1U3LA

Ispf with mg and cdp
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structure of 2C-Methyl-D-Erythritol-2,4-Cyclodiphosphate Synthase Involved in Mevalonate Independent Biosynthesis of Isoprenoids
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 50
structure length 155
sequence length 155
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2004-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1u3lA00
3T80A 1U3PA 3EORA 1YQNA 3IKFA 3RE3A 1VH8A 3F0DA 3IKEA 3B6NA 1IV4A 3FBAA 3F0FA 1KNKA 3F0EA 3F0GA 1IV1A 1KNJA 1IV2A 3FPIA 3MBMA 4C8EA 3KE1A 4C8IA 1JN1A 3QHDA 3P10A 5B8FA 1U43A 3K2XA 1T0AA 1JY8A 4C8GA 1IV3A 2AMTA 1GX1A 2GZLA 1H47A 3GHZA 3ESJA 1VHAA 2PMPA 3P0ZA 3F6MA 3JVHA 1U3LA 3K14A 1W57A 2UZHA 1U40A 3IEQA 3IEWA 4C81A 4C82A 1W55A 3Q8HA 3ERNA 3ELCA 1H48A
chains in the Genus database with same CATH superfamily
4X1KB 5LP6C 1N8RH 1VH8A 2HP3A 1J7HA 1TVKB 4WBNB 4YJ2A 4B62A 3RYCA 4EI8A 3P4EA 3FFMA 3IMPA 5J2TA 2ALEA 1Q81H 3OONA 3MBMA 2AIZP 3FPIA 3K12A 3HKDA 1QD9A 5GONA 4G4WA 4C4WC 3E20B 4O4JB 2QA4F 1IPAA 3M4SA 4ZHVA 2IQQA 3D01A 5LYJA 3SIUA 3JALB 4ZHWA 4B45A 1GO0A 3K14A 5HY1A 1FFXB 5A2QM 4I55B 2OTJF 1RQ7A 4F6RA 2CZWA 3M1XA 4EB6A 2H8EA 1DBFA 3KIZA 4X3LA 3RE3A 3F0DA 4X3MA 5LXTB 1M1KH 3WPXA 3L7QA 1Z5VA 1YI2F 4TV9B 3WGJA 3JASB 3G71F 1JN1A 3D54A 1QVFF 4X1IB 5IT9M 1IV3A 2ZVYA 3I7TA 4EI7A 3V7EA 3VMFB 5GIOC 1U3LA 3VIUA 2VXYA 1VQ9F 3I56F 5LA6B 1Q86H 3ELCA 2BTQB 2G9IA 4XCQA 2EWCA 5HY4A 1X7OA 4O4LB 5HXUA 4IIJA 2Z01A 1X52A 2UYNB 3QTYA 3NVIB 1RLUA 2DYYA 3HKCB 1QAHA 4PWTA 1VQOF 3JATA 4B46A 1YIJF 1XRGA 3WGKA 1YITF 4U39A 1YGYA 5BMVA 2W8BC 3IR9A 4YJ3B 1U40A 3RYIB 3N2KA 4C82A 1VQLF 4M8IA 3JCMM 3VYSC 3J81M 5FNVA 3CMAF 3JARA 3DDNA 1KQSF 2UYKA 3ZP7A 3CCJF 5KMGB 5EO3A 1W5AA 5EIBC 4HNAB 5JVDB 5KX5B 5G4UC 3RYFA 1VQ8F 3RA5A 2VGNA 3C9SA 3G4SF 1JFFA 1XHOA 4TUYB 3JAWA 3MQWA 5JCOC 2ZODA 1Q8RA 4BVQA 3LMEA 1W55A 3N2GA 1Q82H 2QTPA 2Q1XA 4X1YB 1NJIH 3CCEF 4BY9D 3NK7A 5CA0B 1QU9A 4DRXA 3F0FA 3PLAC 4LNUB 3OBYA 5EZYB 5EYPB 1W5BA 3CYQA 1SA0B 3V7QA 5CA1A 3G6EF 4X20B 3LDTA 3S0YA 2CW4A 5IYZB 4BT7A 1PF5A 1H47A 4E6EA 3QUWA 1TVKA 3WXMB 3CCUF 2P6YA 2K1SA 1GZ0A 2IG8A 3C9RA 2N48A 1S72F 2AIFA 4O4JA 4O4IA 3JAMM 4O4HB 1VQMF 5GIPC 1YHQF 3E22B 4DXDA 3TD3A 3D00A 3JALA 3LFOA 3HKEA 3CC7F 3FD5A 4NWOB 4BT3A 1FFXA 3RA6A 4I4TB 4I55A 2VAWA 5C8YA 4ZHQB 2AMTA 3V4DA 3CCRF 3ESJA 4ZHYB 4U3JB 3C9UA 4ERHA 1UFYA 5HY0A 5IJ0B 5DCVA 3RYHB 3SIVA 4ZI7B 2GLZA 3VI6A 5IJ9B 3IEQA 4BT6A 3MCQA 4TV9A 3N4YA 2Q1YA 1H7MA 5HP7A 1X7PA 4BT2A 3HTNA 5J2UB 4X1IA 5CB4B 2QEXF 2RHJA 1K8AH 4BT4A 5FLXM 2RB9A 3CCVF 1T0KB 2F9ZC 4EI9A 4C8EA 5LP6A 3P10A 3TD4A 4NUTA 1W5FA 4I50B 2ZAUA 5LA6A 1YJ9F 4YJ2B 3RYCB 2RHLA 3I3FA 3KHNA 2KTVA 1VQ5F 3CPWF 5HXZA 5JQGB 4O4LA 3JVHA 5GONB 1JD1A 2HRUA 3PAFA 3CCSF 2UYNA 2CHTA 3CXCF 5JH7A 3EORA 3UT5A 1XBIA 1RLGA 5FJ4C 5EIBD 3N4ZA 3VCZA 1OFUA 3F0EA 3VOBA 3MCAB 3WGNA 4F6RB 4YJ3A 4EB6B 1QVGF 2VAPA 2KG4A 2NMUA 3CMEF 1E7KA 1KC8H 3CCMF 1RQ2A 3GHZA 1RA4A 1TUBA 2HP0A 2YXZA 2KGWA 1K9MH 3M84A 3GYQA 5KMGA 3DC2A 2VGMA 1VQ4F 3HAXD 5JVDA 5KX5A 3IKFA 3B6NA 1COMA 2DT4A 3NVKE 4O2BA 3F0GA 2L26A 3J7AR 4O2AA 3LWQC 3VYUC 3VOAA 2HQSC 3I55F 4X1YA 1GX1A 4G88A 1NQ3A 3KJKA 5CA0A 5ITZA 4LNUA 5EZYA 5EYPA 3IEWA 3JATB 1KD1H 3Q8HA 4IHJA 3S0WA 3T80A 1VQVA 1YQNA 5BMVB 5GANK 3CG6A 4TZZA 1X25A 3CD6F 3KE1A 5FNVB 4FFBA 1JJ2F 1JY8A 4C8GA 1VQKF 2V9YA 4G4ZA 2HX0A 1CN7A 4X1KA 3E22A 3P0ZA 4WBNA 2CWJA 4G4YA 3CCQF 2H6LA 3MDOA 1SDSA 5JCOA 1JFFB 2B33A 2PHNA 4ZHQA 2LBTA 3VO8A 4U3JA 3HKBB 3O85A 4TV8B 1KNJA 3KJJA 3OBWA 3S03A 2ZF8A 2OHWA 1W41A 5HP8A 4DRXB 5GAPK 1YJNF 2BTUA 3HWUA 5EWRA 5J2UA 3J80M 2FGYA 2LBXA 5CB4A 5LOVB 5EB1B 3CB2A 4ZOLB 2LBWA 4LCKA 4R40B 5LXTA 5HY2A 3CYPB 5MN5A 3LWRC 4BVRA 4G4XA 3JASA 4I50A 3NMUC 1U3PA 3VYTC 3VTIC 3CC2F 2QI2A 3WPWA 3JAKB 4KWEA 2ZOVA 1DT9A 5JQGA 4O4IB 5B8FA 2KTUA 5MN6A 5GINC 2I6DA 1VQNF 4BVSA 5AVMA 5J2TB 3HKEB 3HKDB 3F6MA 3ON1A 2UZHA 3WJQA 4B5CA 5C8YB 2Z1EA 1UI9A 1W40A 5LYJB 4RQOA 2VAMA 3HKCA 1VQPF 3WJPA 3TD5A 3GTZA 2CSLA 1IV2A 2ZVZA 3CPQA 3AGKA 1W3EX 1FNKA 2BO1A 2HS0A 3S06A 3RYIA 1W2BF 1SZQA 1W59A 3LWPC 2IAFA 4ZK7A 2WALA 3WJRA 1K73H 2OTMA 2PMPA 5LP6B 1ZWZA 2OTLF 1H48A 2HRYA 3LWVC 4HNAA 1NMUB 3IKEA 2Z1FA 3FBAA 1Q7YH 1W5EA 3C8LA 1R1MA 1XV2A 2YYEA 3WGLA 4TUYA 2OZBA 1Z5WA 2CVLA 1W42A 1GO1A 5JH7B 1U43A 3K2XA 3UT5B 2UYJA 2RHOA 5EB0A 1W581 3BYQA 4G4VA 3OW2F 4IIJB 3HJWC 3R0PA 3E1YA 2I6RA 3ERNA 3K0TA 1SA0A 2GVIA 2LCAA 5EAZA 1TUBB 2UYPA 2HP0B 1FNJA 4X20A 5MN4A 1IV4A 5IYZA 1VQ6F 1KNKA 3LWOC 1IV1A 3LYBA 1OAPA 3N2KB 1PXWA 3S0HA 3V3TA 3QHDA 1T0AA 3JARB 4O2BB 4BW0B 4O4HA 1M90H 4O2AB 2MQEA 1FSZA 3CC4F 1W57A 3HKBA 3WGMA 3ZO8A 4TV8A 3C9TA 1VQ7F 2Z1UA 3S02A 3RYFB 2BTOA 1VK3A 4BT5A 5HWEA 4RHAA 1ODEA 4I4TA 3U0OA 5ITZB 2HVYD 3ZOPA 2R751 4NQ3A 3JAWB 5LOVA 1CLIA 4ZOLA 1CK2A 4BVTA 4IHJB 4C8IA 5IJ0A 3RYHA 3N2GB 4ZI7A 5IJ9A 2RHHA 2HS3A 5G4VC 2Z1TA 2GZLA 3FD6A 1YJWF 3ZP4A 1VHAA 2CHSA 2H8CA 3JAKA 3CCLF 2FC3A 2HS4A 2JNBA 4FFBB 5CA1B 3NK6A 4C81A 1ONIA 2R6R1
chains in the Genus database with same CATH topology
3T80A 1U3PA 3EORA 1YQNA 3IKFA 3RE3A 1VH8A 3F0DA 3IKEA 3B6NA 1IV4A 3FBAA 3F0FA 1KNKA 3F0EA 3F0GA 1IV1A 1KNJA 1IV2A 3FPIA 3MBMA 4C8EA 3KE1A 4C8IA 1JN1A 3QHDA 3P10A 5B8FA 1U43A 3K2XA 1T0AA 1JY8A 4C8GA 1IV3A 2AMTA 1GX1A 2GZLA 1H47A 3GHZA 3ESJA 1VHAA 2PMPA 3P0ZA 3F6MA 3JVHA 1U3LA 3K14A 1W57A 2UZHA 1U40A 3IEQA 3IEWA 4C81A 4C82A 1W55A 3Q8HA 3ERNA 3ELCA 1H48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T80 A;  1U3P A;  3EOR A;  1YQN A;  3IKF A;  3RE3 A;  1VH8 A;  3F0D A;  3IKE A;  3B6N A;  1IV4 A;  3FBA A;  3F0F A;  1KNK A;  3F0E A;  3F0G A;  1IV1 A;  1KNJ A;  1IV2 A;  3FPI A;  3MBM A;  4C8E A;  3KE1 A;  4C8I A;  1JN1 A;  3QHD A;  3P10 A;  5B8F A;  1U43 A;  3K2X A;  1T0A A;  1JY8 A;  4C8G A;  1IV3 A;  2AMT A;  1GX1 A;  2GZL A;  1H47 A;  3GHZ A;  3ESJ A;  1VHA A;  2PMP A;  3P0Z A;  3F6M A;  3JVH A;  1U3L A;  3K14 A;  1W57 A;  2UZH A;  1U40 A;  3IEQ A;  3IEW A;  4C81 A;  4C82 A;  1W55 A;  3Q8H A;  3ERN A;  3ELC A;  1H48 A; 
#chains in the Genus database with same CATH topology
 4X1K B;  5LP6 C;  1N8R H;  1VH8 A;  2HP3 A;  1J7H A;  1TVK B;  4WBN B;  4YJ2 A;  4B62 A;  3RYC A;  4EI8 A;  3P4E A;  3FFM A;  3IMP A;  5J2T A;  2ALE A;  1Q81 H;  3OON A;  3MBM A;  2AIZ P;  3FPI A;  3K12 A;  3HKD A;  1QD9 A;  5GON A;  4G4W A;  4C4W C;  3E20 B;  4O4J B;  2QA4 F;  1IPA A;  3M4S A;  4ZHV A;  2IQQ A;  3D01 A;  5LYJ A;  3SIU A;  3JAL B;  4ZHW A;  4B45 A;  1GO0 A;  3K14 A;  5HY1 A;  1FFX B;  5A2Q M;  4I55 B;  2OTJ F;  1RQ7 A;  4F6R A;  2CZW A;  3M1X A;  4EB6 A;  2H8E A;  1DBF A;  3KIZ A;  4X3L A;  3RE3 A;  3F0D A;  4X3M A;  5LXT B;  1M1K H;  3WPX A;  3L7Q A;  1Z5V A;  1YI2 F;  4TV9 B;  3WGJ A;  3JAS B;  3G71 F;  1JN1 A;  3D54 A;  1QVF F;  4X1I B;  5IT9 M;  1IV3 A;  2ZVY A;  3I7T A;  4EI7 A;  3V7E A;  3VMF B;  5GIO C;  1U3L A;  3VIU A;  2VXY A;  1VQ9 F;  3I56 F;  5LA6 B;  1Q86 H;  3ELC A;  2BTQ B;  2G9I A;  4XCQ A;  2EWC A;  5HY4 A;  1X7O A;  4O4L B;  5HXU A;  4IIJ A;  2Z01 A;  1X52 A;  2UYN B;  3QTY A;  3NVI B;  1RLU A;  2DYY A;  3HKC B;  1QAH A;  4PWT A;  1VQO F;  3JAT A;  4B46 A;  1YIJ F;  1XRG A;  3WGK A;  1YIT F;  4U39 A;  1YGY A;  5BMV A;  2W8B C;  3IR9 A;  4YJ3 B;  1U40 A;  3RYI B;  3N2K A;  4C82 A;  1VQL F;  4M8I A;  3JCM M;  3VYS C;  3J81 M;  5FNV A;  3CMA F;  3JAR A;  3DDN A;  1KQS F;  2UYK A;  3ZP7 A;  3CCJ F;  5KMG B;  5EO3 A;  1W5A A;  5EIB C;  4HNA B;  5JVD B;  5KX5 B;  5G4U C;  3RYF A;  1VQ8 F;  3RA5 A;  2VGN A;  3C9S A;  3G4S F;  1JFF A;  1XHO A;  4TUY B;  3JAW A;  3MQW A;  5JCO C;  2ZOD A;  1Q8R A;  4BVQ A;  3LME A;  1W55 A;  3N2G A;  1Q82 H;  2QTP A;  2Q1X A;  4X1Y B;  1NJI H;  3CCE F;  4BY9 D;  3NK7 A;  5CA0 B;  1QU9 A;  4DRX A;  3F0F A;  3PLA C;  4LNU B;  3OBY A;  5EZY B;  5EYP B;  1W5B A;  3CYQ A;  1SA0 B;  3V7Q A;  5CA1 A;  3G6E F;  4X20 B;  3LDT A;  3S0Y A;  2CW4 A;  5IYZ B;  4BT7 A;  1PF5 A;  1H47 A;  4E6E A;  3QUW A;  1TVK A;  3WXM B;  3CCU F;  2P6Y A;  2K1S A;  1GZ0 A;  2IG8 A;  3C9R A;  2N48 A;  1S72 F;  2AIF A;  4O4J A;  4O4I A;  3JAM M;  4O4H B;  1VQM F;  5GIP C;  1YHQ F;  3E22 B;  4DXD A;  3TD3 A;  3D00 A;  3JAL A;  3LFO A;  3HKE A;  3CC7 F;  3FD5 A;  4NWO B;  4BT3 A;  1FFX A;  3RA6 A;  4I4T B;  4I55 A;  2VAW A;  5C8Y A;  4ZHQ B;  2AMT A;  3V4D A;  3CCR F;  3ESJ A;  4ZHY B;  4U3J B;  3C9U A;  4ERH A;  1UFY A;  5HY0 A;  5IJ0 B;  5DCV A;  3RYH B;  3SIV A;  4ZI7 B;  2GLZ A;  3VI6 A;  5IJ9 B;  3IEQ A;  4BT6 A;  3MCQ A;  4TV9 A;  3N4Y A;  2Q1Y A;  1H7M A;  5HP7 A;  1X7P A;  4BT2 A;  3HTN A;  5J2U B;  4X1I A;  5CB4 B;  2QEX F;  2RHJ A;  1K8A H;  4BT4 A;  5FLX M;  2RB9 A;  3CCV F;  1T0K B;  2F9Z C;  4EI9 A;  4C8E A;  5LP6 A;  3P10 A;  3TD4 A;  4NUT A;  1W5F A;  4I50 B;  2ZAU A;  5LA6 A;  1YJ9 F;  4YJ2 B;  3RYC B;  2RHL A;  3I3F A;  3KHN A;  2KTV A;  1VQ5 F;  3CPW F;  5HXZ A;  5JQG B;  4O4L A;  3JVH A;  5GON B;  1JD1 A;  2HRU A;  3PAF A;  3CCS F;  2UYN A;  2CHT A;  3CXC F;  5JH7 A;  3EOR A;  3UT5 A;  1XBI A;  1RLG A;  5FJ4 C;  5EIB D;  3N4Z A;  3VCZ A;  1OFU A;  3F0E A;  3VOB A;  3MCA B;  3WGN A;  4F6R B;  4YJ3 A;  4EB6 B;  1QVG F;  2VAP A;  2KG4 A;  2NMU A;  3CME F;  1E7K A;  1KC8 H;  3CCM F;  1RQ2 A;  3GHZ A;  1RA4 A;  1TUB A;  2HP0 A;  2YXZ A;  2KGW A;  1K9M H;  3M84 A;  3GYQ A;  5KMG A;  3DC2 A;  2VGM A;  1VQ4 F;  3HAX D;  5JVD A;  5KX5 A;  3IKF A;  3B6N A;  1COM A;  2DT4 A;  3NVK E;  4O2B A;  3F0G A;  2L26 A;  3J7A R;  4O2A A;  3LWQ C;  3VYU C;  3VOA A;  2HQS C;  3I55 F;  4X1Y A;  1GX1 A;  4G88 A;  1NQ3 A;  3KJK A;  5CA0 A;  5ITZ A;  4LNU A;  5EZY A;  5EYP A;  3IEW A;  3JAT B;  1KD1 H;  3Q8H A;  4IHJ A;  3S0W A;  3T80 A;  1VQV A;  1YQN A;  5BMV B;  5GAN K;  3CG6 A;  4TZZ A;  1X25 A;  3CD6 F;  3KE1 A;  5FNV B;  4FFB A;  1JJ2 F;  1JY8 A;  4C8G A;  1VQK F;  2V9Y A;  4G4Z A;  2HX0 A;  1CN7 A;  4X1K A;  3E22 A;  3P0Z A;  4WBN A;  2CWJ A;  4G4Y A;  3CCQ F;  2H6L A;  3MDO A;  1SDS A;  5JCO A;  1JFF B;  2B33 A;  2PHN A;  4ZHQ A;  2LBT A;  3VO8 A;  4U3J A;  3HKB B;  3O85 A;  4TV8 B;  1KNJ A;  3KJJ A;  3OBW A;  3S03 A;  2ZF8 A;  2OHW A;  1W41 A;  5HP8 A;  4DRX B;  5GAP K;  1YJN F;  2BTU A;  3HWU A;  5EWR A;  5J2U A;  3J80 M;  2FGY A;  2LBX A;  5CB4 A;  5LOV B;  5EB1 B;  3CB2 A;  4ZOL B;  2LBW A;  4LCK A;  4R40 B;  5LXT A;  5HY2 A;  3CYP B;  5MN5 A;  3LWR C;  4BVR A;  4G4X A;  3JAS A;  4I50 A;  3NMU C;  1U3P A;  3VYT C;  3VTI C;  3CC2 F;  2QI2 A;  3WPW A;  3JAK B;  4KWE A;  2ZOV A;  1DT9 A;  5JQG A;  4O4I B;  5B8F A;  2KTU A;  5MN6 A;  5GIN C;  2I6D A;  1VQN F;  4BVS A;  5AVM A;  5J2T B;  3HKE B;  3HKD B;  3F6M A;  3ON1 A;  2UZH A;  3WJQ A;  4B5C A;  5C8Y B;  2Z1E A;  1UI9 A;  1W40 A;  5LYJ B;  4RQO A;  2VAM A;  3HKC A;  1VQP F;  3WJP A;  3TD5 A;  3GTZ A;  2CSL A;  1IV2 A;  2ZVZ A;  3CPQ A;  3AGK A;  1W3E X;  1FNK A;  2BO1 A;  2HS0 A;  3S06 A;  3RYI A;  1W2B F;  1SZQ A;  1W59 A;  3LWP C;  2IAF A;  4ZK7 A;  2WAL A;  3WJR A;  1K73 H;  2OTM A;  2PMP A;  5LP6 B;  1ZWZ A;  2OTL F;  1H48 A;  2HRY A;  3LWV C;  4HNA A;  1NMU B;  3IKE A;  2Z1F A;  3FBA A;  1Q7Y H;  1W5E A;  3C8L A;  1R1M A;  1XV2 A;  2YYE A;  3WGL A;  4TUY A;  2OZB A;  1Z5W A;  2CVL A;  1W42 A;  1GO1 A;  5JH7 B;  1U43 A;  3K2X A;  3UT5 B;  2UYJ A;  2RHO A;  5EB0 A;  1W58 1;  3BYQ A;  4G4V A;  3OW2 F;  4IIJ B;  3HJW C;  3R0P A;  3E1Y A;  2I6R A;  3ERN A;  3K0T A;  1SA0 A;  2GVI A;  2LCA A;  5EAZ A;  1TUB B;  2UYP A;  2HP0 B;  1FNJ A;  4X20 A;  5MN4 A;  1IV4 A;  5IYZ A;  1VQ6 F;  1KNK A;  3LWO C;  1IV1 A;  3LYB A;  1OAP A;  3N2K B;  1PXW A;  3S0H A;  3V3T A;  3QHD A;  1T0A A;  3JAR B;  4O2B B;  4BW0 B;  4O4H A;  1M90 H;  4O2A B;  2MQE A;  1FSZ A;  3CC4 F;  1W57 A;  3HKB A;  3WGM A;  3ZO8 A;  4TV8 A;  3C9T A;  1VQ7 F;  2Z1U A;  3S02 A;  3RYF B;  2BTO A;  1VK3 A;  4BT5 A;  5HWE A;  4RHA A;  1ODE A;  4I4T A;  3U0O A;  5ITZ B;  2HVY D;  3ZOP A;  2R75 1;  4NQ3 A;  3JAW B;  5LOV A;  1CLI A;  4ZOL A;  1CK2 A;  4BVT A;  4IHJ B;  4C8I A;  5IJ0 A;  3RYH A;  3N2G B;  4ZI7 A;  5IJ9 A;  2RHH A;  2HS3 A;  5G4V C;  2Z1T A;  2GZL A;  3FD6 A;  1YJW F;  3ZP4 A;  1VHA A;  2CHS A;  2H8C A;  3JAK A;  3CCL F;  2FC3 A;  2HS4 A;  2JNB A;  4FFB B;  5CA1 B;  3NK6 A;  4C81 A;  1ONI A;  2R6R 1; 
#chains in the Genus database with same CATH homology
 3T80 A;  1U3P A;  3EOR A;  1YQN A;  3IKF A;  3RE3 A;  1VH8 A;  3F0D A;  3IKE A;  3B6N A;  1IV4 A;  3FBA A;  3F0F A;  1KNK A;  3F0E A;  3F0G A;  1IV1 A;  1KNJ A;  1IV2 A;  3FPI A;  3MBM A;  4C8E A;  3KE1 A;  4C8I A;  1JN1 A;  3QHD A;  3P10 A;  5B8F A;  1U43 A;  3K2X A;  1T0A A;  1JY8 A;  4C8G A;  1IV3 A;  2AMT A;  1GX1 A;  2GZL A;  1H47 A;  3GHZ A;  3ESJ A;  1VHA A;  2PMP A;  3P0Z A;  3F6M A;  3JVH A;  1U3L A;  3K14 A;  1W57 A;  2UZH A;  1U40 A;  3IEQ A;  3IEW A;  4C81 A;  4C82 A;  1W55 A;  3Q8H A;  3ERN A;  3ELC A;  1H48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...