3I55F

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3i55F00
5DCVA 1YI2F 3CD6F 3SIVA 3CCQF 5EWRA 1VQLF 3CXCF 1QVGF 2HVYD 1KQSF 1T0KB 2OTLF 3RA5A 1M90H 1VQMF 2I6DA 3OW2F 3CG6A 3I56F 1RA4A 3CCLF 5GAPK 1YIJF 1VQ4F 5G4VC 2QI2A 1YJWF 5GANK 2KTUA 3PLAC 1VQ6F 2LBXA 3FFMA 3PAFA 3CCJF 5IT9M 3AGKA 1Q7YH 2KG4A 4TZZA 2CZWA 2FC3A 1W42A 2VGNA 3RA6A 1JJ2F 3OBWA 5GIPC 4BY9D 1VQ5F 3V7QA 5GIOC 1K9MH 1VQ9F 1VQ8F 2JNBA 4X3LA 3CCRF 5GINC 3SIUA 2QEXF 3NMUC 3NVIB 1Q86H 3N4YA 1X7OA 3LFOA 1N8RH 1W40A 1E7KA 1NMUB 1GO1A 1S72F 3CC4F 1VQOF 2VGMA 4X3MA 2LBWA 3LWQC 5G4UC 1GZ0A 3JCMM 3V7EA 1Q82H 4LCKA 3I55F 1IPAA 3CCSF 1PXWA 1VQPF 3CPWF 1YJ9F 5A2QM 1YITF 3NK6A 3CCUF 1K8AH 3CMEF 5EO3A 3O85A 1SDSA 1YJNF 3HAXD 3OBYA 1CK2A 2OZBA 1VQKF 3E20B 1YHQF 3CC2F 3CMAF 2WALA 1CN7A 2OTJF 3LWRC 1KC8H 2QA4F 5FLXM 4BW0B 1W2BF 1M1KH 3CCMF 4NUTA 1H7MA 3E1YA 2OHWA 3CC7F 3CCVF 3NVKE 5FJ4C 1X7PA 3VMFB 1KD1H 3G4SF 1K73H 2AIFA 3J80M 2KTVA 3LWPC 3ON1A 1XBIA 2ALEA 1NJIH 1VQNF 3LWVC 1RLGA 1W3EX 1X52A 3J7AR 3G71F 3G6EF 3IR9A 3N4ZA 1W41A 4C4WC 3VI6A 3CCEF 1Q81H 3MCAB 3NK7A 3GYQA 3HJWC 3JAMM 3J81M 2BO1A 3LWOC 3WXMB 1QVFF 1ZWZA 3CPQA 1VQ7F 1DT9A 1GO0A
chains in the Genus database with same CATH superfamily
4X1YA 3RYCB 3JAWA 5LXTB 2BTOA 1VQLF 2HVYD 2AMTA 4DRXA 4TUYA 1M90H 5JVDB 3M1XA 4NWOB 5LOVA 1YQNA 1RA4A 3VYUC 2EWCA 3TD5A 5G4VC 5HY1A 5GANK 1W57A 3ZP4A 5LA6B 2LBXA 3FFMA 3CCJF 2ZOVA 3AGKA 2KG4A 3KHNA 2Q1YA 2CZWA 3HKDA 1COMA 5GIPC 4I55A 2K1SA 2RHLA 4BY9D 4X20B 3V7QA 1VQ9F 1VQ8F 1SA0A 5HY0A 5GINC 3SIUA 2VAMA 3CYQA 1JFFA 1OFUA 4EI9A 3LFOA 5EB1B 1N8RH 5HXUA 4IIJB 3V3TA 2ZVYA 2KGWA 5J2UB 1NMUB 3CB2A 3MQWA 1VQOF 3C8LA 2VGMA 3HKCB 1Z5VA 2LBWA 4C8EA 4C82A 3RYFA 5CA0A 3LWQC 5KMGB 3RYIB 2BTQB 3I55F 1IPAA 4ZHVA 3JATB 2R6R1 2HQSC 5JH7A 3DDNA 1FFXA 3HWUA 2DT4A 5IJ0B 4WBNA 5EYPB 2R751 2CVLA 2DYYA 1VHAA 5JQGB 3RYHB 3VOBA 2OZBA 3Q8HA 1IV2A 4X1KB 3E20B 1VQKF 5EIBD 3JAKA 2OTJF 5CA1B 2P6YA 2W8BC 5FLXM 5CB4B 4NUTA 3EORA 2Z01A 3E1YA 5JCOA 2HP0A 1U43A 1W5AA 2RHJA 2HRYA 2Z1UA 3IEWA 1JFFB 1K73H 3N2GB 3J80M 2Z1EA 2KTVA 2CHTA 3LWPC 4YJ2A 4IHJB 1VQNF 4TV8B 3K12A 4C8GA 3M4SA 3J7AR 4ZOLA 4U39A 4ERHA 4YJ2B 3WGNA 3G71F 3IR9A 5C8YA 2UZHA 1R1MA 3CCEF 5LP6C 5LYJB 4RHAA 4M8IA 2IG8A 5EIBC 2PHNA 3WXMB 1QAHA 1DT9A 2CWJA 1FSZA 3B6NA 3IMPA 1GO0A 1XV2A 1YI2F 3OONA 3SIVA 4KWEA 5EWRA 5LOVB 4BVQA 1VQMF 5IYZB 3N2KA 2G9IA 3ZP7A 2NMUA 3RYCA 5BMVB 3RYHA 3WGKA 3KIZA 3HKEA 1VQ6F 5EYPA 3QHDA 5IT9M 1Q7YH 4O2BB 5IJ0A 4B46A 5AVMA 2FC3A 3RE3A 4I50A 5FNVB 2LCAA 3K14A 4BVTA 5GIOC 3VOAA 1QD9A 4FFBB 2JNBA 4IHJA 1U3PA 4BT5A 4I4TB 2QEXF 3NMUC 5CA0B 5KX5B 3LMEA 3VYTC 1W5BA 1IV4A 3C9TA 1W40A 3UT5A 2FGYA 4ZI7B 3R0PA 4EB6A 3WJRA 3JCMM 2GLZA 1JY8A 1U3LA 2HP3A 5MN5A 5CA1A 3V7EA 4O4JB 3I3FA 4LCKA 4FFBA 3HKEB 5A2QM 3WPWA 2YXZA 5HY2A 4PWTA 2AIZP 5HP7A 2CSLA 4F6RA 5LA6A 1K8AH 3CMEF 4O4LA 1SDSA 1YJNF 2ZVZA 3JATA 1TVKA 2HS0A 2CHSA 1CN7A 3K2XA 5JVDA 4ZK7A 3KE1A 4EI8A 2MQEA 3JAWB 1PF5A 2V9YA 4ZOLB 3CC7F 1X7PA 3T80A 1KD1H 3IKEA 5LYJA 1XRGA 3ON1A 1XBIA 5C8YB 2ALEA 3D54A 1SA0B 1RLGA 1JD1A 3HKDB 1Z5WA 3N4ZA 1W41A 3KJJA 4C4WC 2YYEA 3VYSC 1Q81H 3MCAB 4I4TA 3GYQA 3JAMM 3C9SA 3J81M 3LWOC 1ZWZA 3CPQA 3P4EA 4G4ZA 4X1KA 2HP0B 3CYPB 4I50B 5FNVA 3CCQF 4X1IB 1KQSF 1T0KB 2IQQA 3RA5A 4DRXB 4DXDA 3JAKB 3OW2F 3FD6A 4O4IA 1VQ4F 5GAPK 1OAPA 3JARB 5EAZA 2QI2A 1X25A 3JARA 3VCZA 1YJWF 2RHHA 2HX0A 3F0GA 1T0AA 2KTUA 3PLAC 5IYZA 4O4JA 2B33A 3F0FA 3PAFA 3RYIA 4X1IA 4TZZA 5LP6B 1Q8RA 1W42A 3HKCA 5HWEA 2VGNA 3RA6A 1JJ2F 3OBWA 1H47A 2H8EA 3WJPA 4B5CA 3WPXA 1H48A 4G4WA 5GONA 4BT3A 1YGYA 5KMGA 2HRUA 1SZQA 3S03A 4G4YA 1IV1A 4O2AB 3ERNA 4G88A 1FNJA 5J2TB 3LDTA 1E7KA 3BYQA 4I55B 3DC2A 3VTIC 1S72F 3CC4F 4TV8A 3L7QA 4BVSA 4X3MA 4BT7A 5G4UC 4ZHYB 3N2GA 3I7TA 1Q82H 3ZOPA 3HTNA 2ZF8A 1TUBA 1VQPF 3CPWF 1W55A 3MBMA 3ELCA 5CB4A 3F0EA 3NK6A 3S0WA 2UYKA 2I6RA 4G4XA 3F0DA 5EO3A 5LXTA 1KNKA 3QTYA 1TVKB 2Q1XA 1CK2A 3CC2F 3CMAF 3S0YA 3JALA 3JASB 4YJ3A 3LWRC 1GX1A 5EB0A 4WBNB 2RHOA 4B62A 1FFXB 1ONIA 1RLUA 4BW0B 1VQVA 3CCMF 4BVRA 3MDOA 1M1KH 3M84A 2OHWA 4HNAB 4X1YB 4BT2A 3NVKE 5FJ4C 3C9UA 4RQOA 2Z1TA 2GZLA 3VMFB 4C81A 2IAFA 4ZHQB 4EB6B 5ITZA 1W5FA 4U3JB 3ZO8A 1NJIH 4E6EA 3LWVC 1UI9A 2F9ZC 2ZAUA 5J2UA 4ZI7A 4IIJA 3S06A 4C8IA 3F6MA 4XCQA 5KX5A 5LP6A 5ITZB 3ESJA 3NK7A 2RB9A 3TD3A 3FD5A 1VQ7F 3D00A 5DCVA 1RQ2A 5JQGA 3CD6F 4O4IB 3V4DA 3CXCF 1QVGF 4O2BA 1XHOA 2OTLF 3JALB 1UFYA 3JASA 4YJ3B 5HP8A 2I6DA 3CG6A 3I56F 4NQ3A 2OTMA 3C9RA 3VIUA 3CCLF 1YIJF 5JH7B 5BMVA 2HS4A 3S0HA 5JCOC 1RQ7A 3N2KB 4R40B 2UYJA 4TUYB 4O4HB 2LBTA 2PMPA 3E22B 3IEQA 3RYFB 1W5EA 5B8FA 2UYPA 1VQ5F 3P0ZA 1K9MH 2N48A 5IJ9A 4X3LA 3CCRF 2UYNA 1DBFA 3FPIA 3HKBA 3WGMA 2ZODA 2HS3A 3NVIB 1Q86H 2UYNB 3JVHA 3N4YA 1X7OA 2BTUA 2CW4A 5EZYA 4X20A 1VK3A 1GO1A 5EZYB 2H6LA 2VAWA 5MN4A 4O2AA 3P10A 5J2TA 1ODEA 1GZ0A 1CLIA 3E22A 3HKBB 3D01A 5GONB 5IJ9B 3CCSF 1PXWA 1U40A 1YJ9F 3U0OA 1YITF 4LNUA 4B45A 1NQ3A 4O4LB 1W59A 3WGJA 4F6RB 4O4HA 3S02A 3CCUF 4ZHWA 3LYBA 3K0TA 3O85A 5HY4A 3HAXD 3OBYA 3TD4A 4BT6A 3GHZA 1J7HA 1YHQF 1TUBB 2WALA 3GTZA 1KC8H 2QA4F 1W2BF 3MCQA 4TV9B 4LNUB 1H7MA 1W581 3CCVF 5HXZA 2QTPA 1IV3A 3UT5B 4U3JA 3IKFA 3G4SF 1VH8A 2AIFA 3VO8A 1KNJA 1FNKA 3FBAA 3KJKA 1W3EX 1X52A 4BT4A 4HNAA 3QUWA 2Z1FA 4EI7A 2VXYA 3G6EF 1QU9A 4TV9A 3WJQA 4G4VA 3VI6A 2VAPA 2H8CA 1JN1A 4ZHQA 3WGLA 3HJWC 2GVIA 2L26A 2BO1A 1QVFF 5MN6A
chains in the Genus database with same CATH topology
3D00A 5DCVA 1YI2F 3CD6F 3SIVA 3CCQF 5EWRA 1VQLF 3CXCF 1QVGF 2HVYD 1KQSF 1T0KB 4BVQA 2OTLF 3RA5A 1M90H 1VQMF 2I6DA 3OW2F 3CG6A 3I56F 4NQ3A 1RA4A 3CCLF 5GAPK 1YIJF 1VQ4F 5G4VC 2QI2A 1YJWF 5HY1A 5GANK 2KTUA 3PLAC 1VQ6F 2LBXA 3FFMA 3PAFA 3CCJF 5IT9M 3AGKA 1Q7YH 2KG4A 4TZZA 2CZWA 2FC3A 1W42A 5HWEA 2VGNA 3RA6A 1JJ2F 3OBWA 5GIPC 4BVTA 1VQ5F 3V7QA 5GIOC 1K9MH 1VQ9F 4BY9D 1VQ8F 2JNBA 4X3LA 5HY0A 3CCRF 5GINC 3SIUA 2QEXF 3NMUC 3NVIB 1Q86H 4EI9A 3N4YA 1X7OA 3LFOA 1N8RH 1W40A 5HXUA 2FGYA 3V3TA 1E7KA 1NMUB 1GO1A 1S72F 3CC4F 4BVSA 1VQOF 2VGMA 4X3MA 2LBWA 3LWQC 5G4UC 1GZ0A 3JCMM 2GLZA 3V7EA 1Q82H 4LCKA 3I55F 1IPAA 3CCSF 1PXWA 1VQPF 3CPWF 1YJ9F 5A2QM 1YITF 5HY2A 3NK6A 3CCUF 1K8AH 3CMEF 5EO3A 3O85A 1SDSA 5HY4A 1YJNF 3HAXD 3OBYA 1CK2A 2OZBA 1VQKF 3E20B 1YHQF 3CC2F 3CMAF 2WALA 1CN7A 2OTJF 3LWRC 1KC8H 2QA4F 4EI8A 5FLXM 4BW0B 1W2BF 1M1KH 3CCMF 4BVRA 4NUTA 1H7MA 3E1YA 2OHWA 3CC7F 3CCVF 5HXZA 3NVKE 5FJ4C 1X7PA 3VMFB 1KD1H 3G4SF 1K73H 2AIFA 3J80M 2KTVA 3LWPC 3ON1A 1XBIA 2ALEA 1NJIH 1VQNF 3LWVC 2F9ZC 1RLGA 1W3EX 1X52A 3J7AR 4EI7A 3G71F 3G6EF 4XCQA 3IR9A 3N4ZA 1W41A 4C4WC 3VI6A 3CCEF 1Q81H 3MCAB 3NK7A 3GYQA 3HJWC 3JAMM 3J81M 2BO1A 3LWOC 3WXMB 1QVFF 1ZWZA 3CPQA 1VQ7F 1DT9A 1GO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DCV A;  1YI2 F;  3CD6 F;  3SIV A;  3CCQ F;  5EWR A;  1VQL F;  3CXC F;  1QVG F;  2HVY D;  1KQS F;  1T0K B;  2OTL F;  3RA5 A;  1M90 H;  1VQM F;  2I6D A;  3OW2 F;  3CG6 A;  3I56 F;  1RA4 A;  3CCL F;  5GAP K;  1YIJ F;  1VQ4 F;  5G4V C;  2QI2 A;  1YJW F;  5GAN K;  2KTU A;  3PLA C;  1VQ6 F;  2LBX A;  3FFM A;  3PAF A;  3CCJ F;  5IT9 M;  3AGK A;  1Q7Y H;  2KG4 A;  4TZZ A;  2CZW A;  2FC3 A;  1W42 A;  2VGN A;  3RA6 A;  1JJ2 F;  3OBW A;  5GIP C;  4BY9 D;  1VQ5 F;  3V7Q A;  5GIO C;  1K9M H;  1VQ9 F;  1VQ8 F;  2JNB A;  4X3L A;  3CCR F;  5GIN C;  3SIU A;  2QEX F;  3NMU C;  3NVI B;  1Q86 H;  3N4Y A;  1X7O A;  3LFO A;  1N8R H;  1W40 A;  1E7K A;  1NMU B;  1GO1 A;  1S72 F;  3CC4 F;  1VQO F;  2VGM A;  4X3M A;  2LBW A;  3LWQ C;  5G4U C;  1GZ0 A;  3JCM M;  3V7E A;  1Q82 H;  4LCK A;  3I55 F;  1IPA A;  3CCS F;  1PXW A;  1VQP F;  3CPW F;  1YJ9 F;  5A2Q M;  1YIT F;  3NK6 A;  3CCU F;  1K8A H;  3CME F;  5EO3 A;  3O85 A;  1SDS A;  1YJN F;  3HAX D;  3OBY A;  1CK2 A;  2OZB A;  1VQK F;  3E20 B;  1YHQ F;  3CC2 F;  3CMA F;  2WAL A;  1CN7 A;  2OTJ F;  3LWR C;  1KC8 H;  2QA4 F;  5FLX M;  4BW0 B;  1W2B F;  1M1K H;  3CCM F;  4NUT A;  1H7M A;  3E1Y A;  2OHW A;  3CC7 F;  3CCV F;  3NVK E;  5FJ4 C;  1X7P A;  3VMF B;  1KD1 H;  3G4S F;  1K73 H;  2AIF A;  3J80 M;  2KTV A;  3LWP C;  3ON1 A;  1XBI A;  2ALE A;  1NJI H;  1VQN F;  3LWV C;  1RLG A;  1W3E X;  1X52 A;  3J7A R;  3G71 F;  3G6E F;  3IR9 A;  3N4Z A;  1W41 A;  4C4W C;  3VI6 A;  3CCE F;  1Q81 H;  3MCA B;  3NK7 A;  3GYQ A;  3HJW C;  3JAM M;  3J81 M;  2BO1 A;  3LWO C;  3WXM B;  1QVF F;  1ZWZ A;  3CPQ A;  1VQ7 F;  1DT9 A;  1GO0 A; 
#chains in the Genus database with same CATH topology
 4X1Y A;  3RYC B;  3JAW A;  5LXT B;  2BTO A;  1VQL F;  2HVY D;  2AMT A;  4DRX A;  4TUY A;  1M90 H;  5JVD B;  3M1X A;  4NWO B;  5LOV A;  1YQN A;  1RA4 A;  3VYU C;  2EWC A;  3TD5 A;  5G4V C;  5HY1 A;  5GAN K;  1W57 A;  3ZP4 A;  5LA6 B;  2LBX A;  3FFM A;  3CCJ F;  2ZOV A;  3AGK A;  2KG4 A;  3KHN A;  2Q1Y A;  2CZW A;  3HKD A;  1COM A;  5GIP C;  4I55 A;  2K1S A;  2RHL A;  4BY9 D;  4X20 B;  3V7Q A;  1VQ9 F;  1VQ8 F;  1SA0 A;  5HY0 A;  5GIN C;  3SIU A;  2VAM A;  3CYQ A;  1JFF A;  1OFU A;  4EI9 A;  3LFO A;  5EB1 B;  1N8R H;  5HXU A;  4IIJ B;  3V3T A;  2ZVY A;  2KGW A;  5J2U B;  1NMU B;  3CB2 A;  3MQW A;  1VQO F;  3C8L A;  2VGM A;  3HKC B;  1Z5V A;  2LBW A;  4C8E A;  4C82 A;  3RYF A;  5CA0 A;  3LWQ C;  5KMG B;  3RYI B;  2BTQ B;  3I55 F;  1IPA A;  4ZHV A;  3JAT B;  2R6R 1;  2HQS C;  5JH7 A;  3DDN A;  1FFX A;  3HWU A;  2DT4 A;  5IJ0 B;  4WBN A;  5EYP B;  2R75 1;  2CVL A;  2DYY A;  1VHA A;  5JQG B;  3RYH B;  3VOB A;  2OZB A;  3Q8H A;  1IV2 A;  4X1K B;  3E20 B;  1VQK F;  5EIB D;  3JAK A;  2OTJ F;  5CA1 B;  2P6Y A;  2W8B C;  5FLX M;  5CB4 B;  4NUT A;  3EOR A;  2Z01 A;  3E1Y A;  5JCO A;  2HP0 A;  1U43 A;  1W5A A;  2RHJ A;  2HRY A;  2Z1U A;  3IEW A;  1JFF B;  1K73 H;  3N2G B;  3J80 M;  2Z1E A;  2KTV A;  2CHT A;  3LWP C;  4YJ2 A;  4IHJ B;  1VQN F;  4TV8 B;  3K12 A;  4C8G A;  3M4S A;  3J7A R;  4ZOL A;  4U39 A;  4ERH A;  4YJ2 B;  3WGN A;  3G71 F;  3IR9 A;  5C8Y A;  2UZH A;  1R1M A;  3CCE F;  5LP6 C;  5LYJ B;  4RHA A;  4M8I A;  2IG8 A;  5EIB C;  2PHN A;  3WXM B;  1QAH A;  1DT9 A;  2CWJ A;  1FSZ A;  3B6N A;  3IMP A;  1GO0 A;  1XV2 A;  1YI2 F;  3OON A;  3SIV A;  4KWE A;  5EWR A;  5LOV B;  4BVQ A;  1VQM F;  5IYZ B;  3N2K A;  2G9I A;  3ZP7 A;  2NMU A;  3RYC A;  5BMV B;  3RYH A;  3WGK A;  3KIZ A;  3HKE A;  1VQ6 F;  5EYP A;  3QHD A;  5IT9 M;  1Q7Y H;  4O2B B;  5IJ0 A;  4B46 A;  5AVM A;  2FC3 A;  3RE3 A;  4I50 A;  5FNV B;  2LCA A;  3K14 A;  4BVT A;  5GIO C;  3VOA A;  1QD9 A;  4FFB B;  2JNB A;  4IHJ A;  1U3P A;  4BT5 A;  4I4T B;  2QEX F;  3NMU C;  5CA0 B;  5KX5 B;  3LME A;  3VYT C;  1W5B A;  1IV4 A;  3C9T A;  1W40 A;  3UT5 A;  2FGY A;  4ZI7 B;  3R0P A;  4EB6 A;  3WJR A;  3JCM M;  2GLZ A;  1JY8 A;  1U3L A;  2HP3 A;  5MN5 A;  5CA1 A;  3V7E A;  4O4J B;  3I3F A;  4LCK A;  4FFB A;  3HKE B;  5A2Q M;  3WPW A;  2YXZ A;  5HY2 A;  4PWT A;  2AIZ P;  5HP7 A;  2CSL A;  4F6R A;  5LA6 A;  1K8A H;  3CME F;  4O4L A;  1SDS A;  1YJN F;  2ZVZ A;  3JAT A;  1TVK A;  2HS0 A;  2CHS A;  1CN7 A;  3K2X A;  5JVD A;  4ZK7 A;  3KE1 A;  4EI8 A;  2MQE A;  3JAW B;  1PF5 A;  2V9Y A;  4ZOL B;  3CC7 F;  1X7P A;  3T80 A;  1KD1 H;  3IKE A;  5LYJ A;  1XRG A;  3ON1 A;  1XBI A;  5C8Y B;  2ALE A;  3D54 A;  1SA0 B;  1RLG A;  1JD1 A;  3HKD B;  1Z5W A;  3N4Z A;  1W41 A;  3KJJ A;  4C4W C;  2YYE A;  3VYS C;  1Q81 H;  3MCA B;  4I4T A;  3GYQ A;  3JAM M;  3C9S A;  3J81 M;  3LWO C;  1ZWZ A;  3CPQ A;  3P4E A;  4G4Z A;  4X1K A;  2HP0 B;  3CYP B;  4I50 B;  5FNV A;  3CCQ F;  4X1I B;  1KQS F;  1T0K B;  2IQQ A;  3RA5 A;  4DRX B;  4DXD A;  3JAK B;  3OW2 F;  3FD6 A;  4O4I A;  1VQ4 F;  5GAP K;  1OAP A;  3JAR B;  5EAZ A;  2QI2 A;  1X25 A;  3JAR A;  3VCZ A;  1YJW F;  2RHH A;  2HX0 A;  3F0G A;  1T0A A;  2KTU A;  3PLA C;  5IYZ A;  4O4J A;  2B33 A;  3F0F A;  3PAF A;  3RYI A;  4X1I A;  4TZZ A;  5LP6 B;  1Q8R A;  1W42 A;  3HKC A;  5HWE A;  2VGN A;  3RA6 A;  1JJ2 F;  3OBW A;  1H47 A;  2H8E A;  3WJP A;  4B5C A;  3WPX A;  1H48 A;  4G4W A;  5GON A;  4BT3 A;  1YGY A;  5KMG A;  2HRU A;  1SZQ A;  3S03 A;  4G4Y A;  1IV1 A;  4O2A B;  3ERN A;  4G88 A;  1FNJ A;  5J2T B;  3LDT A;  1E7K A;  3BYQ A;  4I55 B;  3DC2 A;  3VTI C;  1S72 F;  3CC4 F;  4TV8 A;  3L7Q A;  4BVS A;  4X3M A;  4BT7 A;  5G4U C;  4ZHY B;  3N2G A;  3I7T A;  1Q82 H;  3ZOP A;  3HTN A;  2ZF8 A;  1TUB A;  1VQP F;  3CPW F;  1W55 A;  3MBM A;  3ELC A;  5CB4 A;  3F0E A;  3NK6 A;  3S0W A;  2UYK A;  2I6R A;  4G4X A;  3F0D A;  5EO3 A;  5LXT A;  1KNK A;  3QTY A;  1TVK B;  2Q1X A;  1CK2 A;  3CC2 F;  3CMA F;  3S0Y A;  3JAL A;  3JAS B;  4YJ3 A;  3LWR C;  1GX1 A;  5EB0 A;  4WBN B;  2RHO A;  4B62 A;  1FFX B;  1ONI A;  1RLU A;  4BW0 B;  1VQV A;  3CCM F;  4BVR A;  3MDO A;  1M1K H;  3M84 A;  2OHW A;  4HNA B;  4X1Y B;  4BT2 A;  3NVK E;  5FJ4 C;  3C9U A;  4RQO A;  2Z1T A;  2GZL A;  3VMF B;  4C81 A;  2IAF A;  4ZHQ B;  4EB6 B;  5ITZ A;  1W5F A;  4U3J B;  3ZO8 A;  1NJI H;  4E6E A;  3LWV C;  1UI9 A;  2F9Z C;  2ZAU A;  5J2U A;  4ZI7 A;  4IIJ A;  3S06 A;  4C8I A;  3F6M A;  4XCQ A;  5KX5 A;  5LP6 A;  5ITZ B;  3ESJ A;  3NK7 A;  2RB9 A;  3TD3 A;  3FD5 A;  1VQ7 F;  3D00 A;  5DCV A;  1RQ2 A;  5JQG A;  3CD6 F;  4O4I B;  3V4D A;  3CXC F;  1QVG F;  4O2B A;  1XHO A;  2OTL F;  3JAL B;  1UFY A;  3JAS A;  4YJ3 B;  5HP8 A;  2I6D A;  3CG6 A;  3I56 F;  4NQ3 A;  2OTM A;  3C9R A;  3VIU A;  3CCL F;  1YIJ F;  5JH7 B;  5BMV A;  2HS4 A;  3S0H A;  5JCO C;  1RQ7 A;  3N2K B;  4R40 B;  2UYJ A;  4TUY B;  4O4H B;  2LBT A;  2PMP A;  3E22 B;  3IEQ A;  3RYF B;  1W5E A;  5B8F A;  2UYP A;  1VQ5 F;  3P0Z A;  1K9M H;  2N48 A;  5IJ9 A;  4X3L A;  3CCR F;  2UYN A;  1DBF A;  3FPI A;  3HKB A;  3WGM A;  2ZOD A;  2HS3 A;  3NVI B;  1Q86 H;  2UYN B;  3JVH A;  3N4Y A;  1X7O A;  2BTU A;  2CW4 A;  5EZY A;  4X20 A;  1VK3 A;  1GO1 A;  5EZY B;  2H6L A;  2VAW A;  5MN4 A;  4O2A A;  3P10 A;  5J2T A;  1ODE A;  1GZ0 A;  1CLI A;  3E22 A;  3HKB B;  3D01 A;  5GON B;  5IJ9 B;  3CCS F;  1PXW A;  1U40 A;  1YJ9 F;  3U0O A;  1YIT F;  4LNU A;  4B45 A;  1NQ3 A;  4O4L B;  1W59 A;  3WGJ A;  4F6R B;  4O4H A;  3S02 A;  3CCU F;  4ZHW A;  3LYB A;  3K0T A;  3O85 A;  5HY4 A;  3HAX D;  3OBY A;  3TD4 A;  4BT6 A;  3GHZ A;  1J7H A;  1YHQ F;  1TUB B;  2WAL A;  3GTZ A;  1KC8 H;  2QA4 F;  1W2B F;  3MCQ A;  4TV9 B;  4LNU B;  1H7M A;  1W58 1;  3CCV F;  5HXZ A;  2QTP A;  1IV3 A;  3UT5 B;  4U3J A;  3IKF A;  3G4S F;  1VH8 A;  2AIF A;  3VO8 A;  1KNJ A;  1FNK A;  3FBA A;  3KJK A;  1W3E X;  1X52 A;  4BT4 A;  4HNA A;  3QUW A;  2Z1F A;  4EI7 A;  2VXY A;  3G6E F;  1QU9 A;  4TV9 A;  3WJQ A;  4G4V A;  3VI6 A;  2VAP A;  2H8C A;  1JN1 A;  4ZHQ A;  3WGL A;  3HJW C;  2GVI A;  2L26 A;  2BO1 A;  1QVF F;  5MN6 A; 
#chains in the Genus database with same CATH homology
 3D00 A;  5DCV A;  1YI2 F;  3CD6 F;  3SIV A;  3CCQ F;  5EWR A;  1VQL F;  3CXC F;  1QVG F;  2HVY D;  1KQS F;  1T0K B;  4BVQ A;  2OTL F;  3RA5 A;  1M90 H;  1VQM F;  2I6D A;  3OW2 F;  3CG6 A;  3I56 F;  4NQ3 A;  1RA4 A;  3CCL F;  5GAP K;  1YIJ F;  1VQ4 F;  5G4V C;  2QI2 A;  1YJW F;  5HY1 A;  5GAN K;  2KTU A;  3PLA C;  1VQ6 F;  2LBX A;  3FFM A;  3PAF A;  3CCJ F;  5IT9 M;  3AGK A;  1Q7Y H;  2KG4 A;  4TZZ A;  2CZW A;  2FC3 A;  1W42 A;  5HWE A;  2VGN A;  3RA6 A;  1JJ2 F;  3OBW A;  5GIP C;  4BVT A;  1VQ5 F;  3V7Q A;  5GIO C;  1K9M H;  1VQ9 F;  4BY9 D;  1VQ8 F;  2JNB A;  4X3L A;  5HY0 A;  3CCR F;  5GIN C;  3SIU A;  2QEX F;  3NMU C;  3NVI B;  1Q86 H;  4EI9 A;  3N4Y A;  1X7O A;  3LFO A;  1N8R H;  1W40 A;  5HXU A;  2FGY A;  3V3T A;  1E7K A;  1NMU B;  1GO1 A;  1S72 F;  3CC4 F;  4BVS A;  1VQO F;  2VGM A;  4X3M A;  2LBW A;  3LWQ C;  5G4U C;  1GZ0 A;  3JCM M;  2GLZ A;  3V7E A;  1Q82 H;  4LCK A;  3I55 F;  1IPA A;  3CCS F;  1PXW A;  1VQP F;  3CPW F;  1YJ9 F;  5A2Q M;  1YIT F;  5HY2 A;  3NK6 A;  3CCU F;  1K8A H;  3CME F;  5EO3 A;  3O85 A;  1SDS A;  5HY4 A;  1YJN F;  3HAX D;  3OBY A;  1CK2 A;  2OZB A;  1VQK F;  3E20 B;  1YHQ F;  3CC2 F;  3CMA F;  2WAL A;  1CN7 A;  2OTJ F;  3LWR C;  1KC8 H;  2QA4 F;  4EI8 A;  5FLX M;  4BW0 B;  1W2B F;  1M1K H;  3CCM F;  4BVR A;  4NUT A;  1H7M A;  3E1Y A;  2OHW A;  3CC7 F;  3CCV F;  5HXZ A;  3NVK E;  5FJ4 C;  1X7P A;  3VMF B;  1KD1 H;  3G4S F;  1K73 H;  2AIF A;  3J80 M;  2KTV A;  3LWP C;  3ON1 A;  1XBI A;  2ALE A;  1NJI H;  1VQN F;  3LWV C;  2F9Z C;  1RLG A;  1W3E X;  1X52 A;  3J7A R;  4EI7 A;  3G71 F;  3G6E F;  4XCQ A;  3IR9 A;  3N4Z A;  1W41 A;  4C4W C;  3VI6 A;  3CCE F;  1Q81 H;  3MCA B;  3NK7 A;  3GYQ A;  3HJW C;  3JAM M;  3J81 M;  2BO1 A;  3LWO C;  3WXM B;  1QVF F;  1ZWZ A;  3CPQ A;  1VQ7 F;  1DT9 A;  1GO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...