1U3LA

Ispf with mg and cdp
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structure of 2C-Methyl-D-Erythritol-2,4-Cyclodiphosphate Synthase Involved in Mevalonate Independent Biosynthesis of Isoprenoids
pubmed doi rcsb
source organism Escherichia coli
total genus 50
structure length 155
sequence length 155
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2004-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1u3lA00
1KNJA 4C81A 1IV3A 1YQNA 3FBAA 1JN1A 3K14A 1GX1A 3IEWA 2AMTA 1JY8A 3GHZA 3ELCA 4C8IA 1W57A 3F0DA 3RE3A 1IV4A 3MBMA 5B8FA 1W55A 3F0GA 1KNKA 1H47A 2UZHA 3IKEA 1U3LA 3B6NA 3K2XA 3IEQA 3Q8HA 3QHDA 3ERNA 1U43A 3ESJA 4C82A 3KE1A 3IKFA 1H48A 1IV2A 3T80A 3JVHA 3F6MA 3EORA 4C8GA 3F0FA 2PMPA 3P10A 1IV1A 1T0AA 4C8EA 2GZLA 3F0EA 1VH8A 1VHAA 3P0ZA 1U40A 3FPIA 1U3PA
chains in the Genus database with same CATH superfamily
1YJNF 2HS0A 2H8EA 2QEXF 4DRXA 3E1YA 3HJWC 4ZI7B 3OONA 2BO1A 4ERHA 1NQ3A 3O85A 2WALA 1TVKA 1GO0A 1FFXB 3HKBA 2KTUA 1H47A 1YI2F 3MCQA 3ERNA 5GIOC 4IIJA 4F6RA 3I7TA 1Q81H 3K12A 1SDSA 4ZHQB 3KJJA 5J2TB 1VQ5F 4X3MA 3N2KA 3OBWA 2ZVYA 1KNJA 1TUBB 4LNUA 4M8IA 4C81A 3SIVA 1W59A 2NMUA 3K14A 1JJ2F 2R6R1 1GZ0A 2V9YA 2DYYA 3M4SA 2I6RA 4BT3A 1N8RH 1JFFB 2CW4A 2ALEA 5JQGB 3LWRC 3FFMA 1RQ7A 3JARA 5IYZA 4BT2A 5HY0A 3P0ZA 5KMGA 1IV3A 3CCLF 5EZYA 2HS3A 2HP3A 2AIZP 3AGKA 4U3JB 3DC2A 3C9SA 3RYCA 4R40B 4O4HB 4BVQA 4O4LA 3OBYA 4I4TB 1XV2A 3GTZA 2ZAUA 1S72F 5HY2A 3S03A 1FSZA 3IKFA 1X25A 5IJ0A 4EI7A 2RB9A 5MN5A 3J81M 3S06A 2MQEA 1Q82H 3N2GB 4BT6A 3CPWF 4ZOLA 3MQWA 4WBNA 4TUYB 1VQKF 2RHHA 3CMAF 4E6EA 2AMTA 3G6EF 1E7KA 4LCKA 3C9RA 5IJ9A 2UYJA 3K2XA 2RHOA 3N4ZA 2N48A 5EWRA 2QI2A 5JVDB 1SA0A 5HWEA 4O2AA 3ON1A 5GANK 2FGYA 4I55B 1KQSF 1T0AA 3S02A 4EB6A 5J2UA 3CC7F 5AVMA 3LWPC 2LBTA 2OTJF 4O4JB 3JALA 3LDTA 4YJ2B 3CG6A 2HRUA 1UFYA 3JATB 5MN4A 1OFUA 1YGYA 1YITF 2ZOVA 5FNVA 3KIZA 4C8IA 1W42A 3F0DA 1YJ9F 2VAMA 3V7QA 1W5BA 5C8YB 1FNKA 1XBIA 2L26A 3RYHA 1QVGF 3KJKA 4X20B 4ZI7A 2HRYA 3WPXA 1VQ8F 1M1KH 4ZHVA 3V4DA 1K9MH 1FFXA 3P10A 2GLZA 3G4SF 4G4WA 4DXDA 5LXTB 3I55F 3L7QA 1YQNA 3UT5B 5CA1B 4O2BA 1VQNF 3RYIB 3JAMM 3C9UA 2H8CA 4G88A 4YJ3A 1R1MA 4BT4A 3NK6A 5J2TA 4TV8B 4X1KA 1VQMF 3M1XA 1W5EA 3RA6A 2CSLA 4ZHWA 3PLAC 4X1YB 3HKDA 3IEQA 3Q8HA 5HY1A 1VQOF 1VQ6F 4FFBB 3TD5A 5LOVB 3WJPA 3BYQA 5FJ4C 3ZO8A 4NQ3A 3CCRF 1VQ4F 4NWOB 3S0HA 3VTIC 3C9TA 2FC3A 3SIUA 5FLXM 3J80M 5JQGA 4B62A 5KX5B 4G4YA 2IG8A 3IEWA 3JASA 1T0KB 5HP8A 3MCAB 5GINC 1VQLF 3CXCF 4TZZA 3CCSF 1RA4A 4BVSA 3F0GA 1XRGA 5JCOC 1KNKA 2B33A 1RQ2A 2CZWA 4U3JA 5ITZB 3CCJF 3RA5A 4C4WC 1IV2A 3CYPB 3WXMB 1RLUA 4O4HA 2PHNA 1FNJA 5EO3A 4BT5A 4C8EA 4I4TA 4U39A 2VGNA 1TVKB 3VI6A 1U40A 2LBWA 2RHLA 3PAFA 4IIJB 1VQ7F 5JCOA 1W41A 3E22B 3VO8A 3NVIB 2VGMA 1QD9A 3N2GA 3ELCA 1W57A 3U0OA 3V3TA 3NVKE 4TUYA 3N2KB 3HTNA 1Z5VA 4G4XA 4BT7A 3WGNA 2GZLA 2HP0A 1UI9A 2OTLF 2K1SA 5JVDA 4B45A 3HKCB 5HXZA 3TD4A 4I55A 5BMVB 1KC8H 1JY8A 5IT9M 3JAKB 5LA6B 3GYQA 2Z1UA 5IYZB 4O4JA 1YJWF 1W2BF 5GAPK 2JNBA 2UZHA 2VAWA 3CCQF 1Q8RA 5LYJB 3MDOA 2UYNB 3I56F 3LWOC 3KE1A 3WGKA 1K73H 4X1IA 3NK7A 3CPQA 3EORA 3F0FA 3FD5A 4IHJA 3ZP4A 2IQQA 5C8YA 3RYCB 3CMEF 4O4LB 3FPIA 3D01A 1XHOA 1JD1A 4X20A 5EYPB 3JCMM 4BVRA 3ZP7A 4X3LA 5EB1B 1Z5WA 5EB0A 1JN1A 3J7AR 3D00A 1ZWZA 1IPAA 2ZVZA 1DT9A 4PWTA 1VQ9F 5LXTA 3RYFB 3JAWB 5EIBC 2KGWA 4I50B 1U3LA 1ONIA 3RYIA 4WBNB 3ESJA 3WGLA 2AIFA 3IMPA 4TV8A 1J7HA 3VCZA 2Q1YA 3HWUA 3KHNA 4B5CA 2BTUA 2Z1EA 1VH8A 4X1YA 1Q7YH 1KD1H 1H7MA 1VQVA 3VOBA 4FFBA 1X7OA 3FD6A 5LOVA 3R0PA 1SA0B 4XCQA 2HS4A 2EWCA 2UYPA 4ZHQA 1K8AH 4O2AB 3WGMA 4O4IB 3MBMA 5B8FA 3QTYA 5LP6B 1QAHA 3IKEA 1TUBA 3B6NA 3JALB 5GONB 5HY4A 2ZODA 2VXYA 2KG4A 1GO1A 2LCAA 3JVHA 1M90H 1W5AA 2CHTA 2KTVA 3CYQA 1PXWA 1JFFA 3RYHB 3HKEB 5ITZA 5CB4B 1SZQA 4HNAB 3CB2A 5G4VC 1VQPF 1QVFF 5MN6A 2Z1TA 3D54A 1COMA 3NMUC 3WPWA 3E20B 5JH7B 2Z1FA 4TV9B 5CA0B 2RHJA 5HXUA 3OW2F 1U43A 3E22A 4G4VA 2G9IA 4O2BB 2BTOA 1X7PA 1W581 2R751 4BY9D 3F6MA 4DRXB 1ODEA 1X52A 4YJ3B 2PMPA 5G4UC 4X1KB 3IR9A 3WGJA 2Z01A 3VMFB 3HAXD 4KWEA 4B46A 3HKBB 1W3EX 3HKDB 3CD6F 5EAZA 4F6RB 2ZF8A 3RE3A 1IV4A 3S0YA 2Q1XA 3N4YA 3HKCA 3P4EA 5BMVA 4LNUB 3CC4F 3JAKA 5LA6A 3JASB 2CVLA 4C8GA 1Q86H 2P6YA 1PF5A 1VHAA 2UYKA 5LYJA 3CCVF 1NJIH 2UYNA 2H6LA 2I6DA 3S0WA 2IAFA 2OTMA 3C8LA 1GX1A 3GHZA 3CCEF 3JARB 3LWQC 3QUWA 3LMEA 4BW0B 5EYPA 1DBFA 2HVYD 4YJ2A 2F9ZC 4RHAA 3JATA 3LYBA 3QHDA 4ZHYB 1YIJF 1OAPA 5KMGB 2QTPA 4NUTA 3T80A 5EZYB 1VK3A 3RYFA 2HX0A 3JAWA 3F0EA 2YXZA 4I50A 3CC2F 1QU9A 3VYTC 3G71F 2OZBA 4EI9A 3DDNA 3FBAA 3ZOPA 1CLIA 5LP6C 1CK2A 3WJQA 5HP7A 5IJ0B 3M84A 1W55A 2HP0B 3TD3A 4EI8A 3LWVC 3UT5A 5CA1A 4ZK7A 4ZOLB 4RQOA 2BTQB 3VIUA 5GIPC 1YHQF 3WJRA 4O4IA 2OHWA 5LP6A 5A2QM 3LFOA 2DT4A 2HQSC 5GONA 3VOAA 1U3PA 5IJ9B 3VYUC 3V7EA 2CHSA 3CCUF 1W40A 4G4ZA 2CWJA 4X1IB 4IHJB 3K0TA 2W8BC 2QA4F 3HKEA 5EIBD 2LBXA 5CB4A 4EB6B 5J2UB 4HNAA 3I3FA 1RLGA 5KX5A 5DCVA 2GVIA 4C82A 1H48A 1CN7A 2VAPA 5JH7A 3CCMF 4TV9A 5CA0A 1IV1A 1NMUB 4BVTA 2YYEA 5FNVB 1W5FA 3VYSC
chains in the Genus database with same CATH topology
1KNJA 4C81A 1IV3A 1YQNA 3FBAA 1JN1A 3K14A 1GX1A 3IEWA 2AMTA 1JY8A 3GHZA 3ELCA 4C8IA 1W57A 3F0DA 3RE3A 1IV4A 3MBMA 5B8FA 1W55A 3F0GA 1KNKA 1H47A 2UZHA 3IKEA 1U3LA 3B6NA 3K2XA 3IEQA 3Q8HA 3QHDA 3ERNA 1U43A 3ESJA 4C82A 3KE1A 3IKFA 1H48A 1IV2A 3T80A 3JVHA 3F6MA 3EORA 4C8GA 3F0FA 2PMPA 3P10A 1IV1A 1T0AA 4C8EA 2GZLA 3F0EA 1VH8A 1VHAA 3P0ZA 1U40A 3FPIA 1U3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KNJ A;  4C81 A;  1IV3 A;  1YQN A;  3FBA A;  1JN1 A;  3K14 A;  1GX1 A;  3IEW A;  2AMT A;  1JY8 A;  3GHZ A;  3ELC A;  4C8I A;  1W57 A;  3F0D A;  3RE3 A;  1IV4 A;  3MBM A;  5B8F A;  1W55 A;  3F0G A;  1KNK A;  1H47 A;  2UZH A;  3IKE A;  1U3L A;  3B6N A;  3K2X A;  3IEQ A;  3Q8H A;  3QHD A;  3ERN A;  1U43 A;  3ESJ A;  4C82 A;  3KE1 A;  3IKF A;  1H48 A;  1IV2 A;  3T80 A;  3JVH A;  3F6M A;  3EOR A;  4C8G A;  3F0F A;  2PMP A;  3P10 A;  1IV1 A;  1T0A A;  4C8E A;  2GZL A;  3F0E A;  1VH8 A;  1VHA A;  3P0Z A;  1U40 A;  3FPI A;  1U3P A; 
#chains in the Genus database with same CATH topology
 1YJN F;  2HS0 A;  2H8E A;  2QEX F;  4DRX A;  3E1Y A;  3HJW C;  4ZI7 B;  3OON A;  2BO1 A;  4ERH A;  1NQ3 A;  3O85 A;  2WAL A;  1TVK A;  1GO0 A;  1FFX B;  3HKB A;  2KTU A;  1H47 A;  1YI2 F;  3MCQ A;  3ERN A;  5GIO C;  4IIJ A;  4F6R A;  3I7T A;  1Q81 H;  3K12 A;  1SDS A;  4ZHQ B;  3KJJ A;  5J2T B;  1VQ5 F;  4X3M A;  3N2K A;  3OBW A;  2ZVY A;  1KNJ A;  1TUB B;  4LNU A;  4M8I A;  4C81 A;  3SIV A;  1W59 A;  2NMU A;  3K14 A;  1JJ2 F;  2R6R 1;  1GZ0 A;  2V9Y A;  2DYY A;  3M4S A;  2I6R A;  4BT3 A;  1N8R H;  1JFF B;  2CW4 A;  2ALE A;  5JQG B;  3LWR C;  3FFM A;  1RQ7 A;  3JAR A;  5IYZ A;  4BT2 A;  5HY0 A;  3P0Z A;  5KMG A;  1IV3 A;  3CCL F;  5EZY A;  2HS3 A;  2HP3 A;  2AIZ P;  3AGK A;  4U3J B;  3DC2 A;  3C9S A;  3RYC A;  4R40 B;  4O4H B;  4BVQ A;  4O4L A;  3OBY A;  4I4T B;  1XV2 A;  3GTZ A;  2ZAU A;  1S72 F;  5HY2 A;  3S03 A;  1FSZ A;  3IKF A;  1X25 A;  5IJ0 A;  4EI7 A;  2RB9 A;  5MN5 A;  3J81 M;  3S06 A;  2MQE A;  1Q82 H;  3N2G B;  4BT6 A;  3CPW F;  4ZOL A;  3MQW A;  4WBN A;  4TUY B;  1VQK F;  2RHH A;  3CMA F;  4E6E A;  2AMT A;  3G6E F;  1E7K A;  4LCK A;  3C9R A;  5IJ9 A;  2UYJ A;  3K2X A;  2RHO A;  3N4Z A;  2N48 A;  5EWR A;  2QI2 A;  5JVD B;  1SA0 A;  5HWE A;  4O2A A;  3ON1 A;  5GAN K;  2FGY A;  4I55 B;  1KQS F;  1T0A A;  3S02 A;  4EB6 A;  5J2U A;  3CC7 F;  5AVM A;  3LWP C;  2LBT A;  2OTJ F;  4O4J B;  3JAL A;  3LDT A;  4YJ2 B;  3CG6 A;  2HRU A;  1UFY A;  3JAT B;  5MN4 A;  1OFU A;  1YGY A;  1YIT F;  2ZOV A;  5FNV A;  3KIZ A;  4C8I A;  1W42 A;  3F0D A;  1YJ9 F;  2VAM A;  3V7Q A;  1W5B A;  5C8Y B;  1FNK A;  1XBI A;  2L26 A;  3RYH A;  1QVG F;  3KJK A;  4X20 B;  4ZI7 A;  2HRY A;  3WPX A;  1VQ8 F;  1M1K H;  4ZHV A;  3V4D A;  1K9M H;  1FFX A;  3P10 A;  2GLZ A;  3G4S F;  4G4W A;  4DXD A;  5LXT B;  3I55 F;  3L7Q A;  1YQN A;  3UT5 B;  5CA1 B;  4O2B A;  1VQN F;  3RYI B;  3JAM M;  3C9U A;  2H8C A;  4G88 A;  4YJ3 A;  1R1M A;  4BT4 A;  3NK6 A;  5J2T A;  4TV8 B;  4X1K A;  1VQM F;  3M1X A;  1W5E A;  3RA6 A;  2CSL A;  4ZHW A;  3PLA C;  4X1Y B;  3HKD A;  3IEQ A;  3Q8H A;  5HY1 A;  1VQO F;  1VQ6 F;  4FFB B;  3TD5 A;  5LOV B;  3WJP A;  3BYQ A;  5FJ4 C;  3ZO8 A;  4NQ3 A;  3CCR F;  1VQ4 F;  4NWO B;  3S0H A;  3VTI C;  3C9T A;  2FC3 A;  3SIU A;  5FLX M;  3J80 M;  5JQG A;  4B62 A;  5KX5 B;  4G4Y A;  2IG8 A;  3IEW A;  3JAS A;  1T0K B;  5HP8 A;  3MCA B;  5GIN C;  1VQL F;  3CXC F;  4TZZ A;  3CCS F;  1RA4 A;  4BVS A;  3F0G A;  1XRG A;  5JCO C;  1KNK A;  2B33 A;  1RQ2 A;  2CZW A;  4U3J A;  5ITZ B;  3CCJ F;  3RA5 A;  4C4W C;  1IV2 A;  3CYP B;  3WXM B;  1RLU A;  4O4H A;  2PHN A;  1FNJ A;  5EO3 A;  4BT5 A;  4C8E A;  4I4T A;  4U39 A;  2VGN A;  1TVK B;  3VI6 A;  1U40 A;  2LBW A;  2RHL A;  3PAF A;  4IIJ B;  1VQ7 F;  5JCO A;  1W41 A;  3E22 B;  3VO8 A;  3NVI B;  2VGM A;  1QD9 A;  3N2G A;  3ELC A;  1W57 A;  3U0O A;  3V3T A;  3NVK E;  4TUY A;  3N2K B;  3HTN A;  1Z5V A;  4G4X A;  4BT7 A;  3WGN A;  2GZL A;  2HP0 A;  1UI9 A;  2OTL F;  2K1S A;  5JVD A;  4B45 A;  3HKC B;  5HXZ A;  3TD4 A;  4I55 A;  5BMV B;  1KC8 H;  1JY8 A;  5IT9 M;  3JAK B;  5LA6 B;  3GYQ A;  2Z1U A;  5IYZ B;  4O4J A;  1YJW F;  1W2B F;  5GAP K;  2JNB A;  2UZH A;  2VAW A;  3CCQ F;  1Q8R A;  5LYJ B;  3MDO A;  2UYN B;  3I56 F;  3LWO C;  3KE1 A;  3WGK A;  1K73 H;  4X1I A;  3NK7 A;  3CPQ A;  3EOR A;  3F0F A;  3FD5 A;  4IHJ A;  3ZP4 A;  2IQQ A;  5C8Y A;  3RYC B;  3CME F;  4O4L B;  3FPI A;  3D01 A;  1XHO A;  1JD1 A;  4X20 A;  5EYP B;  3JCM M;  4BVR A;  3ZP7 A;  4X3L A;  5EB1 B;  1Z5W A;  5EB0 A;  1JN1 A;  3J7A R;  3D00 A;  1ZWZ A;  1IPA A;  2ZVZ A;  1DT9 A;  4PWT A;  1VQ9 F;  5LXT A;  3RYF B;  3JAW B;  5EIB C;  2KGW A;  4I50 B;  1U3L A;  1ONI A;  3RYI A;  4WBN B;  3ESJ A;  3WGL A;  2AIF A;  3IMP A;  4TV8 A;  1J7H A;  3VCZ A;  2Q1Y A;  3HWU A;  3KHN A;  4B5C A;  2BTU A;  2Z1E A;  1VH8 A;  4X1Y A;  1Q7Y H;  1KD1 H;  1H7M A;  1VQV A;  3VOB A;  4FFB A;  1X7O A;  3FD6 A;  5LOV A;  3R0P A;  1SA0 B;  4XCQ A;  2HS4 A;  2EWC A;  2UYP A;  4ZHQ A;  1K8A H;  4O2A B;  3WGM A;  4O4I B;  3MBM A;  5B8F A;  3QTY A;  5LP6 B;  1QAH A;  3IKE A;  1TUB A;  3B6N A;  3JAL B;  5GON B;  5HY4 A;  2ZOD A;  2VXY A;  2KG4 A;  1GO1 A;  2LCA A;  3JVH A;  1M90 H;  1W5A A;  2CHT A;  2KTV A;  3CYQ A;  1PXW A;  1JFF A;  3RYH B;  3HKE B;  5ITZ A;  5CB4 B;  1SZQ A;  4HNA B;  3CB2 A;  5G4V C;  1VQP F;  1QVF F;  5MN6 A;  2Z1T A;  3D54 A;  1COM A;  3NMU C;  3WPW A;  3E20 B;  5JH7 B;  2Z1F A;  4TV9 B;  5CA0 B;  2RHJ A;  5HXU A;  3OW2 F;  1U43 A;  3E22 A;  4G4V A;  2G9I A;  4O2B B;  2BTO A;  1X7P A;  1W58 1;  2R75 1;  4BY9 D;  3F6M A;  4DRX B;  1ODE A;  1X52 A;  4YJ3 B;  2PMP A;  5G4U C;  4X1K B;  3IR9 A;  3WGJ A;  2Z01 A;  3VMF B;  3HAX D;  4KWE A;  4B46 A;  3HKB B;  1W3E X;  3HKD B;  3CD6 F;  5EAZ A;  4F6R B;  2ZF8 A;  3RE3 A;  1IV4 A;  3S0Y A;  2Q1X A;  3N4Y A;  3HKC A;  3P4E A;  5BMV A;  4LNU B;  3CC4 F;  3JAK A;  5LA6 A;  3JAS B;  2CVL A;  4C8G A;  1Q86 H;  2P6Y A;  1PF5 A;  1VHA A;  2UYK A;  5LYJ A;  3CCV F;  1NJI H;  2UYN A;  2H6L A;  2I6D A;  3S0W A;  2IAF A;  2OTM A;  3C8L A;  1GX1 A;  3GHZ A;  3CCE F;  3JAR B;  3LWQ C;  3QUW A;  3LME A;  4BW0 B;  5EYP A;  1DBF A;  2HVY D;  4YJ2 A;  2F9Z C;  4RHA A;  3JAT A;  3LYB A;  3QHD A;  4ZHY B;  1YIJ F;  1OAP A;  5KMG B;  2QTP A;  4NUT A;  3T80 A;  5EZY B;  1VK3 A;  3RYF A;  2HX0 A;  3JAW A;  3F0E A;  2YXZ A;  4I50 A;  3CC2 F;  1QU9 A;  3VYT C;  3G71 F;  2OZB A;  4EI9 A;  3DDN A;  3FBA A;  3ZOP A;  1CLI A;  5LP6 C;  1CK2 A;  3WJQ A;  5HP7 A;  5IJ0 B;  3M84 A;  1W55 A;  2HP0 B;  3TD3 A;  4EI8 A;  3LWV C;  3UT5 A;  5CA1 A;  4ZK7 A;  4ZOL B;  4RQO A;  2BTQ B;  3VIU A;  5GIP C;  1YHQ F;  3WJR A;  4O4I A;  2OHW A;  5LP6 A;  5A2Q M;  3LFO A;  2DT4 A;  2HQS C;  5GON A;  3VOA A;  1U3P A;  5IJ9 B;  3VYU C;  3V7E A;  2CHS A;  3CCU F;  1W40 A;  4G4Z A;  2CWJ A;  4X1I B;  4IHJ B;  3K0T A;  2W8B C;  2QA4 F;  3HKE A;  5EIB D;  2LBX A;  5CB4 A;  4EB6 B;  5J2U B;  4HNA A;  3I3F A;  1RLG A;  5KX5 A;  5DCV A;  2GVI A;  4C82 A;  1H48 A;  1CN7 A;  2VAP A;  5JH7 A;  3CCM F;  4TV9 A;  5CA0 A;  1IV1 A;  1NMU B;  4BVT A;  2YYE A;  5FNV B;  1W5F A;  3VYS C; 
#chains in the Genus database with same CATH homology
 1KNJ A;  4C81 A;  1IV3 A;  1YQN A;  3FBA A;  1JN1 A;  3K14 A;  1GX1 A;  3IEW A;  2AMT A;  1JY8 A;  3GHZ A;  3ELC A;  4C8I A;  1W57 A;  3F0D A;  3RE3 A;  1IV4 A;  3MBM A;  5B8F A;  1W55 A;  3F0G A;  1KNK A;  1H47 A;  2UZH A;  3IKE A;  1U3L A;  3B6N A;  3K2X A;  3IEQ A;  3Q8H A;  3QHD A;  3ERN A;  1U43 A;  3ESJ A;  4C82 A;  3KE1 A;  3IKF A;  1H48 A;  1IV2 A;  3T80 A;  3JVH A;  3F6M A;  3EOR A;  4C8G A;  3F0F A;  2PMP A;  3P10 A;  1IV1 A;  1T0A A;  4C8E A;  2GZL A;  3F0E A;  1VH8 A;  1VHA A;  3P0Z A;  1U40 A;  3FPI A;  1U3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...