3KHNA

Crystal structure of putative motb like protein dvu_2228 from desulfovibrio vulgaris.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
162
Chain Sequence
RLQRELIEAQRQTYNEMRTYFTVNGVEGVIGAVFDEGVITLRVPSEVLFAPGAVELAPGADRVLATLKDLFIRRREQNINIKGFTDDVQPSANARFKDNWEVSALRSVNVLRYFLGAGIEPARLTATGLGELDPLFPNTSDENRARNRRVEFVLEREGHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MotB protein, putative
publication title Crystal structure of putative MotB like protein DVU_2228 from Desulfovibrio vulgaris
rcsb
source organism Desulfovibrio vulgaris str. hildenborough
molecule tags Structural genomics, unknown function
total genus 54
structure length 162
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3khnA00
3KHNA 5EB0A 2KGWA 4ERHA 4ZHVA 3CYPB 3WPWA 4B5CA 4G4ZA 3S0YA 1OAPA 3S02A 3WPXA 3S06A 3S0WA 4PWTA 4B62A 2LCAA 3TD5A 4G4XA 2ZOVA 5EAZA 2N48A 4G4WA 2ZVZA 2ZF8A 4G88A 3LDTA 2HQSC 4ZHYB 2ZVYA 2K1SA 5EB1B 4G4VA 3CYQA 2AIZP 3TD3A 4G4YA 3S03A 3TD4A 3OONA 4RHAA 2LBTA 3S0HA 1R1MA 2L26A 4ZHWA 2W8BC 4R40B 2MQEA 3IMPA
chains in the Genus database with same CATH superfamily
5CA0A 2KGWA 4ERHA 4BT3A 1JD1A 2EWCA 4C8EA 3J81M 1VHAA 5LP6B 3IEWA 1W2BF 4B62A 4LCKA 3KJKA 5FJ4C 4O4IA 4X1YB 5KMGA 1W3EX 2HQSC 3JARB 4X1KA 2KG4A 4XCQA 2AIFA 2UYNA 3ESJA 1YGYA 5FNVB 4O4HB 4O4LB 2KTUA 5EIBC 3QTYA 1W40A 1VQ7F 3DDNA 3RYFA 3LFOA 3KIZA 5LP6C 5LOVA 5LP6A 1TVKA 1CLIA 3I3FA 4TV9A 4YJ2B 4G4ZA 3S0YA 2OZBA 1IV4A 2GLZA 3ZP4A 1VQ4F 4ZI7A 4BVRA 3RYCA 3FD6A 2HP3A 4U3JA 5DCVA 3CB2A 2UYKA 4I50A 5LXTB 3JAMM 4KWEA 2H8CA 4EB6B 4F6RA 4WBNB 3OONA 2I6DA 3S0HA 3VO8A 5GIPC 2UYPA 4BT2A 2BTQB 1K9MH 2HX0A 1CK2A 4BT6A 1OFUA 5JCOC 3CCVF 3DC2A 3HWUA 5JCOA 5JH7A 3CMAF 1YITF 3VYSC 3IKFA 4BW0B 3HJWC 4O2BB 5FLXM 3KJJA 5LXTA 3D54A 2CVLA 3LWRC 2G9IA 1YJ9F 5G4UC 1XHOA 4I55B 4I4TB 1VQOF 5C8YA 2CW4A 1ONIA 3VIUA 2HS4A 1W5AA 2B33A 3CC4F 4DRXA 3FPIA 1NQ3A 3CPQA 1YIJF 3K2XA 1DT9A 3S02A 4HNAA 3N2GA 4O4JB 4LNUB 5CA1A 1JN1A 3CCEF 4ZHQA 5JVDB 2GZLA 3FFMA 3O85A 2QTPA 2RHJA 4I55A 4ZHYB 1H47A 1W42A 3HKBB 3CCRF 1VQ5F 3SIUA 4BY9D 3E22A 1QD9A 2FGYA 2HP0B 4IIJB 3FD5A 3OBYA 3JAWA 3IMPA 2F9ZC 5GIOC 3RA6A 3AGKA 5J2UA 5JVDA 4M8IA 1N8RH 1GO0A 1M90H 3F0GA 2Z1TA 5GAPK 4G4WA 3LMEA 3WXMB 2UYJA 3P4EA 1VQKF 2DYYA 4BT5A 3IR9A 4X20B 1IV1A 3P10A 4C8GA 3JATA 3M84A 2OTLF 4C8IA 3E20B 3JASB 3KHNA 3QUWA 4X3LA 3M1XA 2OTMA 5IJ9A 3IEQA 1PF5A 3UT5B 4TZZA 3RYHA 3S06A 4PWTA 2AMTA 2CSLA 5EZYB 1XRGA 5ITZA 3G71F 3RYIA 3HKCB 2CHSA 3VCZA 5BMVB 5CB4B 2OTJF 5IJ0A 3M4SA 5GANK 1W59A 3PAFA 3WGMA 1XV2A 1RA4A 1Q86H 3GTZA 3VYUC 4U39A 3JAKA 2NMUA 2PMPA 3I56F 3K14A 1T0KB 1JFFB 3K0TA 3CCQF 2FC3A 3SIVA 3CCJF 1GZ0A 1FNJA 1VQ9F 2CZWA 3ELCA 1U40A 3CG6A 1PXWA 3T80A 4ZOLB 5HY0A 2VAMA 1VQ6F 3ZO8A 3JCMM 4X1YA 5CB4A 2LBWA 3K12A 3JARA 2N48A 3IKEA 2ZF8A 2V9YA 5FNVA 1QU9A 4O4HA 4O4LA 5MN5A 1JFFA 4IHJB 4BVQA 5LA6B 2LBTA 2Z01A 4ZHVA 3F6MA 4YJ2A 4ZOLA 1VQNF 3R0PA 3S0WA 5HY1A 4NQ3A 1K8AH 2CHTA 3P0ZA 2H6LA 3ZOPA 2ZOVA 4B46A 1FFXB 3CMEF 1IPAA 3CCLF 3U0OA 4EB6A 3C8LA 4ZK7A 3JALB 4WBNA 4TV8B 5HXUA 4G4YA 1QVGF 2UZHA 1YI2F 3MCAB 5JQGB 3C9TA 5HP7A 3ERNA 2P6YA 4X1IB 4B45A 3HKEB 3F0DA 2ALEA 4TUYB 1U43A 1W5EA 3JVHA 2KTVA 4EI9A 3V7EA 1M1KH 1VQPF 1KQSF 4O2AB 3C9UA 5EO3A 5IYZB 1JY8A 2R6R1 1YJNF 5J2TB 4O2BA 3HKDB 5EAZA 1VQ8F 1QAHA 4FFBB 4C4WC 4BT7A 5IT9M 1GX1A 4I4TA 3MCQA 2GVIA 5KX5B 5AVMA 3GYQA 4X1IA 3MBMA 2QEXF 3HKEA 2RB9A 1KD1H 1XBIA 4BVTA 5HY2A 4O2AA 2OHWA 1W5BA 3CCMF 1IV2A 1TUBB 4LNUA 1IV3A 4O4JA 1RLGA 3CD6F 1J7HA 5GINC 1YHQF 4G4XA 3CXCF 5HY4A 2DT4A 2ZVZA 3HKBA 2Z1EA 3OBWA 2VXYA 3J80M 1RQ2A 1H48A 3VMFB 2VGNA 2HP0A 3I55F 4IIJA 5MN4A 5EYPB 1X52A 3NK6A 2LBXA 5EIBD 1VQLF 2ZAUA 2YXZA 1X25A 2BTUA 1E7KA 3CYPB 3WGKA 3CC7F 3CCSF 3WPWA 1OAPA 3F0FA 2I6RA 2Q1XA 3RE3A 3G4SF 1W581 2RHHA 3C9SA 4O4IB 3LDTA 3N2KB 1RQ7A 1U3PA 3WJQA 5KMGB 4X20A 5EB1B 1K73H 3D01A 5B8FA 4X1KB 4E6EA 3TD3A 3FBAA 2UYNB 1YQNA 4RHAA 3JASA 1YJWF 2L26A 1UFYA 1U3LA 4R40B 1S72F 3PLAC 5EB0A 3UT5A 5GONB 3RA5A 3RYFB 5LOVB 5EZYA 1TVKB 1T0AA 3ON1A 4YJ3B 3WPXA 2BTOA 4TV9B 1JJ2F 3HKCA 4NWOB 2H8EA 3N2KA 5BMVA 1Q7YH 1SDSA 2Z1UA 4ZI7B 3RYCB 4G88A 1GO1A 1W55A 2ZVYA 2K1SA 4U3JB 3V3TA 3CC2F 2BO1A 1ODEA 2QA4F 1W5FA 1UI9A 3CCUF 4I50B 2HRYA 3I7TA 5HP8A 1Z5WA 5G4VC 3KE1A 4ZHWA 4F6RB 3WJRA 5GONA 1Z5VA 4YJ3A 2VAWA 3VOAA 3ZP7A 1FNKA 2VAPA 4C81A 3TD5A 3J7AR 1NJIH 5JH7B 3NMUC 3E1YA 1KNKA 3VOBA 4RQOA 2CWJA 1SA0B 4IHJA 4EI7A 1Q8RA 5LA6A 1NMUB 2PHNA 1Q82H 3HTNA 3TD4A 4C82A 3EORA 5EWRA 3LWQC 5HWEA 5C8YB 2MQEA 3VTIC 1DBFA 4DRXB 1W57A 2HVYD 2LCAA 3Q8HA 1CN7A 2VGMA 2HRUA 3N2GB 4HNAB 2Q1YA 2HS0A 4BVSA 1FFXA 1SA0A 3BYQA 5CA1B 3LWVC 3F0EA 3N4ZA 4ZHQB 3JALA 4TV8A 4X3MA 5LYJB 4G4VA 3CYQA 5A2QM 5JQGA 3OW2F 2HS3A 3B6NA 3S03A 4TUYA 3E22B 1RLUA 3VYTC 1KC8H 3LWPC 1W41A 4NUTA 3JAWB 5IYZA 5J2TA 1ZWZA 3HKDA 2RHOA 3MDOA 1QVFF 1COMA 3WJPA 3HAXD 1Q81H 1SZQA 5J2UB 4FFBA 3D00A 2QI2A 3WGLA 3C9RA 5LYJA 5HXZA 5KX5A 1VH8A 3V4DA 3GHZA 3NVKE 4EI8A 2AIZP 3VI6A 2IG8A 3LWOC 1H7MA 2WALA 3CPWF 3JATB 4BT4A 5MN6A 1VK3A 1TUBA 2JNBA 3LYBA 3G6EF 2R751 4B5CA 3MQWA 5CA0B 3L7QA 1X7PA 3N4YA 5IJ9B 3WGJA 3WGNA 3RYHB 1VQVA 2IAFA 2ZODA 2Z1FA 3NVIB 5ITZB 3RYIB 3V7QA 3QHDA 3NK7A 2YYEA 5IJ0B 1X7OA 5EYPA 1KNJA 4DXDA 2RHLA 1R1MA 2IQQA 3JAKB 2W8BC 1VQMF 1FSZA
chains in the Genus database with same CATH topology
3KHNA 5EB0A 2KGWA 4ERHA 4ZHVA 3CYPB 3WPWA 4B5CA 4G4ZA 3S0YA 1OAPA 3S02A 3WPXA 3S06A 3S0WA 4PWTA 4B62A 2LCAA 3TD5A 4G4XA 2ZOVA 5EAZA 2N48A 4G4WA 2ZVZA 2ZF8A 4G88A 3LDTA 2HQSC 4ZHYB 2ZVYA 2K1SA 5EB1B 4G4VA 3CYQA 2AIZP 3TD3A 4G4YA 3S03A 3TD4A 3OONA 4RHAA 2LBTA 3S0HA 1R1MA 2L26A 4ZHWA 2W8BC 4R40B 2MQEA 3IMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KHN A;  5EB0 A;  2KGW A;  4ERH A;  4ZHV A;  3CYP B;  3WPW A;  4B5C A;  4G4Z A;  3S0Y A;  1OAP A;  3S02 A;  3WPX A;  3S06 A;  3S0W A;  4PWT A;  4B62 A;  2LCA A;  3TD5 A;  4G4X A;  2ZOV A;  5EAZ A;  2N48 A;  4G4W A;  2ZVZ A;  2ZF8 A;  4G88 A;  3LDT A;  2HQS C;  4ZHY B;  2ZVY A;  2K1S A;  5EB1 B;  4G4V A;  3CYQ A;  2AIZ P;  3TD3 A;  4G4Y A;  3S03 A;  3TD4 A;  3OON A;  4RHA A;  2LBT A;  3S0H A;  1R1M A;  2L26 A;  4ZHW A;  2W8B C;  4R40 B;  2MQE A;  3IMP A; 
#chains in the Genus database with same CATH topology
 5CA0 A;  2KGW A;  4ERH A;  4BT3 A;  1JD1 A;  2EWC A;  4C8E A;  3J81 M;  1VHA A;  5LP6 B;  3IEW A;  1W2B F;  4B62 A;  4LCK A;  3KJK A;  5FJ4 C;  4O4I A;  4X1Y B;  5KMG A;  1W3E X;  2HQS C;  3JAR B;  4X1K A;  2KG4 A;  4XCQ A;  2AIF A;  2UYN A;  3ESJ A;  1YGY A;  5FNV B;  4O4H B;  4O4L B;  2KTU A;  5EIB C;  3QTY A;  1W40 A;  1VQ7 F;  3DDN A;  3RYF A;  3LFO A;  3KIZ A;  5LP6 C;  5LOV A;  5LP6 A;  1TVK A;  1CLI A;  3I3F A;  4TV9 A;  4YJ2 B;  4G4Z A;  3S0Y A;  2OZB A;  1IV4 A;  2GLZ A;  3ZP4 A;  1VQ4 F;  4ZI7 A;  4BVR A;  3RYC A;  3FD6 A;  2HP3 A;  4U3J A;  5DCV A;  3CB2 A;  2UYK A;  4I50 A;  5LXT B;  3JAM M;  4KWE A;  2H8C A;  4EB6 B;  4F6R A;  4WBN B;  3OON A;  2I6D A;  3S0H A;  3VO8 A;  5GIP C;  2UYP A;  4BT2 A;  2BTQ B;  1K9M H;  2HX0 A;  1CK2 A;  4BT6 A;  1OFU A;  5JCO C;  3CCV F;  3DC2 A;  3HWU A;  5JCO A;  5JH7 A;  3CMA F;  1YIT F;  3VYS C;  3IKF A;  4BW0 B;  3HJW C;  4O2B B;  5FLX M;  3KJJ A;  5LXT A;  3D54 A;  2CVL A;  3LWR C;  2G9I A;  1YJ9 F;  5G4U C;  1XHO A;  4I55 B;  4I4T B;  1VQO F;  5C8Y A;  2CW4 A;  1ONI A;  3VIU A;  2HS4 A;  1W5A A;  2B33 A;  3CC4 F;  4DRX A;  3FPI A;  1NQ3 A;  3CPQ A;  1YIJ F;  3K2X A;  1DT9 A;  3S02 A;  4HNA A;  3N2G A;  4O4J B;  4LNU B;  5CA1 A;  1JN1 A;  3CCE F;  4ZHQ A;  5JVD B;  2GZL A;  3FFM A;  3O85 A;  2QTP A;  2RHJ A;  4I55 A;  4ZHY B;  1H47 A;  1W42 A;  3HKB B;  3CCR F;  1VQ5 F;  3SIU A;  4BY9 D;  3E22 A;  1QD9 A;  2FGY A;  2HP0 B;  4IIJ B;  3FD5 A;  3OBY A;  3JAW A;  3IMP A;  2F9Z C;  5GIO C;  3RA6 A;  3AGK A;  5J2U A;  5JVD A;  4M8I A;  1N8R H;  1GO0 A;  1M90 H;  3F0G A;  2Z1T A;  5GAP K;  4G4W A;  3LME A;  3WXM B;  2UYJ A;  3P4E A;  1VQK F;  2DYY A;  4BT5 A;  3IR9 A;  4X20 B;  1IV1 A;  3P10 A;  4C8G A;  3JAT A;  3M84 A;  2OTL F;  4C8I A;  3E20 B;  3JAS B;  3KHN A;  3QUW A;  4X3L A;  3M1X A;  2OTM A;  5IJ9 A;  3IEQ A;  1PF5 A;  3UT5 B;  4TZZ A;  3RYH A;  3S06 A;  4PWT A;  2AMT A;  2CSL A;  5EZY B;  1XRG A;  5ITZ A;  3G71 F;  3RYI A;  3HKC B;  2CHS A;  3VCZ A;  5BMV B;  5CB4 B;  2OTJ F;  5IJ0 A;  3M4S A;  5GAN K;  1W59 A;  3PAF A;  3WGM A;  1XV2 A;  1RA4 A;  1Q86 H;  3GTZ A;  3VYU C;  4U39 A;  3JAK A;  2NMU A;  2PMP A;  3I56 F;  3K14 A;  1T0K B;  1JFF B;  3K0T A;  3CCQ F;  2FC3 A;  3SIV A;  3CCJ F;  1GZ0 A;  1FNJ A;  1VQ9 F;  2CZW A;  3ELC A;  1U40 A;  3CG6 A;  1PXW A;  3T80 A;  4ZOL B;  5HY0 A;  2VAM A;  1VQ6 F;  3ZO8 A;  3JCM M;  4X1Y A;  5CB4 A;  2LBW A;  3K12 A;  3JAR A;  2N48 A;  3IKE A;  2ZF8 A;  2V9Y A;  5FNV A;  1QU9 A;  4O4H A;  4O4L A;  5MN5 A;  1JFF A;  4IHJ B;  4BVQ A;  5LA6 B;  2LBT A;  2Z01 A;  4ZHV A;  3F6M A;  4YJ2 A;  4ZOL A;  1VQN F;  3R0P A;  3S0W A;  5HY1 A;  4NQ3 A;  1K8A H;  2CHT A;  3P0Z A;  2H6L A;  3ZOP A;  2ZOV A;  4B46 A;  1FFX B;  3CME F;  1IPA A;  3CCL F;  3U0O A;  4EB6 A;  3C8L A;  4ZK7 A;  3JAL B;  4WBN A;  4TV8 B;  5HXU A;  4G4Y A;  1QVG F;  2UZH A;  1YI2 F;  3MCA B;  5JQG B;  3C9T A;  5HP7 A;  3ERN A;  2P6Y A;  4X1I B;  4B45 A;  3HKE B;  3F0D A;  2ALE A;  4TUY B;  1U43 A;  1W5E A;  3JVH A;  2KTV A;  4EI9 A;  3V7E A;  1M1K H;  1VQP F;  1KQS F;  4O2A B;  3C9U A;  5EO3 A;  5IYZ B;  1JY8 A;  2R6R 1;  1YJN F;  5J2T B;  4O2B A;  3HKD B;  5EAZ A;  1VQ8 F;  1QAH A;  4FFB B;  4C4W C;  4BT7 A;  5IT9 M;  1GX1 A;  4I4T A;  3MCQ A;  2GVI A;  5KX5 B;  5AVM A;  3GYQ A;  4X1I A;  3MBM A;  2QEX F;  3HKE A;  2RB9 A;  1KD1 H;  1XBI A;  4BVT A;  5HY2 A;  4O2A A;  2OHW A;  1W5B A;  3CCM F;  1IV2 A;  1TUB B;  4LNU A;  1IV3 A;  4O4J A;  1RLG A;  3CD6 F;  1J7H A;  5GIN C;  1YHQ F;  4G4X A;  3CXC F;  5HY4 A;  2DT4 A;  2ZVZ A;  3HKB A;  2Z1E A;  3OBW A;  2VXY A;  3J80 M;  1RQ2 A;  1H48 A;  3VMF B;  2VGN A;  2HP0 A;  3I55 F;  4IIJ A;  5MN4 A;  5EYP B;  1X52 A;  3NK6 A;  2LBX A;  5EIB D;  1VQL F;  2ZAU A;  2YXZ A;  1X25 A;  2BTU A;  1E7K A;  3CYP B;  3WGK A;  3CC7 F;  3CCS F;  3WPW A;  1OAP A;  3F0F A;  2I6R A;  2Q1X A;  3RE3 A;  3G4S F;  1W58 1;  2RHH A;  3C9S A;  4O4I B;  3LDT A;  3N2K B;  1RQ7 A;  1U3P A;  3WJQ A;  5KMG B;  4X20 A;  5EB1 B;  1K73 H;  3D01 A;  5B8F A;  4X1K B;  4E6E A;  3TD3 A;  3FBA A;  2UYN B;  1YQN A;  4RHA A;  3JAS A;  1YJW F;  2L26 A;  1UFY A;  1U3L A;  4R40 B;  1S72 F;  3PLA C;  5EB0 A;  3UT5 A;  5GON B;  3RA5 A;  3RYF B;  5LOV B;  5EZY A;  1TVK B;  1T0A A;  3ON1 A;  4YJ3 B;  3WPX A;  2BTO A;  4TV9 B;  1JJ2 F;  3HKC A;  4NWO B;  2H8E A;  3N2K A;  5BMV A;  1Q7Y H;  1SDS A;  2Z1U A;  4ZI7 B;  3RYC B;  4G88 A;  1GO1 A;  1W55 A;  2ZVY A;  2K1S A;  4U3J B;  3V3T A;  3CC2 F;  2BO1 A;  1ODE A;  2QA4 F;  1W5F A;  1UI9 A;  3CCU F;  4I50 B;  2HRY A;  3I7T A;  5HP8 A;  1Z5W A;  5G4V C;  3KE1 A;  4ZHW A;  4F6R B;  3WJR A;  5GON A;  1Z5V A;  4YJ3 A;  2VAW A;  3VOA A;  3ZP7 A;  1FNK A;  2VAP A;  4C81 A;  3TD5 A;  3J7A R;  1NJI H;  5JH7 B;  3NMU C;  3E1Y A;  1KNK A;  3VOB A;  4RQO A;  2CWJ A;  1SA0 B;  4IHJ A;  4EI7 A;  1Q8R A;  5LA6 A;  1NMU B;  2PHN A;  1Q82 H;  3HTN A;  3TD4 A;  4C82 A;  3EOR A;  5EWR A;  3LWQ C;  5HWE A;  5C8Y B;  2MQE A;  3VTI C;  1DBF A;  4DRX B;  1W57 A;  2HVY D;  2LCA A;  3Q8H A;  1CN7 A;  2VGM A;  2HRU A;  3N2G B;  4HNA B;  2Q1Y A;  2HS0 A;  4BVS A;  1FFX A;  1SA0 A;  3BYQ A;  5CA1 B;  3LWV C;  3F0E A;  3N4Z A;  4ZHQ B;  3JAL A;  4TV8 A;  4X3M A;  5LYJ B;  4G4V A;  3CYQ A;  5A2Q M;  5JQG A;  3OW2 F;  2HS3 A;  3B6N A;  3S03 A;  4TUY A;  3E22 B;  1RLU A;  3VYT C;  1KC8 H;  3LWP C;  1W41 A;  4NUT A;  3JAW B;  5IYZ A;  5J2T A;  1ZWZ A;  3HKD A;  2RHO A;  3MDO A;  1QVF F;  1COM A;  3WJP A;  3HAX D;  1Q81 H;  1SZQ A;  5J2U B;  4FFB A;  3D00 A;  2QI2 A;  3WGL A;  3C9R A;  5LYJ A;  5HXZ A;  5KX5 A;  1VH8 A;  3V4D A;  3GHZ A;  3NVK E;  4EI8 A;  2AIZ P;  3VI6 A;  2IG8 A;  3LWO C;  1H7M A;  2WAL A;  3CPW F;  3JAT B;  4BT4 A;  5MN6 A;  1VK3 A;  1TUB A;  2JNB A;  3LYB A;  3G6E F;  2R75 1;  4B5C A;  3MQW A;  5CA0 B;  3L7Q A;  1X7P A;  3N4Y A;  5IJ9 B;  3WGJ A;  3WGN A;  3RYH B;  1VQV A;  2IAF A;  2ZOD A;  2Z1F A;  3NVI B;  5ITZ B;  3RYI B;  3V7Q A;  3QHD A;  3NK7 A;  2YYE A;  5IJ0 B;  1X7O A;  5EYP A;  1KNJ A;  4DXD A;  2RHL A;  1R1M A;  2IQQ A;  3JAK B;  2W8B C;  1VQM F;  1FSZ A; 
#chains in the Genus database with same CATH homology
 3KHN A;  5EB0 A;  2KGW A;  4ERH A;  4ZHV A;  3CYP B;  3WPW A;  4B5C A;  4G4Z A;  3S0Y A;  1OAP A;  3S02 A;  3WPX A;  3S06 A;  3S0W A;  4PWT A;  4B62 A;  2LCA A;  3TD5 A;  4G4X A;  2ZOV A;  5EAZ A;  2N48 A;  4G4W A;  2ZVZ A;  2ZF8 A;  4G88 A;  3LDT A;  2HQS C;  4ZHY B;  2ZVY A;  2K1S A;  5EB1 B;  4G4V A;  3CYQ A;  2AIZ P;  3TD3 A;  4G4Y A;  3S03 A;  3TD4 A;  3OON A;  4RHA A;  2LBT A;  3S0H A;  1R1M A;  2L26 A;  4ZHW A;  2W8B C;  4R40 B;  2MQE A;  3IMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...