3I55F

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3i55F00
2I6DA 3JAMM 1VQKF 3CCUF 3CCLF 3NVKE 1IPAA 1XBIA 3CPWF 1QVGF 2LBXA 3LWVC 1Q7YH 1N8RH 1VQ6F 1GZ0A 5G4VC 1YI2F 2QI2A 1QVFF 1JJ2F 4TZZA 1VQNF 5EO3A 3HJWC 1NJIH 1W3EX 3SIVA 2LBWA 4LCKA 1X7PA 3CCEF 1GO1A 1X7OA 2KTUA 5FLXM 1M1KH 3CXCF 1X52A 4BW0B 1GO0A 1K8AH 1RA4A 3CCSF 3CC4F 4BY9D 2ALEA 3MCAB 1VQ9F 5DCVA 1VQ7F 2AIFA 3NMUC 1CK2A 3PAFA 3J81M 1VQOF 1YJNF 1YIJF 3NVIB 1Q82H 1K9MH 5GIPC 1K73H 2BO1A 3AGKA 3CD6F 4C4WC 3J80M 1PXWA 3CCJF 1W2BF 1SDSA 3N4ZA 3LWQC 3CPQA 1M90H 3I56F 1W40A 3ON1A 4NUTA 3VI6A 3LWRC 3I55F 1W42A 3NK7A 3V7EA 1YJWF 3NK6A 1VQMF 3LFOA 1YHQF 2JNBA 4X3LA 2OTJF 1RLGA 1W41A 5GINC 1VQLF 5G4UC 4X3MA 1KC8H 3WXMB 3OBWA 5FJ4C 1CN7A 2CZWA 1Q81H 3LWPC 3OW2F 1VQPF 1H7MA 3CMAF 3J7AR 1VQ4F 3IR9A 2FC3A 3G4SF 3RA6A 5IT9M 3CCMF 3CC7F 3VMFB 3JCMM 1YITF 3HAXD 3CMEF 5GIOC 5GAPK 2HVYD 2KG4A 3LWOC 2OTLF 3GYQA 1NMUB 3E20B 2VGMA 1VQ5F 2KTVA 3G71F 3OBYA 1KD1H 1Q86H 3FFMA 1T0KB 3PLAC 3CCVF 3RA5A 3E1YA 1E7KA 2QA4F 1KQSF 1S72F 3O85A 5EWRA 1YJ9F 3CCRF 1VQ8F 5GANK 2VGNA 5A2QM 3V7QA 2WALA 3N4YA 3SIUA 3CCQF 3CC2F 2OHWA 2OZBA 2QEXF 1ZWZA 3CG6A 3G6EF 1DT9A
chains in the Genus database with same CATH superfamily
3JAMM 4RHAA 3E22A 2MQEA 1GX1A 3C8LA 4XCQA 1W55A 5JH7B 5GONB 1IPAA 1VHAA 1QVGF 3F0FA 3KIZA 1VK3A 2G9IA 3VYSC 3LWVC 2Z1EA 1Q7YH 1R1MA 1GZ0A 1Z5WA 1IV3A 3VOBA 5EZYA 4TZZA 4ZI7B 3C9UA 5EO3A 3HJWC 5FNVA 1W3EX 2BTQB 2RHOA 4LCKA 1X7PA 4G4ZA 3CCEF 5LA6B 1KNKA 5EYPA 1QU9A 2ZOVA 1X52A 3CCSF 3LYBA 3GHZA 3MCQA 4G4YA 1VQ9F 3HKDB 4ZHQA 1YJNF 5BMVB 3AGKA 1PXWA 3JAWB 1XRGA 5HY1A 3F0GA 2UYJA 3CPQA 2Z01A 1OAPA 3QTYA 4O4HB 3LWRC 3HKDA 1W42A 4IHJA 3V7EA 1YJWF 3NK6A 1VQMF 3LFOA 1H48A 3E22B 2RHJA 4BVTA 5JCOC 1SZQA 2KGWA 2AMTA 4ZHVA 1RLGA 5EB0A 5G4UC 5ITZA 5LOVB 3WXMB 2CZWA 1Q81H 2QTPA 4O2BB 4C81A 4R40B 3LWPC 4O4JB 3CMAF 2HP0A 3G4SF 1IV1A 4X20B 4TV8A 3WGKA 3CC7F 3HAXD 4B45A 3IEQA 2KG4A 3B6NA 5KMGB 2VGMA 3CB2A 3HKEA 2RHHA 1TVKB 3G71F 5EIBC 1Q86H 3S0WA 1JY8A 3VYTC 3RA5A 3E1YA 2F9ZC 4O4LB 2HP3A 4EI8A 3U0OA 2QA4F 4O4HA 3LMEA 5HY0A 5EWRA 1YJ9F 5IYZB 2CW4A 1VQ8F 1W5FA 1U43A 2VGNA 4I4TB 3HWUA 4IIJB 1OFUA 3M1XA 3ZOPA 3K12A 4O4IB 1TUBA 3WPXA 2Q1XA 3G6EF 4O2BA 3RE3A 4B46A 3HKBA 2I6DA 2ZODA 3VIUA 1VQKF 5EYPB 3KJJA 2ZF8A 5HXZA 3FBAA 1U40A 4U3JB 3JARB 4YJ3A 5JVDB 4I50A 3IKEA 2H6LA 2QI2A 1COMA 1QVFF 3RYFB 2VAPA 4C8IA 2LBWA 3CYQA 3HKBB 4B62A 3HKCB 3JARA 5LP6C 3K0TA 2UYPA 3WJRA 1K8AH 4ZOLB 3UT5B 5DCVA 1CLIA 4G88A 2FGYA 5HP8A 5IYZA 3HTNA 5MN5A 1YIJF 2BTUA 1Q82H 4I4TA 5GIPC 1K73H 2BO1A 1PF5A 2I6RA 4TV9A 5JCOA 3CCJF 2GLZA 3K14A 3LWQC 4X1KB 2DYYA 1W40A 4NUTA 4HNAA 3VI6A 1JFFB 5JH7A 2HS0A 4ZHQB 1U3PA 5J2UB 2P6YA 4F6RB 4ZHWA 1W41A 1VQVA 2HS3A 5GINC 1VQLF 2NMUA 3VYUC 4EB6B 1UFYA 3S0HA 3LDTA 3TD3A 3J7AR 1VQ4F 2FC3A 1SA0A 3C9TA 2Q1YA 1W581 1Q8RA 3D01A 3JCMM 3ERNA 2UZHA 4FFBB 3CMEF 2EWCA 2K1SA 2VXYA 5LYJB 2PMPA 3UT5A 5IJ0A 5HXUA 4EB6A 2CVLA 5C8YA 5GONA 1VQ5F 2KTVA 3RYHB 3OBYA 3F0DA 3ZO8A 3FFMA 3DC2A 5HWEA 3O85A 4RQOA 1QAHA 1W5AA 3F0EA 3MQWA 5IJ9A 1T0AA 3VOAA 5A2QM 3V7QA 5LYJA 3N4YA 5JQGB 4I50B 3CC2F 5CA0B 5C8YB 4DRXB 2CSLA 1ZWZA 3RYCA 5ITZB 3CG6A 2RHLA 4C82A 3ZP4A 3KJKA 1ONIA 3ESJA 3V4DA 5B8FA 4O4IA 3MDOA 3QUWA 3L7QA 5EAZA 5EB1B 4FFBA 5LXTB 3CPWF 4U39A 5LP6A 2OTMA 1FNJA 4X1IB 3IMPA 3V3TA 5CA1A 1W5BA 1VQ6F 3DDNA 3VTIC 3ZP7A 1YI2F 2Z1UA 4X1KA 3RYHA 3JATB 3S02A 5LOVA 3S03A 4G4WA 1NJIH 4BVQA 1FFXB 1GO1A 4YJ3B 3JASB 4IIJA 4BW0B 1GO0A 1RA4A 1QD9A 1XV2A 3M4SA 4BY9D 3FD6A 3F6MA 4X20A 3CYPB 3RYFA 3NMUC 1W57A 5KX5B 1CK2A 3C9RA 1IV2A 3CD6F 4O2AA 3MBMA 3J80M 1W2BF 4G4XA 1SDSA 3WGJA 1M90H 4B5CA 2R6R1 2HRYA 3I55F 4YJ2B 1KNJA 1YHQF 2CHTA 2AIZP 4X3LA 2OTJF 1RQ7A 1FNKA 4TUYA 1VH8A 4BVRA 4DXDA 1JFFA 2ZAUA 2Z1TA 2HS4A 3OBWA 1IV4A 1CN7A 3M84A 1VQPF 4LNUB 1J7HA 1RQ2A 2N48A 3HKCA 1H7MA 2IG8A 3R0PA 3IR9A 3BYQA 1W5EA 3CCMF 3VMFB 5HP7A 1YITF 2HVYD 5GIOC 2HRUA 3GYQA 3P10A 1NMUB 2LCAA 3E20B 2ZVZA 4ZOLA 5AVMA 2YYEA 3JALA 5CB4A 2UYKA 5EZYB 3IEWA 3K2XA 4O2AB 1T0KB 4TV9B 4C8EA 4C8GA 3PLAC 3CCVF 1UI9A 3VO8A 1E7KA 2HX0A 5MN6A 4HNAB 5CB4B 4EI9A 4M8IA 2UYNA 4F6RA 5J2UA 2OHWA 3P0ZA 2OZBA 4BT6A 2QEXF 3FD5A 2V9YA 2L26A 3JAKB 4BT4A 5IJ9B 4WBNA 4IHJB 3P4EA 3JAWA 2GVIA 3FPIA 1JN1A 1XHOA 3CCUF 2DT4A 4DRXA 4E6EA 3KHNA 3CCLF 3NVKE 3JAKA 1XBIA 2ZVYA 2LBXA 5J2TA 2HQSC 2IQQA 3EORA 4BT5A 3IKFA 4X1YB 1N8RH 1U3LA 3TD4A 2YXZA 3WGMA 2VAWA 5IJ0B 3TD5A 5G4VC 4NQ3A 3KE1A 4I55A 1JJ2F 1DBFA 3OONA 1VQNF 2LBTA 2PHNA 3SIVA 4TV8B 5BMVA 2KTUA 1X7OA 4G4VA 2VAMA 4O4JA 4X1YA 4BT7A 5FLXM 2HP0B 5JQGA 3CXCF 1SA0B 1M1KH 3T80A 3CC4F 1TUBB 2ALEA 3MCAB 3RYCB 3WPWA 1VQ7F 2AIFA 3PAFA 1YGYA 3J81M 1VQOF 3NVIB 4C4WC 1K9MH 1FFXA 5MN4A 5KMGA 3RYIA 4LNUA 5CA0A 3N4ZA 4O4LA 2W8BC 2BTOA 4I55B 4BT2A 3I56F 3HKEB 3ON1A 3VCZA 5FNVB 4ERHA 3S0YA 4WBNB 5KX5A 3NK7A 1H47A 4U3JA 5LP6B 4NWOB 5CA1B 2JNBA 3WGLA 4X3MA 5LXTA 4PWTA 1KC8H 4ZHYB 3WGNA 3WJPA 1X25A 5FJ4C 4YJ2A 4X1IA 3D54A 3RYIB 3OW2F 3N2GB 3S06A 2CHSA 4TUYB 3JATA 3RA6A 5HY2A 5IT9M 1ODEA 2CWJA 3D00A 5GAPK 3WJQA 3LWOC 3JASA 2OTLF 3C9SA 3N2KB 2Z1FA 3GTZA 3I3FA 2GZLA 1RLUA 3JVHA 1FSZA 1KD1H 4BVSA 5HY4A 3N2GA 5JVDA 1Z5VA 5LA6A 3Q8HA 1W59A 1JD1A 3JALB 1KQSF 1S72F 1NQ3A 3CCRF 4EI7A 5GANK 3QHDA 2H8CA 5J2TB 2IAFA 3N2KA 5EIBD 2WALA 1YQNA 2R751 3SIUA 3CCQF 3I7TA 2B33A 1TVKA 4ZK7A 2RB9A 4ZI7A 2UYNB 4KWEA 3ELCA 1DT9A 2H8EA 4BT3A
chains in the Genus database with same CATH topology
2I6DA 3JAMM 1VQKF 3CCUF 3HAXD 4XCQA 3CCLF 5HXZA 3NVKE 1IPAA 1XBIA 3CPWF 1QVGF 2LBXA 3LWVC 1Q7YH 1N8RH 3V3TA 1VQ6F 1GZ0A 5G4VC 4NQ3A 1YI2F 2QI2A 1QVFF 1JJ2F 4TZZA 1VQNF 5EO3A 3HJWC 1NJIH 1W3EX 3SIVA 2LBWA 4BVQA 4LCKA 1X7PA 3CCEF 1GO1A 1X7OA 2KTUA 5FLXM 1M1KH 3CXCF 1X52A 4BW0B 1GO0A 1K8AH 1RA4A 3CCSF 3CC4F 4BY9D 2ALEA 3MCAB 1VQ9F 5DCVA 2FGYA 1VQ7F 2AIFA 3NMUC 1CK2A 3PAFA 3J81M 1VQOF 1YJNF 1YIJF 3NVIB 1Q82H 1K9MH 5GIPC 1K73H 2BO1A 3AGKA 3CD6F 4C4WC 3J80M 1PXWA 3CCJF 5HY1A 1W2BF 1SDSA 2GLZA 3N4ZA 3LWQC 3CPQA 1M90H 3I56F 1W40A 3ON1A 4NUTA 3VI6A 3LWRC 3I55F 1W42A 3NK7A 3V7EA 1YJWF 3NK6A 1VQMF 3LFOA 1YHQF 4BVTA 2JNBA 4X3LA 2OTJF 1RLGA 1W41A 4BVRA 5GINC 1VQLF 5G4UC 4X3MA 1KC8H 3WXMB 3OBWA 5FJ4C 1CN7A 2CZWA 1Q81H 3LWPC 3OW2F 1VQPF 1H7MA 3CMAF 3J7AR 1VQ4F 3IR9A 2FC3A 3G4SF 3RA6A 5HY2A 5IT9M 3D00A 3CCMF 3VMFB 3JCMM 1YITF 3CC7F 3CMEF 5GIOC 5GAPK 2HVYD 2KG4A 3LWOC 2OTLF 3GYQA 1NMUB 3E20B 2VGMA 5HXUA 1VQ5F 2KTVA 3G71F 3OBYA 1KD1H 1Q86H 3FFMA 4BVSA 1T0KB 3PLAC 5HY4A 3CCVF 3RA5A 3E1YA 2F9ZC 1E7KA 4EI8A 5HWEA 2QA4F 3O85A 4EI9A 1S72F 1KQSF 5HY0A 5EWRA 1YJ9F 3CCRF 1VQ8F 4EI7A 5GANK 2VGNA 5A2QM 3V7QA 2WALA 3N4YA 3SIUA 3CCQF 3CC2F 2OHWA 2OZBA 2QEXF 1ZWZA 3CG6A 3G6EF 1DT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I6D A;  3JAM M;  1VQK F;  3CCU F;  3CCL F;  3NVK E;  1IPA A;  1XBI A;  3CPW F;  1QVG F;  2LBX A;  3LWV C;  1Q7Y H;  1N8R H;  1VQ6 F;  1GZ0 A;  5G4V C;  1YI2 F;  2QI2 A;  1QVF F;  1JJ2 F;  4TZZ A;  1VQN F;  5EO3 A;  3HJW C;  1NJI H;  1W3E X;  3SIV A;  2LBW A;  4LCK A;  1X7P A;  3CCE F;  1GO1 A;  1X7O A;  2KTU A;  5FLX M;  1M1K H;  3CXC F;  1X52 A;  4BW0 B;  1GO0 A;  1K8A H;  1RA4 A;  3CCS F;  3CC4 F;  4BY9 D;  2ALE A;  3MCA B;  1VQ9 F;  5DCV A;  1VQ7 F;  2AIF A;  3NMU C;  1CK2 A;  3PAF A;  3J81 M;  1VQO F;  1YJN F;  1YIJ F;  3NVI B;  1Q82 H;  1K9M H;  5GIP C;  1K73 H;  2BO1 A;  3AGK A;  3CD6 F;  4C4W C;  3J80 M;  1PXW A;  3CCJ F;  1W2B F;  1SDS A;  3N4Z A;  3LWQ C;  3CPQ A;  1M90 H;  3I56 F;  1W40 A;  3ON1 A;  4NUT A;  3VI6 A;  3LWR C;  3I55 F;  1W42 A;  3NK7 A;  3V7E A;  1YJW F;  3NK6 A;  1VQM F;  3LFO A;  1YHQ F;  2JNB A;  4X3L A;  2OTJ F;  1RLG A;  1W41 A;  5GIN C;  1VQL F;  5G4U C;  4X3M A;  1KC8 H;  3WXM B;  3OBW A;  5FJ4 C;  1CN7 A;  2CZW A;  1Q81 H;  3LWP C;  3OW2 F;  1VQP F;  1H7M A;  3CMA F;  3J7A R;  1VQ4 F;  3IR9 A;  2FC3 A;  3G4S F;  3RA6 A;  5IT9 M;  3CCM F;  3CC7 F;  3VMF B;  3JCM M;  1YIT F;  3HAX D;  3CME F;  5GIO C;  5GAP K;  2HVY D;  2KG4 A;  3LWO C;  2OTL F;  3GYQ A;  1NMU B;  3E20 B;  2VGM A;  1VQ5 F;  2KTV A;  3G71 F;  3OBY A;  1KD1 H;  1Q86 H;  3FFM A;  1T0K B;  3PLA C;  3CCV F;  3RA5 A;  3E1Y A;  1E7K A;  2QA4 F;  1KQS F;  1S72 F;  3O85 A;  5EWR A;  1YJ9 F;  3CCR F;  1VQ8 F;  5GAN K;  2VGN A;  5A2Q M;  3V7Q A;  2WAL A;  3N4Y A;  3SIU A;  3CCQ F;  3CC2 F;  2OHW A;  2OZB A;  2QEX F;  1ZWZ A;  3CG6 A;  3G6E F;  1DT9 A; 
#chains in the Genus database with same CATH topology
 3JAM M;  4RHA A;  3E22 A;  2MQE A;  1GX1 A;  3C8L A;  4XCQ A;  1W55 A;  5JH7 B;  5GON B;  1IPA A;  1VHA A;  1QVG F;  3F0F A;  3KIZ A;  1VK3 A;  2G9I A;  3VYS C;  3LWV C;  2Z1E A;  1Q7Y H;  1R1M A;  1GZ0 A;  1Z5W A;  1IV3 A;  3VOB A;  5EZY A;  4TZZ A;  4ZI7 B;  3C9U A;  5EO3 A;  3HJW C;  5FNV A;  1W3E X;  2BTQ B;  2RHO A;  4LCK A;  1X7P A;  4G4Z A;  3CCE F;  5LA6 B;  1KNK A;  5EYP A;  1QU9 A;  2ZOV A;  1X52 A;  3CCS F;  3LYB A;  3GHZ A;  3MCQ A;  4G4Y A;  1VQ9 F;  3HKD B;  4ZHQ A;  1YJN F;  5BMV B;  3AGK A;  1PXW A;  3JAW B;  1XRG A;  5HY1 A;  3F0G A;  2UYJ A;  3CPQ A;  2Z01 A;  1OAP A;  3QTY A;  4O4H B;  3LWR C;  3HKD A;  1W42 A;  4IHJ A;  3V7E A;  1YJW F;  3NK6 A;  1VQM F;  3LFO A;  1H48 A;  3E22 B;  2RHJ A;  4BVT A;  5JCO C;  1SZQ A;  2KGW A;  2AMT A;  4ZHV A;  1RLG A;  5EB0 A;  5G4U C;  5ITZ A;  5LOV B;  3WXM B;  2CZW A;  1Q81 H;  2QTP A;  4O2B B;  4C81 A;  4R40 B;  3LWP C;  4O4J B;  3CMA F;  2HP0 A;  3G4S F;  1IV1 A;  4X20 B;  4TV8 A;  3WGK A;  3CC7 F;  3HAX D;  4B45 A;  3IEQ A;  2KG4 A;  3B6N A;  5KMG B;  2VGM A;  3CB2 A;  3HKE A;  2RHH A;  1TVK B;  3G71 F;  5EIB C;  1Q86 H;  3S0W A;  1JY8 A;  3VYT C;  3RA5 A;  3E1Y A;  2F9Z C;  4O4L B;  2HP3 A;  4EI8 A;  3U0O A;  2QA4 F;  4O4H A;  3LME A;  5HY0 A;  5EWR A;  1YJ9 F;  5IYZ B;  2CW4 A;  1VQ8 F;  1W5F A;  1U43 A;  2VGN A;  4I4T B;  3HWU A;  4IIJ B;  1OFU A;  3M1X A;  3ZOP A;  3K12 A;  4O4I B;  1TUB A;  3WPX A;  2Q1X A;  3G6E F;  4O2B A;  3RE3 A;  4B46 A;  3HKB A;  2I6D A;  2ZOD A;  3VIU A;  1VQK F;  5EYP B;  3KJJ A;  2ZF8 A;  5HXZ A;  3FBA A;  1U40 A;  4U3J B;  3JAR B;  4YJ3 A;  5JVD B;  4I50 A;  3IKE A;  2H6L A;  2QI2 A;  1COM A;  1QVF F;  3RYF B;  2VAP A;  4C8I A;  2LBW A;  3CYQ A;  3HKB B;  4B62 A;  3HKC B;  3JAR A;  5LP6 C;  3K0T A;  2UYP A;  3WJR A;  1K8A H;  4ZOL B;  3UT5 B;  5DCV A;  1CLI A;  4G88 A;  2FGY A;  5HP8 A;  5IYZ A;  3HTN A;  5MN5 A;  1YIJ F;  2BTU A;  1Q82 H;  4I4T A;  5GIP C;  1K73 H;  2BO1 A;  1PF5 A;  2I6R A;  4TV9 A;  5JCO A;  3CCJ F;  2GLZ A;  3K14 A;  3LWQ C;  4X1K B;  2DYY A;  1W40 A;  4NUT A;  4HNA A;  3VI6 A;  1JFF B;  5JH7 A;  2HS0 A;  4ZHQ B;  1U3P A;  5J2U B;  2P6Y A;  4F6R B;  4ZHW A;  1W41 A;  1VQV A;  2HS3 A;  5GIN C;  1VQL F;  2NMU A;  3VYU C;  4EB6 B;  1UFY A;  3S0H A;  3LDT A;  3TD3 A;  3J7A R;  1VQ4 F;  2FC3 A;  1SA0 A;  3C9T A;  2Q1Y A;  1W58 1;  1Q8R A;  3D01 A;  3JCM M;  3ERN A;  2UZH A;  4FFB B;  3CME F;  2EWC A;  2K1S A;  2VXY A;  5LYJ B;  2PMP A;  3UT5 A;  5IJ0 A;  5HXU A;  4EB6 A;  2CVL A;  5C8Y A;  5GON A;  1VQ5 F;  2KTV A;  3RYH B;  3OBY A;  3F0D A;  3ZO8 A;  3FFM A;  3DC2 A;  5HWE A;  3O85 A;  4RQO A;  1QAH A;  1W5A A;  3F0E A;  3MQW A;  5IJ9 A;  1T0A A;  3VOA A;  5A2Q M;  3V7Q A;  5LYJ A;  3N4Y A;  5JQG B;  4I50 B;  3CC2 F;  5CA0 B;  5C8Y B;  4DRX B;  2CSL A;  1ZWZ A;  3RYC A;  5ITZ B;  3CG6 A;  2RHL A;  4C82 A;  3ZP4 A;  3KJK A;  1ONI A;  3ESJ A;  3V4D A;  5B8F A;  4O4I A;  3MDO A;  3QUW A;  3L7Q A;  5EAZ A;  5EB1 B;  4FFB A;  5LXT B;  3CPW F;  4U39 A;  5LP6 A;  2OTM A;  1FNJ A;  4X1I B;  3IMP A;  3V3T A;  5CA1 A;  1W5B A;  1VQ6 F;  3DDN A;  3VTI C;  3ZP7 A;  1YI2 F;  2Z1U A;  4X1K A;  3RYH A;  3JAT B;  3S02 A;  5LOV A;  3S03 A;  4G4W A;  1NJI H;  4BVQ A;  1FFX B;  1GO1 A;  4YJ3 B;  3JAS B;  4IIJ A;  4BW0 B;  1GO0 A;  1RA4 A;  1QD9 A;  1XV2 A;  3M4S A;  4BY9 D;  3FD6 A;  3F6M A;  4X20 A;  3CYP B;  3RYF A;  3NMU C;  1W57 A;  5KX5 B;  1CK2 A;  3C9R A;  1IV2 A;  3CD6 F;  4O2A A;  3MBM A;  3J80 M;  1W2B F;  4G4X A;  1SDS A;  3WGJ A;  1M90 H;  4B5C A;  2R6R 1;  2HRY A;  3I55 F;  4YJ2 B;  1KNJ A;  1YHQ F;  2CHT A;  2AIZ P;  4X3L A;  2OTJ F;  1RQ7 A;  1FNK A;  4TUY A;  1VH8 A;  4BVR A;  4DXD A;  1JFF A;  2ZAU A;  2Z1T A;  2HS4 A;  3OBW A;  1IV4 A;  1CN7 A;  3M84 A;  1VQP F;  4LNU B;  1J7H A;  1RQ2 A;  2N48 A;  3HKC A;  1H7M A;  2IG8 A;  3R0P A;  3IR9 A;  3BYQ A;  1W5E A;  3CCM F;  3VMF B;  5HP7 A;  1YIT F;  2HVY D;  5GIO C;  2HRU A;  3GYQ A;  3P10 A;  1NMU B;  2LCA A;  3E20 B;  2ZVZ A;  4ZOL A;  5AVM A;  2YYE A;  3JAL A;  5CB4 A;  2UYK A;  5EZY B;  3IEW A;  3K2X A;  4O2A B;  1T0K B;  4TV9 B;  4C8E A;  4C8G A;  3PLA C;  3CCV F;  1UI9 A;  3VO8 A;  1E7K A;  2HX0 A;  5MN6 A;  4HNA B;  5CB4 B;  4EI9 A;  4M8I A;  2UYN A;  4F6R A;  5J2U A;  2OHW A;  3P0Z A;  2OZB A;  4BT6 A;  2QEX F;  3FD5 A;  2V9Y A;  2L26 A;  3JAK B;  4BT4 A;  5IJ9 B;  4WBN A;  4IHJ B;  3P4E A;  3JAW A;  2GVI A;  3FPI A;  1JN1 A;  1XHO A;  3CCU F;  2DT4 A;  4DRX A;  4E6E A;  3KHN A;  3CCL F;  3NVK E;  3JAK A;  1XBI A;  2ZVY A;  2LBX A;  5J2T A;  2HQS C;  2IQQ A;  3EOR A;  4BT5 A;  3IKF A;  4X1Y B;  1N8R H;  1U3L A;  3TD4 A;  2YXZ A;  3WGM A;  2VAW A;  5IJ0 B;  3TD5 A;  5G4V C;  4NQ3 A;  3KE1 A;  4I55 A;  1JJ2 F;  1DBF A;  3OON A;  1VQN F;  2LBT A;  2PHN A;  3SIV A;  4TV8 B;  5BMV A;  2KTU A;  1X7O A;  4G4V A;  2VAM A;  4O4J A;  4X1Y A;  4BT7 A;  5FLX M;  2HP0 B;  5JQG A;  3CXC F;  1SA0 B;  1M1K H;  3T80 A;  3CC4 F;  1TUB B;  2ALE A;  3MCA B;  3RYC B;  3WPW A;  1VQ7 F;  2AIF A;  3PAF A;  1YGY A;  3J81 M;  1VQO F;  3NVI B;  4C4W C;  1K9M H;  1FFX A;  5MN4 A;  5KMG A;  3RYI A;  4LNU A;  5CA0 A;  3N4Z A;  4O4L A;  2W8B C;  2BTO A;  4I55 B;  4BT2 A;  3I56 F;  3HKE B;  3ON1 A;  3VCZ A;  5FNV B;  4ERH A;  3S0Y A;  4WBN B;  5KX5 A;  3NK7 A;  1H47 A;  4U3J A;  5LP6 B;  4NWO B;  5CA1 B;  2JNB A;  3WGL A;  4X3M A;  5LXT A;  4PWT A;  1KC8 H;  4ZHY B;  3WGN A;  3WJP A;  1X25 A;  5FJ4 C;  4YJ2 A;  4X1I A;  3D54 A;  3RYI B;  3OW2 F;  3N2G B;  3S06 A;  2CHS A;  4TUY B;  3JAT A;  3RA6 A;  5HY2 A;  5IT9 M;  1ODE A;  2CWJ A;  3D00 A;  5GAP K;  3WJQ A;  3LWO C;  3JAS A;  2OTL F;  3C9S A;  3N2K B;  2Z1F A;  3GTZ A;  3I3F A;  2GZL A;  1RLU A;  3JVH A;  1FSZ A;  1KD1 H;  4BVS A;  5HY4 A;  3N2G A;  5JVD A;  1Z5V A;  5LA6 A;  3Q8H A;  1W59 A;  1JD1 A;  3JAL B;  1KQS F;  1S72 F;  1NQ3 A;  3CCR F;  4EI7 A;  5GAN K;  3QHD A;  2H8C A;  5J2T B;  2IAF A;  3N2K A;  5EIB D;  2WAL A;  1YQN A;  2R75 1;  3SIU A;  3CCQ F;  3I7T A;  2B33 A;  1TVK A;  4ZK7 A;  2RB9 A;  4ZI7 A;  2UYN B;  4KWE A;  3ELC A;  1DT9 A;  2H8E A;  4BT3 A; 
#chains in the Genus database with same CATH homology
 2I6D A;  3JAM M;  1VQK F;  3CCU F;  3HAX D;  4XCQ A;  3CCL F;  5HXZ A;  3NVK E;  1IPA A;  1XBI A;  3CPW F;  1QVG F;  2LBX A;  3LWV C;  1Q7Y H;  1N8R H;  3V3T A;  1VQ6 F;  1GZ0 A;  5G4V C;  4NQ3 A;  1YI2 F;  2QI2 A;  1QVF F;  1JJ2 F;  4TZZ A;  1VQN F;  5EO3 A;  3HJW C;  1NJI H;  1W3E X;  3SIV A;  2LBW A;  4BVQ A;  4LCK A;  1X7P A;  3CCE F;  1GO1 A;  1X7O A;  2KTU A;  5FLX M;  1M1K H;  3CXC F;  1X52 A;  4BW0 B;  1GO0 A;  1K8A H;  1RA4 A;  3CCS F;  3CC4 F;  4BY9 D;  2ALE A;  3MCA B;  1VQ9 F;  5DCV A;  2FGY A;  1VQ7 F;  2AIF A;  3NMU C;  1CK2 A;  3PAF A;  3J81 M;  1VQO F;  1YJN F;  1YIJ F;  3NVI B;  1Q82 H;  1K9M H;  5GIP C;  1K73 H;  2BO1 A;  3AGK A;  3CD6 F;  4C4W C;  3J80 M;  1PXW A;  3CCJ F;  5HY1 A;  1W2B F;  1SDS A;  2GLZ A;  3N4Z A;  3LWQ C;  3CPQ A;  1M90 H;  3I56 F;  1W40 A;  3ON1 A;  4NUT A;  3VI6 A;  3LWR C;  3I55 F;  1W42 A;  3NK7 A;  3V7E A;  1YJW F;  3NK6 A;  1VQM F;  3LFO A;  1YHQ F;  4BVT A;  2JNB A;  4X3L A;  2OTJ F;  1RLG A;  1W41 A;  4BVR A;  5GIN C;  1VQL F;  5G4U C;  4X3M A;  1KC8 H;  3WXM B;  3OBW A;  5FJ4 C;  1CN7 A;  2CZW A;  1Q81 H;  3LWP C;  3OW2 F;  1VQP F;  1H7M A;  3CMA F;  3J7A R;  1VQ4 F;  3IR9 A;  2FC3 A;  3G4S F;  3RA6 A;  5HY2 A;  5IT9 M;  3D00 A;  3CCM F;  3VMF B;  3JCM M;  1YIT F;  3CC7 F;  3CME F;  5GIO C;  5GAP K;  2HVY D;  2KG4 A;  3LWO C;  2OTL F;  3GYQ A;  1NMU B;  3E20 B;  2VGM A;  5HXU A;  1VQ5 F;  2KTV A;  3G71 F;  3OBY A;  1KD1 H;  1Q86 H;  3FFM A;  4BVS A;  1T0K B;  3PLA C;  5HY4 A;  3CCV F;  3RA5 A;  3E1Y A;  2F9Z C;  1E7K A;  4EI8 A;  5HWE A;  2QA4 F;  3O85 A;  4EI9 A;  1S72 F;  1KQS F;  5HY0 A;  5EWR A;  1YJ9 F;  3CCR F;  1VQ8 F;  4EI7 A;  5GAN K;  2VGN A;  5A2Q M;  3V7Q A;  2WAL A;  3N4Y A;  3SIU A;  3CCQ F;  3CC2 F;  2OHW A;  2OZB A;  2QEX F;  1ZWZ A;  3CG6 A;  3G6E F;  1DT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...