3I55F

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3i55F00
3J81M 1Q86H 1VQKF 1Q82H 1M1KH 3CCJF 1VQ6F 1E7KA 2WALA 1N8RH 2LBXA 3JCMM 3CCUF 3NVKE 1CN7A 4LCKA 3FFMA 1GZ0A 1W42A 1ZWZA 1DT9A 2ALEA 1W2BF 3CPQA 3WXMB 1X7OA 1Q81H 2CZWA 3GYQA 3PAFA 1Q7YH 1VQ7F 1VQ9F 2AIFA 3CD6F 3N4ZA 4BY9D 3NMUC 3V7QA 3NK6A 1GO1A 3IR9A 3E1YA 4BW0B 3I55F 3CCRF 1M90H 2BO1A 2OTJF 3CCEF 1JJ2F 1YHQF 3CCQF 1YJNF 3JAMM 1RA4A 3NK7A 5GIOC 3J80M 3J7AR 3CCVF 2FC3A 1XBIA 1KD1H 3CMEF 2JNBA 1VQOF 3O85A 1S72F 3N4YA 3HAXD 1YI2F 3CXCF 2LBWA 3LWVC 2KTVA 3LWPC 3CCLF 5IT9M 2OHWA 2VGMA 1W3EX 1VQ8F 2OZBA 3SIVA 1QVGF 4X3LA 1T0KB 2OTLF 1KQSF 3G6EF 3E20B 2HVYD 1CK2A 3MCAB 3HJWC 3CCMF 5GIPC 3CMAF 5FLXM 1K8AH 5GINC 2QEXF 1NJIH 5EWRA 1PXWA 5GAPK 3RA6A 1W41A 3AGKA 2QI2A 1VQ4F 3LFOA 1X52A 5FJ4C 2I6DA 1GO0A 3I56F 3V7EA 2KG4A 3RA5A 3OBWA 3VMFB 1YITF 3OBYA 3CCSF 5A2QM 5EO3A 2KTUA 3LWQC 3CC7F 4C4WC 5G4UC 5GANK 4X3MA 3SIUA 3OW2F 2QA4F 1RLGA 1YJWF 3CG6A 1KC8H 1K73H 1YIJF 3CC2F 1VQNF 5DCVA 1IPAA 1SDSA 1W40A 1QVFF 3LWOC 1VQMF 1VQLF 3NVIB 4NUTA 2VGNA 3VI6A 3G4SF 1VQ5F 3PLAC 1NMUB 3CPWF 1X7PA 3LWRC 3CC4F 3ON1A 1K9MH 5G4VC 1H7MA 1VQPF 4TZZA 1YJ9F 3G71F
chains in the Genus database with same CATH superfamily
3J81M 5J2TB 1VQKF 5LA6B 4BT4A 4KWEA 3C9RA 4X1IA 1VQ6F 1VH8A 2WALA 3M1XA 3M84A 4PWTA 2HS4A 3ZOPA 1N8RH 3U0OA 4HNAA 3NVKE 1RQ2A 1CN7A 4LCKA 1GZ0A 1H48A 4TV8B 3FD6A 1FFXA 3E22B 1W2BF 5LYJA 1DBFA 5JCOA 3S0WA 5HXZA 5IJ0A 5CB4A 2Z1FA 3KIZA 3NMUC 1RLUA 2GZLA 3NK6A 3GHZA 1H47A 3E1YA 3CCRF 2HP0A 2OTJF 3CCEF 1TVKB 2VAMA 1IV1A 3RYIB 2UYPA 5LP6A 3C9TA 3JAMM 2RHHA 4ZOLA 2BTOA 5GIOC 1YQNA 3J80M 4LNUB 3J7AR 5KX5B 3IMPA 3HWUA 3JARA 3CMEF 3O85A 3N2GA 1S72F 2OTMA 4U39A 3HAXD 4X20B 3WGKA 3IKEA 3VOBA 2LBWA 2DYYA 2KTVA 4G4VA 4EB6A 3LWVC 3CCLF 4IHJA 4C82A 3C9SA 1VQ8F 3WJPA 2ZOVA 2CW4A 3RE3A 3HKEA 5EYPB 3JASB 1IV4A 1T0KB 5J2UA 4DRXB 2OTLF 1ODEA 2HVYD 2Z1EA 3D01A 3WJRA 3DC2A 4O2BA 3P4EA 4TV9A 2GLZA 5GINC 2QEXF 1QU9A 3HKDB 3UT5B 3RA6A 5GAPK 2QI2A 2I6DA 4X1IB 4XCQA 2KG4A 1PF5A 4HNAB 4TV8A 2L26A 2H6LA 3E22A 1YITF 1JFFB 2Z1TA 3WGLA 1U3PA 4B5CA 3CCSF 1FFXB 5HP7A 2KTUA 5LYJB 4C4WC 4X3MA 3JAWB 1W59A 1RLGA 3CG6A 1K73H 5CB4B 2I6RA 1W40A 3LWOC 1TVKA 4I55A 2HP0B 2P6YA 3ERNA 1IV2A 3F0DA 3NVIB 1FNKA 2QTPA 1VQ5F 3FBAA 5LP6B 3CPWF 4O2AA 3ELCA 4ZOLB 3VTIC 1K9MH 3VYUC 3VIUA 5KX5A 1SA0B 1CLIA 1H7MA 2PHNA 1VQPF 1QD9A 4TZZA 1YJ9F 3FPIA 3JARB 3G71F 4X20A 5CA1B 1Q86H 3F0GA 1Q82H 1M1KH 2N48A 2AMTA 2CHSA 2MQEA 1X25A 4EB6B 5HY1A 2LBXA 3KHNA 4ERHA 3CCUF 3N2KB 5EZYA 3WPWA 4B62A 1DT9A 3HKEB 2ZVYA 4ZHQA 5FNVB 3WXMB 1X7OA 3HKBA 5J2UB 1Q7YH 3QTYA 4O4LA 1VQ9F 2W8BC 3K0TA 5LXTA 4BY9D 3V7QA 2HRUA 1GO1A 3L7QA 1JN1A 2YYEA 2PMPA 2RB9A 2K1SA 2BO1A 4TV9B 2UZHA 3CYQA 1YJNF 2AIZP 5JQGB 3MBMA 1VHAA 4U3JA 3V4DA 2ZF8A 4I50B 1UI9A 2FC3A 2Q1YA 1XBIA 1KD1H 1JY8A 1JFFA 4RQOA 3VCZA 5IYZB 4O4IB 4NQ3A 4EI8A 3JAWA 3LWPC 5IT9M 5EIBC 3DDNA 1Z5WA 4G4YA 2UYKA 1W3EX 4ZI7A 3HTNA 1XRGA 1W57A 3LMEA 2IG8A 3SIVA 1QVGF 3F6MA 2UYNB 2Z01A 4I55B 3IEWA 3E20B 4X1YA 2CVLA 3IEQA 1SA0A 4O2AB 3CCMF 4C8IA 5GIPC 2RHOA 3CMAF 3MDOA 3K2XA 5CA1A 1NJIH 1YGYA 5EWRA 3AGKA 1W5EA 3KJKA 5FJ4C 1X52A 1GX1A 2ZAUA 1Q8RA 3N2KA 2IAFA 3RA5A 3RYHA 4B46A 5EZYB 1U3LA 5FNVA 3OBYA 3TD5A 5EO3A 4ZHQB 3LWQC 2RHJA 1J7HA 5GANK 1KNKA 2R6R1 3HKBB 1W581 4BVSA 4O4LB 5LXTB 1YIJF 3CC2F 1VQNF 2Q1XA 1SDSA 4BT3A 5BMVA 1XHOA 2VGNA 3QHDA 5JQGA 3ESJA 3VI6A 3VO8A 3PLAC 5C8YA 3LWRC 3CC4F 2GVIA 4I50A 4BT2A 5G4VC 4U3JB 4I4TA 5IYZA 2VXYA 4O4IA 1OFUA 2H8EA 5EAZA 1U40A 2NMUA 2LBTA 2RHLA 3QUWA 3TD4A 1TUBA 3I7TA 3B6NA 4ZI7B 1ZWZA 5IJ9B 3LYBA 3CB2A 2ALEA 2UYNA 1SZQA 3CPQA 4O4JB 4G4XA 1Q81H 1VQ7F 2CZWA 3GYQA 4YJ2A 4ZK7A 3TD3A 1RQ7A 4X1YB 5MN4A 4M8IA 4BW0B 3I55F 4BVRA 1JJ2F 3K14A 4F6RB 3HKCB 1W5BA 3S02A 3KJJA 1RA4A 3NK7A 2HP3A 3BYQA 3CCVF 1VQOF 3RYHB 3ZP4A 2DT4A 2BTQB 4RHAA 4G88A 1YI2F 3I3FA 3WGJA 2OHWA 1XV2A 1W55A 2VGMA 2HRYA 3VOAA 4X1KB 2CHTA 2LCAA 3JALB 5BMVB 5HXUA 4WBNA 3RYFA 5EB1B 5HY4A 1CK2A 1VK3A 4FFBB 5C8YB 5HWEA 2UYJA 5EIBD 2F9ZC 4I4TB 5MN6A 1PXWA 5HY2A 1VQ4F 3LFOA 3V3TA 4DXDA 1VQVA 3I56F 3JAKA 1TUBB 2KGWA 5IJ9A 2EWCA 3GTZA 4O4JA 3OONA 5GONA 3CC7F 4TUYB 5G4UC 2HX0A 3D54A 3SIUA 3OW2F 4YJ2B 4G4ZA 1YJWF 5EB0A 5DCVA 2VAWA 4O4HB 3RYCA 3IKFA 2CSLA 1NQ3A 3MQWA 4BT6A 1VQMF 4F6RA 3C8LA 3HKCA 4IIJA 5JVDB 3EORA 4R40B 3ON1A 5JH7A 5ITZB 3WJQA 5HP8A 4EI9A 4YJ3A 3R0PA 4G4WA 3CCJF 5KMGB 1E7KA 3VYSC 4BVTA 5LOVA 3JCMM 3FFMA 1W42A 5HY0A 2ZVZA 4ZHWA 2Z1UA 3P10A 3K12A 2FGYA 4X1KA 2HS0A 1Z5VA 3JALA 3Q8HA 3PAFA 3F0FA 4ZHVA 1U43A 2AIFA 4WBNB 3CD6F 2R751 3RYFB 4FFBA 3N4ZA 3ZO8A 4E6EA 3IR9A 2V9YA 3WGNA 3JATA 1M90H 1JD1A 4BT5A 1YHQF 2G9IA 4B45A 3CCQF 3D00A 2IQQA 1T0AA 5CA0B 1IV3A 3ZP7A 2VAPA 5MN5A 2CWJA 4BVQA 1FSZA 3JAKB 3LDTA 2JNBA 3WPXA 5J2TA 3N4YA 5LA6A 4TUYA 3CXCF 3S0YA 1KNJA 5GONB 1QAHA 3M4SA 2OZBA 4O4HA 5JCOC 1W5FA 4X3LA 3S06A 3F0EA 3RYCB 2H8CA 1KQSF 4ZHYB 5JVDA 3G6EF 4IIJB 5ITZA 5IJ0B 1W5AA 3MCAB 3HJWC 1R1MA 5B8FA 5JH7B 5LP6C 3MCQA 5FLXM 1ONIA 3RYIA 4C81A 1K8AH 3S0HA 4BT7A 4C8GA 2YXZA 3KE1A 1W41A 4YJ3B 5KMGA 3CYPB 4LNUA 1GO0A 3V7EA 5LOVB 3VYTC 3JVHA 3OBWA 1FNJA 4C8EA 3VMFB 3N2GB 2HQSC 4NWOB 1COMA 2ZODA 5A2QM 4EI7A 2QA4F 4IHJB 1KC8H 5EYPA 1UFYA 3C9UA 3JASA 3S03A 1IPAA 5AVMA 3P0ZA 1QVFF 3JATB 4DRXA 1OAPA 1VQLF 4NUTA 2B33A 3FD5A 3G4SF 3WGMA 5CA0A 1NMUB 1X7PA 3T80A 4O2BB 2BTUA 3HKDA 2HS3A 3UT5A
chains in the Genus database with same CATH topology
3J81M 3G71F 1Q86H 1VQKF 1Q82H 1M1KH 3CCJF 1VQ6F 1E7KA 2WALA 4BVTA 1N8RH 5HY1A 2LBXA 3JCMM 3CCUF 3NVKE 1CN7A 4LCKA 3FFMA 1GZ0A 1W42A 5HY0A 1ZWZA 1DT9A 2FGYA 2ALEA 1W2BF 3CPQA 3WXMB 1X7OA 1Q81H 2CZWA 3GYQA 3PAFA 1Q7YH 1VQ7F 1VQ9F 2AIFA 3CD6F 5HXZA 3N4ZA 4BY9D 3NMUC 3V7QA 3NK6A 1GO1A 3IR9A 3E1YA 4BW0B 3I55F 3CCRF 1M90H 2BO1A 2OTJF 4BVRA 3CCEF 1JJ2F 1YHQF 3CCQF 1YJNF 3JAMM 3D00A 1RA4A 3NK7A 5GIOC 3J80M 3J7AR 3CCVF 2FC3A 4BVQA 1XBIA 1KD1H 3CMEF 2JNBA 1VQOF 3O85A 1S72F 3N4YA 3HAXD 4NQ3A 1YI2F 3CXCF 4EI8A 2LBWA 3LWVC 2KTVA 3LWPC 3CCLF 5IT9M 2OHWA 2VGMA 1W3EX 1VQ8F 2OZBA 3SIVA 1QVGF 4X3LA 1T0KB 2OTLF 1KQSF 5HXUA 3G6EF 3E20B 5HY4A 2HVYD 1CK2A 3MCAB 3HJWC 5HWEA 3CCMF 5GIPC 3CMAF 5FLXM 1K8AH 2F9ZC 2GLZA 5GINC 2QEXF 1NJIH 5EWRA 1PXWA 5HY2A 3RA6A 1W41A 3AGKA 5GAPK 2QI2A 1VQ4F 3LFOA 1X52A 5FJ4C 3V3TA 2I6DA 4XCQA 1GO0A 3I56F 3V7EA 2KG4A 3RA5A 3OBWA 3VMFB 1YITF 3OBYA 3CCSF 5A2QM 5EO3A 2KTUA 3LWQC 3CC7F 4EI7A 4C4WC 5G4UC 5GANK 4X3MA 3SIUA 3OW2F 4BVSA 2QA4F 1RLGA 1YJWF 3CG6A 1KC8H 1K73H 1YIJF 3CC2F 1VQNF 5DCVA 1IPAA 1SDSA 1W40A 1QVFF 3LWOC 1VQMF 1VQLF 3NVIB 4NUTA 2VGNA 3VI6A 3G4SF 1VQ5F 3PLAC 1NMUB 3CPWF 1X7PA 3LWRC 3CC4F 3ON1A 1K9MH 5G4VC 1H7MA 1VQPF 4TZZA 1YJ9F 4EI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 M;  1Q86 H;  1VQK F;  1Q82 H;  1M1K H;  3CCJ F;  1VQ6 F;  1E7K A;  2WAL A;  1N8R H;  2LBX A;  3JCM M;  3CCU F;  3NVK E;  1CN7 A;  4LCK A;  3FFM A;  1GZ0 A;  1W42 A;  1ZWZ A;  1DT9 A;  2ALE A;  1W2B F;  3CPQ A;  3WXM B;  1X7O A;  1Q81 H;  2CZW A;  3GYQ A;  3PAF A;  1Q7Y H;  1VQ7 F;  1VQ9 F;  2AIF A;  3CD6 F;  3N4Z A;  4BY9 D;  3NMU C;  3V7Q A;  3NK6 A;  1GO1 A;  3IR9 A;  3E1Y A;  4BW0 B;  3I55 F;  3CCR F;  1M90 H;  2BO1 A;  2OTJ F;  3CCE F;  1JJ2 F;  1YHQ F;  3CCQ F;  1YJN F;  3JAM M;  1RA4 A;  3NK7 A;  5GIO C;  3J80 M;  3J7A R;  3CCV F;  2FC3 A;  1XBI A;  1KD1 H;  3CME F;  2JNB A;  1VQO F;  3O85 A;  1S72 F;  3N4Y A;  3HAX D;  1YI2 F;  3CXC F;  2LBW A;  3LWV C;  2KTV A;  3LWP C;  3CCL F;  5IT9 M;  2OHW A;  2VGM A;  1W3E X;  1VQ8 F;  2OZB A;  3SIV A;  1QVG F;  4X3L A;  1T0K B;  2OTL F;  1KQS F;  3G6E F;  3E20 B;  2HVY D;  1CK2 A;  3MCA B;  3HJW C;  3CCM F;  5GIP C;  3CMA F;  5FLX M;  1K8A H;  5GIN C;  2QEX F;  1NJI H;  5EWR A;  1PXW A;  5GAP K;  3RA6 A;  1W41 A;  3AGK A;  2QI2 A;  1VQ4 F;  3LFO A;  1X52 A;  5FJ4 C;  2I6D A;  1GO0 A;  3I56 F;  3V7E A;  2KG4 A;  3RA5 A;  3OBW A;  3VMF B;  1YIT F;  3OBY A;  3CCS F;  5A2Q M;  5EO3 A;  2KTU A;  3LWQ C;  3CC7 F;  4C4W C;  5G4U C;  5GAN K;  4X3M A;  3SIU A;  3OW2 F;  2QA4 F;  1RLG A;  1YJW F;  3CG6 A;  1KC8 H;  1K73 H;  1YIJ F;  3CC2 F;  1VQN F;  5DCV A;  1IPA A;  1SDS A;  1W40 A;  1QVF F;  3LWO C;  1VQM F;  1VQL F;  3NVI B;  4NUT A;  2VGN A;  3VI6 A;  3G4S F;  1VQ5 F;  3PLA C;  1NMU B;  3CPW F;  1X7P A;  3LWR C;  3CC4 F;  3ON1 A;  1K9M H;  5G4V C;  1H7M A;  1VQP F;  4TZZ A;  1YJ9 F;  3G71 F; 
#chains in the Genus database with same CATH topology
 3J81 M;  5J2T B;  1VQK F;  5LA6 B;  4BT4 A;  4KWE A;  3C9R A;  4X1I A;  1VQ6 F;  1VH8 A;  2WAL A;  3M1X A;  3M84 A;  4PWT A;  2HS4 A;  3ZOP A;  1N8R H;  3U0O A;  4HNA A;  3NVK E;  1RQ2 A;  1CN7 A;  4LCK A;  1GZ0 A;  1H48 A;  4TV8 B;  3FD6 A;  1FFX A;  3E22 B;  1W2B F;  5LYJ A;  1DBF A;  5JCO A;  3S0W A;  5HXZ A;  5IJ0 A;  5CB4 A;  2Z1F A;  3KIZ A;  3NMU C;  1RLU A;  2GZL A;  3NK6 A;  3GHZ A;  1H47 A;  3E1Y A;  3CCR F;  2HP0 A;  2OTJ F;  3CCE F;  1TVK B;  2VAM A;  1IV1 A;  3RYI B;  2UYP A;  5LP6 A;  3C9T A;  3JAM M;  2RHH A;  4ZOL A;  2BTO A;  5GIO C;  1YQN A;  3J80 M;  4LNU B;  3J7A R;  5KX5 B;  3IMP A;  3HWU A;  3JAR A;  3CME F;  3O85 A;  3N2G A;  1S72 F;  2OTM A;  4U39 A;  3HAX D;  4X20 B;  3WGK A;  3IKE A;  3VOB A;  2LBW A;  2DYY A;  2KTV A;  4G4V A;  4EB6 A;  3LWV C;  3CCL F;  4IHJ A;  4C82 A;  3C9S A;  1VQ8 F;  3WJP A;  2ZOV A;  2CW4 A;  3RE3 A;  3HKE A;  5EYP B;  3JAS B;  1IV4 A;  1T0K B;  5J2U A;  4DRX B;  2OTL F;  1ODE A;  2HVY D;  2Z1E A;  3D01 A;  3WJR A;  3DC2 A;  4O2B A;  3P4E A;  4TV9 A;  2GLZ A;  5GIN C;  2QEX F;  1QU9 A;  3HKD B;  3UT5 B;  3RA6 A;  5GAP K;  2QI2 A;  2I6D A;  4X1I B;  4XCQ A;  2KG4 A;  1PF5 A;  4HNA B;  4TV8 A;  2L26 A;  2H6L A;  3E22 A;  1YIT F;  1JFF B;  2Z1T A;  3WGL A;  1U3P A;  4B5C A;  3CCS F;  1FFX B;  5HP7 A;  2KTU A;  5LYJ B;  4C4W C;  4X3M A;  3JAW B;  1W59 A;  1RLG A;  3CG6 A;  1K73 H;  5CB4 B;  2I6R A;  1W40 A;  3LWO C;  1TVK A;  4I55 A;  2HP0 B;  2P6Y A;  3ERN A;  1IV2 A;  3F0D A;  3NVI B;  1FNK A;  2QTP A;  1VQ5 F;  3FBA A;  5LP6 B;  3CPW F;  4O2A A;  3ELC A;  4ZOL B;  3VTI C;  1K9M H;  3VYU C;  3VIU A;  5KX5 A;  1SA0 B;  1CLI A;  1H7M A;  2PHN A;  1VQP F;  1QD9 A;  4TZZ A;  1YJ9 F;  3FPI A;  3JAR B;  3G71 F;  4X20 A;  5CA1 B;  1Q86 H;  3F0G A;  1Q82 H;  1M1K H;  2N48 A;  2AMT A;  2CHS A;  2MQE A;  1X25 A;  4EB6 B;  5HY1 A;  2LBX A;  3KHN A;  4ERH A;  3CCU F;  3N2K B;  5EZY A;  3WPW A;  4B62 A;  1DT9 A;  3HKE B;  2ZVY A;  4ZHQ A;  5FNV B;  3WXM B;  1X7O A;  3HKB A;  5J2U B;  1Q7Y H;  3QTY A;  4O4L A;  1VQ9 F;  2W8B C;  3K0T A;  5LXT A;  4BY9 D;  3V7Q A;  2HRU A;  1GO1 A;  3L7Q A;  1JN1 A;  2YYE A;  2PMP A;  2RB9 A;  2K1S A;  2BO1 A;  4TV9 B;  2UZH A;  3CYQ A;  1YJN F;  2AIZ P;  5JQG B;  3MBM A;  1VHA A;  4U3J A;  3V4D A;  2ZF8 A;  4I50 B;  1UI9 A;  2FC3 A;  2Q1Y A;  1XBI A;  1KD1 H;  1JY8 A;  1JFF A;  4RQO A;  3VCZ A;  5IYZ B;  4O4I B;  4NQ3 A;  4EI8 A;  3JAW A;  3LWP C;  5IT9 M;  5EIB C;  3DDN A;  1Z5W A;  4G4Y A;  2UYK A;  1W3E X;  4ZI7 A;  3HTN A;  1XRG A;  1W57 A;  3LME A;  2IG8 A;  3SIV A;  1QVG F;  3F6M A;  2UYN B;  2Z01 A;  4I55 B;  3IEW A;  3E20 B;  4X1Y A;  2CVL A;  3IEQ A;  1SA0 A;  4O2A B;  3CCM F;  4C8I A;  5GIP C;  2RHO A;  3CMA F;  3MDO A;  3K2X A;  5CA1 A;  1NJI H;  1YGY A;  5EWR A;  3AGK A;  1W5E A;  3KJK A;  5FJ4 C;  1X52 A;  1GX1 A;  2ZAU A;  1Q8R A;  3N2K A;  2IAF A;  3RA5 A;  3RYH A;  4B46 A;  5EZY B;  1U3L A;  5FNV A;  3OBY A;  3TD5 A;  5EO3 A;  4ZHQ B;  3LWQ C;  2RHJ A;  1J7H A;  5GAN K;  1KNK A;  2R6R 1;  3HKB B;  1W58 1;  4BVS A;  4O4L B;  5LXT B;  1YIJ F;  3CC2 F;  1VQN F;  2Q1X A;  1SDS A;  4BT3 A;  5BMV A;  1XHO A;  2VGN A;  3QHD A;  5JQG A;  3ESJ A;  3VI6 A;  3VO8 A;  3PLA C;  5C8Y A;  3LWR C;  3CC4 F;  2GVI A;  4I50 A;  4BT2 A;  5G4V C;  4U3J B;  4I4T A;  5IYZ A;  2VXY A;  4O4I A;  1OFU A;  2H8E A;  5EAZ A;  1U40 A;  2NMU A;  2LBT A;  2RHL A;  3QUW A;  3TD4 A;  1TUB A;  3I7T A;  3B6N A;  4ZI7 B;  1ZWZ A;  5IJ9 B;  3LYB A;  3CB2 A;  2ALE A;  2UYN A;  1SZQ A;  3CPQ A;  4O4J B;  4G4X A;  1Q81 H;  1VQ7 F;  2CZW A;  3GYQ A;  4YJ2 A;  4ZK7 A;  3TD3 A;  1RQ7 A;  4X1Y B;  5MN4 A;  4M8I A;  4BW0 B;  3I55 F;  4BVR A;  1JJ2 F;  3K14 A;  4F6R B;  3HKC B;  1W5B A;  3S02 A;  3KJJ A;  1RA4 A;  3NK7 A;  2HP3 A;  3BYQ A;  3CCV F;  1VQO F;  3RYH B;  3ZP4 A;  2DT4 A;  2BTQ B;  4RHA A;  4G88 A;  1YI2 F;  3I3F A;  3WGJ A;  2OHW A;  1XV2 A;  1W55 A;  2VGM A;  2HRY A;  3VOA A;  4X1K B;  2CHT A;  2LCA A;  3JAL B;  5BMV B;  5HXU A;  4WBN A;  3RYF A;  5EB1 B;  5HY4 A;  1CK2 A;  1VK3 A;  4FFB B;  5C8Y B;  5HWE A;  2UYJ A;  5EIB D;  2F9Z C;  4I4T B;  5MN6 A;  1PXW A;  5HY2 A;  1VQ4 F;  3LFO A;  3V3T A;  4DXD A;  1VQV A;  3I56 F;  3JAK A;  1TUB B;  2KGW A;  5IJ9 A;  2EWC A;  3GTZ A;  4O4J A;  3OON A;  5GON A;  3CC7 F;  4TUY B;  5G4U C;  2HX0 A;  3D54 A;  3SIU A;  3OW2 F;  4YJ2 B;  4G4Z A;  1YJW F;  5EB0 A;  5DCV A;  2VAW A;  4O4H B;  3RYC A;  3IKF A;  2CSL A;  1NQ3 A;  3MQW A;  4BT6 A;  1VQM F;  4F6R A;  3C8L A;  3HKC A;  4IIJ A;  5JVD B;  3EOR A;  4R40 B;  3ON1 A;  5JH7 A;  5ITZ B;  3WJQ A;  5HP8 A;  4EI9 A;  4YJ3 A;  3R0P A;  4G4W A;  3CCJ F;  5KMG B;  1E7K A;  3VYS C;  4BVT A;  5LOV A;  3JCM M;  3FFM A;  1W42 A;  5HY0 A;  2ZVZ A;  4ZHW A;  2Z1U A;  3P10 A;  3K12 A;  2FGY A;  4X1K A;  2HS0 A;  1Z5V A;  3JAL A;  3Q8H A;  3PAF A;  3F0F A;  4ZHV A;  1U43 A;  2AIF A;  4WBN B;  3CD6 F;  2R75 1;  3RYF B;  4FFB A;  3N4Z A;  3ZO8 A;  4E6E A;  3IR9 A;  2V9Y A;  3WGN A;  3JAT A;  1M90 H;  1JD1 A;  4BT5 A;  1YHQ F;  2G9I A;  4B45 A;  3CCQ F;  3D00 A;  2IQQ A;  1T0A A;  5CA0 B;  1IV3 A;  3ZP7 A;  2VAP A;  5MN5 A;  2CWJ A;  4BVQ A;  1FSZ A;  3JAK B;  3LDT A;  2JNB A;  3WPX A;  5J2T A;  3N4Y A;  5LA6 A;  4TUY A;  3CXC F;  3S0Y A;  1KNJ A;  5GON B;  1QAH A;  3M4S A;  2OZB A;  4O4H A;  5JCO C;  1W5F A;  4X3L A;  3S06 A;  3F0E A;  3RYC B;  2H8C A;  1KQS F;  4ZHY B;  5JVD A;  3G6E F;  4IIJ B;  5ITZ A;  5IJ0 B;  1W5A A;  3MCA B;  3HJW C;  1R1M A;  5B8F A;  5JH7 B;  5LP6 C;  3MCQ A;  5FLX M;  1ONI A;  3RYI A;  4C81 A;  1K8A H;  3S0H A;  4BT7 A;  4C8G A;  2YXZ A;  3KE1 A;  1W41 A;  4YJ3 B;  5KMG A;  3CYP B;  4LNU A;  1GO0 A;  3V7E A;  5LOV B;  3VYT C;  3JVH A;  3OBW A;  1FNJ A;  4C8E A;  3VMF B;  3N2G B;  2HQS C;  4NWO B;  1COM A;  2ZOD A;  5A2Q M;  4EI7 A;  2QA4 F;  4IHJ B;  1KC8 H;  5EYP A;  1UFY A;  3C9U A;  3JAS A;  3S03 A;  1IPA A;  5AVM A;  3P0Z A;  1QVF F;  3JAT B;  4DRX A;  1OAP A;  1VQL F;  4NUT A;  2B33 A;  3FD5 A;  3G4S F;  3WGM A;  5CA0 A;  1NMU B;  1X7P A;  3T80 A;  4O2B B;  2BTU A;  3HKD A;  2HS3 A;  3UT5 A; 
#chains in the Genus database with same CATH homology
 3J81 M;  3G71 F;  1Q86 H;  1VQK F;  1Q82 H;  1M1K H;  3CCJ F;  1VQ6 F;  1E7K A;  2WAL A;  4BVT A;  1N8R H;  5HY1 A;  2LBX A;  3JCM M;  3CCU F;  3NVK E;  1CN7 A;  4LCK A;  3FFM A;  1GZ0 A;  1W42 A;  5HY0 A;  1ZWZ A;  1DT9 A;  2FGY A;  2ALE A;  1W2B F;  3CPQ A;  3WXM B;  1X7O A;  1Q81 H;  2CZW A;  3GYQ A;  3PAF A;  1Q7Y H;  1VQ7 F;  1VQ9 F;  2AIF A;  3CD6 F;  5HXZ A;  3N4Z A;  4BY9 D;  3NMU C;  3V7Q A;  3NK6 A;  1GO1 A;  3IR9 A;  3E1Y A;  4BW0 B;  3I55 F;  3CCR F;  1M90 H;  2BO1 A;  2OTJ F;  4BVR A;  3CCE F;  1JJ2 F;  1YHQ F;  3CCQ F;  1YJN F;  3JAM M;  3D00 A;  1RA4 A;  3NK7 A;  5GIO C;  3J80 M;  3J7A R;  3CCV F;  2FC3 A;  4BVQ A;  1XBI A;  1KD1 H;  3CME F;  2JNB A;  1VQO F;  3O85 A;  1S72 F;  3N4Y A;  3HAX D;  4NQ3 A;  1YI2 F;  3CXC F;  4EI8 A;  2LBW A;  3LWV C;  2KTV A;  3LWP C;  3CCL F;  5IT9 M;  2OHW A;  2VGM A;  1W3E X;  1VQ8 F;  2OZB A;  3SIV A;  1QVG F;  4X3L A;  1T0K B;  2OTL F;  1KQS F;  5HXU A;  3G6E F;  3E20 B;  5HY4 A;  2HVY D;  1CK2 A;  3MCA B;  3HJW C;  5HWE A;  3CCM F;  5GIP C;  3CMA F;  5FLX M;  1K8A H;  2F9Z C;  2GLZ A;  5GIN C;  2QEX F;  1NJI H;  5EWR A;  1PXW A;  5HY2 A;  3RA6 A;  1W41 A;  3AGK A;  5GAP K;  2QI2 A;  1VQ4 F;  3LFO A;  1X52 A;  5FJ4 C;  3V3T A;  2I6D A;  4XCQ A;  1GO0 A;  3I56 F;  3V7E A;  2KG4 A;  3RA5 A;  3OBW A;  3VMF B;  1YIT F;  3OBY A;  3CCS F;  5A2Q M;  5EO3 A;  2KTU A;  3LWQ C;  3CC7 F;  4EI7 A;  4C4W C;  5G4U C;  5GAN K;  4X3M A;  3SIU A;  3OW2 F;  4BVS A;  2QA4 F;  1RLG A;  1YJW F;  3CG6 A;  1KC8 H;  1K73 H;  1YIJ F;  3CC2 F;  1VQN F;  5DCV A;  1IPA A;  1SDS A;  1W40 A;  1QVF F;  3LWO C;  1VQM F;  1VQL F;  3NVI B;  4NUT A;  2VGN A;  3VI6 A;  3G4S F;  1VQ5 F;  3PLA C;  1NMU B;  3CPW F;  1X7P A;  3LWR C;  3CC4 F;  3ON1 A;  1K9M H;  5G4V C;  1H7M A;  1VQP F;  4TZZ A;  1YJ9 F;  4EI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...