3KHNA

Crystal structure of putative motb like protein dvu_2228 from desulfovibrio vulgaris.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
162
Chain Sequence
RLQRELIEAQRQTYNEMRTYFTVNGVEGVIGAVFDEGVITLRVPSEVLFAPGAVELAPGADRVLATLKDLFIRRREQNINIKGFTDDVQPSANARFKDNWEVSALRSVNVLRYFLGAGIEPARLTATGLGELDPLFPNTSDENRARNRRVEFVLEREGHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords MotB protein, putative
publication title Crystal structure of putative MotB like protein DVU_2228 from Desulfovibrio vulgaris
rcsb
source organism Desulfovibrio vulgaris str. hildenborough
total genus 54
structure length 162
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3khnA00
2LCAA 3CYPB 5EB1B 4ERHA 4G4WA 2LBTA 3S0WA 1R1MA 3KHNA 3CYQA 4PWTA 2ZVYA 2AIZP 3S0HA 4B5CA 2ZOVA 1OAPA 3TD3A 3S06A 4ZHVA 2ZVZA 2HQSC 3TD4A 3OONA 2N48A 4ZHYB 3S02A 3IMPA 4G4ZA 3WPWA 4ZHWA 5EAZA 4G4XA 4RHAA 4R40B 2KGWA 2K1SA 5EB0A 3TD5A 4G4VA 4G88A 3WPXA 2ZF8A 4G4YA 3S0YA 2W8BC 3S03A 2MQEA 3LDTA 2L26A 4B62A
chains in the Genus database with same CATH superfamily
5HY0A 2VAPA 4O4HA 2LBTA 2BTUA 5JQGB 1NJIH 3K0TA 4TZZA 3GYQA 4X1IB 3LWPC 3TD4A 3F6MA 5GONA 1K9MH 4LNUB 3E22B 1CLIA 1W5AA 2IQQA 3JALA 4C4WC 2YXZA 1S72F 2HP3A 3ZP4A 1X52A 2IG8A 5EZYA 2Z1UA 1TUBA 5B8FA 5LYJB 1IPAA 3N2KA 4U3JB 1YGYA 4DRXB 4I4TB 3VOAA 5HY1A 5FNVA 1Z5WA 3N2GB 3I56F 4ZHVA 1XRGA 2ZVZA 3CCVF 2VAMA 3F0DA 3VYSC 3WGNA 3NVIB 1CN7A 4KWEA 1VQ5F 2ZAUA 1KQSF 3NK6A 2CVLA 4ZOLA 4IHJA 4NQ3A 1VQ6F 3JAKB 2KGWA 3JARB 5IJ9B 3HKDB 3P10A 3WGJA 2AMTA 4X1KA 3QUWA 4TV9B 4X3MA 2MQEA 4BVQA 5G4VC 5LP6B 4FFBB 1X7OA 5EYPA 4X20A 2UYPA 3L7QA 3RYIB 3WGKA 3VIUA 5G4UC 1W59A 1VH8A 1VQVA 1OAPA 3KJJA 3DC2A 2UYNB 3C9TA 1GX1A 4O4JB 4TV8A 3J7AR 3JATA 3JAMM 1YQNA 3Q8HA 4G4XA 5LXTB 3IR9A 2BTOA 3CC4F 5MN5A 4B46A 5J2UB 3HKCB 3EORA 3T80A 3F0GA 2HS4A 3RE3A 3LDTA 2WALA 3CXCF 3VCZA 1X7PA 3CCUF 2LBWA 4BVRA 1H48A 4ERHA 5IYZA 5GINC 4X1IA 5HY4A 3ESJA 4I50B 3CMEF 1W55A 3PAFA 4X1YB 3CG6A 3VO8A 3C9UA 2P6YA 2YYEA 1SA0A 2HS0A 4I55A 2Z1EA 3R0PA 4ZHYB 5ITZB 1VQMF 1W41A 2KTVA 1UFYA 5HXUA 1IV1A 5LYJA 2Z1TA 4U3JA 4DRXA 3I7TA 4TUYB 5CB4B 3UT5B 3WPXA 2KTUA 3BYQA 1Q86H 3ELCA 2RHJA 3HTNA 3M1XA 5J2TB 3CCLF 5LA6B 5BMVA 2H8EA 4BT5A 2Z1FA 4BT2A 4U39A 2FGYA 4C81A 2HRYA 5HWEA 3NMUC 3CYQA 1COMA 2AIZP 2ZOVA 2VGNA 3WJPA 4C82A 1DT9A 5IJ9A 1E7KA 1FNKA 3RYFB 2HQSC 1RLUA 2N48A 3WPWA 3FD5A 4ZHWA 2DT4A 3G71F 1RQ2A 1OFUA 1RA4A 1K73H 1DBFA 3D54A 5LP6A 4FFBA 5KX5B 1W581 3CCEF 1VQ8F 3TD5A 3VTIC 3SIVA 3AGKA 4O2AB 1TVKB 2AIFA 4IIJB 3RYHB 3CMAF 3B6NA 3M4SA 1VQPF 1NMUB 2Z01A 5GIOC 2LCAA 2OTLF 1KD1H 3HKEA 3JVHA 1GZ0A 1R1MA 4ZI7A 3K14A 4F6RA 3FPIA 3JASA 3O85A 1XBIA 3I55F 5HP8A 1J7HA 3HKCA 4YJ2B 4YJ3B 4BY9D 3S02A 2CSLA 3P4EA 4BT6A 3HAXD 1YJNF 2OTJF 1W2BF 1QVGF 3VYUC 5CA1A 5LOVB 1RQ7A 1PF5A 1FFXB 4I50A 3JCMM 3D01A 4X1YA 1JFFB 4LCKA 5EO3A 3LFOA 1W40A 3CC7F 4BVTA 5MN4A 5IJ0B 1YIJF 4O4LA 1KC8H 3N4ZA 3RA6A 5JH7B 3IKEA 5HXZA 4EI8A 5GIPC 1T0KB 5EIBD 5LA6A 5JCOA 3HKBA 3J81M 4WBNB 2CHTA 4ZHQB 2GZLA 4EB6B 2VGMA 5FLXM 3JAWB 3OBYA 3K2XA 3F0FA 5C8YB 3CCRF 2VXYA 3IEQA 4B5CA 1VQ9F 1KNJA 2CZWA 2H8CA 5JVDB 4HNAA 2HVYD 2HRUA 2HP0A 5KX5A 3CCJF 1GO0A 1IV4A 3IMPA 5KMGB 1W57A 3DDNA 2RB9A 2JNBA 5EWRA 3RYCB 2OTMA 2K1SA 5EB0A 1X25A 1VQOF 4O2BB 2UZHA 4G4VA 5JQGA 4RQOA 2R6R1 1JY8A 3WJRA 2EWCA 3OBWA 2QEXF 3MQWA 3CYPB 5HP7A 2DYYA 3V3TA 2OHWA 2NMUA 5GAPK 3FBAA 1ZWZA 4LNUA 4ZK7A 3E22A 3C8LA 3C9RA 1W5FA 3S06A 4O4HB 3VMFB 3CCMF 2RHOA 1W42A 3MCQA 4B45A 1Q7YH 4O4IB 3M84A 5EAZA 4RHAA 1VQLF 3HWUA 1ONIA 3GHZA 3JALB 4I4TA 5GANK 1NQ3A 3N2GA 1JN1A 4BT4A 4B62A 5MN6A 3ZP7A 1TUBB 3WGMA 3CPWF 3N2KB 2I6RA 5CA0B 2RHLA 1GO1A 3JAKA 3JARA 2G9IA 3HKDA 3FD6A 1QVFF 4WBNA 4G4ZA 1SDSA 1U3LA 3CC2F 4TV9A 1IV2A 3V7QA 2ALEA 3JAWA 4ZOLB 4IHJB 3RYIA 3U0OA 4X3LA 2L26A 1QD9A 3CCQF 3HJWC 3CPQA 3S0WA 2UYNA 3G6EF 4X1KB 4O4JA 3E20B 5FJ4C 1U40A 5KMGA 5IT9M 4M8IA 4DXDA 1KNKA 5EYPB 4X20B 2RHHA 5LXTA 1H7MA 5J2UA 3G4SF 1Q8RA 3GTZA 3V7EA 4BW0B 4NWOB 2UYJA 1QAHA 2HX0A 4BVSA 5HY2A 2F9ZC 2QA4F 1JJ2F 1Q81H 2BTQB 3LWQC 2W8BC 3P0ZA 3QHDA 3MBMA 2CHSA 4BT7A 4C8GA 3V4DA 5LP6C 2QI2A 3KHNA 1M1KH 4O4IA 5ITZA 1ODEA 5IYZB 3J80M 2QTPA 4XCQA 3NVKE 4EI7A 3D00A 4BT3A 2KG4A 4TUYA 3OW2F 3LYBA 5CB4A 3UT5A 1SA0B 4I55B 5J2TA 3IKFA 1FSZA 1YHQF 5DCVA 2PHNA 3LWOC 3VI6A 5CA0A 3CD6F 5EIBC 3I3FA 1W5EA 3RYFA 5BMVB 1T0AA 1YJ9F 3TD3A 4NUTA 3VOBA 2R751 1CK2A 3ON1A 1XV2A 4O2AA 1TVKA 4IIJA 3RA5A 3F0EA 3RYHA 1K8AH 3SIUA 3PLAC 4G88A 3LWVC 3C9SA 2GLZA 4G4YA 3S0YA 2CWJA 1M90H 1N8RH 3IEWA 1W5BA 5A2QM 2Q1YA 5JCOC 2BO1A 3CCSF 2B33A 4YJ3A 4YJ2A 2ZVYA 1Q82H 3S0HA 2IAFA 1SZQA 3N4YA 1UI9A 1U3PA 3WXMB 1RLGA 5AVMA 3HKEB 2V9YA 1JD1A 4ZI7B 1Z5VA 1VQKF 4F6RB 5LOVA 3JASB 1FFXA 3ZOPA 2CW4A 1JFFA 1VHAA 5GONB 5IJ0A 3ERNA 1VK3A 1VQ4F 3MDOA 5CA1B 5JH7A 4G4WA 1YJWF 1IV3A 5EZYB 4PWTA 1H47A 2Q1XA 1XHOA 4O4LB 2H6LA 5FNVB 2UYKA 2PMPA 1YI2F 2I6DA 4R40B 4C8IA 4ZHQA 3QTYA 3ZO8A 4EB6A 3E1YA 4E6EA 3VYTC 2ZF8A 3S03A 5C8YA 3WJQA 2VAWA 3NK7A 5EB1B 3HKBB 2HS3A 3LWRC 5JVDA 3FFMA 1VQ7F 1YITF 1QU9A 2FC3A 3WGLA 2ZODA 1FNJA 3K12A 3RYCA 4C8EA 3OONA 4O2BA 3CB2A 3KE1A 4EI9A 3LMEA 2OZBA 3KIZA 1W3EX 2LBXA 3MCAB 4HNAB 2HP0B 4TV8B 3JATB 2GVIA 1PXWA 1VQNF 3KJKA 1U43A
chains in the Genus database with same CATH topology
2LCAA 3CYPB 5EB1B 4ERHA 4G4WA 2LBTA 3S0WA 1R1MA 3KHNA 3CYQA 4PWTA 2ZVYA 2AIZP 3S0HA 4B5CA 2ZOVA 1OAPA 3TD3A 3S06A 4ZHVA 2ZVZA 2HQSC 3TD4A 3OONA 2N48A 4ZHYB 3S02A 3IMPA 4G4ZA 3WPWA 4ZHWA 5EAZA 4G4XA 4RHAA 4R40B 2KGWA 2K1SA 5EB0A 3TD5A 4G4VA 4G88A 3WPXA 2ZF8A 4G4YA 3S0YA 2W8BC 3S03A 2MQEA 3LDTA 2L26A 4B62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LCA A;  3CYP B;  5EB1 B;  4ERH A;  4G4W A;  2LBT A;  3S0W A;  1R1M A;  3KHN A;  3CYQ A;  4PWT A;  2ZVY A;  2AIZ P;  3S0H A;  4B5C A;  2ZOV A;  1OAP A;  3TD3 A;  3S06 A;  4ZHV A;  2ZVZ A;  2HQS C;  3TD4 A;  3OON A;  2N48 A;  4ZHY B;  3S02 A;  3IMP A;  4G4Z A;  3WPW A;  4ZHW A;  5EAZ A;  4G4X A;  4RHA A;  4R40 B;  2KGW A;  2K1S A;  5EB0 A;  3TD5 A;  4G4V A;  4G88 A;  3WPX A;  2ZF8 A;  4G4Y A;  3S0Y A;  2W8B C;  3S03 A;  2MQE A;  3LDT A;  2L26 A;  4B62 A; 
#chains in the Genus database with same CATH topology
 5HY0 A;  2VAP A;  4O4H A;  2LBT A;  2BTU A;  5JQG B;  1NJI H;  3K0T A;  4TZZ A;  3GYQ A;  4X1I B;  3LWP C;  3TD4 A;  3F6M A;  5GON A;  1K9M H;  4LNU B;  3E22 B;  1CLI A;  1W5A A;  2IQQ A;  3JAL A;  4C4W C;  2YXZ A;  1S72 F;  2HP3 A;  3ZP4 A;  1X52 A;  2IG8 A;  5EZY A;  2Z1U A;  1TUB A;  5B8F A;  5LYJ B;  1IPA A;  3N2K A;  4U3J B;  1YGY A;  4DRX B;  4I4T B;  3VOA A;  5HY1 A;  5FNV A;  1Z5W A;  3N2G B;  3I56 F;  4ZHV A;  1XRG A;  2ZVZ A;  3CCV F;  2VAM A;  3F0D A;  3VYS C;  3WGN A;  3NVI B;  1CN7 A;  4KWE A;  1VQ5 F;  2ZAU A;  1KQS F;  3NK6 A;  2CVL A;  4ZOL A;  4IHJ A;  4NQ3 A;  1VQ6 F;  3JAK B;  2KGW A;  3JAR B;  5IJ9 B;  3HKD B;  3P10 A;  3WGJ A;  2AMT A;  4X1K A;  3QUW A;  4TV9 B;  4X3M A;  2MQE A;  4BVQ A;  5G4V C;  5LP6 B;  4FFB B;  1X7O A;  5EYP A;  4X20 A;  2UYP A;  3L7Q A;  3RYI B;  3WGK A;  3VIU A;  5G4U C;  1W59 A;  1VH8 A;  1VQV A;  1OAP A;  3KJJ A;  3DC2 A;  2UYN B;  3C9T A;  1GX1 A;  4O4J B;  4TV8 A;  3J7A R;  3JAT A;  3JAM M;  1YQN A;  3Q8H A;  4G4X A;  5LXT B;  3IR9 A;  2BTO A;  3CC4 F;  5MN5 A;  4B46 A;  5J2U B;  3HKC B;  3EOR A;  3T80 A;  3F0G A;  2HS4 A;  3RE3 A;  3LDT A;  2WAL A;  3CXC F;  3VCZ A;  1X7P A;  3CCU F;  2LBW A;  4BVR A;  1H48 A;  4ERH A;  5IYZ A;  5GIN C;  4X1I A;  5HY4 A;  3ESJ A;  4I50 B;  3CME F;  1W55 A;  3PAF A;  4X1Y B;  3CG6 A;  3VO8 A;  3C9U A;  2P6Y A;  2YYE A;  1SA0 A;  2HS0 A;  4I55 A;  2Z1E A;  3R0P A;  4ZHY B;  5ITZ B;  1VQM F;  1W41 A;  2KTV A;  1UFY A;  5HXU A;  1IV1 A;  5LYJ A;  2Z1T A;  4U3J A;  4DRX A;  3I7T A;  4TUY B;  5CB4 B;  3UT5 B;  3WPX A;  2KTU A;  3BYQ A;  1Q86 H;  3ELC A;  2RHJ A;  3HTN A;  3M1X A;  5J2T B;  3CCL F;  5LA6 B;  5BMV A;  2H8E A;  4BT5 A;  2Z1F A;  4BT2 A;  4U39 A;  2FGY A;  4C81 A;  2HRY A;  5HWE A;  3NMU C;  3CYQ A;  1COM A;  2AIZ P;  2ZOV A;  2VGN A;  3WJP A;  4C82 A;  1DT9 A;  5IJ9 A;  1E7K A;  1FNK A;  3RYF B;  2HQS C;  1RLU A;  2N48 A;  3WPW A;  3FD5 A;  4ZHW A;  2DT4 A;  3G71 F;  1RQ2 A;  1OFU A;  1RA4 A;  1K73 H;  1DBF A;  3D54 A;  5LP6 A;  4FFB A;  5KX5 B;  1W58 1;  3CCE F;  1VQ8 F;  3TD5 A;  3VTI C;  3SIV A;  3AGK A;  4O2A B;  1TVK B;  2AIF A;  4IIJ B;  3RYH B;  3CMA F;  3B6N A;  3M4S A;  1VQP F;  1NMU B;  2Z01 A;  5GIO C;  2LCA A;  2OTL F;  1KD1 H;  3HKE A;  3JVH A;  1GZ0 A;  1R1M A;  4ZI7 A;  3K14 A;  4F6R A;  3FPI A;  3JAS A;  3O85 A;  1XBI A;  3I55 F;  5HP8 A;  1J7H A;  3HKC A;  4YJ2 B;  4YJ3 B;  4BY9 D;  3S02 A;  2CSL A;  3P4E A;  4BT6 A;  3HAX D;  1YJN F;  2OTJ F;  1W2B F;  1QVG F;  3VYU C;  5CA1 A;  5LOV B;  1RQ7 A;  1PF5 A;  1FFX B;  4I50 A;  3JCM M;  3D01 A;  4X1Y A;  1JFF B;  4LCK A;  5EO3 A;  3LFO A;  1W40 A;  3CC7 F;  4BVT A;  5MN4 A;  5IJ0 B;  1YIJ F;  4O4L A;  1KC8 H;  3N4Z A;  3RA6 A;  5JH7 B;  3IKE A;  5HXZ A;  4EI8 A;  5GIP C;  1T0K B;  5EIB D;  5LA6 A;  5JCO A;  3HKB A;  3J81 M;  4WBN B;  2CHT A;  4ZHQ B;  2GZL A;  4EB6 B;  2VGM A;  5FLX M;  3JAW B;  3OBY A;  3K2X A;  3F0F A;  5C8Y B;  3CCR F;  2VXY A;  3IEQ A;  4B5C A;  1VQ9 F;  1KNJ A;  2CZW A;  2H8C A;  5JVD B;  4HNA A;  2HVY D;  2HRU A;  2HP0 A;  5KX5 A;  3CCJ F;  1GO0 A;  1IV4 A;  3IMP A;  5KMG B;  1W57 A;  3DDN A;  2RB9 A;  2JNB A;  5EWR A;  3RYC B;  2OTM A;  2K1S A;  5EB0 A;  1X25 A;  1VQO F;  4O2B B;  2UZH A;  4G4V A;  5JQG A;  4RQO A;  2R6R 1;  1JY8 A;  3WJR A;  2EWC A;  3OBW A;  2QEX F;  3MQW A;  3CYP B;  5HP7 A;  2DYY A;  3V3T A;  2OHW A;  2NMU A;  5GAP K;  3FBA A;  1ZWZ A;  4LNU A;  4ZK7 A;  3E22 A;  3C8L A;  3C9R A;  1W5F A;  3S06 A;  4O4H B;  3VMF B;  3CCM F;  2RHO A;  1W42 A;  3MCQ A;  4B45 A;  1Q7Y H;  4O4I B;  3M84 A;  5EAZ A;  4RHA A;  1VQL F;  3HWU A;  1ONI A;  3GHZ A;  3JAL B;  4I4T A;  5GAN K;  1NQ3 A;  3N2G A;  1JN1 A;  4BT4 A;  4B62 A;  5MN6 A;  3ZP7 A;  1TUB B;  3WGM A;  3CPW F;  3N2K B;  2I6R A;  5CA0 B;  2RHL A;  1GO1 A;  3JAK A;  3JAR A;  2G9I A;  3HKD A;  3FD6 A;  1QVF F;  4WBN A;  4G4Z A;  1SDS A;  1U3L A;  3CC2 F;  4TV9 A;  1IV2 A;  3V7Q A;  2ALE A;  3JAW A;  4ZOL B;  4IHJ B;  3RYI A;  3U0O A;  4X3L A;  2L26 A;  1QD9 A;  3CCQ F;  3HJW C;  3CPQ A;  3S0W A;  2UYN A;  3G6E F;  4X1K B;  4O4J A;  3E20 B;  5FJ4 C;  1U40 A;  5KMG A;  5IT9 M;  4M8I A;  4DXD A;  1KNK A;  5EYP B;  4X20 B;  2RHH A;  5LXT A;  1H7M A;  5J2U A;  3G4S F;  1Q8R A;  3GTZ A;  3V7E A;  4BW0 B;  4NWO B;  2UYJ A;  1QAH A;  2HX0 A;  4BVS A;  5HY2 A;  2F9Z C;  2QA4 F;  1JJ2 F;  1Q81 H;  2BTQ B;  3LWQ C;  2W8B C;  3P0Z A;  3QHD A;  3MBM A;  2CHS A;  4BT7 A;  4C8G A;  3V4D A;  5LP6 C;  2QI2 A;  3KHN A;  1M1K H;  4O4I A;  5ITZ A;  1ODE A;  5IYZ B;  3J80 M;  2QTP A;  4XCQ A;  3NVK E;  4EI7 A;  3D00 A;  4BT3 A;  2KG4 A;  4TUY A;  3OW2 F;  3LYB A;  5CB4 A;  3UT5 A;  1SA0 B;  4I55 B;  5J2T A;  3IKF A;  1FSZ A;  1YHQ F;  5DCV A;  2PHN A;  3LWO C;  3VI6 A;  5CA0 A;  3CD6 F;  5EIB C;  3I3F A;  1W5E A;  3RYF A;  5BMV B;  1T0A A;  1YJ9 F;  3TD3 A;  4NUT A;  3VOB A;  2R75 1;  1CK2 A;  3ON1 A;  1XV2 A;  4O2A A;  1TVK A;  4IIJ A;  3RA5 A;  3F0E A;  3RYH A;  1K8A H;  3SIU A;  3PLA C;  4G88 A;  3LWV C;  3C9S A;  2GLZ A;  4G4Y A;  3S0Y A;  2CWJ A;  1M90 H;  1N8R H;  3IEW A;  1W5B A;  5A2Q M;  2Q1Y A;  5JCO C;  2BO1 A;  3CCS F;  2B33 A;  4YJ3 A;  4YJ2 A;  2ZVY A;  1Q82 H;  3S0H A;  2IAF A;  1SZQ A;  3N4Y A;  1UI9 A;  1U3P A;  3WXM B;  1RLG A;  5AVM A;  3HKE B;  2V9Y A;  1JD1 A;  4ZI7 B;  1Z5V A;  1VQK F;  4F6R B;  5LOV A;  3JAS B;  1FFX A;  3ZOP A;  2CW4 A;  1JFF A;  1VHA A;  5GON B;  5IJ0 A;  3ERN A;  1VK3 A;  1VQ4 F;  3MDO A;  5CA1 B;  5JH7 A;  4G4W A;  1YJW F;  1IV3 A;  5EZY B;  4PWT A;  1H47 A;  2Q1X A;  1XHO A;  4O4L B;  2H6L A;  5FNV B;  2UYK A;  2PMP A;  1YI2 F;  2I6D A;  4R40 B;  4C8I A;  4ZHQ A;  3QTY A;  3ZO8 A;  4EB6 A;  3E1Y A;  4E6E A;  3VYT C;  2ZF8 A;  3S03 A;  5C8Y A;  3WJQ A;  2VAW A;  3NK7 A;  5EB1 B;  3HKB B;  2HS3 A;  3LWR C;  5JVD A;  3FFM A;  1VQ7 F;  1YIT F;  1QU9 A;  2FC3 A;  3WGL A;  2ZOD A;  1FNJ A;  3K12 A;  3RYC A;  4C8E A;  3OON A;  4O2B A;  3CB2 A;  3KE1 A;  4EI9 A;  3LME A;  2OZB A;  3KIZ A;  1W3E X;  2LBX A;  3MCA B;  4HNA B;  2HP0 B;  4TV8 B;  3JAT B;  2GVI A;  1PXW A;  1VQN F;  3KJK A;  1U43 A; 
#chains in the Genus database with same CATH homology
 2LCA A;  3CYP B;  5EB1 B;  4ERH A;  4G4W A;  2LBT A;  3S0W A;  1R1M A;  3KHN A;  3CYQ A;  4PWT A;  2ZVY A;  2AIZ P;  3S0H A;  4B5C A;  2ZOV A;  1OAP A;  3TD3 A;  3S06 A;  4ZHV A;  2ZVZ A;  2HQS C;  3TD4 A;  3OON A;  2N48 A;  4ZHY B;  3S02 A;  3IMP A;  4G4Z A;  3WPW A;  4ZHW A;  5EAZ A;  4G4X A;  4RHA A;  4R40 B;  2KGW A;  2K1S A;  5EB0 A;  3TD5 A;  4G4V A;  4G88 A;  3WPX A;  2ZF8 A;  4G4Y A;  3S0Y A;  2W8B C;  3S03 A;  2MQE A;  3LDT A;  2L26 A;  4B62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...