1U3LA

Ispf with mg and cdp
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
b'MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structure of 2C-Methyl-D-Erythritol-2,4-Cyclodiphosphate Synthase Involved in Mevalonate Independent Biosynthesis of Isoprenoids
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 50
structure length 155
sequence length 155
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2004-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1u3lA00
3ERNA 3JVHA 1W55A 3P0ZA 4C8IA 3GHZA 4C8EA 1IV1A 3ELCA 1IV2A 1U43A 1IV4A 3MBMA 1VHAA 3IEQA 1YQNA 3IKFA 3K14A 2UZHA 2PMPA 3P10A 3EORA 3T80A 1KNKA 3F0EA 1U3PA 3K2XA 1U40A 4C81A 4C8GA 1JN1A 3F0DA 1W57A 3F6MA 2GZLA 5B8FA 1IV3A 1KNJA 1VH8A 1H48A 3IKEA 3FPIA 3ESJA 4C82A 3F0FA 1T0AA 1H47A 2AMTA 3B6NA 3KE1A 3Q8HA 1JY8A 3IEWA 1GX1A 3FBAA 3F0GA 3QHDA 3RE3A 1U3LA
chains in the Genus database with same CATH superfamily
2LCAA 4ZHQA 1QU9A 3O85A 3VYUC 2UYNA 4BT7A 1TUBA 3JARA 1TVKB 4I55B 2LBTA 5HY2A 1Q81H 4G4WA 5CA0A 4BT2A 3UT5B 4RQOA 3P4EA 5ITZA 3JAKA 2OZBA 3RYHA 1CLIA 1PF5A 1Z5VA 3HKDB 3FBAA 3MQWA 2QI2A 4X3LA 4X1KB 3KIZA 3S02A 3WGLA 2NMUA 3CMEF 3CCVF 3U0OA 4YJ2B 2OHWA 4X20B 3E20B 2ZF8A 5KX5A 3FFMA 2ZVYA 3DC2A 1U43A 2RHJA 3CG6A 2BTUA 3V4DA 3IEQA 4O2BB 2FC3A 1SA0A 1PXWA 3DDNA 1U40A 1YHQF 5C8YA 1VQMF 2G9IA 3CPQA 1VH8A 5GONA 1K73H 4LNUB 4G4YA 4IIJA 1JFFB 4O4IA 3VOBA 3I56F 3D01A 3JASA 1YIJF 4HNAB 2QEXF 2H6LA 3RYFA 4E6EA 5CB4A 3JVHA 3J81M 2Q1YA 5HXUA 1IPAA 4C8IA 1VQ9F 2HS4A 1NQ3A 1X7PA 4O2AB 3MBMA 1ODEA 2LBWA 3VMFB 1JJ2F 4ZOLA 3WPXA 1XRGA 5J2TB 1FFXA 4EI8A 3D54A 5EIBC 3WPWA 3F6MA 5LYJB 2Q1XA 5J2UA 3I55F 1OFUA 4O4HA 3M1XA 3NK7A 2HRYA 2IG8A 3IR9A 1M1KH 1JY8A 4I4TB 4YJ3B 1E7KA 2QTPA 3I3FA 1KD1H 2ALEA 3CC4F 1YJNF 2OTMA 2DT4A 5EYPA 2UZHA 3N4ZA 1CN7A 3CYQA 3JCMM 4DXDA 3LWOC 3JALA 1JN1A 1W2BF 3LMEA 2GZLA 4TUYB 1ONIA 1H48A 5IYZA 3VYSC 2GLZA 2YXZA 5FNVB 3QHDA 5HY0A 1U3LA 3HKBA 3K0TA 1JD1A 3TD5A 5FLXM 4B5CA 3NVIB 3ELCA 3JATB 3ZP4A 1VK3A 1ZWZA 4ZI7A 5JCOC 2ZODA 5BMVA 5LOVB 1N8RH 1VQVA 3V7EA 5FJ4C 3VI6A 3F0DA 3M84A 4IHJB 3G6EF 4WBNA 2VGNA 2CHTA 5IJ0A 1KNJA 3V7QA 4TV9B 3OW2F 2OTLF 3CMAF 1T0AA 4NUTA 2ZOVA 1W3EX 4F6RB 1TVKA 2MQEA 3LWVC 4ZHVA 3C8LA 5JVDB 4BT6A 4EI7A 3LWQC 3RYCB 3UT5A 3HJWC 5HY4A 5HXZA 1YJ9F 3EORA 5LP6A 3HKDA 2EWCA 1K9MH 2I6RA 3CC7F 4X1KA 1IV3A 1VQ6F 3QUWA 3R0PA 5G4VC 3HKCB 2Z01A 3HTNA 3N2GB 4YJ2A 4X20A 3C9RA 2IQQA 5GAPK 2Z1UA 1W42A 4KWEA 5KMGB 3J80M 2PHNA 3RA6A 3CCQF 5LA6A 4O2BA 1KC8H 1X7OA 4U3JB 4X1IB 3VTIC 5HP8A 2UYJA 4FFBB 2H8EA 3RA5A 3CCRF 4LNUA 2AIZP 1S72F 1YITF 1VQLF 3CB2A 1JFFA 5MN6A 3NMUC 2KTVA 4HNAA 3VCZA 1XBIA 2KGWA 4EI9A 4ZHWA 4X3MA 4C4WC 2RB9A 1W581 4PWTA 2RHHA 2GVIA 5EB1B 2DYYA 3KHNA 4G4VA 3PLAC 4O2AA 3WGJA 2VAPA 5AVMA 5HP7A 4G4XA 3HAXD 3JAKB 3ZP7A 2HX0A 1FNKA 3RYHB 4TV8B 5LP6C 4C8EA 3GYQA 2RHOA 3C9TA 5LYJA 3S03A 1RLGA 3K14A 2QA4F 3QTYA 4BVSA 3WXMB 5KX5B 3JAWB 4I4TA 4YJ3A 3JAMM 3CCJF 2IAFA 2HP3A 1SA0B 1R1MA 2AMTA 1Z5WA 3Q8HA 2BTQB 3IEWA 4NQ3A 2HRUA 1COMA 5GIPC 1UFYA 1QAHA 5JH7A 1K8AH 1UI9A 3NVKE 2VAWA 4RHAA 1YGYA 4O4IB 2VXYA 1VQ8F 5DCVA 2UYKA 3JASB 4EB6B 5JQGB 4TUYA 2HP0B 2N48A 1YI2F 1GZ0A 1VQOF 1VQ5F 1DT9A 5FNVA 4C8GA 2F9ZC 1RQ2A 2RHLA 3MCQA 5MN5A 3TD3A 4C82A 3S0WA 3J7AR 5EB0A 3VYTC 1VQ4F 1Q7YH 1M90H 1GO0A 4X1YB 5LXTB 3LYBA 4O4HB 2CZWA 3N2KA 5LOVA 3CCSF 2LBXA 4IHJA 4ZK7A 3S0YA 3WGKA 5EO3A 2CVLA 4NWOB 2K1SA 5HWEA 3K2XA 3CD6F 4TZZA 4O4LB 1GO1A 1QVFF 3G4SF 5CA1B 3F0FA 1Q82H 1W5FA 4BW0B 5JVDA 3F0GA 5HY1A 3RYCA 1T0KB 1RQ7A 2AIFA 1DBFA 2V9YA 5IJ9B 3ERNA 2KG4A 3RYIB 3WGNA 3P0ZA 4I55A 1VQPF 1W5AA 3V3TA 3KJJA 1YQNA 3HKCA 3IKFA 4DRXB 2PMPA 3P10A 3HKEB 3N2GA 1VQ7F 1U3PA 4G4ZA 5EIBD 4C81A 3CC2F 5EAZA 4B62A 2P6YA 1XHOA 3ON1A 3CYPB 4O4JB 5GINC 1VQKF 3OBWA 4X1IA 3CCMF 3S06A 3SIUA 1RLUA 4WBNB 4I50B 1Q86H 3E22B 5A2QM 2R6R1 3D00A 1SDSA 5EZYB 1W55A 3MCAB 1IV1A 1VQNF 1NJIH 3FD6A 4BY9D 1QD9A 2R751 4ZHQB 3WJQA 3SIVA 3NK6A 2I6DA 3GTZA 3ZO8A 2UYNB 4M8IA 4BVRA 3S0HA 3IKEA 1TUBB 3ESJA 3FPIA 3JARB 4TV8A 1H47A 5LP6B 4XCQA 3K12A 4LCKA 4R40B 2VAMA 5CA0B 3FD5A 3CCLF 3OONA 5ITZB 3JAWA 5EWRA 5J2TA 1YJWF 1IV4A 1Q8RA 3MDOA 2CHSA 3PAFA 5LA6B 2HQSC 1H7MA 3T80A 3WJPA 1W57A 4G88A 2L26A 4ERHA 3HWUA 3TD4A 3IMPA 3B6NA 3KJKA 5JQGA 1QVGF 4EB6A 5C8YB 1OAPA 3E1YA 3VIUA 3LWRC 3CCUF 2HP0A 5G4UC 5GONB 3GHZA 4IIJB 4BT3A 1VHAA 1W59A 3ZOPA 2ZVZA 3AGKA 3RYFB 2JNBA 5CB4B 3LWPC 2YYEA 1X52A 5GIOC 4BVQA 1KQSF 1CK2A 4X1YA 5LXTA 1W5EA 1J7HA 2HS0A 3G71F 5JCOA 2HS3A 2VGMA 4ZOLB 2HVYD 2CW4A 1FFXB 2WALA 5MN4A 3JATA 5J2UB 2CWJA 1FNJA 1XV2A 1SZQA 1NMUB 4U39A 2ZAUA 3VO8A 3OBYA 2KTUA 4O4LA 5JH7B 4TV9A 2B33A 5CA1A 4BT5A 3F0EA 1W41A 2BO1A 3WGMA 1W40A 2BTOA 3L7QA 5GANK 1RA4A 3N4YA 5IJ9A 5EYPB 3RYIA 4F6RA 3KE1A 1W5BA 3CXCF 1GX1A 3JALB 1X25A 1FSZA 3BYQA 3RE3A 4DRXA 5IYZB 5IT9M 3HKEA 2Z1FA 2Z1TA 2FGYA 1IV2A 2Z1EA 3C9SA 4B46A 4O4JA 3M4SA 3C9UA 3N2KB 4ZHYB 3HKBB 2CSLA 1KNKA 2H8CA 3CCEF 2W8BC 4BT4A 4I50A 4BVTA 3E22A 5B8FA 5KMGA 3LDTA 5EZYA 4ZI7B 2OTJF 5BMVB 3I7TA 3LFOA 3WJRA 4U3JA 3VOAA 4FFBA 4B45A 5IJ0B 3CPWF 2UYPA
chains in the Genus database with same CATH topology
3ERNA 3JVHA 1W55A 3P0ZA 4C8IA 3GHZA 4C8EA 1IV1A 3ELCA 1IV2A 1U43A 1IV4A 3MBMA 1VHAA 3IEQA 1YQNA 3IKFA 3K14A 2UZHA 2PMPA 3P10A 3EORA 3T80A 1KNKA 3F0EA 1U3PA 3K2XA 1U40A 4C81A 4C8GA 1JN1A 3F0DA 1W57A 3F6MA 2GZLA 5B8FA 1IV3A 1KNJA 1VH8A 1H48A 3IKEA 3FPIA 3ESJA 4C82A 3F0FA 1T0AA 1H47A 2AMTA 3B6NA 3KE1A 3Q8HA 1JY8A 3IEWA 1GX1A 3FBAA 3F0GA 3QHDA 3RE3A 1U3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERN A;  3JVH A;  1W55 A;  3P0Z A;  4C8I A;  3GHZ A;  4C8E A;  1IV1 A;  3ELC A;  1IV2 A;  1U43 A;  1IV4 A;  3MBM A;  1VHA A;  3IEQ A;  1YQN A;  3IKF A;  3K14 A;  2UZH A;  2PMP A;  3P10 A;  3EOR A;  3T80 A;  1KNK A;  3F0E A;  1U3P A;  3K2X A;  1U40 A;  4C81 A;  4C8G A;  1JN1 A;  3F0D A;  1W57 A;  3F6M A;  2GZL A;  5B8F A;  1IV3 A;  1KNJ A;  1VH8 A;  1H48 A;  3IKE A;  3FPI A;  3ESJ A;  4C82 A;  3F0F A;  1T0A A;  1H47 A;  2AMT A;  3B6N A;  3KE1 A;  3Q8H A;  1JY8 A;  3IEW A;  1GX1 A;  3FBA A;  3F0G A;  3QHD A;  3RE3 A;  1U3L A; 
#chains in the Genus database with same CATH topology
 2LCA A;  4ZHQ A;  1QU9 A;  3O85 A;  3VYU C;  2UYN A;  4BT7 A;  1TUB A;  3JAR A;  1TVK B;  4I55 B;  2LBT A;  5HY2 A;  1Q81 H;  4G4W A;  5CA0 A;  4BT2 A;  3UT5 B;  4RQO A;  3P4E A;  5ITZ A;  3JAK A;  2OZB A;  3RYH A;  1CLI A;  1PF5 A;  1Z5V A;  3HKD B;  3FBA A;  3MQW A;  2QI2 A;  4X3L A;  4X1K B;  3KIZ A;  3S02 A;  3WGL A;  2NMU A;  3CME F;  3CCV F;  3U0O A;  4YJ2 B;  2OHW A;  4X20 B;  3E20 B;  2ZF8 A;  5KX5 A;  3FFM A;  2ZVY A;  3DC2 A;  1U43 A;  2RHJ A;  3CG6 A;  2BTU A;  3V4D A;  3IEQ A;  4O2B B;  2FC3 A;  1SA0 A;  1PXW A;  3DDN A;  1U40 A;  1YHQ F;  5C8Y A;  1VQM F;  2G9I A;  3CPQ A;  1VH8 A;  5GON A;  1K73 H;  4LNU B;  4G4Y A;  4IIJ A;  1JFF B;  4O4I A;  3VOB A;  3I56 F;  3D01 A;  3JAS A;  1YIJ F;  4HNA B;  2QEX F;  2H6L A;  3RYF A;  4E6E A;  5CB4 A;  3JVH A;  3J81 M;  2Q1Y A;  5HXU A;  1IPA A;  4C8I A;  1VQ9 F;  2HS4 A;  1NQ3 A;  1X7P A;  4O2A B;  3MBM A;  1ODE A;  2LBW A;  3VMF B;  1JJ2 F;  4ZOL A;  3WPX A;  1XRG A;  5J2T B;  1FFX A;  4EI8 A;  3D54 A;  5EIB C;  3WPW A;  3F6M A;  5LYJ B;  2Q1X A;  5J2U A;  3I55 F;  1OFU A;  4O4H A;  3M1X A;  3NK7 A;  2HRY A;  2IG8 A;  3IR9 A;  1M1K H;  1JY8 A;  4I4T B;  4YJ3 B;  1E7K A;  2QTP A;  3I3F A;  1KD1 H;  2ALE A;  3CC4 F;  1YJN F;  2OTM A;  2DT4 A;  5EYP A;  2UZH A;  3N4Z A;  1CN7 A;  3CYQ A;  3JCM M;  4DXD A;  3LWO C;  3JAL A;  1JN1 A;  1W2B F;  3LME A;  2GZL A;  4TUY B;  1ONI A;  1H48 A;  5IYZ A;  3VYS C;  2GLZ A;  2YXZ A;  5FNV B;  3QHD A;  5HY0 A;  1U3L A;  3HKB A;  3K0T A;  1JD1 A;  3TD5 A;  5FLX M;  4B5C A;  3NVI B;  3ELC A;  3JAT B;  3ZP4 A;  1VK3 A;  1ZWZ A;  4ZI7 A;  5JCO C;  2ZOD A;  5BMV A;  5LOV B;  1N8R H;  1VQV A;  3V7E A;  5FJ4 C;  3VI6 A;  3F0D A;  3M84 A;  4IHJ B;  3G6E F;  4WBN A;  2VGN A;  2CHT A;  5IJ0 A;  1KNJ A;  3V7Q A;  4TV9 B;  3OW2 F;  2OTL F;  3CMA F;  1T0A A;  4NUT A;  2ZOV A;  1W3E X;  4F6R B;  1TVK A;  2MQE A;  3LWV C;  4ZHV A;  3C8L A;  5JVD B;  4BT6 A;  4EI7 A;  3LWQ C;  3RYC B;  3UT5 A;  3HJW C;  5HY4 A;  5HXZ A;  1YJ9 F;  3EOR A;  5LP6 A;  3HKD A;  2EWC A;  1K9M H;  2I6R A;  3CC7 F;  4X1K A;  1IV3 A;  1VQ6 F;  3QUW A;  3R0P A;  5G4V C;  3HKC B;  2Z01 A;  3HTN A;  3N2G B;  4YJ2 A;  4X20 A;  3C9R A;  2IQQ A;  5GAP K;  2Z1U A;  1W42 A;  4KWE A;  5KMG B;  3J80 M;  2PHN A;  3RA6 A;  3CCQ F;  5LA6 A;  4O2B A;  1KC8 H;  1X7O A;  4U3J B;  4X1I B;  3VTI C;  5HP8 A;  2UYJ A;  4FFB B;  2H8E A;  3RA5 A;  3CCR F;  4LNU A;  2AIZ P;  1S72 F;  1YIT F;  1VQL F;  3CB2 A;  1JFF A;  5MN6 A;  3NMU C;  2KTV A;  4HNA A;  3VCZ A;  1XBI A;  2KGW A;  4EI9 A;  4ZHW A;  4X3M A;  4C4W C;  2RB9 A;  1W58 1;  4PWT A;  2RHH A;  2GVI A;  5EB1 B;  2DYY A;  3KHN A;  4G4V A;  3PLA C;  4O2A A;  3WGJ A;  2VAP A;  5AVM A;  5HP7 A;  4G4X A;  3HAX D;  3JAK B;  3ZP7 A;  2HX0 A;  1FNK A;  3RYH B;  4TV8 B;  5LP6 C;  4C8E A;  3GYQ A;  2RHO A;  3C9T A;  5LYJ A;  3S03 A;  1RLG A;  3K14 A;  2QA4 F;  3QTY A;  4BVS A;  3WXM B;  5KX5 B;  3JAW B;  4I4T A;  4YJ3 A;  3JAM M;  3CCJ F;  2IAF A;  2HP3 A;  1SA0 B;  1R1M A;  2AMT A;  1Z5W A;  3Q8H A;  2BTQ B;  3IEW A;  4NQ3 A;  2HRU A;  1COM A;  5GIP C;  1UFY A;  1QAH A;  5JH7 A;  1K8A H;  1UI9 A;  3NVK E;  2VAW A;  4RHA A;  1YGY A;  4O4I B;  2VXY A;  1VQ8 F;  5DCV A;  2UYK A;  3JAS B;  4EB6 B;  5JQG B;  4TUY A;  2HP0 B;  2N48 A;  1YI2 F;  1GZ0 A;  1VQO F;  1VQ5 F;  1DT9 A;  5FNV A;  4C8G A;  2F9Z C;  1RQ2 A;  2RHL A;  3MCQ A;  5MN5 A;  3TD3 A;  4C82 A;  3S0W A;  3J7A R;  5EB0 A;  3VYT C;  1VQ4 F;  1Q7Y H;  1M90 H;  1GO0 A;  4X1Y B;  5LXT B;  3LYB A;  4O4H B;  2CZW A;  3N2K A;  5LOV A;  3CCS F;  2LBX A;  4IHJ A;  4ZK7 A;  3S0Y A;  3WGK A;  5EO3 A;  2CVL A;  4NWO B;  2K1S A;  5HWE A;  3K2X A;  3CD6 F;  4TZZ A;  4O4L B;  1GO1 A;  1QVF F;  3G4S F;  5CA1 B;  3F0F A;  1Q82 H;  1W5F A;  4BW0 B;  5JVD A;  3F0G A;  5HY1 A;  3RYC A;  1T0K B;  1RQ7 A;  2AIF A;  1DBF A;  2V9Y A;  5IJ9 B;  3ERN A;  2KG4 A;  3RYI B;  3WGN A;  3P0Z A;  4I55 A;  1VQP F;  1W5A A;  3V3T A;  3KJJ A;  1YQN A;  3HKC A;  3IKF A;  4DRX B;  2PMP A;  3P10 A;  3HKE B;  3N2G A;  1VQ7 F;  1U3P A;  4G4Z A;  5EIB D;  4C81 A;  3CC2 F;  5EAZ A;  4B62 A;  2P6Y A;  1XHO A;  3ON1 A;  3CYP B;  4O4J B;  5GIN C;  1VQK F;  3OBW A;  4X1I A;  3CCM F;  3S06 A;  3SIU A;  1RLU A;  4WBN B;  4I50 B;  1Q86 H;  3E22 B;  5A2Q M;  2R6R 1;  3D00 A;  1SDS A;  5EZY B;  1W55 A;  3MCA B;  1IV1 A;  1VQN F;  1NJI H;  3FD6 A;  4BY9 D;  1QD9 A;  2R75 1;  4ZHQ B;  3WJQ A;  3SIV A;  3NK6 A;  2I6D A;  3GTZ A;  3ZO8 A;  2UYN B;  4M8I A;  4BVR A;  3S0H A;  3IKE A;  1TUB B;  3ESJ A;  3FPI A;  3JAR B;  4TV8 A;  1H47 A;  5LP6 B;  4XCQ A;  3K12 A;  4LCK A;  4R40 B;  2VAM A;  5CA0 B;  3FD5 A;  3CCL F;  3OON A;  5ITZ B;  3JAW A;  5EWR A;  5J2T A;  1YJW F;  1IV4 A;  1Q8R A;  3MDO A;  2CHS A;  3PAF A;  5LA6 B;  2HQS C;  1H7M A;  3T80 A;  3WJP A;  1W57 A;  4G88 A;  2L26 A;  4ERH A;  3HWU A;  3TD4 A;  3IMP A;  3B6N A;  3KJK A;  5JQG A;  1QVG F;  4EB6 A;  5C8Y B;  1OAP A;  3E1Y A;  3VIU A;  3LWR C;  3CCU F;  2HP0 A;  5G4U C;  5GON B;  3GHZ A;  4IIJ B;  4BT3 A;  1VHA A;  1W59 A;  3ZOP A;  2ZVZ A;  3AGK A;  3RYF B;  2JNB A;  5CB4 B;  3LWP C;  2YYE A;  1X52 A;  5GIO C;  4BVQ A;  1KQS F;  1CK2 A;  4X1Y A;  5LXT A;  1W5E A;  1J7H A;  2HS0 A;  3G71 F;  5JCO A;  2HS3 A;  2VGM A;  4ZOL B;  2HVY D;  2CW4 A;  1FFX B;  2WAL A;  5MN4 A;  3JAT A;  5J2U B;  2CWJ A;  1FNJ A;  1XV2 A;  1SZQ A;  1NMU B;  4U39 A;  2ZAU A;  3VO8 A;  3OBY A;  2KTU A;  4O4L A;  5JH7 B;  4TV9 A;  2B33 A;  5CA1 A;  4BT5 A;  3F0E A;  1W41 A;  2BO1 A;  3WGM A;  1W40 A;  2BTO A;  3L7Q A;  5GAN K;  1RA4 A;  3N4Y A;  5IJ9 A;  5EYP B;  3RYI A;  4F6R A;  3KE1 A;  1W5B A;  3CXC F;  1GX1 A;  3JAL B;  1X25 A;  1FSZ A;  3BYQ A;  3RE3 A;  4DRX A;  5IYZ B;  5IT9 M;  3HKE A;  2Z1F A;  2Z1T A;  2FGY A;  1IV2 A;  2Z1E A;  3C9S A;  4B46 A;  4O4J A;  3M4S A;  3C9U A;  3N2K B;  4ZHY B;  3HKB B;  2CSL A;  1KNK A;  2H8C A;  3CCE F;  2W8B C;  4BT4 A;  4I50 A;  4BVT A;  3E22 A;  5B8F A;  5KMG A;  3LDT A;  5EZY A;  4ZI7 B;  2OTJ F;  5BMV B;  3I7T A;  3LFO A;  3WJR A;  4U3J A;  3VOA A;  4FFB A;  4B45 A;  5IJ0 B;  3CPW F;  2UYP A; 
#chains in the Genus database with same CATH homology
 3ERN A;  3JVH A;  1W55 A;  3P0Z A;  4C8I A;  3GHZ A;  4C8E A;  1IV1 A;  3ELC A;  1IV2 A;  1U43 A;  1IV4 A;  3MBM A;  1VHA A;  3IEQ A;  1YQN A;  3IKF A;  3K14 A;  2UZH A;  2PMP A;  3P10 A;  3EOR A;  3T80 A;  1KNK A;  3F0E A;  1U3P A;  3K2X A;  1U40 A;  4C81 A;  4C8G A;  1JN1 A;  3F0D A;  1W57 A;  3F6M A;  2GZL A;  5B8F A;  1IV3 A;  1KNJ A;  1VH8 A;  1H48 A;  3IKE A;  3FPI A;  3ESJ A;  4C82 A;  3F0F A;  1T0A A;  1H47 A;  2AMT A;  3B6N A;  3KE1 A;  3Q8H A;  1JY8 A;  3IEW A;  1GX1 A;  3FBA A;  3F0G A;  3QHD A;  3RE3 A;  1U3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...