1VQ5F

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq5F00
3CPQA 3VMFB 1PXWA 1T0KB 3RA5A 1YI2F 1VQ4F 3CXCF 3PAFA 3LWVC 3CCEF 1M1KH 3JAMM 4LCKA 3SIVA 4C4WC 1Q82H 2AIFA 2WALA 1Q86H 5G4VC 1Q81H 2I6DA 1GO1A 1M90H 1RLGA 2OZBA 3CCVF 2OHWA 3LWQC 3OW2F 2KTVA 5GINC 5GANK 5EO3A 1KQSF 3CCSF 3ON1A 3CMAF 2LBWA 1YJ9F 1N8RH 3HJWC 3NVKE 1K9MH 1W42A 1KC8H 3CD6F 3IR9A 3CCLF 4NUTA 3PLAC 1Q7YH 2FC3A 4X3MA 1YJNF 3RA6A 3LWRC 5IT9M 3SIUA 3N4YA 3HAXD 1NJIH 3CC7F 1VQMF 1VQOF 3J80M 1ZWZA 1VQKF 3J7AR 2BO1A 3CCQF 1CN7A 1VQLF 1K8AH 3LWPC 1W3EX 1VQPF 2QEXF 5EWRA 3GYQA 1VQ8F 5GIOC 3E1YA 1VQ7F 2HVYD 3CG6A 3MCAB 3OBWA 1YITF 1YJWF 1VQ6F 1KD1H 1H7MA 3NVIB 1XBIA 4BY9D 3N4ZA 3G71F 3V7QA 3CMEF 1SDSA 2OTJF 4BW0B 2CZWA 5FLXM 2VGMA 1JJ2F 2QA4F 1GZ0A 3NMUC 2KTUA 5A2QM 3I55F 3FFMA 5GAPK 1IPAA 1NMUB 3G4SF 1QVGF 3NK6A 1K73H 3LFOA 1W41A 1VQ9F 2JNBA 2LBXA 3LWOC 3CPWF 3V7EA 5G4UC 1X7PA 1CK2A 1DT9A 1RA4A 1X7OA 3JCMM 1QVFF 1VQ5F 5DCVA 1VQNF 1E7KA 1GO0A 3CCRF 3VI6A 3G6EF 3AGKA 3CC2F 4X3LA 3WXMB 3J81M 1X52A 1YHQF 5GIPC 2QI2A 1W40A 3E20B 3CCMF 2ALEA 3I56F 1YIJF 3CCUF 5FJ4C 2VGNA 1S72F 3CCJF 3NK7A 3O85A 2OTLF 4TZZA 3CC4F 1W2BF 3OBYA 2KG4A
chains in the Genus database with same CATH superfamily
3S03A 3JAKB 3E22A 3Q8HA 2AIZP 3WPWA 2GLZA 3IMPA 3S0YA 2HS3A 3CXCF 2R751 2RB9A 5IYZA 3F0FA 3LWVC 3CCEF 4LCKA 4I4TA 3SIVA 3JARB 1XV2A 2WALA 5EIBC 3GTZA 5EIBD 4HNAB 1Q81H 5EB1B 1U3LA 2HQSC 4O2BB 4B5CA 3CCVF 3OW2F 2KTVA 3HKDA 5LA6B 3R0PA 2YYEA 5EZYB 5C8YA 4X1IB 3JALB 2RHLA 3JAWB 2LBWA 1KNKA 4ZHQB 4ZHVA 2CSLA 1W42A 4B62A 1IV2A 4WBNA 1IV1A 3JASB 3DDNA 1W5EA 4EB6A 5JCOC 1VK3A 4BT3A 5CB4B 3N4YA 5HXZA 3HAXD 3K12A 1W5BA 2EWCA 1ZWZA 4ZHWA 1VQKF 3TD3A 1SZQA 3HKDB 2HRUA 2MQEA 3P10A 3K2XA 2BO1A 5C8YB 1CN7A 1W581 1K8AH 2W8BC 4BT6A 3KHNA 5IJ9B 5MN6A 4G4ZA 4TV8B 1JN1A 4C8GA 3JATB 2R6R1 1YITF 1VQ6F 3KJKA 2H8EA 1H7MA 1Z5VA 4BY9D 5LOVB 2CWJA 3M4SA 4I50A 1SDSA 5EB0A 3C9TA 3V3TA 5FLXM 4EI9A 3U0OA 2QA4F 4G4XA 5HXUA 3I55F 5LXTA 3P4EA 3V4DA 2Z01A 3CPWF 3IKFA 2PMPA 1DT9A 1RA4A 3ERNA 1R1MA 4IIJB 2FGYA 3EORA 3VI6A 3CC2F 4X3LA 3WXMB 1ONIA 3RYFB 4X1YA 3JVHA 3TD4A 1YHQF 2RHJA 5GIPC 2QI2A 2G9IA 3E20B 4YJ3A 2ALEA 3I56F 1YQNA 5JVDB 5ITZA 2UZHA 2KGWA 3ZOPA 5LXTB 2CHTA 4X20B 4RQOA 2KG4A 3KE1A 5MN5A 3I7TA 3RE3A 5EYPA 1PXWA 4LNUA 5HP8A 2NMUA 4BVRA 1Z5WA 1M1KH 1RQ2A 4C4WC 1COMA 2Q1XA 3MQWA 2AIFA 2I6DA 1RLGA 5KX5A 1DBFA 5GINC 4TUYA 4C82A 5GANK 3RYCA 3IEWA 3ON1A 3K14A 4BVQA 3M1XA 4G4WA 1IV4A 4FFBB 2N48A 3HWUA 3KIZA 1KC8H 3CD6F 4NUTA 3PLAC 1Q7YH 4X3MA 3VIUA 3RA6A 1X25A 1PF5A 3QTYA 3HKBA 3FD5A 1TVKA 3ZP4A 5JQGA 3CC7F 1VQOF 2LBTA 1H47A 1KNJA 2ZODA 2BTOA 3J7AR 4NQ3A 5KX5B 4TUYB 1W55A 2ZAUA 3RYCB 1VHAA 2I6RA 2V9YA 4O4HA 3IEQA 4DXDA 2QEXF 2QTPA 1VQ8F 2AMTA 3E1YA 5HY2A 4O4JA 2HVYD 3E22B 3CG6A 2ZVYA 3OONA 3WJRA 3NVIB 5IYZB 1U3PA 3HKBB 3N4ZA 4I4TB 1TVKB 4ERHA 2OTJF 2ZF8A 4BW0B 2CZWA 2LCAA 4C8EA 1JJ2F 5BMVA 4U3JA 5A2QM 4KWEA 1IPAA 2IQQA 1NMUB 1QVGF 2IG8A 3LFOA 1JD1A 3ZP7A 5KMGA 4O4HB 5J2TA 2UYPA 3V7EA 5G4UC 2UYKA 3WJPA 1X7OA 3JCMM 4WBNB 1VQ5F 3BYQA 1VQNF 3VTIC 4EB6B 3C8LA 2PHNA 3HKCA 5LP6A 3AGKA 1FNJA 3J81M 4ZHYB 1FNKA 1W59A 4YJ2A 3S0WA 1W40A 1YIJF 1GX1A 4U3JB 3VYSC 1S72F 1SA0A 3NK7A 5J2UA 2OTLF 5EAZA 4BT2A 5JCOA 1XHOA 4F6RA 3CPQA 3VMFB 2VXYA 3RYIA 3D54A 3I3FA 2CVLA 4B46A 3RA5A 3JAMM 3N2KA 5LP6B 2Z1EA 1Q82H 4E6EA 1FSZA 5HY0A 2HS4A 1M90H 4I50B 3ESJA 4C81A 1KQSF 3CCSF 3LDTA 2ZOVA 3M84A 1RQ7A 1RLUA 2UYNA 3HJWC 4B45A 4O4IA 4I55A 2H8CA 2L26A 2HX0A 3IR9A 5CA0A 4O2AA 1YJNF 3S06A 3HKEA 3FD6A 5IT9M 3QHDA 3N2GA 1NQ3A 1NJIH 2B33A 4X1YB 3UT5A 4YJ3B 1IV3A 5HP7A 3CYPB 2GZLA 4G4YA 5ITZB 3CCQF 1VQLF 2Z1UA 4DRXA 3JAKA 3LWPC 5EWRA 3GYQA 5GIOC 5CA0B 3MCAB 3FPIA 3OBWA 5EYPB 1KD1H 2HP0A 4LNUB 3GHZA 3WGNA 1W57A 2BTQB 3N2GB 4HNAA 3ZO8A 4O2BA 3G71F 3V7QA 3CMEF 3P0ZA 3F0GA 5LA6A 1VQVA 5EZYA 4NWOB 4R40B 2VGMA 5CA1A 2IAFA 3B6NA 3UT5B 3LYBA 1JY8A 3JALA 3G4SF 3NK6A 3WPXA 1K73H 2Z1TA 1VQ9F 3JASA 4DRXB 2JNBA 3LWOC 4TV9A 1X7PA 2HP3A 5HY1A 3T80A 1J7HA 4ZI7A 3CCRF 3WGJA 5CB4A 3LMEA 3G6EF 2HP0B 5AVMA 4XCQA 4C8IA 5FNVA 5B8FA 1X52A 3DC2A 5JQGB 5LP6C 3CCMF 3ELCA 3CCUF 4U39A 5CA1B 3F0EA 4IHJA 2OTMA 3WGKA 4TZZA 2RHHA 1W2BF 5IJ9A 4TV8A 3VO8A 4RHAA 3D01A 2HRYA 3JATA 3RYHA 2VAMA 4TV9B 1UFYA 1T0KB 3MBMA 1YI2F 4ZI7B 1VQ4F 4O4JB 3VYTC 3PAFA 4BVSA 5LOVA 4G88A 2BTUA 1Q86H 5FNVB 3K0TA 2F9ZC 1W5AA 5G4VC 1GO1A 3CB2A 2OZBA 1ODEA 4BT5A 2OHWA 3LWQC 3L7QA 2GVIA 3F6MA 4X1KA 1TUBA 5EO3A 1H48A 1W5FA 2K1SA 3CMAF 4IHJB 2YXZA 5BMVB 1YJ9F 1XRGA 2ZVZA 1N8RH 3NVKE 1K9MH 5KMGB 3C9SA 2Z1FA 3C9UA 1OAPA 4IIJA 3RYHB 3CCLF 5J2TB 2FC3A 1QD9A 3LWRC 3SIUA 3RYFA 1U40A 5JH7A 1JFFA 4ZOLA 3HKCB 1VQMF 3J80M 4G4VA 5GONA 5JVDA 4YJ2B 4ZK7A 3VYUC 4X1KB 1TUBB 4X20A 3VOBA 3WJQA 1QU9A 1SA0B 5J2UB 2VAWA 1W3EX 1VQPF 3VCZA 4PWTA 5HWEA 4F6RB 5IJ0A 3C9RA 1VQ7F 1YJWF 5LYJA 3S0HA 3RYIB 1U43A 3CYQA 3MCQA 3QUWA 1XBIA 4M8IA 3FBAA 2VAPA 5JH7B 3N2KB 1JFFB 4ZOLB 2Q1YA 3F0DA 4O4LA 1FFXA 5GONB 1VH8A 4EI8A 1GZ0A 3NMUC 2KTUA 3WGMA 3FFMA 5GAPK 1YGYA 4FFBA 3IKEA 2HS0A 2RHOA 1W41A 2CHSA 2LBXA 2UYJA 2UYNB 5MN4A 1CK2A 5HY4A 1QVFF 4O4IB 4I55B 5IJ0B 5DCVA 1E7KA 1T0AA 1GO0A 4O2AB 5LYJB 3KJJA 3MDOA 3HKEB 3JARA 1QAHA 2P6YA 1Q8RA 1UI9A 2DYYA 2H6LA 4BT4A 4EI7A 4O4LB 1FFXB 5FJ4C 4BT7A 3D00A 3VOAA 4X1IA 2VGNA 3TD5A 2DT4A 1CLIA 3WGLA 3S02A 3CCJF 3O85A 3JAWA 4BVTA 3HTNA 3CC4F 1OFUA 4ZHQA 3OBYA 2CW4A
chains in the Genus database with same CATH topology
3CPQA 3VMFB 2GLZA 1PXWA 1T0KB 3RA5A 1YI2F 1VQ4F 4BVRA 3PAFA 4BVSA 3CXCF 3LWVC 3CCEF 1M1KH 3JAMM 4LCKA 3SIVA 4C4WC 1Q82H 2AIFA 2WALA 1Q86H 2F9ZC 5HY0A 5G4VC 2I6DA 1GO1A 1Q81H 1M90H 1RLGA 2OZBA 3CCVF 2OHWA 3LWQC 3OW2F 2KTVA 5GINC 5GANK 5EO3A 1KQSF 3CCSF 3ON1A 4BVQA 3CMAF 2LBWA 1YJ9F 1N8RH 3HJWC 3NVKE 1K9MH 1W42A 1KC8H 3CD6F 3IR9A 3CCLF 4NUTA 3PLAC 1Q7YH 2FC3A 4X3MA 1YJNF 3RA6A 3LWRC 5IT9M 3SIUA 3N4YA 5HXZA 3HAXD 1NJIH 3CC7F 1VQMF 1VQOF 3J80M 1ZWZA 1VQKF 3J7AR 4NQ3A 2BO1A 3CCQF 1CN7A 1VQLF 1K8AH 3LWPC 1W3EX 1VQPF 2QEXF 5EWRA 5HWEA 3GYQA 1VQ8F 5GIOC 3E1YA 5HY2A 1VQ7F 2HVYD 3CG6A 3MCAB 3OBWA 1YITF 1YJWF 1VQ6F 1KD1H 1H7MA 3NVIB 1XBIA 4BY9D 3N4ZA 3G71F 3V7QA 3CMEF 1SDSA 2OTJF 4BW0B 3V3TA 2CZWA 5FLXM 4EI9A 4EI8A 2VGMA 1JJ2F 2QA4F 1GZ0A 3NMUC 2KTUA 5A2QM 5HXUA 3I55F 3FFMA 5GAPK 1IPAA 1NMUB 3G4SF 1QVGF 3NK6A 1K73H 3LFOA 1W41A 1VQ9F 2JNBA 2LBXA 3LWOC 3CPWF 3V7EA 5G4UC 1X7PA 1CK2A 1DT9A 1RA4A 1X7OA 5HY4A 3JCMM 5HY1A 1QVFF 1VQ5F 5DCVA 1VQNF 1E7KA 2FGYA 1GO0A 3CCRF 3VI6A 3G6EF 3AGKA 4XCQA 4X3LA 3CC2F 3WXMB 3J81M 1X52A 1YHQF 5GIPC 2QI2A 1W40A 3E20B 4EI7A 3CCMF 2ALEA 3I56F 1YIJF 3CCUF 5FJ4C 3D00A 2VGNA 1S72F 3CCJF 3NK7A 3O85A 4BVTA 2OTLF 4TZZA 3CC4F 1W2BF 3OBYA 2KG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPQ A;  3VMF B;  1PXW A;  1T0K B;  3RA5 A;  1YI2 F;  1VQ4 F;  3CXC F;  3PAF A;  3LWV C;  3CCE F;  1M1K H;  3JAM M;  4LCK A;  3SIV A;  4C4W C;  1Q82 H;  2AIF A;  2WAL A;  1Q86 H;  5G4V C;  1Q81 H;  2I6D A;  1GO1 A;  1M90 H;  1RLG A;  2OZB A;  3CCV F;  2OHW A;  3LWQ C;  3OW2 F;  2KTV A;  5GIN C;  5GAN K;  5EO3 A;  1KQS F;  3CCS F;  3ON1 A;  3CMA F;  2LBW A;  1YJ9 F;  1N8R H;  3HJW C;  3NVK E;  1K9M H;  1W42 A;  1KC8 H;  3CD6 F;  3IR9 A;  3CCL F;  4NUT A;  3PLA C;  1Q7Y H;  2FC3 A;  4X3M A;  1YJN F;  3RA6 A;  3LWR C;  5IT9 M;  3SIU A;  3N4Y A;  3HAX D;  1NJI H;  3CC7 F;  1VQM F;  1VQO F;  3J80 M;  1ZWZ A;  1VQK F;  3J7A R;  2BO1 A;  3CCQ F;  1CN7 A;  1VQL F;  1K8A H;  3LWP C;  1W3E X;  1VQP F;  2QEX F;  5EWR A;  3GYQ A;  1VQ8 F;  5GIO C;  3E1Y A;  1VQ7 F;  2HVY D;  3CG6 A;  3MCA B;  3OBW A;  1YIT F;  1YJW F;  1VQ6 F;  1KD1 H;  1H7M A;  3NVI B;  1XBI A;  4BY9 D;  3N4Z A;  3G71 F;  3V7Q A;  3CME F;  1SDS A;  2OTJ F;  4BW0 B;  2CZW A;  5FLX M;  2VGM A;  1JJ2 F;  2QA4 F;  1GZ0 A;  3NMU C;  2KTU A;  5A2Q M;  3I55 F;  3FFM A;  5GAP K;  1IPA A;  1NMU B;  3G4S F;  1QVG F;  3NK6 A;  1K73 H;  3LFO A;  1W41 A;  1VQ9 F;  2JNB A;  2LBX A;  3LWO C;  3CPW F;  3V7E A;  5G4U C;  1X7P A;  1CK2 A;  1DT9 A;  1RA4 A;  1X7O A;  3JCM M;  1QVF F;  1VQ5 F;  5DCV A;  1VQN F;  1E7K A;  1GO0 A;  3CCR F;  3VI6 A;  3G6E F;  3AGK A;  3CC2 F;  4X3L A;  3WXM B;  3J81 M;  1X52 A;  1YHQ F;  5GIP C;  2QI2 A;  1W40 A;  3E20 B;  3CCM F;  2ALE A;  3I56 F;  1YIJ F;  3CCU F;  5FJ4 C;  2VGN A;  1S72 F;  3CCJ F;  3NK7 A;  3O85 A;  2OTL F;  4TZZ A;  3CC4 F;  1W2B F;  3OBY A;  2KG4 A; 
#chains in the Genus database with same CATH topology
 3S03 A;  3JAK B;  3E22 A;  3Q8H A;  2AIZ P;  3WPW A;  2GLZ A;  3IMP A;  3S0Y A;  2HS3 A;  3CXC F;  2R75 1;  2RB9 A;  5IYZ A;  3F0F A;  3LWV C;  3CCE F;  4LCK A;  4I4T A;  3SIV A;  3JAR B;  1XV2 A;  2WAL A;  5EIB C;  3GTZ A;  5EIB D;  4HNA B;  1Q81 H;  5EB1 B;  1U3L A;  2HQS C;  4O2B B;  4B5C A;  3CCV F;  3OW2 F;  2KTV A;  3HKD A;  5LA6 B;  3R0P A;  2YYE A;  5EZY B;  5C8Y A;  4X1I B;  3JAL B;  2RHL A;  3JAW B;  2LBW A;  1KNK A;  4ZHQ B;  4ZHV A;  2CSL A;  1W42 A;  4B62 A;  1IV2 A;  4WBN A;  1IV1 A;  3JAS B;  3DDN A;  1W5E A;  4EB6 A;  5JCO C;  1VK3 A;  4BT3 A;  5CB4 B;  3N4Y A;  5HXZ A;  3HAX D;  3K12 A;  1W5B A;  2EWC A;  1ZWZ A;  4ZHW A;  1VQK F;  3TD3 A;  1SZQ A;  3HKD B;  2HRU A;  2MQE A;  3P10 A;  3K2X A;  2BO1 A;  5C8Y B;  1CN7 A;  1W58 1;  1K8A H;  2W8B C;  4BT6 A;  3KHN A;  5IJ9 B;  5MN6 A;  4G4Z A;  4TV8 B;  1JN1 A;  4C8G A;  3JAT B;  2R6R 1;  1YIT F;  1VQ6 F;  3KJK A;  2H8E A;  1H7M A;  1Z5V A;  4BY9 D;  5LOV B;  2CWJ A;  3M4S A;  4I50 A;  1SDS A;  5EB0 A;  3C9T A;  3V3T A;  5FLX M;  4EI9 A;  3U0O A;  2QA4 F;  4G4X A;  5HXU A;  3I55 F;  5LXT A;  3P4E A;  3V4D A;  2Z01 A;  3CPW F;  3IKF A;  2PMP A;  1DT9 A;  1RA4 A;  3ERN A;  1R1M A;  4IIJ B;  2FGY A;  3EOR A;  3VI6 A;  3CC2 F;  4X3L A;  3WXM B;  1ONI A;  3RYF B;  4X1Y A;  3JVH A;  3TD4 A;  1YHQ F;  2RHJ A;  5GIP C;  2QI2 A;  2G9I A;  3E20 B;  4YJ3 A;  2ALE A;  3I56 F;  1YQN A;  5JVD B;  5ITZ A;  2UZH A;  2KGW A;  3ZOP A;  5LXT B;  2CHT A;  4X20 B;  4RQO A;  2KG4 A;  3KE1 A;  5MN5 A;  3I7T A;  3RE3 A;  5EYP A;  1PXW A;  4LNU A;  5HP8 A;  2NMU A;  4BVR A;  1Z5W A;  1M1K H;  1RQ2 A;  4C4W C;  1COM A;  2Q1X A;  3MQW A;  2AIF A;  2I6D A;  1RLG A;  5KX5 A;  1DBF A;  5GIN C;  4TUY A;  4C82 A;  5GAN K;  3RYC A;  3IEW A;  3ON1 A;  3K14 A;  4BVQ A;  3M1X A;  4G4W A;  1IV4 A;  4FFB B;  2N48 A;  3HWU A;  3KIZ A;  1KC8 H;  3CD6 F;  4NUT A;  3PLA C;  1Q7Y H;  4X3M A;  3VIU A;  3RA6 A;  1X25 A;  1PF5 A;  3QTY A;  3HKB A;  3FD5 A;  1TVK A;  3ZP4 A;  5JQG A;  3CC7 F;  1VQO F;  2LBT A;  1H47 A;  1KNJ A;  2ZOD A;  2BTO A;  3J7A R;  4NQ3 A;  5KX5 B;  4TUY B;  1W55 A;  2ZAU A;  3RYC B;  1VHA A;  2I6R A;  2V9Y A;  4O4H A;  3IEQ A;  4DXD A;  2QEX F;  2QTP A;  1VQ8 F;  2AMT A;  3E1Y A;  5HY2 A;  4O4J A;  2HVY D;  3E22 B;  3CG6 A;  2ZVY A;  3OON A;  3WJR A;  3NVI B;  5IYZ B;  1U3P A;  3HKB B;  3N4Z A;  4I4T B;  1TVK B;  4ERH A;  2OTJ F;  2ZF8 A;  4BW0 B;  2CZW A;  2LCA A;  4C8E A;  1JJ2 F;  5BMV A;  4U3J A;  5A2Q M;  4KWE A;  1IPA A;  2IQQ A;  1NMU B;  1QVG F;  2IG8 A;  3LFO A;  1JD1 A;  3ZP7 A;  5KMG A;  4O4H B;  5J2T A;  2UYP A;  3V7E A;  5G4U C;  2UYK A;  3WJP A;  1X7O A;  3JCM M;  4WBN B;  1VQ5 F;  3BYQ A;  1VQN F;  3VTI C;  4EB6 B;  3C8L A;  2PHN A;  3HKC A;  5LP6 A;  3AGK A;  1FNJ A;  3J81 M;  4ZHY B;  1FNK A;  1W59 A;  4YJ2 A;  3S0W A;  1W40 A;  1YIJ F;  1GX1 A;  4U3J B;  3VYS C;  1S72 F;  1SA0 A;  3NK7 A;  5J2U A;  2OTL F;  5EAZ A;  4BT2 A;  5JCO A;  1XHO A;  4F6R A;  3CPQ A;  3VMF B;  2VXY A;  3RYI A;  3D54 A;  3I3F A;  2CVL A;  4B46 A;  3RA5 A;  3JAM M;  3N2K A;  5LP6 B;  2Z1E A;  1Q82 H;  4E6E A;  1FSZ A;  5HY0 A;  2HS4 A;  1M90 H;  4I50 B;  3ESJ A;  4C81 A;  1KQS F;  3CCS F;  3LDT A;  2ZOV A;  3M84 A;  1RQ7 A;  1RLU A;  2UYN A;  3HJW C;  4B45 A;  4O4I A;  4I55 A;  2H8C A;  2L26 A;  2HX0 A;  3IR9 A;  5CA0 A;  4O2A A;  1YJN F;  3S06 A;  3HKE A;  3FD6 A;  5IT9 M;  3QHD A;  3N2G A;  1NQ3 A;  1NJI H;  2B33 A;  4X1Y B;  3UT5 A;  4YJ3 B;  1IV3 A;  5HP7 A;  3CYP B;  2GZL A;  4G4Y A;  5ITZ B;  3CCQ F;  1VQL F;  2Z1U A;  4DRX A;  3JAK A;  3LWP C;  5EWR A;  3GYQ A;  5GIO C;  5CA0 B;  3MCA B;  3FPI A;  3OBW A;  5EYP B;  1KD1 H;  2HP0 A;  4LNU B;  3GHZ A;  3WGN A;  1W57 A;  2BTQ B;  3N2G B;  4HNA A;  3ZO8 A;  4O2B A;  3G71 F;  3V7Q A;  3CME F;  3P0Z A;  3F0G A;  5LA6 A;  1VQV A;  5EZY A;  4NWO B;  4R40 B;  2VGM A;  5CA1 A;  2IAF A;  3B6N A;  3UT5 B;  3LYB A;  1JY8 A;  3JAL A;  3G4S F;  3NK6 A;  3WPX A;  1K73 H;  2Z1T A;  1VQ9 F;  3JAS A;  4DRX B;  2JNB A;  3LWO C;  4TV9 A;  1X7P A;  2HP3 A;  5HY1 A;  3T80 A;  1J7H A;  4ZI7 A;  3CCR F;  3WGJ A;  5CB4 A;  3LME A;  3G6E F;  2HP0 B;  5AVM A;  4XCQ A;  4C8I A;  5FNV A;  5B8F A;  1X52 A;  3DC2 A;  5JQG B;  5LP6 C;  3CCM F;  3ELC A;  3CCU F;  4U39 A;  5CA1 B;  3F0E A;  4IHJ A;  2OTM A;  3WGK A;  4TZZ A;  2RHH A;  1W2B F;  5IJ9 A;  4TV8 A;  3VO8 A;  4RHA A;  3D01 A;  2HRY A;  3JAT A;  3RYH A;  2VAM A;  4TV9 B;  1UFY A;  1T0K B;  3MBM A;  1YI2 F;  4ZI7 B;  1VQ4 F;  4O4J B;  3VYT C;  3PAF A;  4BVS A;  5LOV A;  4G88 A;  2BTU A;  1Q86 H;  5FNV B;  3K0T A;  2F9Z C;  1W5A A;  5G4V C;  1GO1 A;  3CB2 A;  2OZB A;  1ODE A;  4BT5 A;  2OHW A;  3LWQ C;  3L7Q A;  2GVI A;  3F6M A;  4X1K A;  1TUB A;  5EO3 A;  1H48 A;  1W5F A;  2K1S A;  3CMA F;  4IHJ B;  2YXZ A;  5BMV B;  1YJ9 F;  1XRG A;  2ZVZ A;  1N8R H;  3NVK E;  1K9M H;  5KMG B;  3C9S A;  2Z1F A;  3C9U A;  1OAP A;  4IIJ A;  3RYH B;  3CCL F;  5J2T B;  2FC3 A;  1QD9 A;  3LWR C;  3SIU A;  3RYF A;  1U40 A;  5JH7 A;  1JFF A;  4ZOL A;  3HKC B;  1VQM F;  3J80 M;  4G4V A;  5GON A;  5JVD A;  4YJ2 B;  4ZK7 A;  3VYU C;  4X1K B;  1TUB B;  4X20 A;  3VOB A;  3WJQ A;  1QU9 A;  1SA0 B;  5J2U B;  2VAW A;  1W3E X;  1VQP F;  3VCZ A;  4PWT A;  5HWE A;  4F6R B;  5IJ0 A;  3C9R A;  1VQ7 F;  1YJW F;  5LYJ A;  3S0H A;  3RYI B;  1U43 A;  3CYQ A;  3MCQ A;  3QUW A;  1XBI A;  4M8I A;  3FBA A;  2VAP A;  5JH7 B;  3N2K B;  1JFF B;  4ZOL B;  2Q1Y A;  3F0D A;  4O4L A;  1FFX A;  5GON B;  1VH8 A;  4EI8 A;  1GZ0 A;  3NMU C;  2KTU A;  3WGM A;  3FFM A;  5GAP K;  1YGY A;  4FFB A;  3IKE A;  2HS0 A;  2RHO A;  1W41 A;  2CHS A;  2LBX A;  2UYJ A;  2UYN B;  5MN4 A;  1CK2 A;  5HY4 A;  1QVF F;  4O4I B;  4I55 B;  5IJ0 B;  5DCV A;  1E7K A;  1T0A A;  1GO0 A;  4O2A B;  5LYJ B;  3KJJ A;  3MDO A;  3HKE B;  3JAR A;  1QAH A;  2P6Y A;  1Q8R A;  1UI9 A;  2DYY A;  2H6L A;  4BT4 A;  4EI7 A;  4O4L B;  1FFX B;  5FJ4 C;  4BT7 A;  3D00 A;  3VOA A;  4X1I A;  2VGN A;  3TD5 A;  2DT4 A;  1CLI A;  3WGL A;  3S02 A;  3CCJ F;  3O85 A;  3JAW A;  4BVT A;  3HTN A;  3CC4 F;  1OFU A;  4ZHQ A;  3OBY A;  2CW4 A; 
#chains in the Genus database with same CATH homology
 3CPQ A;  3VMF B;  2GLZ A;  1PXW A;  1T0K B;  3RA5 A;  1YI2 F;  1VQ4 F;  4BVR A;  3PAF A;  4BVS A;  3CXC F;  3LWV C;  3CCE F;  1M1K H;  3JAM M;  4LCK A;  3SIV A;  4C4W C;  1Q82 H;  2AIF A;  2WAL A;  1Q86 H;  2F9Z C;  5HY0 A;  5G4V C;  2I6D A;  1GO1 A;  1Q81 H;  1M90 H;  1RLG A;  2OZB A;  3CCV F;  2OHW A;  3LWQ C;  3OW2 F;  2KTV A;  5GIN C;  5GAN K;  5EO3 A;  1KQS F;  3CCS F;  3ON1 A;  4BVQ A;  3CMA F;  2LBW A;  1YJ9 F;  1N8R H;  3HJW C;  3NVK E;  1K9M H;  1W42 A;  1KC8 H;  3CD6 F;  3IR9 A;  3CCL F;  4NUT A;  3PLA C;  1Q7Y H;  2FC3 A;  4X3M A;  1YJN F;  3RA6 A;  3LWR C;  5IT9 M;  3SIU A;  3N4Y A;  5HXZ A;  3HAX D;  1NJI H;  3CC7 F;  1VQM F;  1VQO F;  3J80 M;  1ZWZ A;  1VQK F;  3J7A R;  4NQ3 A;  2BO1 A;  3CCQ F;  1CN7 A;  1VQL F;  1K8A H;  3LWP C;  1W3E X;  1VQP F;  2QEX F;  5EWR A;  5HWE A;  3GYQ A;  1VQ8 F;  5GIO C;  3E1Y A;  5HY2 A;  1VQ7 F;  2HVY D;  3CG6 A;  3MCA B;  3OBW A;  1YIT F;  1YJW F;  1VQ6 F;  1KD1 H;  1H7M A;  3NVI B;  1XBI A;  4BY9 D;  3N4Z A;  3G71 F;  3V7Q A;  3CME F;  1SDS A;  2OTJ F;  4BW0 B;  3V3T A;  2CZW A;  5FLX M;  4EI9 A;  4EI8 A;  2VGM A;  1JJ2 F;  2QA4 F;  1GZ0 A;  3NMU C;  2KTU A;  5A2Q M;  5HXU A;  3I55 F;  3FFM A;  5GAP K;  1IPA A;  1NMU B;  3G4S F;  1QVG F;  3NK6 A;  1K73 H;  3LFO A;  1W41 A;  1VQ9 F;  2JNB A;  2LBX A;  3LWO C;  3CPW F;  3V7E A;  5G4U C;  1X7P A;  1CK2 A;  1DT9 A;  1RA4 A;  1X7O A;  5HY4 A;  3JCM M;  5HY1 A;  1QVF F;  1VQ5 F;  5DCV A;  1VQN F;  1E7K A;  2FGY A;  1GO0 A;  3CCR F;  3VI6 A;  3G6E F;  3AGK A;  4XCQ A;  4X3L A;  3CC2 F;  3WXM B;  3J81 M;  1X52 A;  1YHQ F;  5GIP C;  2QI2 A;  1W40 A;  3E20 B;  4EI7 A;  3CCM F;  2ALE A;  3I56 F;  1YIJ F;  3CCU F;  5FJ4 C;  3D00 A;  2VGN A;  1S72 F;  3CCJ F;  3NK7 A;  3O85 A;  4BVT A;  2OTL F;  4TZZ A;  3CC4 F;  1W2B F;  3OBY A;  2KG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...