3I55F

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3i55F00
1SDSA 1VQ6F 2QEXF 3CC2F 1CN7A 1H7MA 3OBYA 3J7AR 1QVGF 1X7OA 1W41A 3LWVC 3J80M 2LBWA 3LWQC 3OW2F 5FJ4C 3AGKA 1Q7YH 1Q86H 3CCLF 3FFMA 1T0KB 2WALA 3JAMM 1N8RH 1VQ4F 3NK6A 3SIUA 1K73H 2ALEA 2OHWA 3CC7F 5A2QM 3HAXD 1W42A 1M1KH 1KC8H 3NK7A 1VQ5F 3VI6A 3G6EF 1YJ9F 3OBWA 5GIPC 1GZ0A 1YIJF 3I56F 1DT9A 3CPQA 3CG6A 2QA4F 3E1YA 3CCEF 2OZBA 1VQ8F 3LWPC 3CMEF 2KTVA 4X3MA 3VMFB 3CCSF 1VQ7F 3PAFA 5G4UC 3CCVF 4BW0B 3CCRF 5G4VC 3CCQF 5FLXM 1VQMF 3PLAC 1CK2A 3CCJF 1YI2F 5GIOC 1GO1A 3CCUF 1X7PA 4X3LA 3NVKE 3G4SF 5GAPK 1Q81H 1W40A 3E20B 3WXMB 3V7EA 3LWOC 3O85A 3NVIB 1QVFF 1KQSF 5DCVA 3CPWF 1K8AH 1RA4A 3V7QA 2OTLF 1YITF 2KTUA 1X52A 1E7KA 3RA5A 2BO1A 3I55F 4BY9D 2KG4A 2I6DA 1M90H 1Q82H 1NMUB 3MCAB 2VGNA 3JCMM 3HJWC 1W2BF 1K9MH 3RA6A 5IT9M 3G71F 3CMAF 1JJ2F 4C4WC 5EWRA 2LBXA 3LWRC 5EO3A 3J81M 5GINC 3CXCF 1VQKF 3LFOA 5GANK 1KD1H 3CC4F 1VQNF 1YJNF 1GO0A 1RLGA 2AIFA 1VQOF 1IPAA 3ON1A 3CCMF 1VQ9F 2OTJF 3N4YA 2QI2A 2FC3A 1VQPF 1YJWF 4LCKA 1PXWA 2CZWA 3N4ZA 1VQLF 3SIVA 4NUTA 1NJIH 1XBIA 3NMUC 3IR9A 1W3EX 3GYQA 1ZWZA 1YHQF 3CD6F 2JNBA 2HVYD 2VGMA 1S72F 4TZZA
chains in the Genus database with same CATH superfamily
3CC2F 3OBYA 3J7AR 2FGYA 2BTQB 2UYNB 4EI8A 3VTIC 2QTPA 4G4YA 5FJ4C 1VH8A 3C9TA 2W8BC 1FFXB 1Q7YH 1H47A 1VK3A 1FFXA 4TV9B 4TV9A 4EI9A 2H6LA 2VAWA 1QU9A 4O2AB 3F6MA 2RHLA 3F0GA 3WJRA 3VI6A 1JD1A 3JAWB 2PHNA 3I56F 3JAWA 4G4VA 1CLIA 5CB4A 5FNVA 3FBAA 2KTVA 4X3MA 1U3PA 5JVDB 3VMFB 5JVDA 4O4HB 2Z1TA 4O4HA 5JCOA 1H48A 5G4VC 5LA6B 5ITZA 4G4XA 5LA6A 5HP8A 4ZHVA 1FNKA 3D54A 3CCUF 2YXZA 1X7PA 2CWJA 3N2GA 4PWTA 4X3LA 4ZI7B 3G4SF 4ZI7A 4XCQA 3KE1A 1TUBB 1TUBA 3LWOC 3D01A 3O85A 1QVFF 4NWOB 3VIUA 4HNAA 5HY2A 3S0WA 4C8IA 4DRXB 4BT4A 2Z01A 4O4LB 1U43A 4TUYB 3RA5A 4U3JA 3QUWA 3TD5A 2RHJA 3I55F 4TUYA 2HRUA 3LMEA 5J2UA 3HJWC 1XV2A 4TV8B 3S0HA 4TV8A 4B45A 5B8FA 1JJ2F 2AMTA 2K1SA 3WGLA 1VQKF 4B46A 2AIZP 2V9YA 4X1KB 4BT6A 2RHHA 1W5AA 1RQ2A 4X1KA 5KX5A 3N4YA 3MDOA 5HXUA 2FC3A 5BMVB 5BMVA 3U0OA 4C8GA 1XBIA 3NMUC 3Q8HA 3IR9A 4B5CA 3V3TA 4I50B 1ZWZA 4O2BB 1YHQF 3CD6F 1R1MA 3F0DA 3VYSC 1S72F 2B33A 1JFFA 4C82A 1CN7A 2DT4A 1H7MA 3VYTC 1X7OA 2YYEA 4X1YA 3HKBB 3J80M 2H8CA 2LBWA 3HKBA 4G4ZA 3F0EA 5LOVB 3LWQC 3OW2F 2I6RA 3AGKA 5CA0B 1W5BA 5LOVA 3CCLF 5AVMA 3KJKA 2WALA 1W581 4NQ3A 3JAMM 1YGYA 2HS0A 3NK6A 3SIUA 1K73H 2ALEA 1M1KH 3MQWA 3EORA 4YJ3B 1KC8H 1VQ5F 4YJ3A 5GIPC 1GZ0A 1NQ3A 1W55A 1IV4A 3C9RA 1YIJF 3WJPA 1ONIA 3S02A 3VOAA 2QA4F 3WGNA 2ZOVA 1VHAA 4RHAA 4F6RA 3CMEF 3LDTA 1RLUA 5HWEA 1VQ7F 3N2KB 3CCVF 3JARB 3N2KA 4G4WA 4YJ2B 3JARA 5LP6A 2Q1YA 4YJ2A 4BVTA 2Z1FA 3CCJF 2KGWA 5EIBC 2R751 4BVSA 1T0AA 3HKEB 5MN4A 1W40A 5CB4B 3HKEA 3JASB 3C8LA 5FNVB 3NVIB 3JASA 3CPWF 3RE3A 1K8AH 1Q8RA 1RA4A 2P6YA 3F0FA 1PF5A 1YITF 1OAPA 1E7KA 3KIZA 4ZK7A 2BO1A 4BY9D 2HRYA 3GTZA 1M90H 5ITZB 2HS4A 1Q82H 3MCAB 2R6R1 4ZOLA 3WPXA 3IMPA 5EAZA 3N2GB 3G71F 3CMAF 2LBXA 3QHDA 4EI7A 3WGJA 4ERHA 5GINC 3CXCF 2IQQA 2VAMA 3CC4F 3HKDB 5JQGA 1GO0A 1FNJA 3HKDA 1RLGA 1OFUA 4HNAB 5J2TB 1Z5WA 2H8EA 5J2TA 2QI2A 3LYBA 4U3JB 2GLZA 5EIBD 2CZWA 3L7QA 3GHZA 4NUTA 5J2UB 3JAKB 2HP0B 3JAKA 3M1XA 2HP0A 3GYQA 3I3FA 2VGMA 3IEWA 5EB0A 3R0PA 4TZZA 3K2XA 1VQ6F 1SDSA 5EZYB 2UYPA 2QEXF 1KNKA 5EZYA 2UZHA 3DC2A 2GZLA 1W41A 4BT2A 3S03A 1FSZA 5CA1B 5CA1A 4BT7A 5KX5B 4C8EA 3FFMA 2CHTA 1T0KB 2CSLA 3M84A 4M8IA 4O4JA 1W5EA 3CC7F 2OHWA 5A2QM 3HAXD 2BTUA 1SA0B 4ZHYB 5IJ9B 1SA0A 2CW4A 1U40A 3NK7A 5IJ9A 1JFFB 3OBWA 5LXTA 3ERNA 4X1YB 5KMGA 5EYPA 3WGMA 3CPQA 3CCEF 3HWUA 2OZBA 1VQ8F 4U39A 3VYUC 1ODEA 2NMUA 2RHOA 3CCSF 3PAFA 5G4UC 3KJJA 3JVHA 3C9UA 3C9SA 3HKCB 3RYHA 3HKCA 5FLXM 3PLAC 3UT5B 1CK2A 2N48A 3VOBA 3UT5A 1JN1A 5GIOC 2VXYA 4X20B 3NVKE 3K14A 4X20A 3V4DA 5DCVA 1KQSF 4F6RB 5JH7B 3V7QA 5JH7A 2OTLF 4I55B 3I7TA 3K0TA 3E22B 4I55A 5LP6B 3E22A 4C81A 2I6DA 4LNUB 1NMUB 2VGNA 4LNUA 4EB6B 1K9MH 4FFBB 5IT9M 4EB6A 2RB9A 3WGKA 4FFBA 3CB2A 4O4IA 4KWEA 2Q1XA 5EO3A 4BVQA 5LP6C 3P0ZA 3LFOA 2OTMA 2UYNA 4BVRA 1VQNF 1YJNF 5IYZB 3M4SA 2ZAUA 3CCMF 1Z5VA 5IYZA 2OTJF 3D00A 5GONB 1W5FA 3S06A 1VQPF 1YJWF 5HY1A 5GONA 4LCKA 1PXWA 1VQLF 3P4EA 2EWCA 1QAHA 3ZP7A 4ZOLB 1GX1A 4O2AA 1W3EX 3RYIB 3IKEA 4X1IB 3VO8A 1U3LA 2JNBA 3RYIA 4X1IA 2HVYD 4BT3A 2HP3A 1IV2A 1YQNA 3ZOPA 4I4TB 3ZO8A 4ZHQB 1QVGF 1UFYA 1W59A 4I4TA 4ZHQA 5JCOC 3LWVC 5JQGB 3WJQA 5LYJB 3ELCA 3JALB 3WPWA 3JATB 1Q86H 5LYJA 3JALA 1VQVA 3JATA 2ZVYA 3FD5A 2ZF8A 1TVKB 1N8RH 1VQ4F 3B6NA 4WBNB 1TVKA 4DXDA 4WBNA 1SZQA 1W42A 3S0YA 3KHNA 3G6EF 1YJ9F 1KNJA 2CHSA 1W57A 1J7HA 5HXZA 1DT9A 2GVIA 2HS3A 3QTYA 3CG6A 1QD9A 3E1YA 5HY4A 3CYPB 3LWPC 3IEQA 5MN6A 4DRXA 2CVLA 4BW0B 1XRGA 3CCRF 2UYJA 1COMA 3OONA 4O4JB 4IHJB 4O4LA 1DBFA 3MCQA 3CCQF 1VQMF 4IHJA 3ZP4A 5C8YB 5EB1B 2UYKA 2IAFA 5C8YA 1YI2F 3VCZA 2IG8A 5MN5A 3TD3A 1GO1A 2ZODA 5LXTB 5GAPK 3IKFA 1Q81H 5KMGB 5EYPB 4G88A 3E20B 3WXMB 1JY8A 3V7EA 5HY0A 1RQ7A 3T80A 4E6EA 3P10A 3HTNA 3FPIA 4ZHWA 3FD6A 2F9ZC 1X52A 2KTUA 2DYYA 2L26A 3RYHB 2HQSC 1X25A 3ESJA 3MBMA 4IIJB 3K12A 3JCMM 4IIJA 1W2BF 3RA6A 5HP7A 1IV3A 2Z1UA 4I50A 4O2BA 3TD4A 3BYQA 2LBTA 1XHOA 4C4WC 2Z1EA 5EWRA 3LWRC 3J81M 4BT5A 2PMPA 5GANK 1KD1H 1UI9A 3RYFB 1IV1A 2AIFA 2G9IA 1IPAA 3DDNA 3ON1A 3RYFA 1VQOF 5CA0A 1VQ9F 4R40B 4RQOA 2ZVZA 3N4ZA 3SIVA 1NJIH 4B62A 3CYQA 3RYCB 2VAPA 2BTOA 5IJ0B 2LCAA 4O4IB 2MQEA 2KG4A 3RYCA 5IJ0A 2HX0A
chains in the Genus database with same CATH topology
1SDSA 1VQ6F 2QEXF 3CC2F 1CN7A 1H7MA 3OBYA 3J7AR 1QVGF 2FGYA 1X7OA 1W41A 4EI8A 3LWVC 3J80M 2LBWA 3LWQC 3OW2F 5FJ4C 3AGKA 1Q7YH 1Q86H 3CCLF 3FFMA 1T0KB 2WALA 4NQ3A 3JAMM 1N8RH 1VQ4F 3NK6A 4EI9A 3SIUA 1K73H 2ALEA 2OHWA 3CC7F 5A2QM 3HAXD 1W42A 1M1KH 1KC8H 3NK7A 1VQ5F 3VI6A 3G6EF 1YJ9F 3OBWA 5GIPC 1GZ0A 1YIJF 5HXZA 3I56F 1DT9A 3CPQA 3CG6A 2QA4F 3E1YA 3CCEF 2OZBA 5HY4A 1VQ8F 3LWPC 3CMEF 2KTVA 4X3MA 3VMFB 5HWEA 3CCSF 1VQ7F 3PAFA 5G4UC 3CCVF 4BW0B 3CCRF 5G4VC 3CCQF 4BVTA 5FLXM 1VQMF 3PLAC 1CK2A 3CCJF 1YI2F 5GIOC 1GO1A 3CCUF 1X7PA 4BVSA 4X3LA 3NVKE 3G4SF 4XCQA 5GAPK 1Q81H 1W40A 3E20B 3WXMB 3V7EA 3LWOC 3O85A 3NVIB 1QVFF 1KQSF 5HY0A 5DCVA 3CPWF 1K8AH 5HY2A 1RA4A 3V7QA 2OTLF 1YITF 2F9ZC 1X52A 2KTUA 1E7KA 3RA5A 2BO1A 3I55F 4BY9D 2KG4A 2I6DA 1M90H 1Q82H 1NMUB 3MCAB 2VGNA 3JCMM 3HJWC 1W2BF 1K9MH 3RA6A 5IT9M 3G71F 3CMAF 1JJ2F 4C4WC 5EWRA 2LBXA 3LWRC 5EO3A 3J81M 4BVQA 4EI7A 5GINC 3CXCF 1VQKF 3LFOA 5GANK 4BVRA 1KD1H 3CC4F 1VQNF 1YJNF 1GO0A 1RLGA 2AIFA 1VQOF 1IPAA 3ON1A 3CCMF 1VQ9F 2OTJF 3N4YA 2QI2A 3D00A 5HXUA 2FC3A 1VQPF 1YJWF 5HY1A 2GLZA 4LCKA 1PXWA 2CZWA 3N4ZA 1VQLF 3SIVA 4NUTA 1NJIH 1XBIA 3NMUC 3IR9A 1W3EX 3V3TA 3GYQA 1ZWZA 1YHQF 3CD6F 2JNBA 2HVYD 2VGMA 1S72F 4TZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SDS A;  1VQ6 F;  2QEX F;  3CC2 F;  1CN7 A;  1H7M A;  3OBY A;  3J7A R;  1QVG F;  1X7O A;  1W41 A;  3LWV C;  3J80 M;  2LBW A;  3LWQ C;  3OW2 F;  5FJ4 C;  3AGK A;  1Q7Y H;  1Q86 H;  3CCL F;  3FFM A;  1T0K B;  2WAL A;  3JAM M;  1N8R H;  1VQ4 F;  3NK6 A;  3SIU A;  1K73 H;  2ALE A;  2OHW A;  3CC7 F;  5A2Q M;  3HAX D;  1W42 A;  1M1K H;  1KC8 H;  3NK7 A;  1VQ5 F;  3VI6 A;  3G6E F;  1YJ9 F;  3OBW A;  5GIP C;  1GZ0 A;  1YIJ F;  3I56 F;  1DT9 A;  3CPQ A;  3CG6 A;  2QA4 F;  3E1Y A;  3CCE F;  2OZB A;  1VQ8 F;  3LWP C;  3CME F;  2KTV A;  4X3M A;  3VMF B;  3CCS F;  1VQ7 F;  3PAF A;  5G4U C;  3CCV F;  4BW0 B;  3CCR F;  5G4V C;  3CCQ F;  5FLX M;  1VQM F;  3PLA C;  1CK2 A;  3CCJ F;  1YI2 F;  5GIO C;  1GO1 A;  3CCU F;  1X7P A;  4X3L A;  3NVK E;  3G4S F;  5GAP K;  1Q81 H;  1W40 A;  3E20 B;  3WXM B;  3V7E A;  3LWO C;  3O85 A;  3NVI B;  1QVF F;  1KQS F;  5DCV A;  3CPW F;  1K8A H;  1RA4 A;  3V7Q A;  2OTL F;  1YIT F;  2KTU A;  1X52 A;  1E7K A;  3RA5 A;  2BO1 A;  3I55 F;  4BY9 D;  2KG4 A;  2I6D A;  1M90 H;  1Q82 H;  1NMU B;  3MCA B;  2VGN A;  3JCM M;  3HJW C;  1W2B F;  1K9M H;  3RA6 A;  5IT9 M;  3G71 F;  3CMA F;  1JJ2 F;  4C4W C;  5EWR A;  2LBX A;  3LWR C;  5EO3 A;  3J81 M;  5GIN C;  3CXC F;  1VQK F;  3LFO A;  5GAN K;  1KD1 H;  3CC4 F;  1VQN F;  1YJN F;  1GO0 A;  1RLG A;  2AIF A;  1VQO F;  1IPA A;  3ON1 A;  3CCM F;  1VQ9 F;  2OTJ F;  3N4Y A;  2QI2 A;  2FC3 A;  1VQP F;  1YJW F;  4LCK A;  1PXW A;  2CZW A;  3N4Z A;  1VQL F;  3SIV A;  4NUT A;  1NJI H;  1XBI A;  3NMU C;  3IR9 A;  1W3E X;  3GYQ A;  1ZWZ A;  1YHQ F;  3CD6 F;  2JNB A;  2HVY D;  2VGM A;  1S72 F;  4TZZ A; 
#chains in the Genus database with same CATH topology
 3CC2 F;  3OBY A;  3J7A R;  2FGY A;  2BTQ B;  2UYN B;  4EI8 A;  3VTI C;  2QTP A;  4G4Y A;  5FJ4 C;  1VH8 A;  3C9T A;  2W8B C;  1FFX B;  1Q7Y H;  1H47 A;  1VK3 A;  1FFX A;  4TV9 B;  4TV9 A;  4EI9 A;  2H6L A;  2VAW A;  1QU9 A;  4O2A B;  3F6M A;  2RHL A;  3F0G A;  3WJR A;  3VI6 A;  1JD1 A;  3JAW B;  2PHN A;  3I56 F;  3JAW A;  4G4V A;  1CLI A;  5CB4 A;  5FNV A;  3FBA A;  2KTV A;  4X3M A;  1U3P A;  5JVD B;  3VMF B;  5JVD A;  4O4H B;  2Z1T A;  4O4H A;  5JCO A;  1H48 A;  5G4V C;  5LA6 B;  5ITZ A;  4G4X A;  5LA6 A;  5HP8 A;  4ZHV A;  1FNK A;  3D54 A;  3CCU F;  2YXZ A;  1X7P A;  2CWJ A;  3N2G A;  4PWT A;  4X3L A;  4ZI7 B;  3G4S F;  4ZI7 A;  4XCQ A;  3KE1 A;  1TUB B;  1TUB A;  3LWO C;  3D01 A;  3O85 A;  1QVF F;  4NWO B;  3VIU A;  4HNA A;  5HY2 A;  3S0W A;  4C8I A;  4DRX B;  4BT4 A;  2Z01 A;  4O4L B;  1U43 A;  4TUY B;  3RA5 A;  4U3J A;  3QUW A;  3TD5 A;  2RHJ A;  3I55 F;  4TUY A;  2HRU A;  3LME A;  5J2U A;  3HJW C;  1XV2 A;  4TV8 B;  3S0H A;  4TV8 A;  4B45 A;  5B8F A;  1JJ2 F;  2AMT A;  2K1S A;  3WGL A;  1VQK F;  4B46 A;  2AIZ P;  2V9Y A;  4X1K B;  4BT6 A;  2RHH A;  1W5A A;  1RQ2 A;  4X1K A;  5KX5 A;  3N4Y A;  3MDO A;  5HXU A;  2FC3 A;  5BMV B;  5BMV A;  3U0O A;  4C8G A;  1XBI A;  3NMU C;  3Q8H A;  3IR9 A;  4B5C A;  3V3T A;  4I50 B;  1ZWZ A;  4O2B B;  1YHQ F;  3CD6 F;  1R1M A;  3F0D A;  3VYS C;  1S72 F;  2B33 A;  1JFF A;  4C82 A;  1CN7 A;  2DT4 A;  1H7M A;  3VYT C;  1X7O A;  2YYE A;  4X1Y A;  3HKB B;  3J80 M;  2H8C A;  2LBW A;  3HKB A;  4G4Z A;  3F0E A;  5LOV B;  3LWQ C;  3OW2 F;  2I6R A;  3AGK A;  5CA0 B;  1W5B A;  5LOV A;  3CCL F;  5AVM A;  3KJK A;  2WAL A;  1W58 1;  4NQ3 A;  3JAM M;  1YGY A;  2HS0 A;  3NK6 A;  3SIU A;  1K73 H;  2ALE A;  1M1K H;  3MQW A;  3EOR A;  4YJ3 B;  1KC8 H;  1VQ5 F;  4YJ3 A;  5GIP C;  1GZ0 A;  1NQ3 A;  1W55 A;  1IV4 A;  3C9R A;  1YIJ F;  3WJP A;  1ONI A;  3S02 A;  3VOA A;  2QA4 F;  3WGN A;  2ZOV A;  1VHA A;  4RHA A;  4F6R A;  3CME F;  3LDT A;  1RLU A;  5HWE A;  1VQ7 F;  3N2K B;  3CCV F;  3JAR B;  3N2K A;  4G4W A;  4YJ2 B;  3JAR A;  5LP6 A;  2Q1Y A;  4YJ2 A;  4BVT A;  2Z1F A;  3CCJ F;  2KGW A;  5EIB C;  2R75 1;  4BVS A;  1T0A A;  3HKE B;  5MN4 A;  1W40 A;  5CB4 B;  3HKE A;  3JAS B;  3C8L A;  5FNV B;  3NVI B;  3JAS A;  3CPW F;  3RE3 A;  1K8A H;  1Q8R A;  1RA4 A;  2P6Y A;  3F0F A;  1PF5 A;  1YIT F;  1OAP A;  1E7K A;  3KIZ A;  4ZK7 A;  2BO1 A;  4BY9 D;  2HRY A;  3GTZ A;  1M90 H;  5ITZ B;  2HS4 A;  1Q82 H;  3MCA B;  2R6R 1;  4ZOL A;  3WPX A;  3IMP A;  5EAZ A;  3N2G B;  3G71 F;  3CMA F;  2LBX A;  3QHD A;  4EI7 A;  3WGJ A;  4ERH A;  5GIN C;  3CXC F;  2IQQ A;  2VAM A;  3CC4 F;  3HKD B;  5JQG A;  1GO0 A;  1FNJ A;  3HKD A;  1RLG A;  1OFU A;  4HNA B;  5J2T B;  1Z5W A;  2H8E A;  5J2T A;  2QI2 A;  3LYB A;  4U3J B;  2GLZ A;  5EIB D;  2CZW A;  3L7Q A;  3GHZ A;  4NUT A;  5J2U B;  3JAK B;  2HP0 B;  3JAK A;  3M1X A;  2HP0 A;  3GYQ A;  3I3F A;  2VGM A;  3IEW A;  5EB0 A;  3R0P A;  4TZZ A;  3K2X A;  1VQ6 F;  1SDS A;  5EZY B;  2UYP A;  2QEX F;  1KNK A;  5EZY A;  2UZH A;  3DC2 A;  2GZL A;  1W41 A;  4BT2 A;  3S03 A;  1FSZ A;  5CA1 B;  5CA1 A;  4BT7 A;  5KX5 B;  4C8E A;  3FFM A;  2CHT A;  1T0K B;  2CSL A;  3M84 A;  4M8I A;  4O4J A;  1W5E A;  3CC7 F;  2OHW A;  5A2Q M;  3HAX D;  2BTU A;  1SA0 B;  4ZHY B;  5IJ9 B;  1SA0 A;  2CW4 A;  1U40 A;  3NK7 A;  5IJ9 A;  1JFF B;  3OBW A;  5LXT A;  3ERN A;  4X1Y B;  5KMG A;  5EYP A;  3WGM A;  3CPQ A;  3CCE F;  3HWU A;  2OZB A;  1VQ8 F;  4U39 A;  3VYU C;  1ODE A;  2NMU A;  2RHO A;  3CCS F;  3PAF A;  5G4U C;  3KJJ A;  3JVH A;  3C9U A;  3C9S A;  3HKC B;  3RYH A;  3HKC A;  5FLX M;  3PLA C;  3UT5 B;  1CK2 A;  2N48 A;  3VOB A;  3UT5 A;  1JN1 A;  5GIO C;  2VXY A;  4X20 B;  3NVK E;  3K14 A;  4X20 A;  3V4D A;  5DCV A;  1KQS F;  4F6R B;  5JH7 B;  3V7Q A;  5JH7 A;  2OTL F;  4I55 B;  3I7T A;  3K0T A;  3E22 B;  4I55 A;  5LP6 B;  3E22 A;  4C81 A;  2I6D A;  4LNU B;  1NMU B;  2VGN A;  4LNU A;  4EB6 B;  1K9M H;  4FFB B;  5IT9 M;  4EB6 A;  2RB9 A;  3WGK A;  4FFB A;  3CB2 A;  4O4I A;  4KWE A;  2Q1X A;  5EO3 A;  4BVQ A;  5LP6 C;  3P0Z A;  3LFO A;  2OTM A;  2UYN A;  4BVR A;  1VQN F;  1YJN F;  5IYZ B;  3M4S A;  2ZAU A;  3CCM F;  1Z5V A;  5IYZ A;  2OTJ F;  3D00 A;  5GON B;  1W5F A;  3S06 A;  1VQP F;  1YJW F;  5HY1 A;  5GON A;  4LCK A;  1PXW A;  1VQL F;  3P4E A;  2EWC A;  1QAH A;  3ZP7 A;  4ZOL B;  1GX1 A;  4O2A A;  1W3E X;  3RYI B;  3IKE A;  4X1I B;  3VO8 A;  1U3L A;  2JNB A;  3RYI A;  4X1I A;  2HVY D;  4BT3 A;  2HP3 A;  1IV2 A;  1YQN A;  3ZOP A;  4I4T B;  3ZO8 A;  4ZHQ B;  1QVG F;  1UFY A;  1W59 A;  4I4T A;  4ZHQ A;  5JCO C;  3LWV C;  5JQG B;  3WJQ A;  5LYJ B;  3ELC A;  3JAL B;  3WPW A;  3JAT B;  1Q86 H;  5LYJ A;  3JAL A;  1VQV A;  3JAT A;  2ZVY A;  3FD5 A;  2ZF8 A;  1TVK B;  1N8R H;  1VQ4 F;  3B6N A;  4WBN B;  1TVK A;  4DXD A;  4WBN A;  1SZQ A;  1W42 A;  3S0Y A;  3KHN A;  3G6E F;  1YJ9 F;  1KNJ A;  2CHS A;  1W57 A;  1J7H A;  5HXZ A;  1DT9 A;  2GVI A;  2HS3 A;  3QTY A;  3CG6 A;  1QD9 A;  3E1Y A;  5HY4 A;  3CYP B;  3LWP C;  3IEQ A;  5MN6 A;  4DRX A;  2CVL A;  4BW0 B;  1XRG A;  3CCR F;  2UYJ A;  1COM A;  3OON A;  4O4J B;  4IHJ B;  4O4L A;  1DBF A;  3MCQ A;  3CCQ F;  1VQM F;  4IHJ A;  3ZP4 A;  5C8Y B;  5EB1 B;  2UYK A;  2IAF A;  5C8Y A;  1YI2 F;  3VCZ A;  2IG8 A;  5MN5 A;  3TD3 A;  1GO1 A;  2ZOD A;  5LXT B;  5GAP K;  3IKF A;  1Q81 H;  5KMG B;  5EYP B;  4G88 A;  3E20 B;  3WXM B;  1JY8 A;  3V7E A;  5HY0 A;  1RQ7 A;  3T80 A;  4E6E A;  3P10 A;  3HTN A;  3FPI A;  4ZHW A;  3FD6 A;  2F9Z C;  1X52 A;  2KTU A;  2DYY A;  2L26 A;  3RYH B;  2HQS C;  1X25 A;  3ESJ A;  3MBM A;  4IIJ B;  3K12 A;  3JCM M;  4IIJ A;  1W2B F;  3RA6 A;  5HP7 A;  1IV3 A;  2Z1U A;  4I50 A;  4O2B A;  3TD4 A;  3BYQ A;  2LBT A;  1XHO A;  4C4W C;  2Z1E A;  5EWR A;  3LWR C;  3J81 M;  4BT5 A;  2PMP A;  5GAN K;  1KD1 H;  1UI9 A;  3RYF B;  1IV1 A;  2AIF A;  2G9I A;  1IPA A;  3DDN A;  3ON1 A;  3RYF A;  1VQO F;  5CA0 A;  1VQ9 F;  4R40 B;  4RQO A;  2ZVZ A;  3N4Z A;  3SIV A;  1NJI H;  4B62 A;  3CYQ A;  3RYC B;  2VAP A;  2BTO A;  5IJ0 B;  2LCA A;  4O4I B;  2MQE A;  2KG4 A;  3RYC A;  5IJ0 A;  2HX0 A; 
#chains in the Genus database with same CATH homology
 1SDS A;  1VQ6 F;  2QEX F;  3CC2 F;  1CN7 A;  1H7M A;  3OBY A;  3J7A R;  1QVG F;  2FGY A;  1X7O A;  1W41 A;  4EI8 A;  3LWV C;  3J80 M;  2LBW A;  3LWQ C;  3OW2 F;  5FJ4 C;  3AGK A;  1Q7Y H;  1Q86 H;  3CCL F;  3FFM A;  1T0K B;  2WAL A;  4NQ3 A;  3JAM M;  1N8R H;  1VQ4 F;  3NK6 A;  4EI9 A;  3SIU A;  1K73 H;  2ALE A;  2OHW A;  3CC7 F;  5A2Q M;  3HAX D;  1W42 A;  1M1K H;  1KC8 H;  3NK7 A;  1VQ5 F;  3VI6 A;  3G6E F;  1YJ9 F;  3OBW A;  5GIP C;  1GZ0 A;  1YIJ F;  5HXZ A;  3I56 F;  1DT9 A;  3CPQ A;  3CG6 A;  2QA4 F;  3E1Y A;  3CCE F;  2OZB A;  5HY4 A;  1VQ8 F;  3LWP C;  3CME F;  2KTV A;  4X3M A;  3VMF B;  5HWE A;  3CCS F;  1VQ7 F;  3PAF A;  5G4U C;  3CCV F;  4BW0 B;  3CCR F;  5G4V C;  3CCQ F;  4BVT A;  5FLX M;  1VQM F;  3PLA C;  1CK2 A;  3CCJ F;  1YI2 F;  5GIO C;  1GO1 A;  3CCU F;  1X7P A;  4BVS A;  4X3L A;  3NVK E;  3G4S F;  4XCQ A;  5GAP K;  1Q81 H;  1W40 A;  3E20 B;  3WXM B;  3V7E A;  3LWO C;  3O85 A;  3NVI B;  1QVF F;  1KQS F;  5HY0 A;  5DCV A;  3CPW F;  1K8A H;  5HY2 A;  1RA4 A;  3V7Q A;  2OTL F;  1YIT F;  2F9Z C;  1X52 A;  2KTU A;  1E7K A;  3RA5 A;  2BO1 A;  3I55 F;  4BY9 D;  2KG4 A;  2I6D A;  1M90 H;  1Q82 H;  1NMU B;  3MCA B;  2VGN A;  3JCM M;  3HJW C;  1W2B F;  1K9M H;  3RA6 A;  5IT9 M;  3G71 F;  3CMA F;  1JJ2 F;  4C4W C;  5EWR A;  2LBX A;  3LWR C;  5EO3 A;  3J81 M;  4BVQ A;  4EI7 A;  5GIN C;  3CXC F;  1VQK F;  3LFO A;  5GAN K;  4BVR A;  1KD1 H;  3CC4 F;  1VQN F;  1YJN F;  1GO0 A;  1RLG A;  2AIF A;  1VQO F;  1IPA A;  3ON1 A;  3CCM F;  1VQ9 F;  2OTJ F;  3N4Y A;  2QI2 A;  3D00 A;  5HXU A;  2FC3 A;  1VQP F;  1YJW F;  5HY1 A;  2GLZ A;  4LCK A;  1PXW A;  2CZW A;  3N4Z A;  1VQL F;  3SIV A;  4NUT A;  1NJI H;  1XBI A;  3NMU C;  3IR9 A;  1W3E X;  3V3T A;  3GYQ A;  1ZWZ A;  1YHQ F;  3CD6 F;  2JNB A;  2HVY D;  2VGM A;  1S72 F;  4TZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...