1QVFF

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1qvfF00
1X7OA 3SIVA 3LWPC 2KTUA 1K8AH 3J81M 2OTLF 3PAFA 5GINC 3JCMM 1VQ7F 1DT9A 5IT9M 1X7PA 1GO0A 1XBIA 1S72F 3CCUF 1VQPF 2LBXA 1N8RH 1JJ2F 3CMEF 1Q82H 3LWQC 4LCKA 3SIUA 1CN7A 3RA6A 1E7KA 2QEXF 1KD1H 1VQ5F 3E20B 2BO1A 5EWRA 1RLGA 5A2QM 1W42A 1IPAA 1VQ6F 2OHWA 3OBWA 3CPQA 1SDSA 3V7QA 5EO3A 1VQKF 3NMUC 3V7EA 3NK6A 3LWVC 1QVFF 2OTJF 3LWOC 2LBWA 3I56F 3OW2F 1VQ4F 1VQOF 1VQNF 1M1KH 3NVIB 1Q81H 3CG6A 5FLXM 1W3EX 5GIOC 1Q7YH 3O85A 3LFOA 1M90H 1K9MH 5DCVA 3AGKA 1X52A 1NMUB 2OZBA 3HJWC 1W41A 3VMFB 1VQLF 2VGNA 4BW0B 3CCLF 1YJNF 3CC4F 2KTVA 4X3LA 2QI2A 2I6DA 3VI6A 4X3MA 4TZZA 1PXWA 3G6EF 3CC2F 1VQ8F 3CXCF 1VQ9F 3CCVF 4C4WC 3RA5A 1YITF 2AIFA 3CCMF 5GANK 3WXMB 3CCRF 2JNBA 1NJIH 3CCEF 3N4ZA 1YI2F 3CPWF 1CK2A 2QA4F 2HVYD 5GIPC 1KQSF 5FJ4C 3NVKE 1YJ9F 4BY9D 3GYQA 3G4SF 3J80M 5GAPK 3NK7A 2KG4A 3JAMM 3OBYA 1W40A 3E1YA 1YHQF 3PLAC 1QVGF 1ZWZA 3IR9A 3CC7F 1GO1A 2VGMA 3LWRC 3HAXD 3CCJF 2WALA 3MCAB 3CMAF 5G4UC 1Q86H 1H7MA 1RA4A 3CCQF 1VQMF 3N4YA 1GZ0A 1YIJF 4NUTA 1KC8H 3CD6F 2FC3A 3CCSF 3G71F 3J7AR 1YJWF 1T0KB 1K73H 5G4VC 1W2BF 2ALEA 3FFMA 3ON1A 3I55F 2CZWA
chains in the Genus database with same CATH superfamily
1X7OA 1PF5A 1VHAA 3HKEA 3SIVA 5LYJA 3FD5A 5GINC 3KE1A 1Z5WA 2ZVYA 3JCMM 1W59A 3UT5A 4ZHYB 5IT9M 2YYEA 4C8EA 4X1YB 3CCUF 1U43A 3F0GA 3S0WA 2IQQA 3F0FA 5EZYA 4O4IA 1CN7A 3FPIA 1T0AA 3U0OA 2BO1A 5C8YA 1RLGA 4EI7A 1W42A 3VIUA 4WBNB 3OBWA 3V7QA 3KHNA 3JASB 1NQ3A 3N2KB 1JFFB 1U3LA 3LWOC 4BVRA 2LBWA 3I56F 5EYPA 2L26A 1VQOF 3HKDB 3NVIB 5IJ0A 2HRUA 2Q1XA 5LXTA 1RLUA 3S06A 1KNKA 4G4WA 4NWOB 3CYQA 3O85A 1M90H 5DCVA 3AGKA 3K0TA 1NMUB 1SA0B 5IYZA 2UYKA 3WGKA 5JQGA 3RYFB 3ESJA 5HWEA 3CB2A 4M8IA 2ZVZA 4F6RB 5LOVB 5CA1B 5HY0A 3V4DA 4X3LA 3WJPA 3P10A 2I6DA 2QI2A 4ZOLB 2HRYA 4TZZA 5KMGB 1PXWA 1TVKA 3CCVF 3N2GB 1JD1A 4FFBB 3VOAA 2RHHA 3VYUC 1XRGA 4C8GA 1W57A 3D01A 5LP6C 5EB1B 4ZHQA 5GANK 3CCRF 2BTQB 3CCEF 2VAWA 1YI2F 4O4JA 3WGJA 2HP0A 4I55A 4O2BB 3M84A 5CA0A 4ZHWA 3B6NA 4BT4A 4BY9D 3HKBA 1TUBB 3K14A 3JALB 4IHJA 2HS3A 3QHDA 3RE3A 2IAFA 2EWCA 1ZWZA 3CC7F 1GO1A 4I50B 3R0PA 3LWRC 3I3FA 2AMTA 5IJ9B 5G4UC 5LP6A 3CCQF 1VQMF 2QTPA 1R1MA 1VK3A 1KC8H 3CD6F 2R751 3GHZA 4BT3A 2RHLA 1W5AA 4U3JB 3HWUA 3VTIC 3OONA 4EB6A 2R6R1 2CWJA 1K73H 4BT2A 1W2BF 2ALEA 3ON1A 1VQ6F 2BTOA 3LWPC 1KNJA 3J81M 3PAFA 1VQ7F 3MQWA 4IIJB 3RYIA 1GO0A 5HP7A 1S72F 1U3PA 2LBXA 3Q8HA 1N8RH 3HKCB 4TV9A 2H8EA 3ZP4A 3SIUA 3DDNA 5EAZA 3P4EA 5FNVA 3E20B 5JCOC 5EWRA 2LBTA 2CHSA 1IPAA 4C8IA 2OHWA 3CPQA 3NK6A 1QVFF 4X20A 5J2UA 4XCQA 3JAKB 2MQEA 3E22B 4G88A 3M4SA 3EORA 2G9IA 4TV8A 3F0EA 1VQNF 3JAWB 2V9YA 2VAMA 4YJ2B 1FFXB 3RYFA 1FNKA 1W3EX 4G4ZA 1Q7YH 3F0DA 4F6RA 2CW4A 5CB4A 1X52A 4LNUA 3HJWC 3WPXA 2GVIA 4I4TA 3VMFB 3WGLA 2VGNA 5JCOA 4X1IB 4BW0B 3IEWA 4HNAB 3CC4F 5HP8A 2ZOVA 4C82A 3VI6A 5GONA 3CYPB 3CC2F 5ITZA 1VQ9F 5LA6B 5JH7B 5EB0A 2OTMA 5HY4A 2UZHA 3JVHA 2K1SA 2JNBA 3F6MA 5J2TA 2UYNA 2Z01A 2Q1YA 3D00A 5JVDA 3RYCA 2HX0A 4DXDA 5GIPC 3JARB 1KQSF 4DRXA 3S0HA 2W8BC 3GYQA 2CVLA 2HQSC 3G4SF 3QUWA 3S03A 5GAPK 3K12A 2KG4A 5KX5B 3JAMM 2LCAA 3FD6A 3E1YA 1YHQF 3PLAC 4YJ3A 3HKEB 3HAXD 4TUYA 5LYJB 3ERNA 4BVQA 3MCAB 5MN5A 5BMVA 3S0YA 1GZ0A 2FC3A 1XV2A 3RYHA 4R40B 3D54A 3J7AR 1FSZA 4O4LB 4O4IB 1T0KB 1H47A 3FFMA 1QD9A 3I55F 5C8YB 5MN6A 2KTUA 4X1KA 3C9UA 3T80A 1DT9A 2RHOA 4ZI7B 1VQPF 4O4HA 2Z1UA 1W5FA 4O2AA 1JJ2F 3CMEF 3LWQC 1IV4A 1FNJA 5LXTB 3RA6A 1E7KA 2QEXF 1VQ5F 2F9ZC 3ZP7A 3LDTA 4ZHVA 5IYZB 1J7HA 5JQGB 3IMPA 1Z5VA 4ZK7A 2NMUA 5EO3A 1VQKF 2OTJF 4X1YA 3K2XA 4BT5A 3C9TA 2PMPA 1M1KH 1TVKB 3MBMA 2ZODA 4G4VA 2H8CA 5GIOC 1W5EA 3LFOA 2CHTA 3C8LA 3ELCA 3ZOPA 4ZHQB 1W41A 4WBNA 3ZO8A 1VQLF 2RHJA 3FBAA 3IKFA 4RQOA 3JASA 3VOBA 3CCLF 1YJNF 3N2KA 1JFFA 3IEQA 3HKDA 4ERHA 4NQ3A 5CA0B 3HKBB 2Z1FA 2DT4A 3JATB 4IHJB 4C81A 3WGMA 1SA0A 3CCMF 3WXMB 1NJIH 3WPWA 4B46A 3N4ZA 5HXUA 5HXZA 5LOVA 5LP6B 5CA1A 1XHOA 4B62A 2VXYA 4ZOLA 2QA4F 1UI9A 2HVYD 1VQVA 5KMGA 3S02A 3NVKE 2VAPA 3N2GA 2YXZA 4E6EA 4FFBA 3J80M 4EB6B 2ZF8A 3NK7A 1W5BA 1W40A 1OAPA 3KJKA 4G4XA 2VGMA 4KWEA 3TD3A 1JY8A 1Q86H 3C9RA 1RA4A 2UYPA 3RYIB 3N4YA 1YIJF 4O4LA 4O2BA 3KIZA 1QAHA 3G71F 3IKEA 1TUBA 4TV9B 1ODEA 2P6YA 3JALA 5G4VC 2RB9A 4EI8A 5FNVB 3V3TA 1COMA 4ZI7A 2I6RA 4I50A 1K8AH 3WJQA 2OTLF 5IJ9A 1IV3A 2AIZP 2IG8A 3C9SA 1X7PA 3TD5A 1RQ2A 3WGNA 1XBIA 4X20B 5J2UB 3QTYA 2FGYA 1RQ7A 2PHNA 1ONIA 4U3JA 4TV8B 2KGWA 3UT5B 3VYTC 1Q82H 1JN1A 4BVTA 4LCKA 1KD1H 3LMEA 5EZYB 1VH8A 5CB4B 4LNUB 5A2QM 3VYSC 4I4TB 3V7EA 1SDSA 4IIJA 3NMUC 4BVSA 3LWVC 4BT6A 2UYJA 1UFYA 3TD4A 4PWTA 3OW2F 1YGYA 3HKCA 5GONB 1VQ4F 5EIBC 1Q81H 5ITZB 3CG6A 1QU9A 5AVMA 5FLXM 4EI9A 1SZQA 1H48A 2Z1EA 5EYPB 2Z1TA 3LYBA 1K9MH 2OZBA 5IJ0B 1U40A 4B5CA 2B33A 5J2TB 2UYNB 4G4YA 1CLIA 3MCQA 5JVDB 3I7TA 2CSLA 3BYQA 3JAKA 2KTVA 3MDOA 3E22A 3RYCB 2GLZA 4X3MA 3JATA 5HY2A 3JAWA 3KJJA 2N48A 4DRXB 3G6EF 1VQ8F 3CXCF 3RA5A 1FFXA 4YJ2A 1X25A 5EIBD 1YITF 2AIFA 1IV1A 4YJ3B 1W55A 4TUYB 4X1IA 3DC2A 3VO8A 4HNAA 3M1XA 5BMVB 3CPWF 2HS4A 5MN4A 1DBFA 1CK2A 4B45A 2HP3A 5FJ4C 3RYHB 3VCZA 1YJ9F 3P0ZA 4O4JB 5LA6A 5JH7A 2HP0B 3HTNA 5B8FA 1IV2A 4I55B 3OBYA 1GX1A 1QVGF 3IR9A 2DYYA 2GZLA 1YQNA 3L7QA 2H6LA 4RHAA 3CCJF 4X1KB 2WALA 5HY1A 2HS0A 3CMAF 1OFUA 1H7MA 4NUTA 2ZAUA 3JARA 4O4HB 4U39A 4BT7A 2BTUA 3CCSF 4O2AB 1W581 3GTZA 1YJWF 5KX5A 1Q8RA 4C4WC 3WJRA 2CZWA
chains in the Genus database with same CATH topology
1X7OA 3SIVA 3LWPC 2KTUA 1K8AH 3J81M 2OTLF 3PAFA 5GINC 3JCMM 1VQ7F 3V7EA 1DT9A 5IT9M 1X7PA 1GO0A 1XBIA 1S72F 3CCUF 1VQPF 2FGYA 2LBXA 1N8RH 3FFMA 1JJ2F 3CMEF 1Q82H 3LWQC 4LCKA 4BVTA 3SIUA 1CN7A 3RA6A 1E7KA 2QEXF 1KD1H 1VQ5F 2F9ZC 3E20B 2BO1A 5EWRA 1RLGA 4EI7A 5A2QM 1W42A 1IPAA 1VQ6F 2OHWA 3OBWA 3CPQA 1SDSA 3V7QA 5EO3A 4BVSA 1VQKF 3NMUC 3NK6A 3LWVC 1QVFF 2OTJF 4XCQA 3LWOC 4BVRA 2LBWA 3I56F 3OW2F 1VQ4F 1VQOF 1VQNF 1M1KH 3NVIB 1Q81H 3CG6A 5FLXM 4EI9A 1W3EX 5GIOC 1Q7YH 3O85A 3LFOA 1M90H 1K9MH 5DCVA 3AGKA 1X52A 1NMUB 2OZBA 3HJWC 1W41A 3VMFB 5HWEA 1VQLF 2VGNA 4BW0B 3CCLF 1YJNF 5HY0A 3CC4F 2KTVA 4X3LA 2QI2A 2I6DA 2GLZA 3VI6A 4X3MA 4TZZA 5HY2A 4NQ3A 1PXWA 3G6EF 3CC2F 1VQ8F 3CXCF 1VQ9F 3CCVF 4C4WC 3RA5A 5HY4A 1YITF 2AIFA 3CCMF 5GANK 3WXMB 3CCRF 2JNBA 1NJIH 3D00A 3CCEF 3N4ZA 5HXUA 5HXZA 1YI2F 3CPWF 1CK2A 2QA4F 2HVYD 5GIPC 1KQSF 5FJ4C 3NVKE 1YJ9F 4BY9D 3GYQA 3G4SF 3J80M 5GAPK 3NK7A 2KG4A 3JAMM 3OBYA 1W40A 3E1YA 1YHQF 3PLAC 1QVGF 1ZWZA 3IR9A 3CC7F 1GO1A 2VGMA 3LWRC 3HAXD 3CCJF 2WALA 3MCAB 4BVQA 5HY1A 3CMAF 5G4UC 1Q86H 1H7MA 1RA4A 3CCQF 1VQMF 3N4YA 1GZ0A 1YIJF 4NUTA 1KC8H 3CD6F 2FC3A 3CCSF 3G71F 3J7AR 1YJWF 1T0KB 1K73H 5G4VC 4EI8A 1W2BF 2ALEA 3V3TA 3ON1A 3I55F 2CZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X7O A;  3SIV A;  3LWP C;  2KTU A;  1K8A H;  3J81 M;  2OTL F;  3PAF A;  5GIN C;  3JCM M;  1VQ7 F;  1DT9 A;  5IT9 M;  1X7P A;  1GO0 A;  1XBI A;  1S72 F;  3CCU F;  1VQP F;  2LBX A;  1N8R H;  1JJ2 F;  3CME F;  1Q82 H;  3LWQ C;  4LCK A;  3SIU A;  1CN7 A;  3RA6 A;  1E7K A;  2QEX F;  1KD1 H;  1VQ5 F;  3E20 B;  2BO1 A;  5EWR A;  1RLG A;  5A2Q M;  1W42 A;  1IPA A;  1VQ6 F;  2OHW A;  3OBW A;  3CPQ A;  1SDS A;  3V7Q A;  5EO3 A;  1VQK F;  3NMU C;  3V7E A;  3NK6 A;  3LWV C;  1QVF F;  2OTJ F;  3LWO C;  2LBW A;  3I56 F;  3OW2 F;  1VQ4 F;  1VQO F;  1VQN F;  1M1K H;  3NVI B;  1Q81 H;  3CG6 A;  5FLX M;  1W3E X;  5GIO C;  1Q7Y H;  3O85 A;  3LFO A;  1M90 H;  1K9M H;  5DCV A;  3AGK A;  1X52 A;  1NMU B;  2OZB A;  3HJW C;  1W41 A;  3VMF B;  1VQL F;  2VGN A;  4BW0 B;  3CCL F;  1YJN F;  3CC4 F;  2KTV A;  4X3L A;  2QI2 A;  2I6D A;  3VI6 A;  4X3M A;  4TZZ A;  1PXW A;  3G6E F;  3CC2 F;  1VQ8 F;  3CXC F;  1VQ9 F;  3CCV F;  4C4W C;  3RA5 A;  1YIT F;  2AIF A;  3CCM F;  5GAN K;  3WXM B;  3CCR F;  2JNB A;  1NJI H;  3CCE F;  3N4Z A;  1YI2 F;  3CPW F;  1CK2 A;  2QA4 F;  2HVY D;  5GIP C;  1KQS F;  5FJ4 C;  3NVK E;  1YJ9 F;  4BY9 D;  3GYQ A;  3G4S F;  3J80 M;  5GAP K;  3NK7 A;  2KG4 A;  3JAM M;  3OBY A;  1W40 A;  3E1Y A;  1YHQ F;  3PLA C;  1QVG F;  1ZWZ A;  3IR9 A;  3CC7 F;  1GO1 A;  2VGM A;  3LWR C;  3HAX D;  3CCJ F;  2WAL A;  3MCA B;  3CMA F;  5G4U C;  1Q86 H;  1H7M A;  1RA4 A;  3CCQ F;  1VQM F;  3N4Y A;  1GZ0 A;  1YIJ F;  4NUT A;  1KC8 H;  3CD6 F;  2FC3 A;  3CCS F;  3G71 F;  3J7A R;  1YJW F;  1T0K B;  1K73 H;  5G4V C;  1W2B F;  2ALE A;  3FFM A;  3ON1 A;  3I55 F;  2CZW A; 
#chains in the Genus database with same CATH topology
 1X7O A;  1PF5 A;  1VHA A;  3HKE A;  3SIV A;  5LYJ A;  3FD5 A;  5GIN C;  3KE1 A;  1Z5W A;  2ZVY A;  3JCM M;  1W59 A;  3UT5 A;  4ZHY B;  5IT9 M;  2YYE A;  4C8E A;  4X1Y B;  3CCU F;  1U43 A;  3F0G A;  3S0W A;  2IQQ A;  3F0F A;  5EZY A;  4O4I A;  1CN7 A;  3FPI A;  1T0A A;  3U0O A;  2BO1 A;  5C8Y A;  1RLG A;  4EI7 A;  1W42 A;  3VIU A;  4WBN B;  3OBW A;  3V7Q A;  3KHN A;  3JAS B;  1NQ3 A;  3N2K B;  1JFF B;  1U3L A;  3LWO C;  4BVR A;  2LBW A;  3I56 F;  5EYP A;  2L26 A;  1VQO F;  3HKD B;  3NVI B;  5IJ0 A;  2HRU A;  2Q1X A;  5LXT A;  1RLU A;  3S06 A;  1KNK A;  4G4W A;  4NWO B;  3CYQ A;  3O85 A;  1M90 H;  5DCV A;  3AGK A;  3K0T A;  1NMU B;  1SA0 B;  5IYZ A;  2UYK A;  3WGK A;  5JQG A;  3RYF B;  3ESJ A;  5HWE A;  3CB2 A;  4M8I A;  2ZVZ A;  4F6R B;  5LOV B;  5CA1 B;  5HY0 A;  3V4D A;  4X3L A;  3WJP A;  3P10 A;  2I6D A;  2QI2 A;  4ZOL B;  2HRY A;  4TZZ A;  5KMG B;  1PXW A;  1TVK A;  3CCV F;  3N2G B;  1JD1 A;  4FFB B;  3VOA A;  2RHH A;  3VYU C;  1XRG A;  4C8G A;  1W57 A;  3D01 A;  5LP6 C;  5EB1 B;  4ZHQ A;  5GAN K;  3CCR F;  2BTQ B;  3CCE F;  2VAW A;  1YI2 F;  4O4J A;  3WGJ A;  2HP0 A;  4I55 A;  4O2B B;  3M84 A;  5CA0 A;  4ZHW A;  3B6N A;  4BT4 A;  4BY9 D;  3HKB A;  1TUB B;  3K14 A;  3JAL B;  4IHJ A;  2HS3 A;  3QHD A;  3RE3 A;  2IAF A;  2EWC A;  1ZWZ A;  3CC7 F;  1GO1 A;  4I50 B;  3R0P A;  3LWR C;  3I3F A;  2AMT A;  5IJ9 B;  5G4U C;  5LP6 A;  3CCQ F;  1VQM F;  2QTP A;  1R1M A;  1VK3 A;  1KC8 H;  3CD6 F;  2R75 1;  3GHZ A;  4BT3 A;  2RHL A;  1W5A A;  4U3J B;  3HWU A;  3VTI C;  3OON A;  4EB6 A;  2R6R 1;  2CWJ A;  1K73 H;  4BT2 A;  1W2B F;  2ALE A;  3ON1 A;  1VQ6 F;  2BTO A;  3LWP C;  1KNJ A;  3J81 M;  3PAF A;  1VQ7 F;  3MQW A;  4IIJ B;  3RYI A;  1GO0 A;  5HP7 A;  1S72 F;  1U3P A;  2LBX A;  3Q8H A;  1N8R H;  3HKC B;  4TV9 A;  2H8E A;  3ZP4 A;  3SIU A;  3DDN A;  5EAZ A;  3P4E A;  5FNV A;  3E20 B;  5JCO C;  5EWR A;  2LBT A;  2CHS A;  1IPA A;  4C8I A;  2OHW A;  3CPQ A;  3NK6 A;  1QVF F;  4X20 A;  5J2U A;  4XCQ A;  3JAK B;  2MQE A;  3E22 B;  4G88 A;  3M4S A;  3EOR A;  2G9I A;  4TV8 A;  3F0E A;  1VQN F;  3JAW B;  2V9Y A;  2VAM A;  4YJ2 B;  1FFX B;  3RYF A;  1FNK A;  1W3E X;  4G4Z A;  1Q7Y H;  3F0D A;  4F6R A;  2CW4 A;  5CB4 A;  1X52 A;  4LNU A;  3HJW C;  3WPX A;  2GVI A;  4I4T A;  3VMF B;  3WGL A;  2VGN A;  5JCO A;  4X1I B;  4BW0 B;  3IEW A;  4HNA B;  3CC4 F;  5HP8 A;  2ZOV A;  4C82 A;  3VI6 A;  5GON A;  3CYP B;  3CC2 F;  5ITZ A;  1VQ9 F;  5LA6 B;  5JH7 B;  5EB0 A;  2OTM A;  5HY4 A;  2UZH A;  3JVH A;  2K1S A;  2JNB A;  3F6M A;  5J2T A;  2UYN A;  2Z01 A;  2Q1Y A;  3D00 A;  5JVD A;  3RYC A;  2HX0 A;  4DXD A;  5GIP C;  3JAR B;  1KQS F;  4DRX A;  3S0H A;  2W8B C;  3GYQ A;  2CVL A;  2HQS C;  3G4S F;  3QUW A;  3S03 A;  5GAP K;  3K12 A;  2KG4 A;  5KX5 B;  3JAM M;  2LCA A;  3FD6 A;  3E1Y A;  1YHQ F;  3PLA C;  4YJ3 A;  3HKE B;  3HAX D;  4TUY A;  5LYJ B;  3ERN A;  4BVQ A;  3MCA B;  5MN5 A;  5BMV A;  3S0Y A;  1GZ0 A;  2FC3 A;  1XV2 A;  3RYH A;  4R40 B;  3D54 A;  3J7A R;  1FSZ A;  4O4L B;  4O4I B;  1T0K B;  1H47 A;  3FFM A;  1QD9 A;  3I55 F;  5C8Y B;  5MN6 A;  2KTU A;  4X1K A;  3C9U A;  3T80 A;  1DT9 A;  2RHO A;  4ZI7 B;  1VQP F;  4O4H A;  2Z1U A;  1W5F A;  4O2A A;  1JJ2 F;  3CME F;  3LWQ C;  1IV4 A;  1FNJ A;  5LXT B;  3RA6 A;  1E7K A;  2QEX F;  1VQ5 F;  2F9Z C;  3ZP7 A;  3LDT A;  4ZHV A;  5IYZ B;  1J7H A;  5JQG B;  3IMP A;  1Z5V A;  4ZK7 A;  2NMU A;  5EO3 A;  1VQK F;  2OTJ F;  4X1Y A;  3K2X A;  4BT5 A;  3C9T A;  2PMP A;  1M1K H;  1TVK B;  3MBM A;  2ZOD A;  4G4V A;  2H8C A;  5GIO C;  1W5E A;  3LFO A;  2CHT A;  3C8L A;  3ELC A;  3ZOP A;  4ZHQ B;  1W41 A;  4WBN A;  3ZO8 A;  1VQL F;  2RHJ A;  3FBA A;  3IKF A;  4RQO A;  3JAS A;  3VOB A;  3CCL F;  1YJN F;  3N2K A;  1JFF A;  3IEQ A;  3HKD A;  4ERH A;  4NQ3 A;  5CA0 B;  3HKB B;  2Z1F A;  2DT4 A;  3JAT B;  4IHJ B;  4C81 A;  3WGM A;  1SA0 A;  3CCM F;  3WXM B;  1NJI H;  3WPW A;  4B46 A;  3N4Z A;  5HXU A;  5HXZ A;  5LOV A;  5LP6 B;  5CA1 A;  1XHO A;  4B62 A;  2VXY A;  4ZOL A;  2QA4 F;  1UI9 A;  2HVY D;  1VQV A;  5KMG A;  3S02 A;  3NVK E;  2VAP A;  3N2G A;  2YXZ A;  4E6E A;  4FFB A;  3J80 M;  4EB6 B;  2ZF8 A;  3NK7 A;  1W5B A;  1W40 A;  1OAP A;  3KJK A;  4G4X A;  2VGM A;  4KWE A;  3TD3 A;  1JY8 A;  1Q86 H;  3C9R A;  1RA4 A;  2UYP A;  3RYI B;  3N4Y A;  1YIJ F;  4O4L A;  4O2B A;  3KIZ A;  1QAH A;  3G71 F;  3IKE A;  1TUB A;  4TV9 B;  1ODE A;  2P6Y A;  3JAL A;  5G4V C;  2RB9 A;  4EI8 A;  5FNV B;  3V3T A;  1COM A;  4ZI7 A;  2I6R A;  4I50 A;  1K8A H;  3WJQ A;  2OTL F;  5IJ9 A;  1IV3 A;  2AIZ P;  2IG8 A;  3C9S A;  1X7P A;  3TD5 A;  1RQ2 A;  3WGN A;  1XBI A;  4X20 B;  5J2U B;  3QTY A;  2FGY A;  1RQ7 A;  2PHN A;  1ONI A;  4U3J A;  4TV8 B;  2KGW A;  3UT5 B;  3VYT C;  1Q82 H;  1JN1 A;  4BVT A;  4LCK A;  1KD1 H;  3LME A;  5EZY B;  1VH8 A;  5CB4 B;  4LNU B;  5A2Q M;  3VYS C;  4I4T B;  3V7E A;  1SDS A;  4IIJ A;  3NMU C;  4BVS A;  3LWV C;  4BT6 A;  2UYJ A;  1UFY A;  3TD4 A;  4PWT A;  3OW2 F;  1YGY A;  3HKC A;  5GON B;  1VQ4 F;  5EIB C;  1Q81 H;  5ITZ B;  3CG6 A;  1QU9 A;  5AVM A;  5FLX M;  4EI9 A;  1SZQ A;  1H48 A;  2Z1E A;  5EYP B;  2Z1T A;  3LYB A;  1K9M H;  2OZB A;  5IJ0 B;  1U40 A;  4B5C A;  2B33 A;  5J2T B;  2UYN B;  4G4Y A;  1CLI A;  3MCQ A;  5JVD B;  3I7T A;  2CSL A;  3BYQ A;  3JAK A;  2KTV A;  3MDO A;  3E22 A;  3RYC B;  2GLZ A;  4X3M A;  3JAT A;  5HY2 A;  3JAW A;  3KJJ A;  2N48 A;  4DRX B;  3G6E F;  1VQ8 F;  3CXC F;  3RA5 A;  1FFX A;  4YJ2 A;  1X25 A;  5EIB D;  1YIT F;  2AIF A;  1IV1 A;  4YJ3 B;  1W55 A;  4TUY B;  4X1I A;  3DC2 A;  3VO8 A;  4HNA A;  3M1X A;  5BMV B;  3CPW F;  2HS4 A;  5MN4 A;  1DBF A;  1CK2 A;  4B45 A;  2HP3 A;  5FJ4 C;  3RYH B;  3VCZ A;  1YJ9 F;  3P0Z A;  4O4J B;  5LA6 A;  5JH7 A;  2HP0 B;  3HTN A;  5B8F A;  1IV2 A;  4I55 B;  3OBY A;  1GX1 A;  1QVG F;  3IR9 A;  2DYY A;  2GZL A;  1YQN A;  3L7Q A;  2H6L A;  4RHA A;  3CCJ F;  4X1K B;  2WAL A;  5HY1 A;  2HS0 A;  3CMA F;  1OFU A;  1H7M A;  4NUT A;  2ZAU A;  3JAR A;  4O4H B;  4U39 A;  4BT7 A;  2BTU A;  3CCS F;  4O2A B;  1W58 1;  3GTZ A;  1YJW F;  5KX5 A;  1Q8R A;  4C4W C;  3WJR A;  2CZW A; 
#chains in the Genus database with same CATH homology
 1X7O A;  3SIV A;  3LWP C;  2KTU A;  1K8A H;  3J81 M;  2OTL F;  3PAF A;  5GIN C;  3JCM M;  1VQ7 F;  3V7E A;  1DT9 A;  5IT9 M;  1X7P A;  1GO0 A;  1XBI A;  1S72 F;  3CCU F;  1VQP F;  2FGY A;  2LBX A;  1N8R H;  3FFM A;  1JJ2 F;  3CME F;  1Q82 H;  3LWQ C;  4LCK A;  4BVT A;  3SIU A;  1CN7 A;  3RA6 A;  1E7K A;  2QEX F;  1KD1 H;  1VQ5 F;  2F9Z C;  3E20 B;  2BO1 A;  5EWR A;  1RLG A;  4EI7 A;  5A2Q M;  1W42 A;  1IPA A;  1VQ6 F;  2OHW A;  3OBW A;  3CPQ A;  1SDS A;  3V7Q A;  5EO3 A;  4BVS A;  1VQK F;  3NMU C;  3NK6 A;  3LWV C;  1QVF F;  2OTJ F;  4XCQ A;  3LWO C;  4BVR A;  2LBW A;  3I56 F;  3OW2 F;  1VQ4 F;  1VQO F;  1VQN F;  1M1K H;  3NVI B;  1Q81 H;  3CG6 A;  5FLX M;  4EI9 A;  1W3E X;  5GIO C;  1Q7Y H;  3O85 A;  3LFO A;  1M90 H;  1K9M H;  5DCV A;  3AGK A;  1X52 A;  1NMU B;  2OZB A;  3HJW C;  1W41 A;  3VMF B;  5HWE A;  1VQL F;  2VGN A;  4BW0 B;  3CCL F;  1YJN F;  5HY0 A;  3CC4 F;  2KTV A;  4X3L A;  2QI2 A;  2I6D A;  2GLZ A;  3VI6 A;  4X3M A;  4TZZ A;  5HY2 A;  4NQ3 A;  1PXW A;  3G6E F;  3CC2 F;  1VQ8 F;  3CXC F;  1VQ9 F;  3CCV F;  4C4W C;  3RA5 A;  5HY4 A;  1YIT F;  2AIF A;  3CCM F;  5GAN K;  3WXM B;  3CCR F;  2JNB A;  1NJI H;  3D00 A;  3CCE F;  3N4Z A;  5HXU A;  5HXZ A;  1YI2 F;  3CPW F;  1CK2 A;  2QA4 F;  2HVY D;  5GIP C;  1KQS F;  5FJ4 C;  3NVK E;  1YJ9 F;  4BY9 D;  3GYQ A;  3G4S F;  3J80 M;  5GAP K;  3NK7 A;  2KG4 A;  3JAM M;  3OBY A;  1W40 A;  3E1Y A;  1YHQ F;  3PLA C;  1QVG F;  1ZWZ A;  3IR9 A;  3CC7 F;  1GO1 A;  2VGM A;  3LWR C;  3HAX D;  3CCJ F;  2WAL A;  3MCA B;  4BVQ A;  5HY1 A;  3CMA F;  5G4U C;  1Q86 H;  1H7M A;  1RA4 A;  3CCQ F;  1VQM F;  3N4Y A;  1GZ0 A;  1YIJ F;  4NUT A;  1KC8 H;  3CD6 F;  2FC3 A;  3CCS F;  3G71 F;  3J7A R;  1YJW F;  1T0K B;  1K73 H;  5G4V C;  4EI8 A;  1W2B F;  2ALE A;  3V3T A;  3ON1 A;  3I55 F;  2CZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...