1VQ7F

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq7F00
2ALEA 3G71F 3VI6A 3CMAF 1XBIA 3CC7F 1CN7A 3HJWC 1KQSF 3LWVC 2OTJF 3NVIB 1W42A 5GANK 3LWRC 2VGNA 4X3LA 2FC3A 3CCLF 3SIVA 4BW0B 1H7MA 3SIUA 3G6EF 1QVGF 3MCAB 1E7KA 2QA4F 3HAXD 3RA6A 3LWPC 1N8RH 1KD1H 2I6DA 1VQ7F 3WXMB 1W3EX 2JNBA 3GYQA 1IPAA 1X7PA 3N4ZA 1RA4A 1W41A 3O85A 3CD6F 1PXWA 1VQOF 3CCRF 1Q81H 3E20B 3CC2F 5IT9M 5EWRA 3CCMF 1RLGA 4NUTA 3VMFB 3CCSF 3RA5A 1GZ0A 2LBXA 4LCKA 1VQ5F 3PAFA 1YHQF 3LFOA 3CG6A 3FFMA 3CCVF 2VGMA 3I56F 3CC4F 3V7QA 1X52A 5G4UC 1M90H 3V7EA 2QI2A 2AIFA 1M1KH 5FLXM 2QEXF 3J7AR 5GIPC 3LWQC 1KC8H 1K73H 1S72F 3JAMM 2OHWA 1VQ6F 5GIOC 2KTUA 1W40A 1X7OA 4X3MA 4C4WC 3CCEF 3CMEF 3N4YA 1DT9A 3CPQA 3CCJF 2HVYD 3IR9A 3NMUC 1VQLF 1VQMF 2OZBA 1YJ9F 1K9MH 1VQNF 1YITF 1YIJF 1VQ8F 1VQ9F 1VQKF 1JJ2F 1GO1A 3J81M 5GAPK 3CCUF 1YJWF 5GINC 4TZZA 4BY9D 3ON1A 5A2QM 3I55F 2BO1A 3PLAC 1VQ4F 2OTLF 1Q82H 1NJIH 1ZWZA 2LBWA 3CXCF 2WALA 1VQPF 1Q7YH 5G4VC 1YJNF 5FJ4C 2CZWA 3LWOC 2KG4A 3AGKA 1YI2F 2KTVA 3NVKE 3NK6A 5DCVA 1NMUB 1K8AH 3J80M 3G4SF 1QVFF 1W2BF 1T0KB 3CPWF 3E1YA 3CCQF 3OBWA 1CK2A 3NK7A 5EO3A 1SDSA 3OW2F 1GO0A 1Q86H 3JCMM 3OBYA
chains in the Genus database with same CATH superfamily
4O4JB 3JVHA 3RYFA 2ALEA 3G71F 3MCQA 2I6RA 4IHJB 3WGJA 4ZHYB 3WJPA 1KNJA 3HKBA 3LWVC 4X1KB 2ZOVA 3ELCA 1W42A 3V3TA 2RHOA 2HP0A 2ZVZA 5CA0A 5JCOC 1OAPA 1W5AA 1RQ2A 1QAHA 3JASB 2EWCA 5MN4A 3RA6A 3LWPC 1ODEA 1N8RH 1KD1H 2I6DA 4G4ZA 4G88A 2YYEA 1SZQA 4U39A 3HWUA 4IIJA 3BYQA 3C9UA 3WGKA 1RA4A 3CD6F 1OFUA 3HKEA 4I50B 4YJ2A 3CCRF 2CHSA 5EAZA 3CC2F 4I4TA 1RLGA 2HX0A 5CA1A 5LXTB 3CCSF 3RA5A 3VYTC 4LNUB 5IJ9A 1GZ0A 2Q1XA 3VYSC 3U0OA 1JD1A 3IMPA 2AMTA 3MBMA 1RQ7A 4EI9A 3PAFA 4C8GA 3GTZA 4YJ3B 4O4LA 4ZOLA 3V7QA 4HNAA 2Q1YA 3K0TA 4WBNA 1W57A 3LYBA 1M1KH 1U3PA 3QUWA 3LMEA 3VIUA 2QEXF 3J7AR 1J7HA 4BT5A 3JAMM 2OHWA 2AIZP 1X7OA 1TVKB 4X3MA 3N4YA 3CCJF 1UI9A 3N2KB 5JQGA 4O4HB 3JALB 1FFXA 1VQMF 1K9MH 1YITF 5HXUA 2UYJA 4BVTA 1H47A 4O4IB 3J81M 3CCUF 1VHAA 3VTIC 3IKEA 4ZHQA 3C9TA 4TV8B 3ON1A 4G4WA 5A2QM 2BO1A 5ITZB 1VQ4F 2UYKA 1Q82H 2RB9A 3V4DA 3S0YA 1NJIH 5LP6C 2UYPA 1ZWZA 2IQQA 2LBWA 3T80A 2RHLA 1YJNF 5FJ4C 1JFFA 3D00A 5BMVA 3JATA 4O2BB 1YI2F 5DCVA 1NMUB 5JCOA 5MN5A 4B62A 4BVRA 4IHJA 5HY0A 2RHJA 2Z1TA 5J2TB 1W2BF 3E22B 4C82A 4X1KA 3CPWF 3P10A 3S02A 5EIBC 3NK7A 1FNJA 1SDSA 3F0DA 2Z1FA 2CHTA 1Q86H 2CW4A 4KWEA 3JASA 2H8CA 3JAKB 3HKCB 5CB4B 1UFYA 3CCLF 2FC3A 1T0AA 4BW0B 3WGNA 3WGLA 2UYNB 2HS4A 4I50A 2UZHA 3G6EF 3MCAB 4XCQA 3ERNA 5KMGB 5LXTA 3M84A 4LNUA 2JNBA 3GYQA 2GVIA 5KX5B 3JAWB 3I3FA 1U40A 4X1YA 1W41A 3O85A 5HY4A 3VOBA 1PXWA 3ZO8A 4YJ3A 1Z5WA 3E20B 4RQOA 1W55A 3DDNA 3F0EA 3CCMF 4X20B 5IYZB 3DC2A 3F0FA 1H48A 3HKDB 1Q8RA 3LFOA 3RYCB 1TVKA 3I56F 2OTMA 2KGWA 2W8BC 4G4XA 2FGYA 4U3JB 3GHZA 1X52A 2NMUA 3N2KA 3WJRA 4O4HA 3I7TA 5LYJB 5G4UC 3C9RA 5JVDB 3LWQC 3TD5A 4BT2A 5LP6A 1S72F 1R1MA 5GIOC 1VK3A 2BTOA 1W40A 5EZYA 1CLIA 4BT3A 4C4WC 1YQNA 4TV8A 3FD6A 3CMEF 1VQVA 3KJJA 3UT5B 3IR9A 5IJ0B 2VAPA 1SA0B 5LOVB 1FSZA 3RE3A 1YIJF 3RYHB 2GZLA 2Z1EA 4O2BA 5GAPK 1YJWF 1XV2A 4FFBB 3JARB 3PLAC 3I55F 3WPWA 1U3LA 5J2TA 3E22A 4TV9B 1PF5A 5J2UB 3ZP4A 1Q7YH 4F6RB 2YXZA 3LWOC 1FNKA 3AGKA 4BT6A 3VCZA 4PWTA 4M8IA 5EB0A 2HQSC 2CVLA 1K8AH 3TD3A 2IAFA 3JAKA 3G4SF 3B6NA 3HKCA 3P4EA 1XRGA 5CB4A 3K12A 3E1YA 4RHAA 3IEQA 3TD4A 2G9IA 1QD9A 2UYNA 3OW2F 2QTPA 3JCMM 2QA4F 3HAXD 2PHNA 2RHHA 4G4YA 5FNVB 5B8FA 3Q8HA 3VI6A 3CMAF 4EI7A 2HS3A 4ZHVA 1CN7A 4I55B 2HP3A 5GONA 1KQSF 3HJWC 4B5CA 3JAWA 3VOAA 2OTJF 1IV3A 3EORA 1TUBA 5GANK 3LWRC 2VGNA 4IIJB 1H7MA 1NQ3A 4O4JA 3M1XA 3SIUA 3OONA 4C81A 1QVGF 2DYYA 1E7KA 4X20A 4X1IB 5IYZA 3FBAA 4ZK7A 1IPAA 1X7PA 5IJ9B 5C8YB 3QHDA 3RYIB 3HKDA 1Z5VA 3RYCA 2ZF8A 1VQOF 2LBTA 5IT9M 4U3JA 1RLUA 2L26A 3K14A 3VMFB 2Z1UA 5LYJA 2H8EA 4NWOB 2LBXA 4E6EA 5HP8A 2HS0A 3FFMA 3CYPB 5HWEA 1GO0A 3FPIA 1IV2A 2CWJA 5IJ0A 5EYPB 1W5BA 1M90H 1W581 1SA0A 2QI2A 3ESJA 4TUYB 4C8EA 1COMA 5LOVA 1KNKA 1KC8H 1K73H 2H6LA 3RYHA 1VQ6F 3S0WA 1DBFA 2KTUA 4FFBA 4ZI7B 1XHOA 3HTNA 1JY8A 2GLZA 3JARA 4ZHQB 4BVQA 1W5FA 5HY2A 3N2GB 2HVYD 2PMPA 1VQLF 2OZBA 3F6MA 1VQNF 2ZODA 5J2UA 5LA6B 1VQ8F 1VQ9F 4F6RA 1VQKF 1GO1A 4R40B 1JFFB 4BY9D 3WPXA 3JALA 2BTUA 2OTLF 4EB6B 4BT7A 3WGMA 3CXCF 3KIZA 4O4IA 1VQPF 5G4VC 4DXDA 2P6YA 2CZWA 3MDOA 3F0GA 4BT4A 2KTVA 5EIBD 5ITZA 2N48A 3NK6A 5FNVA 3R0PA 4EI8A 4I55A 4NQ3A 3CCQF 2ZVYA 5JH7B 4DRXB 5EO3A 3KJKA 1YGYA 2V9YA 2K1SA 1X25A 2HRUA 3OBYA 4ZHWA 5MN6A 3CYQA 4X1IA 1XBIA 3CC7F 2Z01A 4O2AB 3FD5A 2ZAUA 3ZP7A 5C8YA 3RYIA 2B33A 3NVIB 2DT4A 4X3LA 3SIVA 4X1YB 4B46A 2F9ZC 3RYFB 3KHNA 1VQ7F 3WJQA 3WXMB 1W3EX 3HKBB 3QTYA 3IKFA 4BVSA 3L7QA 3N4ZA 1GX1A 3D01A 2HP0B 1IV4A 5CA0B 1QU9A 3C9SA 1Q81H 3IEWA 4ERHA 5KMGA 3LDTA 5EWRA 4NUTA 5KX5A 2HRYA 5EYPA 3MQWA 4TUYA 4LCKA 3S03A 1VQ5F 1YHQF 5LP6B 3CG6A 4ZI7A 3HKEB 3CCVF 2VGMA 4YJ2B 5HXZA 5EZYB 3CC4F 4I4TB 5CA1B 3N2GA 3V7EA 2AIFA 2R6R1 3VYUC 3VO8A 5FLXM 5GIPC 3C8LA 5LA6A 1JN1A 1W5EA 4O4LB 3S06A 4ZOLB 3CB2A 3CCEF 4HNAB 4WBNB 1DT9A 3CPQA 3S0HA 2IG8A 3NMUC 1YJ9F 4G4VA 5JVDA 5EB1B 4EB6A 2VXYA 1JJ2F 3K2XA 1W59A 3KE1A 5HY1A 5GINC 4TZZA 3UT5A 3ZOPA 1ONIA 4B45A 5JQGB 3D54A 1FFXB 2VAWA 2WALA 2CSLA 3M4SA 4DRXA 5JH7A 2KG4A 3NVKE 2VAMA 2MQEA 5AVMA 4C8IA 2LCAA 3J80M 1QVFF 2BTQB 4O2AA 4TV9A 1T0KB 1U43A 3OBWA 5GONB 1CK2A 5BMVB 1IV1A 3JATB 1TUBB 5HP7A 2R751 1VH8A 3P0ZA
chains in the Genus database with same CATH topology
2ALEA 3G71F 3VI6A 3CMAF 1XBIA 4EI7A 3CC7F 1CN7A 3HJWC 1KQSF 3LWVC 2OTJF 3NVIB 1W42A 5GANK 3V3TA 2VGNA 4X3LA 2FC3A 3LWRC 3CCLF 4BW0B 1H7MA 3SIVA 3SIUA 3G6EF 1QVGF 2F9ZC 3MCAB 1E7KA 2QA4F 3HAXD 4XCQA 3RA6A 3LWPC 1N8RH 1KD1H 2I6DA 1VQ7F 3WXMB 1W3EX 2JNBA 3GYQA 1IPAA 1X7PA 4BVSA 3N4ZA 1RA4A 1W41A 5HY4A 3O85A 3CD6F 1PXWA 1VQOF 3CCRF 1Q81H 3E20B 3CC2F 5IT9M 5EWRA 3CCMF 1RLGA 4NUTA 3VMFB 3CCSF 3RA5A 1GZ0A 2LBXA 4LCKA 1VQ5F 4EI9A 3PAFA 1YHQF 3LFOA 3CG6A 3FFMA 3CCVF 2VGMA 5HXZA 3I56F 5HWEA 3CC4F 3V7QA 2FGYA 1X52A 5G4UC 1M90H 3V7EA 2QI2A 2AIFA 1M1KH 5FLXM 2QEXF 3J7AR 5GIPC 3LWQC 1KC8H 1K73H 1S72F 3JAMM 2OHWA 1VQ6F 5GIOC 2KTUA 1W40A 1X7OA 4X3MA 4C4WC 2GLZA 3CCEF 3CMEF 3N4YA 4BVQA 1DT9A 3CPQA 5HY2A 3CCJF 2HVYD 3IR9A 3NMUC 1VQLF 1VQMF 2OZBA 1YJ9F 1K9MH 1VQNF 1YITF 5HXUA 4BVTA 1YIJF 1VQ8F 1VQ9F 1VQKF 1JJ2F 1GO1A 3J81M 5GAPK 3CCUF 1YJWF 5HY1A 5GINC 4TZZA 4BY9D 3ON1A 5A2QM 3I55F 2BO1A 3PLAC 1VQ4F 2OTLF 1Q82H 1NJIH 1ZWZA 2LBWA 3CXCF 2WALA 1VQPF 1Q7YH 5G4VC 1YJNF 5FJ4C 3D00A 2CZWA 3LWOC 2KG4A 3AGKA 1YI2F 2KTVA 3NVKE 3NK6A 5DCVA 1NMUB 1K8AH 4BVRA 4EI8A 5HY0A 3J80M 3G4SF 1QVFF 1W2BF 4NQ3A 1T0KB 3CPWF 3E1YA 3CCQF 3OBWA 1CK2A 3NK7A 5EO3A 1SDSA 3OW2F 1GO0A 1Q86H 3JCMM 3OBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ALE A;  3G71 F;  3VI6 A;  3CMA F;  1XBI A;  3CC7 F;  1CN7 A;  3HJW C;  1KQS F;  3LWV C;  2OTJ F;  3NVI B;  1W42 A;  5GAN K;  3LWR C;  2VGN A;  4X3L A;  2FC3 A;  3CCL F;  3SIV A;  4BW0 B;  1H7M A;  3SIU A;  3G6E F;  1QVG F;  3MCA B;  1E7K A;  2QA4 F;  3HAX D;  3RA6 A;  3LWP C;  1N8R H;  1KD1 H;  2I6D A;  1VQ7 F;  3WXM B;  1W3E X;  2JNB A;  3GYQ A;  1IPA A;  1X7P A;  3N4Z A;  1RA4 A;  1W41 A;  3O85 A;  3CD6 F;  1PXW A;  1VQO F;  3CCR F;  1Q81 H;  3E20 B;  3CC2 F;  5IT9 M;  5EWR A;  3CCM F;  1RLG A;  4NUT A;  3VMF B;  3CCS F;  3RA5 A;  1GZ0 A;  2LBX A;  4LCK A;  1VQ5 F;  3PAF A;  1YHQ F;  3LFO A;  3CG6 A;  3FFM A;  3CCV F;  2VGM A;  3I56 F;  3CC4 F;  3V7Q A;  1X52 A;  5G4U C;  1M90 H;  3V7E A;  2QI2 A;  2AIF A;  1M1K H;  5FLX M;  2QEX F;  3J7A R;  5GIP C;  3LWQ C;  1KC8 H;  1K73 H;  1S72 F;  3JAM M;  2OHW A;  1VQ6 F;  5GIO C;  2KTU A;  1W40 A;  1X7O A;  4X3M A;  4C4W C;  3CCE F;  3CME F;  3N4Y A;  1DT9 A;  3CPQ A;  3CCJ F;  2HVY D;  3IR9 A;  3NMU C;  1VQL F;  1VQM F;  2OZB A;  1YJ9 F;  1K9M H;  1VQN F;  1YIT F;  1YIJ F;  1VQ8 F;  1VQ9 F;  1VQK F;  1JJ2 F;  1GO1 A;  3J81 M;  5GAP K;  3CCU F;  1YJW F;  5GIN C;  4TZZ A;  4BY9 D;  3ON1 A;  5A2Q M;  3I55 F;  2BO1 A;  3PLA C;  1VQ4 F;  2OTL F;  1Q82 H;  1NJI H;  1ZWZ A;  2LBW A;  3CXC F;  2WAL A;  1VQP F;  1Q7Y H;  5G4V C;  1YJN F;  5FJ4 C;  2CZW A;  3LWO C;  2KG4 A;  3AGK A;  1YI2 F;  2KTV A;  3NVK E;  3NK6 A;  5DCV A;  1NMU B;  1K8A H;  3J80 M;  3G4S F;  1QVF F;  1W2B F;  1T0K B;  3CPW F;  3E1Y A;  3CCQ F;  3OBW A;  1CK2 A;  3NK7 A;  5EO3 A;  1SDS A;  3OW2 F;  1GO0 A;  1Q86 H;  3JCM M;  3OBY A; 
#chains in the Genus database with same CATH topology
 4O4J B;  3JVH A;  3RYF A;  2ALE A;  3G71 F;  3MCQ A;  2I6R A;  4IHJ B;  3WGJ A;  4ZHY B;  3WJP A;  1KNJ A;  3HKB A;  3LWV C;  4X1K B;  2ZOV A;  3ELC A;  1W42 A;  3V3T A;  2RHO A;  2HP0 A;  2ZVZ A;  5CA0 A;  5JCO C;  1OAP A;  1W5A A;  1RQ2 A;  1QAH A;  3JAS B;  2EWC A;  5MN4 A;  3RA6 A;  3LWP C;  1ODE A;  1N8R H;  1KD1 H;  2I6D A;  4G4Z A;  4G88 A;  2YYE A;  1SZQ A;  4U39 A;  3HWU A;  4IIJ A;  3BYQ A;  3C9U A;  3WGK A;  1RA4 A;  3CD6 F;  1OFU A;  3HKE A;  4I50 B;  4YJ2 A;  3CCR F;  2CHS A;  5EAZ A;  3CC2 F;  4I4T A;  1RLG A;  2HX0 A;  5CA1 A;  5LXT B;  3CCS F;  3RA5 A;  3VYT C;  4LNU B;  5IJ9 A;  1GZ0 A;  2Q1X A;  3VYS C;  3U0O A;  1JD1 A;  3IMP A;  2AMT A;  3MBM A;  1RQ7 A;  4EI9 A;  3PAF A;  4C8G A;  3GTZ A;  4YJ3 B;  4O4L A;  4ZOL A;  3V7Q A;  4HNA A;  2Q1Y A;  3K0T A;  4WBN A;  1W57 A;  3LYB A;  1M1K H;  1U3P A;  3QUW A;  3LME A;  3VIU A;  2QEX F;  3J7A R;  1J7H A;  4BT5 A;  3JAM M;  2OHW A;  2AIZ P;  1X7O A;  1TVK B;  4X3M A;  3N4Y A;  3CCJ F;  1UI9 A;  3N2K B;  5JQG A;  4O4H B;  3JAL B;  1FFX A;  1VQM F;  1K9M H;  1YIT F;  5HXU A;  2UYJ A;  4BVT A;  1H47 A;  4O4I B;  3J81 M;  3CCU F;  1VHA A;  3VTI C;  3IKE A;  4ZHQ A;  3C9T A;  4TV8 B;  3ON1 A;  4G4W A;  5A2Q M;  2BO1 A;  5ITZ B;  1VQ4 F;  2UYK A;  1Q82 H;  2RB9 A;  3V4D A;  3S0Y A;  1NJI H;  5LP6 C;  2UYP A;  1ZWZ A;  2IQQ A;  2LBW A;  3T80 A;  2RHL A;  1YJN F;  5FJ4 C;  1JFF A;  3D00 A;  5BMV A;  3JAT A;  4O2B B;  1YI2 F;  5DCV A;  1NMU B;  5JCO A;  5MN5 A;  4B62 A;  4BVR A;  4IHJ A;  5HY0 A;  2RHJ A;  2Z1T A;  5J2T B;  1W2B F;  3E22 B;  4C82 A;  4X1K A;  3CPW F;  3P10 A;  3S02 A;  5EIB C;  3NK7 A;  1FNJ A;  1SDS A;  3F0D A;  2Z1F A;  2CHT A;  1Q86 H;  2CW4 A;  4KWE A;  3JAS A;  2H8C A;  3JAK B;  3HKC B;  5CB4 B;  1UFY A;  3CCL F;  2FC3 A;  1T0A A;  4BW0 B;  3WGN A;  3WGL A;  2UYN B;  2HS4 A;  4I50 A;  2UZH A;  3G6E F;  3MCA B;  4XCQ A;  3ERN A;  5KMG B;  5LXT A;  3M84 A;  4LNU A;  2JNB A;  3GYQ A;  2GVI A;  5KX5 B;  3JAW B;  3I3F A;  1U40 A;  4X1Y A;  1W41 A;  3O85 A;  5HY4 A;  3VOB A;  1PXW A;  3ZO8 A;  4YJ3 A;  1Z5W A;  3E20 B;  4RQO A;  1W55 A;  3DDN A;  3F0E A;  3CCM F;  4X20 B;  5IYZ B;  3DC2 A;  3F0F A;  1H48 A;  3HKD B;  1Q8R A;  3LFO A;  3RYC B;  1TVK A;  3I56 F;  2OTM A;  2KGW A;  2W8B C;  4G4X A;  2FGY A;  4U3J B;  3GHZ A;  1X52 A;  2NMU A;  3N2K A;  3WJR A;  4O4H A;  3I7T A;  5LYJ B;  5G4U C;  3C9R A;  5JVD B;  3LWQ C;  3TD5 A;  4BT2 A;  5LP6 A;  1S72 F;  1R1M A;  5GIO C;  1VK3 A;  2BTO A;  1W40 A;  5EZY A;  1CLI A;  4BT3 A;  4C4W C;  1YQN A;  4TV8 A;  3FD6 A;  3CME F;  1VQV A;  3KJJ A;  3UT5 B;  3IR9 A;  5IJ0 B;  2VAP A;  1SA0 B;  5LOV B;  1FSZ A;  3RE3 A;  1YIJ F;  3RYH B;  2GZL A;  2Z1E A;  4O2B A;  5GAP K;  1YJW F;  1XV2 A;  4FFB B;  3JAR B;  3PLA C;  3I55 F;  3WPW A;  1U3L A;  5J2T A;  3E22 A;  4TV9 B;  1PF5 A;  5J2U B;  3ZP4 A;  1Q7Y H;  4F6R B;  2YXZ A;  3LWO C;  1FNK A;  3AGK A;  4BT6 A;  3VCZ A;  4PWT A;  4M8I A;  5EB0 A;  2HQS C;  2CVL A;  1K8A H;  3TD3 A;  2IAF A;  3JAK A;  3G4S F;  3B6N A;  3HKC A;  3P4E A;  1XRG A;  5CB4 A;  3K12 A;  3E1Y A;  4RHA A;  3IEQ A;  3TD4 A;  2G9I A;  1QD9 A;  2UYN A;  3OW2 F;  2QTP A;  3JCM M;  2QA4 F;  3HAX D;  2PHN A;  2RHH A;  4G4Y A;  5FNV B;  5B8F A;  3Q8H A;  3VI6 A;  3CMA F;  4EI7 A;  2HS3 A;  4ZHV A;  1CN7 A;  4I55 B;  2HP3 A;  5GON A;  1KQS F;  3HJW C;  4B5C A;  3JAW A;  3VOA A;  2OTJ F;  1IV3 A;  3EOR A;  1TUB A;  5GAN K;  3LWR C;  2VGN A;  4IIJ B;  1H7M A;  1NQ3 A;  4O4J A;  3M1X A;  3SIU A;  3OON A;  4C81 A;  1QVG F;  2DYY A;  1E7K A;  4X20 A;  4X1I B;  5IYZ A;  3FBA A;  4ZK7 A;  1IPA A;  1X7P A;  5IJ9 B;  5C8Y B;  3QHD A;  3RYI B;  3HKD A;  1Z5V A;  3RYC A;  2ZF8 A;  1VQO F;  2LBT A;  5IT9 M;  4U3J A;  1RLU A;  2L26 A;  3K14 A;  3VMF B;  2Z1U A;  5LYJ A;  2H8E A;  4NWO B;  2LBX A;  4E6E A;  5HP8 A;  2HS0 A;  3FFM A;  3CYP B;  5HWE A;  1GO0 A;  3FPI A;  1IV2 A;  2CWJ A;  5IJ0 A;  5EYP B;  1W5B A;  1M90 H;  1W58 1;  1SA0 A;  2QI2 A;  3ESJ A;  4TUY B;  4C8E A;  1COM A;  5LOV A;  1KNK A;  1KC8 H;  1K73 H;  2H6L A;  3RYH A;  1VQ6 F;  3S0W A;  1DBF A;  2KTU A;  4FFB A;  4ZI7 B;  1XHO A;  3HTN A;  1JY8 A;  2GLZ A;  3JAR A;  4ZHQ B;  4BVQ A;  1W5F A;  5HY2 A;  3N2G B;  2HVY D;  2PMP A;  1VQL F;  2OZB A;  3F6M A;  1VQN F;  2ZOD A;  5J2U A;  5LA6 B;  1VQ8 F;  1VQ9 F;  4F6R A;  1VQK F;  1GO1 A;  4R40 B;  1JFF B;  4BY9 D;  3WPX A;  3JAL A;  2BTU A;  2OTL F;  4EB6 B;  4BT7 A;  3WGM A;  3CXC F;  3KIZ A;  4O4I A;  1VQP F;  5G4V C;  4DXD A;  2P6Y A;  2CZW A;  3MDO A;  3F0G A;  4BT4 A;  2KTV A;  5EIB D;  5ITZ A;  2N48 A;  3NK6 A;  5FNV A;  3R0P A;  4EI8 A;  4I55 A;  4NQ3 A;  3CCQ F;  2ZVY A;  5JH7 B;  4DRX B;  5EO3 A;  3KJK A;  1YGY A;  2V9Y A;  2K1S A;  1X25 A;  2HRU A;  3OBY A;  4ZHW A;  5MN6 A;  3CYQ A;  4X1I A;  1XBI A;  3CC7 F;  2Z01 A;  4O2A B;  3FD5 A;  2ZAU A;  3ZP7 A;  5C8Y A;  3RYI A;  2B33 A;  3NVI B;  2DT4 A;  4X3L A;  3SIV A;  4X1Y B;  4B46 A;  2F9Z C;  3RYF B;  3KHN A;  1VQ7 F;  3WJQ A;  3WXM B;  1W3E X;  3HKB B;  3QTY A;  3IKF A;  4BVS A;  3L7Q A;  3N4Z A;  1GX1 A;  3D01 A;  2HP0 B;  1IV4 A;  5CA0 B;  1QU9 A;  3C9S A;  1Q81 H;  3IEW A;  4ERH A;  5KMG A;  3LDT A;  5EWR A;  4NUT A;  5KX5 A;  2HRY A;  5EYP A;  3MQW A;  4TUY A;  4LCK A;  3S03 A;  1VQ5 F;  1YHQ F;  5LP6 B;  3CG6 A;  4ZI7 A;  3HKE B;  3CCV F;  2VGM A;  4YJ2 B;  5HXZ A;  5EZY B;  3CC4 F;  4I4T B;  5CA1 B;  3N2G A;  3V7E A;  2AIF A;  2R6R 1;  3VYU C;  3VO8 A;  5FLX M;  5GIP C;  3C8L A;  5LA6 A;  1JN1 A;  1W5E A;  4O4L B;  3S06 A;  4ZOL B;  3CB2 A;  3CCE F;  4HNA B;  4WBN B;  1DT9 A;  3CPQ A;  3S0H A;  2IG8 A;  3NMU C;  1YJ9 F;  4G4V A;  5JVD A;  5EB1 B;  4EB6 A;  2VXY A;  1JJ2 F;  3K2X A;  1W59 A;  3KE1 A;  5HY1 A;  5GIN C;  4TZZ A;  3UT5 A;  3ZOP A;  1ONI A;  4B45 A;  5JQG B;  3D54 A;  1FFX B;  2VAW A;  2WAL A;  2CSL A;  3M4S A;  4DRX A;  5JH7 A;  2KG4 A;  3NVK E;  2VAM A;  2MQE A;  5AVM A;  4C8I A;  2LCA A;  3J80 M;  1QVF F;  2BTQ B;  4O2A A;  4TV9 A;  1T0K B;  1U43 A;  3OBW A;  5GON B;  1CK2 A;  5BMV B;  1IV1 A;  3JAT B;  1TUB B;  5HP7 A;  2R75 1;  1VH8 A;  3P0Z A; 
#chains in the Genus database with same CATH homology
 2ALE A;  3G71 F;  3VI6 A;  3CMA F;  1XBI A;  4EI7 A;  3CC7 F;  1CN7 A;  3HJW C;  1KQS F;  3LWV C;  2OTJ F;  3NVI B;  1W42 A;  5GAN K;  3V3T A;  2VGN A;  4X3L A;  2FC3 A;  3LWR C;  3CCL F;  4BW0 B;  1H7M A;  3SIV A;  3SIU A;  3G6E F;  1QVG F;  2F9Z C;  3MCA B;  1E7K A;  2QA4 F;  3HAX D;  4XCQ A;  3RA6 A;  3LWP C;  1N8R H;  1KD1 H;  2I6D A;  1VQ7 F;  3WXM B;  1W3E X;  2JNB A;  3GYQ A;  1IPA A;  1X7P A;  4BVS A;  3N4Z A;  1RA4 A;  1W41 A;  5HY4 A;  3O85 A;  3CD6 F;  1PXW A;  1VQO F;  3CCR F;  1Q81 H;  3E20 B;  3CC2 F;  5IT9 M;  5EWR A;  3CCM F;  1RLG A;  4NUT A;  3VMF B;  3CCS F;  3RA5 A;  1GZ0 A;  2LBX A;  4LCK A;  1VQ5 F;  4EI9 A;  3PAF A;  1YHQ F;  3LFO A;  3CG6 A;  3FFM A;  3CCV F;  2VGM A;  5HXZ A;  3I56 F;  5HWE A;  3CC4 F;  3V7Q A;  2FGY A;  1X52 A;  5G4U C;  1M90 H;  3V7E A;  2QI2 A;  2AIF A;  1M1K H;  5FLX M;  2QEX F;  3J7A R;  5GIP C;  3LWQ C;  1KC8 H;  1K73 H;  1S72 F;  3JAM M;  2OHW A;  1VQ6 F;  5GIO C;  2KTU A;  1W40 A;  1X7O A;  4X3M A;  4C4W C;  2GLZ A;  3CCE F;  3CME F;  3N4Y A;  4BVQ A;  1DT9 A;  3CPQ A;  5HY2 A;  3CCJ F;  2HVY D;  3IR9 A;  3NMU C;  1VQL F;  1VQM F;  2OZB A;  1YJ9 F;  1K9M H;  1VQN F;  1YIT F;  5HXU A;  4BVT A;  1YIJ F;  1VQ8 F;  1VQ9 F;  1VQK F;  1JJ2 F;  1GO1 A;  3J81 M;  5GAP K;  3CCU F;  1YJW F;  5HY1 A;  5GIN C;  4TZZ A;  4BY9 D;  3ON1 A;  5A2Q M;  3I55 F;  2BO1 A;  3PLA C;  1VQ4 F;  2OTL F;  1Q82 H;  1NJI H;  1ZWZ A;  2LBW A;  3CXC F;  2WAL A;  1VQP F;  1Q7Y H;  5G4V C;  1YJN F;  5FJ4 C;  3D00 A;  2CZW A;  3LWO C;  2KG4 A;  3AGK A;  1YI2 F;  2KTV A;  3NVK E;  3NK6 A;  5DCV A;  1NMU B;  1K8A H;  4BVR A;  4EI8 A;  5HY0 A;  3J80 M;  3G4S F;  1QVF F;  1W2B F;  4NQ3 A;  1T0K B;  3CPW F;  3E1Y A;  3CCQ F;  3OBW A;  1CK2 A;  3NK7 A;  5EO3 A;  1SDS A;  3OW2 F;  1GO0 A;  1Q86 H;  3JCM M;  3OBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...