S06A 4RHAA 4PWTA 2K1SA 3TD3A 2ZF8A 3S0YA 3OONA 2ZOVA 3KHNA 3CYQA 5EB1B 4G4ZA 2N48A 4G4XA 3CYPB 3S02A 2ZVZA 5EB0A 4ZHYB 2HQSC 2L26A 4B62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W8B C;  2MQE A;  2LCA A;  4G4Y A;  4ERH A;  4G4W A;  3LDT A;  1OAP A;  3TD4 A;  3WPW A;  4B5C A;  2ZVY A;  1R1M A;  3TD5 A;  4ZHW A;  4ZHV A;  4G88 A;  4R40 B;  3WPX A;  3S0W A;  5EAZ A;  2AIZ P;  2LBT A;  3IMP A;  3S0H A;  2KGW A;  3S03 A;  4G4V A;  3S06 A;  4RHA A;  4PWT A;  2K1S A;  3TD3 A;  2ZF8 A;  3S0Y A;  3OON A;  2ZOV A;  3KHN A;  3CYQ A;  5EB1 B;  4G4Z A;  2N48 A;  4G4X A;  3CYP B;  3S02 A;  2ZVZ A;  5EB0 A;  4ZHY B;  2HQS C;  2L26 A;  4B62 A; 
#chains in the Genus database with same CATH topology
 3CCE F;  4NUT A;  5JH7 A;  3HAX D;  4X1Y A;  3CPW F;  3KIZ A;  3QTY A;  1T0K B;  1W58 1;  4X3L A;  5GIP C;  3DDN A;  4I4T B;  2OTJ F;  5AVM A;  4O4J A;  1K8A H;  1OFU A;  4F6R A;  3TD5 A;  5FLX M;  5IJ0 B;  5EZY B;  2LBT A;  1YIT F;  3HKC A;  3UT5 A;  5IYZ A;  4BY9 D;  3PLA C;  2ZOV A;  4C8E A;  2HS4 A;  4ZI7 A;  2I6D A;  2HVY D;  4IHJ B;  4ZHY B;  3G6E F;  1UFY A;  2VAP A;  5J2U A;  5FNV A;  3K14 A;  1GO1 A;  2GZL A;  5HP7 A;  3WXM B;  3J7A R;  5G4U C;  3ON1 A;  1OAP A;  2P6Y A;  3CG6 A;  2FC3 A;  4FFB B;  4G88 A;  2YYE A;  5C8Y B;  5EYP B;  2OTM A;  5BMV B;  4RHA A;  2H8C A;  5JH7 B;  4TV9 B;  4X1Y B;  3S0Y A;  1H48 A;  3MBM A;  5KMG B;  3D00 A;  5HY4 A;  5MN6 A;  4KWE A;  1RQ7 A;  4BT6 A;  3CME F;  3C9S A;  2R6R 1;  2Z1T A;  4B46 A;  5EO3 A;  5CA1 B;  5HY2 A;  3JAR A;  2Z1F A;  2V9Y A;  3VI6 A;  1DBF A;  2OHW A;  1W59 A;  1PXW A;  3IKE A;  1U40 A;  3F0E A;  1NJI H;  4X1K B;  4O4L A;  1U3L A;  3HKE A;  4PWT A;  5FNV B;  2ALE A;  5JVD B;  1Q82 H;  3E1Y A;  1VQ7 F;  3JAW B;  3J81 M;  1KNK A;  3VCZ A;  5HY1 A;  3RYH A;  4C4W C;  4EI8 A;  5CA1 A;  3WGN A;  2LCA A;  4O4I B;  2ZAU A;  3HKC B;  3UT5 B;  3RE3 A;  5LOV B;  3ZP7 A;  3HKD A;  4C8I A;  3D01 A;  3VO8 A;  1KC8 H;  3N4Z A;  5GIN C;  3IEQ A;  3HKE B;  4BT2 A;  3RYI A;  3KHN A;  5IJ0 A;  1YJN F;  1VQV A;  3I56 F;  2BTQ B;  1VQ6 F;  3S02 A;  1YQN A;  3VYU C;  3FD5 A;  1SZQ A;  1XBI A;  4BT3 A;  3M1X A;  3JAS B;  5JQG A;  5EIB C;  1E7K A;  1W42 A;  1YJ9 F;  4TUY B;  1R1M A;  3JAM M;  5IT9 M;  1RLU A;  2R75 1;  2EWC A;  4YJ2 A;  2KGW A;  5GON A;  3V7Q A;  3CC2 F;  2G9I A;  3OON A;  1KNJ A;  3QHD A;  2HP0 B;  5EB1 B;  3N2K A;  2LBW A;  1K73 H;  4IHJ A;  2VGN A;  2VAM A;  3F0G A;  3GTZ A;  4WBN B;  2RHH A;  3S0W A;  3VYT C;  1JY8 A;  3VMF B;  1TVK B;  2Z1U A;  3O85 A;  2CSL A;  3NMU C;  1Q8R A;  3V4D A;  3RYC A;  4X20 A;  3FFM A;  4U3J B;  2CHS A;  4DRX A;  3F0D A;  4DXD A;  4LCK A;  3KJK A;  1JFF A;  2HS3 A;  3FBA A;  1W5F A;  3NK7 A;  1FNK A;  1W55 A;  1YGY A;  5EZY A;  2QA4 F;  3WGM A;  2Z01 A;  2N48 A;  5LXT B;  3I3F A;  4BT5 A;  1QAH A;  1X25 A;  3IMP A;  3JCM M;  4YJ3 A;  1N8R H;  2RB9 A;  5JCO A;  3HTN A;  5CA0 A;  1M90 H;  5FJ4 C;  3L7Q A;  5LYJ B;  3I7T A;  5BMV A;  4EB6 B;  3CD6 F;  2KTV A;  5GAN K;  1VH8 A;  5LP6 A;  2NMU A;  3CCM F;  3PAF A;  1W2B F;  4X1I A;  5GAP K;  5EWR A;  3G71 F;  1JJ2 F;  3QUW A;  2KG4 A;  3C9T A;  2CHT A;  4O4H B;  1W5B A;  4YJ2 B;  5LP6 C;  3G4S F;  3CYQ A;  3MCQ A;  4RQO A;  4I50 A;  3N2G A;  3HKB B;  1TUB A;  2RHO A;  4TV8 B;  1UI9 A;  3FD6 A;  2BTU A;  2Q1Y A;  3RA5 A;  3LDT A;  1IV1 A;  1TUB B;  3TD4 A;  3F6M A;  4O4J B;  5EAZ A;  3S0H A;  3LWQ C;  2HRY A;  3RYF B;  1ONI A;  1VQ9 F;  5IYZ B;  2ZF8 A;  5LA6 B;  5C8Y A;  1IV4 A;  3JAL A;  4ZOL B;  3WGK A;  4TUY A;  3GYQ A;  1GZ0 A;  1CLI A;  3KJJ A;  1VQ5 F;  3F0F A;  4M8I A;  2IQQ A;  2CZW A;  1VHA A;  1FFX B;  3D54 A;  1W5A A;  2WAL A;  1CN7 A;  3Q8H A;  1S72 F;  2QEX F;  4BVQ A;  4X3M A;  3CC7 F;  2PHN A;  3DC2 A;  3K0T A;  3CCS F;  3E20 B;  2FGY A;  3JVH A;  1YHQ F;  5KMG A;  1H47 A;  3CPQ A;  3K12 A;  4FFB A;  3IR9 A;  3WPX A;  1COM A;  4BVT A;  2BO1 A;  3LME A;  3U0O A;  2CVL A;  3M4S A;  1VQ4 F;  1YIJ F;  4EI7 A;  2I6R A;  1JD1 A;  3P4E A;  3GHZ A;  4E6E A;  2L26 A;  1KD1 H;  5JVD A;  4O4I A;  5IJ9 A;  3VTI C;  1VQM F;  2JNB A;  2YXZ A;  3LFO A;  5GIO C;  4ZHQ A;  2DT4 A;  3M84 A;  1Z5W A;  3OBY A;  2HX0 A;  3RYH B;  4U39 A;  3IKF A;  1SDS A;  4BVR A;  3N2K B;  1QVG F;  3SIU A;  4R40 B;  5CB4 A;  3HWU A;  3HJW C;  3S06 A;  4O2B A;  5LYJ A;  3CCL F;  3K2X A;  4X1I B;  2AMT A;  5EB0 A;  2PMP A;  5G4V C;  5J2T A;  1U43 A;  5LA6 A;  5ITZ B;  2HP3 A;  4IIJ B;  4B45 A;  4ZHQ B;  2MQE A;  1IV3 A;  3RYI B;  2Z1E A;  2UZH A;  3E22 A;  2Q1X A;  3ERN A;  1PF5 A;  1IV2 A;  3ZOP A;  1VQK F;  4ZHW A;  2OZB A;  4I50 B;  5LXT A;  3CC4 F;  3ZO8 A;  3ELC A;  5HP8 A;  3V7E A;  3B6N A;  2RHL A;  4TV9 A;  3JAK A;  5MN4 A;  4O2B B;  3CCJ F;  5IJ9 B;  2B33 A;  2K1S A;  3JAT B;  4WBN A;  3C9U A;  1W40 A;  3N2G B;  3HKB A;  1W41 A;  3HKD B;  5A2Q M;  2GVI A;  1YI2 F;  1CK2 A;  2CWJ A;  1J7H A;  3WJP A;  3ZP4 A;  5GON B;  5MN5 A;  4ERH A;  1VQL F;  1H7M A;  1RA4 A;  3WPW A;  2DYY A;  3IEW A;  3VOA A;  3VYS C;  1FSZ A;  3WJQ A;  5HWE A;  1Z5V A;  4TZZ A;  3E22 B;  2ZOD A;  4IIJ A;  3MCA B;  1FNJ A;  2VGM A;  3MQW A;  1X7O A;  2VXY A;  1QU9 A;  3C8L A;  3P10 A;  5KX5 B;  2UYP A;  3R0P A;  2CW4 A;  4EB6 A;  1GO0 A;  2UYJ A;  3BYQ A;  3AGK A;  2OTL F;  3I55 F;  3MDO A;  3RYF A;  1TVK A;  3LWP C;  2BTO A;  1SA0 A;  5HXZ A;  3VIU A;  3EOR A;  2AIZ P;  4HNA B;  3CCQ F;  1K9M H;  4BT7 A;  1IPA A;  4U3J A;  5CB4 B;  1T0A A;  4LNU B;  3KE1 A;  4G4X A;  4ZI7 B;  1X52 A;  2RHJ A;  3CCU F;  2HQS C;  5JCO C;  2GLZ A;  1W5E A;  3JAS A;  3V3T A;  2H6L A;  2IG8 A;  2QTP A;  5HXU A;  5JQG B;  2W8B C;  3WGL A;  4G4Y A;  4O2A A;  3JAK B;  1YJW F;  1VQO F;  4TV8 A;  4X1K A;  2ZVY A;  5KX5 A;  4C8G A;  1KQS F;  1JN1 A;  3JAT A;  1QVF F;  4I4T A;  5DCV A;  4G4V A;  3ESJ A;  5CA0 B;  1XRG A;  1VQN F;  3NK6 A;  4C81 A;  4I55 B;  4EI9 A;  3RYC B;  3CYP B;  3P0Z A;  5LP6 B;  4B62 A;  3T80 A;  3NVI B;  1JFF B;  3CB2 A;  5EYP A;  4X20 B;  1U3P A;  4NWO B;  3NVK E;  1W57 A;  4BW0 B;  1Q86 H;  1VQ8 F;  3OBW A;  2HP0 A;  2AIF A;  3SIV A;  2H8E A;  5B8F A;  2IAF A;  1GX1 A;  4O2A B;  5EIB D;  3LYB A;  2UYN B;  3OW2 F;  1W3E X;  5J2U B;  4ZK7 A;  4BT4 A;  1DT9 A;  4G4Z A;  3VOB A;  1M1K H;  2ZVZ A;  3JAW A;  3LWV C;  3J80 M;  2HS0 A;  4NQ3 A;  2UYN A;  3C9R A;  3WGJ A;  3FPI A;  1Q7Y H;  1RQ2 A;  4O4H A;  3N4Y A;  3CCR F;  2QI2 A;  4HNA A;  1ZWZ A;  1FFX A;  2LBX A;  4G4W A;  4O4L B;  4BVS A;  5ITZ A;  1VK3 A;  4B5C A;  3RA6 A;  1NMU B;  2F9Z C;  1RLG A;  1Q81 H;  1QD9 A;  4C82 A;  4F6R B;  4ZHV A;  3LWO C;  3JAL B;  4ZOL A;  3LWR C;  4LNU A;  2VAW A;  3JAR B;  3S03 A;  1X7P A;  2HRU A;  1XHO A;  4XCQ A;  1ODE A;  2UYK A;  3TD3 A;  1VQP F;  4DRX B;  4YJ3 B;  3CCV F;  3CXC F;  5J2T B;  1NQ3 A;  2KTU A;  3CMA F;  1SA0 B;  5HY0 A;  3WJR A;  5LOV A;  4I55 A;  1XV2 A; 
#chains in the Genus database with same CATH homology
 2W8B C;  2MQE A;  2LCA A;  4G4Y A;  4ERH A;  4G4W A;  3LDT A;  1OAP A;  3TD4 A;  3WPW A;  4B5C A;  2ZVY A;  1R1M A;  3TD5 A;  4ZHW A;  4ZHV A;  4G88 A;  4R40 B;  3WPX A;  3S0W A;  5EAZ A;  2AIZ P;  2LBT A;  3IMP A;  3S0H A;  2KGW A;  3S03 A;  4G4V A;  3S06 A;  4RHA A;  4PWT A;  2K1S A;  3TD3 A;  2ZF8 A;  3S0Y A;  3OON A;  2ZOV A;  3KHN A;  3CYQ A;  5EB1 B;  4G4Z A;  2N48 A;  4G4X A;  3CYP B;  3S02 A;  2ZVZ A;  5EB0 A;  4ZHY B;  2HQS C;  2L26 A;  4B62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...