1VQ6F

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq6F00
3NK6A 3J81M 1RA4A 3WXMB 3G71F 3CCUF 1RLGA 2FC3A 1VQNF 5FJ4C 3NVIB 2LBXA 3HJWC 3I56F 2JNBA 3PAFA 1VQOF 3OBYA 1H7MA 2BO1A 3J7AR 3CD6F 3LFOA 1KQSF 3CCVF 2OTLF 1GO1A 1VQ6F 4LCKA 3CCQF 3GYQA 1Q82H 3CG6A 3G6EF 1VQLF 1IPAA 1Q81H 1VQMF 3OW2F 1VQ8F 4X3LA 3CC7F 3NVKE 1CN7A 2OZBA 1GZ0A 2KG4A 3LWOC 3CCRF 1X52A 2ALEA 1ZWZA 1VQPF 3NMUC 3SIUA 3CPWF 3OBWA 1E7KA 1VQ4F 3CMAF 1X7OA 3CCJF 4BY9D 1KC8H 3AGKA 3JCMM 5A2QM 5DCVA 3RA6A 3I55F 1VQKF 3J80M 1YI2F 3CMEF 3LWPC 1PXWA 2I6DA 3LWVC 3N4ZA 1K73H 1CK2A 1JJ2F 3E20B 2KTUA 3CCMF 1YIJF 1GO0A 1S72F 2CZWA 1VQ5F 5G4UC 2VGNA 5EWRA 1N8RH 3CCSF 3VMFB 3IR9A 1K9MH 5G4VC 1SDSA 4C4WC 3MCAB 2HVYD 1Q86H 1X7PA 3FFMA 2OTJF 1W41A 5GAPK 4BW0B 3LWRC 1KD1H 1VQ7F 5FLXM 1VQ9F 3HAXD 1T0KB 3G4SF 1XBIA 1YITF 3RA5A 1W40A 3SIVA 1YJ9F 1DT9A 1NJIH 1K8AH 5IT9M 1M90H 1W42A 2QEXF 2WALA 5GIPC 2KTVA 1YHQF 1YJNF 3PLAC 3CCEF 3JAMM 1QVFF 3V7QA 1YJWF 2QA4F 4NUTA 3O85A 3LWQC 3CCLF 1NMUB 1QVGF 1W3EX 4TZZA 3N4YA 3CC4F 3VI6A 3ON1A 4X3MA 2QI2A 2OHWA 2LBWA 5EO3A 1W2BF 3E1YA 1M1KH 5GIOC 5GINC 3CPQA 2VGMA 3CXCF 1Q7YH 3V7EA 3CC2F 3NK7A 5GANK 2AIFA
chains in the Genus database with same CATH superfamily
3RYIB 3JARA 3MCQA 3WGNA 3WGLA 1RA4A 1TUBA 3G71F 3L7QA 2FC3A 3T80A 4ZOLA 2IQQA 2UYNA 1IV4A 1VHAA 2Z1EA 3OBYA 3S03A 1H7MA 2BO1A 3JARB 3ERNA 1TUBB 3VYSC 1UI9A 4ZOLB 1YGYA 3D54A 3CG6A 3G6EF 4M8IA 5LOVA 1Q81H 1VQ8F 2IAFA 3M84A 3HKEA 5HXUA 2ALEA 3N2GB 3S06A 1SZQA 4BT7A 5IYZB 3GTZA 1VQPF 5HY0A 5LOVB 5EB0A 2GVIA 4ZK7A 4ZHYB 2RHJA 3KHNA 4EI8A 4BY9D 3HTNA 1X25A 3K2XA 4PWTA 1JFFA 3J80M 1YI2F 2BTQB 2H6LA 1TVKB 5EYPA 3VYTC 2CSLA 3P10A 2HP0B 2MQEA 3GHZA 4ZHWA 1JFFB 5J2TA 1KNKA 3FD5A 2HX0A 3CCMF 4EB6B 1S72F 2UYPA 5MN4A 3UT5B 5G4UC 3R0PA 1Z5VA 2CW4A 3OONA 3VMFB 4BVQA 3B6NA 3IR9A 1SDSA 1XV2A 5LP6C 4O4HA 2LBTA 2OTJF 5GAPK 1VQ7F 1KD1H 2VAMA 1FSZA 2G9IA 3LDTA 3BYQA 4EI9A 2CHSA 3FPIA 3RYHA 1OFUA 1K8AH 1M90H 5IT9M 1W42A 5HP7A 5GIPC 2KTVA 2HS3A 2NMUA 3PLAC 5KMGA 3D01A 3CCEF 3JAMM 2VAWA 4NUTA 4ZHVA 5LP6B 3CCLF 5HY2A 3RYHB 3MBMA 4X20A 4C8IA 2H8EA 2KGWA 2K1SA 3IEQA 2I6RA 2QI2A 5HP8A 4IIJA 1M1KH 3D00A 5GIOC 1QAHA 1R1MA 1T0AA 5MN5A 4O2AA 5LA6A 1W5BA 4IIJB 3WJRA 3J81M 5EIBD 3CCUF 5FJ4C 1RLGA 3NVIB 4G4XA 2JNBA 4O4LA 5LA6B 3MQWA 2F9ZC 1VQOF 3VOBA 3ESJA 2UYKA 3WGMA 5AVMA 4B45A 3S02A 1KQSF 3CCVF 2OTLF 3HWUA 5BMVA 1VQ6F 2CWJA 4X1KA 1W581 4LCKA 4O4LB 3RYIA 3ELCA 2AMTA 2VAPA 1CN7A 3F6MA 3M4SA 2OZBA 1FNKA 3TD5A 1JD1A 1X52A 4LNUA 5BMVB 4X1KB 1IV3A 1CLIA 3SIUA 3JAKB 3OBWA 1VQ4F 4B46A 5C8YA 3CMAF 3ZP7A 3F0FA 3WPXA 1X7OA 3MDOA 1DBFA 1KC8H 4TUYA 4G4YA 3M1XA 4LNUB 4KWEA 5A2QM 3RA6A 5DCVA 2ZODA 3C9TA 4U3JB 2UZHA 2Q1YA 5C8YB 3K0TA 3JAWA 1YQNA 1XHOA 3N2GA 4I50B 5IYZA 3N4ZA 4TUYB 3TD3A 2RB9A 5HWEA 1K73H 1JJ2F 4DRXA 4O2BA 1W5EA 1ONIA 3TD4A 3F0DA 2BTUA 4I4TA 1YIJF 3JAWB 3KIZA 2VGNA 5EWRA 1FFXA 3CCSF 5CA1B 4DRXB 4O2BB 1TVKA 4I4TB 2HP0A 3MCAB 1FFXB 4BW0B 2RHOA 3WGKA 4EB6A 1ODEA 1T0KB 3WJPA 3UT5A 1YITF 3RA5A 4BT3A 2YYEA 1W40A 1YJ9F 2YXZA 3LMEA 3C9SA 4R40B 2HRYA 2QEXF 3FD6A 3VYUC 5JCOC 1UFYA 2RHLA 2UYJA 4ZI7B 2HP3A 2B33A 4ZHQA 3VO8A 3DDNA 1IV2A 1NMUB 1QVGF 5IJ9A 1VH8A 5JCOA 2GLZA 2LBWA 1W2BF 4ZHQB 5GINC 1FNJA 2HS4A 5IJ9B 4G88A 1Q7YH 5JH7A 5LP6A 2AIFA 3P0ZA 1H47A 4ERHA 3JASB 3IMPA 3I56F 3PAFA 5JH7B 1W5AA 5JQGA 5KX5B 4YJ2B 3QUWA 4C8EA 5FNVA 2OTMA 3LFOA 1GO1A 5EB1B 4HNAA 1H48A 1Q82H 3S0HA 4C82A 4C8GA 1IPAA 1JN1A 2DYYA 4G4WA 5JQGB 1XRGA 3RE3A 4EI7A 3F0EA 1GZ0A 2ZVZA 5FNVB 3LWOC 4G4ZA 3CCRF 4O4IA 4HNAB 4WBNB 5ITZA 2EWCA 4RHAA 1E7KA 1J7HA 5CB4A 3I3FA 5EIBC 3CCJF 3AGKA 3VOAA 1OAPA 4O4IB 1VK3A 3WGJA 1VQKF 1JY8A 5ITZB 3VIUA 3LWPC 5CB4B 4IHJA 2ZVYA 3CYQA 3LWVC 3I7TA 1CK2A 3JAKA 5LXTB 2KTUA 1VQVA 1U3LA 1GO0A 2CZWA 1VQ5F 4IHJB 1N8RH 4TV9A 4U3JA 4I50A 2W8BC 5LYJB 2L26A 2H8CA 1W41A 3IKEA 4TV9B 3LWRC 1VQ9F 3FBAA 4BT6A 3QTYA 4BT5A 1RQ7A 4NQ3A 3G4SF 1XBIA 3SIVA 2HRUA 1DT9A 5CA1A 1W57A 1NJIH 3VCZA 1Q8RA 3HKBA 4B5CA 3CB2A 1IV1A 3K14A 1YHQF 1YJNF 2HS0A 5MN6A 1QU9A 3ZOPA 1W55A 1YJWF 3V4DA 2QA4F 3O85A 3CYPB 4C81A 3HKBB 4E6EA 4F6RA 1W3EX 1U43A 3N4YA 5HY4A 3IKFA 2Z1UA 2UYNB 4RQOA 3ON1A 4X3MA 2DT4A 5EO3A 3E1YA 4F6RB 3JATA 4O4JA 2GZLA 2VGMA 3V7EA 4ZI7A 2ZAUA 3NK7A 3ZO8A 5JVDA 2LCAA 4YJ3A 5GANK 5B8FA 2Q1XA 3NK6A 1W5FA 3WXMB 1VQNF 1KNJA 3S0WA 2LBXA 3JATB 3HJWC 4BT2A 4O4JB 3HKEB 2Z01A 5JVDB 4YJ3B 3KE1A 3J7AR 2CHTA 3CD6F 1QD9A 4U39A 4I55A 3CCQF 4B62A 3GYQA 2N48A 3C9RA 5EAZA 2IG8A 4X1YA 1VQLF 2FGYA 1VQMF 2AIZP 3OW2F 3JASA 4X3LA 3CC7F 3NVKE 2KG4A 4FFBA 1W59A 1RQ2A 4I55B 5EYPB 3HKCA 3KJJA 5KX5A 4YJ2A 4BVSA 1ZWZA 3IEWA 4X1YB 3NMUC 3CPWF 4X1IA 5J2TB 4FFBB 5HY1A 3JCMM 3WJQA 2V9YA 3HKCB 1U3PA 3I55F 1U40A 3CMEF 4X1IB 1PXWA 3QHDA 1COMA 2I6DA 4XCQA 4WBNA 3HKDA 3E22A 4O4HB 3U0OA 3E20B 3Q8HA 5HXZA 3V3TA 3N2KA 4DXDA 5GONA 3HKDB 3E22B 1PF5A 2ZOVA 3K12A 2P6YA 3RYFA 1K9MH 3N2KB 5G4VC 1GX1A 4C4WC 2Z1FA 5GONB 3C8LA 4G4VA 5KMGB 1X7PA 1Q86H 2HVYD 3FFMA 5J2UA 5CA0A 3ZP4A 5LXTA 3HAXD 5FLXM 3RYFB 1RLUA 2HQSC 2PHNA 2PMPA 5EZYA 4TV8A 3LYBA 4X20B 4NWOB 3JVHA 3RYCA 5J2UB 5CA0B 2Z1TA 3JALA 2WALA 3EORA 4TV8B 5EZYB 5LYJA 5IJ0A 1QVFF 3RYCB 4O2AB 3V7QA 2ZF8A 2CVLA 2BTOA 3KJKA 3LWQC 3P4EA 1SA0A 4BVRA 3JALB 1Z5WA 4TZZA 3F0GA 5IJ0B 3CC4F 2R751 3VI6A 3S0YA 2RHHA 2R6R1 2VXYA 2OHWA 3WPWA 3C9UA 1NQ3A 3VTIC 1SA0B 2QTPA 3CPQA 3CXCF 3CC2F 3DC2A 4BT4A 4BVTA
chains in the Genus database with same CATH topology
3NK6A 3J81M 1RA4A 3WXMB 3G71F 3CCUF 1RLGA 2FC3A 1VQNF 5FJ4C 3NVIB 2LBXA 3HJWC 3I56F 2JNBA 3PAFA 2F9ZC 3OBYA 1VQOF 1H7MA 2BO1A 3J7AR 3CD6F 3LFOA 1KQSF 3CCVF 2OTLF 1GO1A 1VQ6F 4LCKA 3CCQF 3GYQA 1Q82H 3CG6A 3G6EF 1VQLF 1IPAA 2FGYA 1Q81H 1VQMF 3OW2F 1VQ8F 4X3LA 3CC7F 4EI7A 3NVKE 1CN7A 2OZBA 1GZ0A 2KG4A 3LWOC 3CCRF 5HXUA 1X52A 2ALEA 4BVSA 1ZWZA 1VQPF 3NMUC 3SIUA 3CPWF 3OBWA 5HY0A 1E7KA 1VQ4F 3CMAF 1X7OA 4EI8A 3CCJF 4BY9D 1KC8H 5HY1A 3AGKA 3JCMM 5A2QM 5DCVA 3RA6A 3I55F 1VQKF 3J80M 1YI2F 3CMEF 3LWPC 1PXWA 2I6DA 4XCQA 3LWVC 3N4ZA 5HWEA 1K73H 1CK2A 1JJ2F 3E20B 2KTUA 5HXZA 3V3TA 3CCMF 1YIJF 1GO0A 1S72F 2CZWA 1VQ5F 5G4UC 2VGNA 5EWRA 1N8RH 3CCSF 3VMFB 4BVQA 3IR9A 1K9MH 5G4VC 1SDSA 4C4WC 3MCAB 2HVYD 1Q86H 1X7PA 3FFMA 2OTJF 1W41A 5GAPK 4BW0B 3LWRC 1KD1H 1VQ7F 5FLXM 1VQ9F 3HAXD 1T0KB 3G4SF 4NQ3A 1XBIA 1YITF 3RA5A 1W40A 3SIVA 1YJ9F 1DT9A 4EI9A 1NJIH 1K8AH 5IT9M 1M90H 1W42A 2QEXF 2WALA 5GIPC 2KTVA 1YHQF 1YJNF 3PLAC 3CCEF 3JAMM 1QVFF 3V7QA 1YJWF 2QA4F 4NUTA 3O85A 3LWQC 3CCLF 5HY2A 4BVRA 1NMUB 1QVGF 1W3EX 4TZZA 3N4YA 5HY4A 3CC4F 3VI6A 2GLZA 3ON1A 4X3MA 2QI2A 2OHWA 2LBWA 5EO3A 1W2BF 3E1YA 1M1KH 3D00A 5GIOC 5GINC 3CPQA 2VGMA 3CXCF 1Q7YH 3V7EA 3CC2F 3NK7A 4BVTA 5GANK 2AIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NK6 A;  3J81 M;  1RA4 A;  3WXM B;  3G71 F;  3CCU F;  1RLG A;  2FC3 A;  1VQN F;  5FJ4 C;  3NVI B;  2LBX A;  3HJW C;  3I56 F;  2JNB A;  3PAF A;  1VQO F;  3OBY A;  1H7M A;  2BO1 A;  3J7A R;  3CD6 F;  3LFO A;  1KQS F;  3CCV F;  2OTL F;  1GO1 A;  1VQ6 F;  4LCK A;  3CCQ F;  3GYQ A;  1Q82 H;  3CG6 A;  3G6E F;  1VQL F;  1IPA A;  1Q81 H;  1VQM F;  3OW2 F;  1VQ8 F;  4X3L A;  3CC7 F;  3NVK E;  1CN7 A;  2OZB A;  1GZ0 A;  2KG4 A;  3LWO C;  3CCR F;  1X52 A;  2ALE A;  1ZWZ A;  1VQP F;  3NMU C;  3SIU A;  3CPW F;  3OBW A;  1E7K A;  1VQ4 F;  3CMA F;  1X7O A;  3CCJ F;  4BY9 D;  1KC8 H;  3AGK A;  3JCM M;  5A2Q M;  5DCV A;  3RA6 A;  3I55 F;  1VQK F;  3J80 M;  1YI2 F;  3CME F;  3LWP C;  1PXW A;  2I6D A;  3LWV C;  3N4Z A;  1K73 H;  1CK2 A;  1JJ2 F;  3E20 B;  2KTU A;  3CCM F;  1YIJ F;  1GO0 A;  1S72 F;  2CZW A;  1VQ5 F;  5G4U C;  2VGN A;  5EWR A;  1N8R H;  3CCS F;  3VMF B;  3IR9 A;  1K9M H;  5G4V C;  1SDS A;  4C4W C;  3MCA B;  2HVY D;  1Q86 H;  1X7P A;  3FFM A;  2OTJ F;  1W41 A;  5GAP K;  4BW0 B;  3LWR C;  1KD1 H;  1VQ7 F;  5FLX M;  1VQ9 F;  3HAX D;  1T0K B;  3G4S F;  1XBI A;  1YIT F;  3RA5 A;  1W40 A;  3SIV A;  1YJ9 F;  1DT9 A;  1NJI H;  1K8A H;  5IT9 M;  1M90 H;  1W42 A;  2QEX F;  2WAL A;  5GIP C;  2KTV A;  1YHQ F;  1YJN F;  3PLA C;  3CCE F;  3JAM M;  1QVF F;  3V7Q A;  1YJW F;  2QA4 F;  4NUT A;  3O85 A;  3LWQ C;  3CCL F;  1NMU B;  1QVG F;  1W3E X;  4TZZ A;  3N4Y A;  3CC4 F;  3VI6 A;  3ON1 A;  4X3M A;  2QI2 A;  2OHW A;  2LBW A;  5EO3 A;  1W2B F;  3E1Y A;  1M1K H;  5GIO C;  5GIN C;  3CPQ A;  2VGM A;  3CXC F;  1Q7Y H;  3V7E A;  3CC2 F;  3NK7 A;  5GAN K;  2AIF A; 
#chains in the Genus database with same CATH topology
 3RYI B;  3JAR A;  3MCQ A;  3WGN A;  3WGL A;  1RA4 A;  1TUB A;  3G71 F;  3L7Q A;  2FC3 A;  3T80 A;  4ZOL A;  2IQQ A;  2UYN A;  1IV4 A;  1VHA A;  2Z1E A;  3OBY A;  3S03 A;  1H7M A;  2BO1 A;  3JAR B;  3ERN A;  1TUB B;  3VYS C;  1UI9 A;  4ZOL B;  1YGY A;  3D54 A;  3CG6 A;  3G6E F;  4M8I A;  5LOV A;  1Q81 H;  1VQ8 F;  2IAF A;  3M84 A;  3HKE A;  5HXU A;  2ALE A;  3N2G B;  3S06 A;  1SZQ A;  4BT7 A;  5IYZ B;  3GTZ A;  1VQP F;  5HY0 A;  5LOV B;  5EB0 A;  2GVI A;  4ZK7 A;  4ZHY B;  2RHJ A;  3KHN A;  4EI8 A;  4BY9 D;  3HTN A;  1X25 A;  3K2X A;  4PWT A;  1JFF A;  3J80 M;  1YI2 F;  2BTQ B;  2H6L A;  1TVK B;  5EYP A;  3VYT C;  2CSL A;  3P10 A;  2HP0 B;  2MQE A;  3GHZ A;  4ZHW A;  1JFF B;  5J2T A;  1KNK A;  3FD5 A;  2HX0 A;  3CCM F;  4EB6 B;  1S72 F;  2UYP A;  5MN4 A;  3UT5 B;  5G4U C;  3R0P A;  1Z5V A;  2CW4 A;  3OON A;  3VMF B;  4BVQ A;  3B6N A;  3IR9 A;  1SDS A;  1XV2 A;  5LP6 C;  4O4H A;  2LBT A;  2OTJ F;  5GAP K;  1VQ7 F;  1KD1 H;  2VAM A;  1FSZ A;  2G9I A;  3LDT A;  3BYQ A;  4EI9 A;  2CHS A;  3FPI A;  3RYH A;  1OFU A;  1K8A H;  1M90 H;  5IT9 M;  1W42 A;  5HP7 A;  5GIP C;  2KTV A;  2HS3 A;  2NMU A;  3PLA C;  5KMG A;  3D01 A;  3CCE F;  3JAM M;  2VAW A;  4NUT A;  4ZHV A;  5LP6 B;  3CCL F;  5HY2 A;  3RYH B;  3MBM A;  4X20 A;  4C8I A;  2H8E A;  2KGW A;  2K1S A;  3IEQ A;  2I6R A;  2QI2 A;  5HP8 A;  4IIJ A;  1M1K H;  3D00 A;  5GIO C;  1QAH A;  1R1M A;  1T0A A;  5MN5 A;  4O2A A;  5LA6 A;  1W5B A;  4IIJ B;  3WJR A;  3J81 M;  5EIB D;  3CCU F;  5FJ4 C;  1RLG A;  3NVI B;  4G4X A;  2JNB A;  4O4L A;  5LA6 B;  3MQW A;  2F9Z C;  1VQO F;  3VOB A;  3ESJ A;  2UYK A;  3WGM A;  5AVM A;  4B45 A;  3S02 A;  1KQS F;  3CCV F;  2OTL F;  3HWU A;  5BMV A;  1VQ6 F;  2CWJ A;  4X1K A;  1W58 1;  4LCK A;  4O4L B;  3RYI A;  3ELC A;  2AMT A;  2VAP A;  1CN7 A;  3F6M A;  3M4S A;  2OZB A;  1FNK A;  3TD5 A;  1JD1 A;  1X52 A;  4LNU A;  5BMV B;  4X1K B;  1IV3 A;  1CLI A;  3SIU A;  3JAK B;  3OBW A;  1VQ4 F;  4B46 A;  5C8Y A;  3CMA F;  3ZP7 A;  3F0F A;  3WPX A;  1X7O A;  3MDO A;  1DBF A;  1KC8 H;  4TUY A;  4G4Y A;  3M1X A;  4LNU B;  4KWE A;  5A2Q M;  3RA6 A;  5DCV A;  2ZOD A;  3C9T A;  4U3J B;  2UZH A;  2Q1Y A;  5C8Y B;  3K0T A;  3JAW A;  1YQN A;  1XHO A;  3N2G A;  4I50 B;  5IYZ A;  3N4Z A;  4TUY B;  3TD3 A;  2RB9 A;  5HWE A;  1K73 H;  1JJ2 F;  4DRX A;  4O2B A;  1W5E A;  1ONI A;  3TD4 A;  3F0D A;  2BTU A;  4I4T A;  1YIJ F;  3JAW B;  3KIZ A;  2VGN A;  5EWR A;  1FFX A;  3CCS F;  5CA1 B;  4DRX B;  4O2B B;  1TVK A;  4I4T B;  2HP0 A;  3MCA B;  1FFX B;  4BW0 B;  2RHO A;  3WGK A;  4EB6 A;  1ODE A;  1T0K B;  3WJP A;  3UT5 A;  1YIT F;  3RA5 A;  4BT3 A;  2YYE A;  1W40 A;  1YJ9 F;  2YXZ A;  3LME A;  3C9S A;  4R40 B;  2HRY A;  2QEX F;  3FD6 A;  3VYU C;  5JCO C;  1UFY A;  2RHL A;  2UYJ A;  4ZI7 B;  2HP3 A;  2B33 A;  4ZHQ A;  3VO8 A;  3DDN A;  1IV2 A;  1NMU B;  1QVG F;  5IJ9 A;  1VH8 A;  5JCO A;  2GLZ A;  2LBW A;  1W2B F;  4ZHQ B;  5GIN C;  1FNJ A;  2HS4 A;  5IJ9 B;  4G88 A;  1Q7Y H;  5JH7 A;  5LP6 A;  2AIF A;  3P0Z A;  1H47 A;  4ERH A;  3JAS B;  3IMP A;  3I56 F;  3PAF A;  5JH7 B;  1W5A A;  5JQG A;  5KX5 B;  4YJ2 B;  3QUW A;  4C8E A;  5FNV A;  2OTM A;  3LFO A;  1GO1 A;  5EB1 B;  4HNA A;  1H48 A;  1Q82 H;  3S0H A;  4C82 A;  4C8G A;  1IPA A;  1JN1 A;  2DYY A;  4G4W A;  5JQG B;  1XRG A;  3RE3 A;  4EI7 A;  3F0E A;  1GZ0 A;  2ZVZ A;  5FNV B;  3LWO C;  4G4Z A;  3CCR F;  4O4I A;  4HNA B;  4WBN B;  5ITZ A;  2EWC A;  4RHA A;  1E7K A;  1J7H A;  5CB4 A;  3I3F A;  5EIB C;  3CCJ F;  3AGK A;  3VOA A;  1OAP A;  4O4I B;  1VK3 A;  3WGJ A;  1VQK F;  1JY8 A;  5ITZ B;  3VIU A;  3LWP C;  5CB4 B;  4IHJ A;  2ZVY A;  3CYQ A;  3LWV C;  3I7T A;  1CK2 A;  3JAK A;  5LXT B;  2KTU A;  1VQV A;  1U3L A;  1GO0 A;  2CZW A;  1VQ5 F;  4IHJ B;  1N8R H;  4TV9 A;  4U3J A;  4I50 A;  2W8B C;  5LYJ B;  2L26 A;  2H8C A;  1W41 A;  3IKE A;  4TV9 B;  3LWR C;  1VQ9 F;  3FBA A;  4BT6 A;  3QTY A;  4BT5 A;  1RQ7 A;  4NQ3 A;  3G4S F;  1XBI A;  3SIV A;  2HRU A;  1DT9 A;  5CA1 A;  1W57 A;  1NJI H;  3VCZ A;  1Q8R A;  3HKB A;  4B5C A;  3CB2 A;  1IV1 A;  3K14 A;  1YHQ F;  1YJN F;  2HS0 A;  5MN6 A;  1QU9 A;  3ZOP A;  1W55 A;  1YJW F;  3V4D A;  2QA4 F;  3O85 A;  3CYP B;  4C81 A;  3HKB B;  4E6E A;  4F6R A;  1W3E X;  1U43 A;  3N4Y A;  5HY4 A;  3IKF A;  2Z1U A;  2UYN B;  4RQO A;  3ON1 A;  4X3M A;  2DT4 A;  5EO3 A;  3E1Y A;  4F6R B;  3JAT A;  4O4J A;  2GZL A;  2VGM A;  3V7E A;  4ZI7 A;  2ZAU A;  3NK7 A;  3ZO8 A;  5JVD A;  2LCA A;  4YJ3 A;  5GAN K;  5B8F A;  2Q1X A;  3NK6 A;  1W5F A;  3WXM B;  1VQN F;  1KNJ A;  3S0W A;  2LBX A;  3JAT B;  3HJW C;  4BT2 A;  4O4J B;  3HKE B;  2Z01 A;  5JVD B;  4YJ3 B;  3KE1 A;  3J7A R;  2CHT A;  3CD6 F;  1QD9 A;  4U39 A;  4I55 A;  3CCQ F;  4B62 A;  3GYQ A;  2N48 A;  3C9R A;  5EAZ A;  2IG8 A;  4X1Y A;  1VQL F;  2FGY A;  1VQM F;  2AIZ P;  3OW2 F;  3JAS A;  4X3L A;  3CC7 F;  3NVK E;  2KG4 A;  4FFB A;  1W59 A;  1RQ2 A;  4I55 B;  5EYP B;  3HKC A;  3KJJ A;  5KX5 A;  4YJ2 A;  4BVS A;  1ZWZ A;  3IEW A;  4X1Y B;  3NMU C;  3CPW F;  4X1I A;  5J2T B;  4FFB B;  5HY1 A;  3JCM M;  3WJQ A;  2V9Y A;  3HKC B;  1U3P A;  3I55 F;  1U40 A;  3CME F;  4X1I B;  1PXW A;  3QHD A;  1COM A;  2I6D A;  4XCQ A;  4WBN A;  3HKD A;  3E22 A;  4O4H B;  3U0O A;  3E20 B;  3Q8H A;  5HXZ A;  3V3T A;  3N2K A;  4DXD A;  5GON A;  3HKD B;  3E22 B;  1PF5 A;  2ZOV A;  3K12 A;  2P6Y A;  3RYF A;  1K9M H;  3N2K B;  5G4V C;  1GX1 A;  4C4W C;  2Z1F A;  5GON B;  3C8L A;  4G4V A;  5KMG B;  1X7P A;  1Q86 H;  2HVY D;  3FFM A;  5J2U A;  5CA0 A;  3ZP4 A;  5LXT A;  3HAX D;  5FLX M;  3RYF B;  1RLU A;  2HQS C;  2PHN A;  2PMP A;  5EZY A;  4TV8 A;  3LYB A;  4X20 B;  4NWO B;  3JVH A;  3RYC A;  5J2U B;  5CA0 B;  2Z1T A;  3JAL A;  2WAL A;  3EOR A;  4TV8 B;  5EZY B;  5LYJ A;  5IJ0 A;  1QVF F;  3RYC B;  4O2A B;  3V7Q A;  2ZF8 A;  2CVL A;  2BTO A;  3KJK A;  3LWQ C;  3P4E A;  1SA0 A;  4BVR A;  3JAL B;  1Z5W A;  4TZZ A;  3F0G A;  5IJ0 B;  3CC4 F;  2R75 1;  3VI6 A;  3S0Y A;  2RHH A;  2R6R 1;  2VXY A;  2OHW A;  3WPW A;  3C9U A;  1NQ3 A;  3VTI C;  1SA0 B;  2QTP A;  3CPQ A;  3CXC F;  3CC2 F;  3DC2 A;  4BT4 A;  4BVT A; 
#chains in the Genus database with same CATH homology
 3NK6 A;  3J81 M;  1RA4 A;  3WXM B;  3G71 F;  3CCU F;  1RLG A;  2FC3 A;  1VQN F;  5FJ4 C;  3NVI B;  2LBX A;  3HJW C;  3I56 F;  2JNB A;  3PAF A;  2F9Z C;  3OBY A;  1VQO F;  1H7M A;  2BO1 A;  3J7A R;  3CD6 F;  3LFO A;  1KQS F;  3CCV F;  2OTL F;  1GO1 A;  1VQ6 F;  4LCK A;  3CCQ F;  3GYQ A;  1Q82 H;  3CG6 A;  3G6E F;  1VQL F;  1IPA A;  2FGY A;  1Q81 H;  1VQM F;  3OW2 F;  1VQ8 F;  4X3L A;  3CC7 F;  4EI7 A;  3NVK E;  1CN7 A;  2OZB A;  1GZ0 A;  2KG4 A;  3LWO C;  3CCR F;  5HXU A;  1X52 A;  2ALE A;  4BVS A;  1ZWZ A;  1VQP F;  3NMU C;  3SIU A;  3CPW F;  3OBW A;  5HY0 A;  1E7K A;  1VQ4 F;  3CMA F;  1X7O A;  4EI8 A;  3CCJ F;  4BY9 D;  1KC8 H;  5HY1 A;  3AGK A;  3JCM M;  5A2Q M;  5DCV A;  3RA6 A;  3I55 F;  1VQK F;  3J80 M;  1YI2 F;  3CME F;  3LWP C;  1PXW A;  2I6D A;  4XCQ A;  3LWV C;  3N4Z A;  5HWE A;  1K73 H;  1CK2 A;  1JJ2 F;  3E20 B;  2KTU A;  5HXZ A;  3V3T A;  3CCM F;  1YIJ F;  1GO0 A;  1S72 F;  2CZW A;  1VQ5 F;  5G4U C;  2VGN A;  5EWR A;  1N8R H;  3CCS F;  3VMF B;  4BVQ A;  3IR9 A;  1K9M H;  5G4V C;  1SDS A;  4C4W C;  3MCA B;  2HVY D;  1Q86 H;  1X7P A;  3FFM A;  2OTJ F;  1W41 A;  5GAP K;  4BW0 B;  3LWR C;  1KD1 H;  1VQ7 F;  5FLX M;  1VQ9 F;  3HAX D;  1T0K B;  3G4S F;  4NQ3 A;  1XBI A;  1YIT F;  3RA5 A;  1W40 A;  3SIV A;  1YJ9 F;  1DT9 A;  4EI9 A;  1NJI H;  1K8A H;  5IT9 M;  1M90 H;  1W42 A;  2QEX F;  2WAL A;  5GIP C;  2KTV A;  1YHQ F;  1YJN F;  3PLA C;  3CCE F;  3JAM M;  1QVF F;  3V7Q A;  1YJW F;  2QA4 F;  4NUT A;  3O85 A;  3LWQ C;  3CCL F;  5HY2 A;  4BVR A;  1NMU B;  1QVG F;  1W3E X;  4TZZ A;  3N4Y A;  5HY4 A;  3CC4 F;  3VI6 A;  2GLZ A;  3ON1 A;  4X3M A;  2QI2 A;  2OHW A;  2LBW A;  5EO3 A;  1W2B F;  3E1Y A;  1M1K H;  3D00 A;  5GIO C;  5GIN C;  3CPQ A;  2VGM A;  3CXC F;  1Q7Y H;  3V7E A;  3CC2 F;  3NK7 A;  4BVT A;  5GAN K;  2AIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...