2OTLF

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2otlF00
3NMUC 3ON1A 1W41A 3VI6A 3E20B 2OTLF 1IPAA 3AGKA 3CC7F 5GINC 3CCVF 1KD1H 1VQ8F 1X7OA 2VGNA 5DCVA 2CZWA 1RLGA 5GIPC 3LWOC 1H7MA 2OHWA 3CG6A 1YI2F 1N8RH 1SDSA 1CK2A 3CCRF 1KC8H 1RA4A 1VQ4F 2KTUA 3NK7A 1VQ9F 4X3LA 1GO0A 3FFMA 3CCSF 1M90H 1Q81H 3CCJF 3CC2F 3E1YA 1T0KB 3PAFA 1KQSF 1VQ6F 1NMUB 3CCMF 3LWVC 1VQMF 1NJIH 1JJ2F 3NVKE 1ZWZA 3G71F 2QEXF 3JAMM 2QI2A 1QVGF 3RA6A 2OTJF 1DT9A 3G4SF 3CMEF 5EO3A 1W2BF 3OBYA 1YHQF 2HVYD 3I55F 3J80M 1VQPF 3SIVA 1M1KH 3J7AR 3CXCF 3MCAB 3PLAC 3CCQF 1VQ5F 1W3EX 3HJWC 3LWPC 1VQLF 5A2QM 1VQ7F 3CC4F 5EWRA 2FC3A 3CCUF 3CD6F 5FJ4C 4X3MA 1E7KA 3OW2F 5G4VC 4LCKA 2LBXA 3LWQC 1YJ9F 3CPWF 1X7PA 3CPQA 1VQKF 1YIJF 3SIUA 5FLXM 3RA5A 3N4YA 1K8AH 3O85A 2LBWA 1GO1A 4BY9D 1GZ0A 1XBIA 5GANK 3V7EA 3OBWA 1W42A 3CCEF 3WXMB 2WALA 3LWRC 3IR9A 1Q7YH 3JCMM 3J81M 4BW0B 1W40A 3LFOA 1PXWA 1S72F 3I56F 4C4WC 2ALEA 3V7QA 5GAPK 1CN7A 2VGMA 5GIOC 3NVIB 3NK6A 1YITF 3CCLF 2QA4F 1YJNF 3N4ZA 5IT9M 2OZBA 5G4UC 1Q86H 1K73H 2BO1A 3G6EF 3CMAF 2AIFA 3HAXD 2KG4A 2KTVA 1VQOF 1QVFF 2JNBA 1K9MH 2I6DA 1VQNF 4TZZA 1YJWF 4NUTA 1X52A 3VMFB 3GYQA 1Q82H
chains in the Genus database with same CATH superfamily
3ON1A 3N2KA 1Z5WA 5EZYB 2BTQB 5EIBD 2RHLA 3RYHA 1SA0A 1VQ8F 4BT6A 3LWOC 1X25A 4TV9A 2CHSA 1H7MA 2OHWA 3F0EA 1N8RH 3KHNA 1CK2A 3CCRF 1H47A 1VQ4F 2BTUA 2OTMA 3C9RA 1M90H 3JARA 3HKDA 3TD5A 4ZHYB 4B5CA 4YJ2A 1VK3A 3CC2F 1T0KB 5CA0A 3CCMF 4BT4A 5LYJB 3IKFA 3WJQA 3NVKE 4BVRA 1IV2A 2I6RA 3MQWA 4U3JA 3RA6A 4PWTA 3D54A 4B46A 3V4DA 1W59A 1DT9A 2LBTA 4O4HB 5EO3A 4ZHQB 4ZOLB 5CA1A 3I3FA 1RLUA 3KJKA 3LDTA 2HS3A 5EYPA 3HTNA 4I4TB 2B33A 3J7AR 4O4JB 3CXCF 3VOBA 3MCQA 1TVKA 1JY8A 3L7QA 3LWPC 1UI9A 3CC4F 4G4YA 4X1YA 2FC3A 3CCUF 4X3MA 3B6NA 3KE1A 5G4VC 2UYNB 3LWQC 3JASA 1Q8RA 2G9IA 4X1KA 2W8BC 4EB6B 2L26A 4TV8B 5EZYA 2MQEA 2F9ZC 5FLXM 5JVDB 3RA5A 1OAPA 2VXYA 2HP0A 2LBWA 3N2KB 3HKCB 2PHNA 5J2UB 1GO1A 3ZP4A 1XBIA 2IQQA 3V7EA 1W5EA 2H6LA 1W42A 3E22B 4O2BB 2Q1XA 1W5FA 5JCOA 2ZVYA 1VH8A 5LYJA 4X20A 1Z5VA 3NVIB 1YITF 3HKDB 3VO8A 5IJ9B 4M8IA 4KWEA 3DC2A 3FPIA 1QD9A 3HAXD 2AIFA 3RYIB 2KG4A 1QVFF 4ZHQA 5MN6A 2I6DA 4ZOLA 4RQOA 3WGJA 4NUTA 4X1IB 2Z1TA 5JQGB 5JH7B 5EB0A 5EIBC 1W41A 4BVSA 4E6EA 1VQVA 4O4JA 3AGKA 5LA6A 1ODEA 1YGYA 3GTZA 5LP6C 5GINC 3IMPA 2VGNA 5DCVA 3FBAA 3LMEA 2K1SA 3CG6A 1YI2F 1JD1A 1RA4A 5J2TB 2KTUA 2UYNA 5KX5B 1FFXB 3FFMA 3RYCA 3IEQA 4R40B 3T80A 3PAFA 1FNKA 3S0HA 1VQ6F 5JVDA 1NMUB 3C9UA 3QTYA 1NJIH 3WGMA 5EB1B 1ZWZA 3G71F 3HKCA 5J2UA 3KJJA 5C8YB 3F6MA 2RHOA 1DBFA 2OTJF 3E22A 4O2BA 2YYEA 2HP0B 3QHDA 3C8LA 3OBYA 1YHQF 5IJ0B 2HVYD 1W5AA 4ZHWA 1XHOA 4RHAA 5IJ9A 1RQ2A 1FNJA 2UZHA 1COMA 4O4LB 3MDOA 4B62A 5A2QM 1VQ7F 3RYIA 2UYPA 5HY1A 4X20B 3CD6F 5IYZA 3Q8HA 2CW4A 4X1IA 3S02A 5JQGA 5JH7A 3ZO8A 2IG8A 3BYQA 1X7PA 1VQKF 3VYUC 3M84A 1W55A 2P6YA 2R751 5GONB 4G4XA 3N4YA 1NQ3A 2BTOA 4BY9D 5J2TA 3IEWA 5LA6B 5KX5A 1FFXA 3WGLA 3CCEF 3WXMB 3DDNA 3LWRC 4I55B 3V3TA 1UFYA 1W40A 4C8GA 1PXWA 3I56F 3FD6A 3WJRA 2VGMA 4BT3A 2UYKA 5LXTB 5GIOC 3NK6A 3K2XA 3RYCB 3CCLF 2QA4F 3N4ZA 5IT9M 3ERNA 1K73H 2BO1A 1TUBB 1IV3A 2EWCA 2VAWA 3G6EF 5C8YA 5LP6B 2YXZA 2GVIA 4IIJB 2RB9A 3D00A 3D01A 2VAMA 2HQSC 3HWUA 5HY2A 1YJWF 3N2GB 5IJ0A 1R1MA 3VMFB 1Q82H 3NMUC 4LCKA 3VIUA 4EI7A 3VYSC 4BVTA 1IPAA 2AMTA 3CCVF 4F6RB 4O4LA 2CZWA 5GIPC 2ZODA 2N48A 4YJ3A 3NK7A 5HP8A 1VQ9F 2KGWA 2FGYA 3CCSF 1PF5A 3VCZA 3CCJF 3WGKA 3I7TA 3R0PA 5IYZB 2PMPA 4C81A 2IAFA 5HXUA 1KQSF 5GONA 4C8IA 2HX0A 1VQMF 3CYPB 2HRUA 4WBNB 3OONA 1QVGF 2RHJA 2GZLA 3P4EA 5MN4A 1IV4A 1KNJA 2Z01A 3JAWA 4I55A 1IV1A 3CYQA 4ZHVA 4BT2A 1QU9A 3I55F 1U3LA 3J80M 5LXTA 1VQPF 1M1KH 4G4VA 1TUBA 3MCAB 3PLAC 1W3EX 5LP6A 1W581 1VQLF 4IIJA 3CB2A 1J7HA 3JAKB 4LNUB 5FJ4C 1E7KA 3OW2F 4O4IB 3N2GA 4NQ3A 1U3PA 3ZP7A 5CB4B 2QTPA 1CLIA 2LBXA 2NMUA 3RYFB 3P0ZA 3CPQA 5AVMA 1U43A 4C8EA 5ITZB 5B8FA 4F6RA 1JN1A 5KMGB 3WJPA 5BMVB 1K8AH 3O85A 5FNVB 2HS0A 3VYTC 3TD3A 3K12A 3F0DA 3F0GA 3M4SA 5GANK 4G88A 1OFUA 3OBWA 2Z1EA 3P10A 1H48A 2HS4A 3ESJA 3J81M 3LFOA 1S72F 4YJ3B 4C4WC 2ALEA 2ZAUA 3WGNA 4TUYB 5GAPK 1CN7A 2Z1FA 3JATA 3HKBB 3JALB 1YJNF 5HY4A 2OZBA 4IHJB 1Q86H 4WBNA 3M1XA 4NWOB 3HKEB 3CMAF 4DRXB 2KTVA 4I50B 5LOVA 1K9MH 1VQNF 4TZZA 4FFBB 1X52A 1SZQA 2Z1UA 3ZOPA 4HNAB 2H8EA 3JAWB 2GLZA 1XV2A 3S06A 3VI6A 3E20B 4ERHA 2OTLF 5HXZA 5MN5A 1YQNA 2ZF8A 3CC7F 1KD1H 3GHZA 1W57A 1X7OA 1RLGA 3WPXA 3JAKA 4LNUA 4C82A 4ZI7A 1KC8H 1SDSA 3S0YA 4O4IA 2H8CA 5CB4A 4X3LA 3UT5B 2R6R1 3C9TA 1GO0A 3RE3A 1VHAA 3RYFA 1Q81H 3E1YA 3K0TA 2CWJA 1XRGA 5ITZA 3K14A 3JVHA 3LWVC 5KMGA 5HWEA 1JJ2F 2HRYA 3C9SA 5BMVA 2ZOVA 2QEXF 3JAMM 5FNVA 1JFFB 2QI2A 3KIZA 3VTIC 1FSZA 4O2AB 3EORA 3G4SF 5HP7A 3CMEF 1W2BF 4ZK7A 1ONIA 2Q1YA 2RHHA 5JCOC 2CSLA 4TUYA 5HY0A 3HKBA 3SIVA 3JALA 4IHJA 3RYHB 2DYYA 1W5BA 3F0FA 3CCQF 1VQ5F 1SA0B 2AIZP 3HJWC 2ZVZA 3HKEA 4DRXA 4TV9B 3JATB 2CHTA 5EWRA 3IKEA 4I50A 1KNKA 3LYBA 4FFBA 1YJ9F 4BT7A 3TD4A 3CPWF 3JARB 1GX1A 4HNAA 4XCQA 2CVLA 4B45A 4YJ2B 1YIJF 4BVQA 5LOVB 3SIUA 3S0WA 5CA0B 4EI8A 1QAHA 1T0AA 4O4HA 3WPWA 4EI9A 1RQ7A 4U3JB 1GZ0A 4G4WA 3VOAA 3UT5A 3MBMA 4I4TA 3FD5A 2WALA 4G4ZA 4DXDA 5CA1B 3IR9A 1Q7YH 3JCMM 4BW0B 3QUWA 4ZI7B 2UYJA 2LCAA 3U0OA 5EAZA 5EYPB 3V7QA 4BT5A 2DT4A 1U40A 2VAPA 5G4UC 2V9YA 1JFFA 1TVKB 4O2AA 4EB6A 4U39A 3S03A 4TV8A 4X1YB 2HP3A 1VQOF 3ELCA 2JNBA 3JASB 4X1KB 3GYQA
chains in the Genus database with same CATH topology
3NMUC 2GLZA 3ON1A 1W41A 3VI6A 3E20B 4BVSA 4EI7A 2OTLF 4BVTA 1IPAA 3AGKA 5HXZA 3CC7F 5GINC 3CCVF 1KD1H 1VQ8F 1X7OA 2VGNA 5DCVA 2CZWA 1RLGA 5GIPC 3LWOC 1H7MA 2OHWA 3CG6A 1YI2F 1N8RH 1SDSA 1CK2A 3CCRF 1KC8H 1RA4A 1VQ4F 2KTUA 3NK7A 1VQ9F 4X3LA 1GO0A 3FFMA 2FGYA 3CCSF 1M90H 1Q81H 3CCJF 3CC2F 3E1YA 1T0KB 5HXUA 3PAFA 1KQSF 1VQ6F 1NMUB 3CCMF 3LWVC 1VQMF 1NJIH 5HWEA 1JJ2F 3NVKE 1ZWZA 3G71F 2QEXF 3JAMM 4BVRA 2QI2A 1QVGF 3RA6A 2OTJF 1DT9A 3G4SF 3CMEF 5EO3A 1W2BF 3OBYA 1YHQF 2HVYD 3I55F 5HY0A 3J80M 1VQPF 3SIVA 1M1KH 3J7AR 3CXCF 3MCAB 3PLAC 3CCQF 1VQ5F 1W3EX 3HJWC 3LWPC 1VQLF 5A2QM 1VQ7F 3CC4F 5HY1A 5EWRA 2FC3A 3CCUF 3CD6F 5FJ4C 4X3MA 1E7KA 3OW2F 4NQ3A 5G4VC 4LCKA 2LBXA 3LWQC 1YJ9F 3CPWF 4XCQA 1X7PA 3CPQA 1VQKF 2F9ZC 1YIJF 4BVQA 3SIUA 5FLXM 4EI8A 3RA5A 3N4YA 4EI9A 3O85A 2LBWA 1K8AH 1GO1A 4BY9D 1GZ0A 1XBIA 5GANK 3V7EA 3OBWA 1W42A 3CCEF 3WXMB 2WALA 3LWRC 3V3TA 3IR9A 1Q7YH 3JCMM 3J81M 4BW0B 1W40A 3LFOA 1PXWA 1S72F 3I56F 4C4WC 2ALEA 3V7QA 5GAPK 1CN7A 2VGMA 5GIOC 3NVIB 3NK6A 1YITF 3CCLF 2QA4F 1YJNF 3N4ZA 5HY4A 5IT9M 2OZBA 5G4UC 1Q86H 1K73H 2BO1A 3G6EF 3CMAF 2AIFA 3HAXD 2KG4A 3D00A 2KTVA 1VQOF 1QVFF 2JNBA 1K9MH 2I6DA 1VQNF 4TZZA 5HY2A 1YJWF 4NUTA 1X52A 3VMFB 3GYQA 1Q82H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NMU C;  3ON1 A;  1W41 A;  3VI6 A;  3E20 B;  2OTL F;  1IPA A;  3AGK A;  3CC7 F;  5GIN C;  3CCV F;  1KD1 H;  1VQ8 F;  1X7O A;  2VGN A;  5DCV A;  2CZW A;  1RLG A;  5GIP C;  3LWO C;  1H7M A;  2OHW A;  3CG6 A;  1YI2 F;  1N8R H;  1SDS A;  1CK2 A;  3CCR F;  1KC8 H;  1RA4 A;  1VQ4 F;  2KTU A;  3NK7 A;  1VQ9 F;  4X3L A;  1GO0 A;  3FFM A;  3CCS F;  1M90 H;  1Q81 H;  3CCJ F;  3CC2 F;  3E1Y A;  1T0K B;  3PAF A;  1KQS F;  1VQ6 F;  1NMU B;  3CCM F;  3LWV C;  1VQM F;  1NJI H;  1JJ2 F;  3NVK E;  1ZWZ A;  3G71 F;  2QEX F;  3JAM M;  2QI2 A;  1QVG F;  3RA6 A;  2OTJ F;  1DT9 A;  3G4S F;  3CME F;  5EO3 A;  1W2B F;  3OBY A;  1YHQ F;  2HVY D;  3I55 F;  3J80 M;  1VQP F;  3SIV A;  1M1K H;  3J7A R;  3CXC F;  3MCA B;  3PLA C;  3CCQ F;  1VQ5 F;  1W3E X;  3HJW C;  3LWP C;  1VQL F;  5A2Q M;  1VQ7 F;  3CC4 F;  5EWR A;  2FC3 A;  3CCU F;  3CD6 F;  5FJ4 C;  4X3M A;  1E7K A;  3OW2 F;  5G4V C;  4LCK A;  2LBX A;  3LWQ C;  1YJ9 F;  3CPW F;  1X7P A;  3CPQ A;  1VQK F;  1YIJ F;  3SIU A;  5FLX M;  3RA5 A;  3N4Y A;  1K8A H;  3O85 A;  2LBW A;  1GO1 A;  4BY9 D;  1GZ0 A;  1XBI A;  5GAN K;  3V7E A;  3OBW A;  1W42 A;  3CCE F;  3WXM B;  2WAL A;  3LWR C;  3IR9 A;  1Q7Y H;  3JCM M;  3J81 M;  4BW0 B;  1W40 A;  3LFO A;  1PXW A;  1S72 F;  3I56 F;  4C4W C;  2ALE A;  3V7Q A;  5GAP K;  1CN7 A;  2VGM A;  5GIO C;  3NVI B;  3NK6 A;  1YIT F;  3CCL F;  2QA4 F;  1YJN F;  3N4Z A;  5IT9 M;  2OZB A;  5G4U C;  1Q86 H;  1K73 H;  2BO1 A;  3G6E F;  3CMA F;  2AIF A;  3HAX D;  2KG4 A;  2KTV A;  1VQO F;  1QVF F;  2JNB A;  1K9M H;  2I6D A;  1VQN F;  4TZZ A;  1YJW F;  4NUT A;  1X52 A;  3VMF B;  3GYQ A;  1Q82 H; 
#chains in the Genus database with same CATH topology
 3ON1 A;  3N2K A;  1Z5W A;  5EZY B;  2BTQ B;  5EIB D;  2RHL A;  3RYH A;  1SA0 A;  1VQ8 F;  4BT6 A;  3LWO C;  1X25 A;  4TV9 A;  2CHS A;  1H7M A;  2OHW A;  3F0E A;  1N8R H;  3KHN A;  1CK2 A;  3CCR F;  1H47 A;  1VQ4 F;  2BTU A;  2OTM A;  3C9R A;  1M90 H;  3JAR A;  3HKD A;  3TD5 A;  4ZHY B;  4B5C A;  4YJ2 A;  1VK3 A;  3CC2 F;  1T0K B;  5CA0 A;  3CCM F;  4BT4 A;  5LYJ B;  3IKF A;  3WJQ A;  3NVK E;  4BVR A;  1IV2 A;  2I6R A;  3MQW A;  4U3J A;  3RA6 A;  4PWT A;  3D54 A;  4B46 A;  3V4D A;  1W59 A;  1DT9 A;  2LBT A;  4O4H B;  5EO3 A;  4ZHQ B;  4ZOL B;  5CA1 A;  3I3F A;  1RLU A;  3KJK A;  3LDT A;  2HS3 A;  5EYP A;  3HTN A;  4I4T B;  2B33 A;  3J7A R;  4O4J B;  3CXC F;  3VOB A;  3MCQ A;  1TVK A;  1JY8 A;  3L7Q A;  3LWP C;  1UI9 A;  3CC4 F;  4G4Y A;  4X1Y A;  2FC3 A;  3CCU F;  4X3M A;  3B6N A;  3KE1 A;  5G4V C;  2UYN B;  3LWQ C;  3JAS A;  1Q8R A;  2G9I A;  4X1K A;  2W8B C;  4EB6 B;  2L26 A;  4TV8 B;  5EZY A;  2MQE A;  2F9Z C;  5FLX M;  5JVD B;  3RA5 A;  1OAP A;  2VXY A;  2HP0 A;  2LBW A;  3N2K B;  3HKC B;  2PHN A;  5J2U B;  1GO1 A;  3ZP4 A;  1XBI A;  2IQQ A;  3V7E A;  1W5E A;  2H6L A;  1W42 A;  3E22 B;  4O2B B;  2Q1X A;  1W5F A;  5JCO A;  2ZVY A;  1VH8 A;  5LYJ A;  4X20 A;  1Z5V A;  3NVI B;  1YIT F;  3HKD B;  3VO8 A;  5IJ9 B;  4M8I A;  4KWE A;  3DC2 A;  3FPI A;  1QD9 A;  3HAX D;  2AIF A;  3RYI B;  2KG4 A;  1QVF F;  4ZHQ A;  5MN6 A;  2I6D A;  4ZOL A;  4RQO A;  3WGJ A;  4NUT A;  4X1I B;  2Z1T A;  5JQG B;  5JH7 B;  5EB0 A;  5EIB C;  1W41 A;  4BVS A;  4E6E A;  1VQV A;  4O4J A;  3AGK A;  5LA6 A;  1ODE A;  1YGY A;  3GTZ A;  5LP6 C;  5GIN C;  3IMP A;  2VGN A;  5DCV A;  3FBA A;  3LME A;  2K1S A;  3CG6 A;  1YI2 F;  1JD1 A;  1RA4 A;  5J2T B;  2KTU A;  2UYN A;  5KX5 B;  1FFX B;  3FFM A;  3RYC A;  3IEQ A;  4R40 B;  3T80 A;  3PAF A;  1FNK A;  3S0H A;  1VQ6 F;  5JVD A;  1NMU B;  3C9U A;  3QTY A;  1NJI H;  3WGM A;  5EB1 B;  1ZWZ A;  3G71 F;  3HKC A;  5J2U A;  3KJJ A;  5C8Y B;  3F6M A;  2RHO A;  1DBF A;  2OTJ F;  3E22 A;  4O2B A;  2YYE A;  2HP0 B;  3QHD A;  3C8L A;  3OBY A;  1YHQ F;  5IJ0 B;  2HVY D;  1W5A A;  4ZHW A;  1XHO A;  4RHA A;  5IJ9 A;  1RQ2 A;  1FNJ A;  2UZH A;  1COM A;  4O4L B;  3MDO A;  4B62 A;  5A2Q M;  1VQ7 F;  3RYI A;  2UYP A;  5HY1 A;  4X20 B;  3CD6 F;  5IYZ A;  3Q8H A;  2CW4 A;  4X1I A;  3S02 A;  5JQG A;  5JH7 A;  3ZO8 A;  2IG8 A;  3BYQ A;  1X7P A;  1VQK F;  3VYU C;  3M84 A;  1W55 A;  2P6Y A;  2R75 1;  5GON B;  4G4X A;  3N4Y A;  1NQ3 A;  2BTO A;  4BY9 D;  5J2T A;  3IEW A;  5LA6 B;  5KX5 A;  1FFX A;  3WGL A;  3CCE F;  3WXM B;  3DDN A;  3LWR C;  4I55 B;  3V3T A;  1UFY A;  1W40 A;  4C8G A;  1PXW A;  3I56 F;  3FD6 A;  3WJR A;  2VGM A;  4BT3 A;  2UYK A;  5LXT B;  5GIO C;  3NK6 A;  3K2X A;  3RYC B;  3CCL F;  2QA4 F;  3N4Z A;  5IT9 M;  3ERN A;  1K73 H;  2BO1 A;  1TUB B;  1IV3 A;  2EWC A;  2VAW A;  3G6E F;  5C8Y A;  5LP6 B;  2YXZ A;  2GVI A;  4IIJ B;  2RB9 A;  3D00 A;  3D01 A;  2VAM A;  2HQS C;  3HWU A;  5HY2 A;  1YJW F;  3N2G B;  5IJ0 A;  1R1M A;  3VMF B;  1Q82 H;  3NMU C;  4LCK A;  3VIU A;  4EI7 A;  3VYS C;  4BVT A;  1IPA A;  2AMT A;  3CCV F;  4F6R B;  4O4L A;  2CZW A;  5GIP C;  2ZOD A;  2N48 A;  4YJ3 A;  3NK7 A;  5HP8 A;  1VQ9 F;  2KGW A;  2FGY A;  3CCS F;  1PF5 A;  3VCZ A;  3CCJ F;  3WGK A;  3I7T A;  3R0P A;  5IYZ B;  2PMP A;  4C81 A;  2IAF A;  5HXU A;  1KQS F;  5GON A;  4C8I A;  2HX0 A;  1VQM F;  3CYP B;  2HRU A;  4WBN B;  3OON A;  1QVG F;  2RHJ A;  2GZL A;  3P4E A;  5MN4 A;  1IV4 A;  1KNJ A;  2Z01 A;  3JAW A;  4I55 A;  1IV1 A;  3CYQ A;  4ZHV A;  4BT2 A;  1QU9 A;  3I55 F;  1U3L A;  3J80 M;  5LXT A;  1VQP F;  1M1K H;  4G4V A;  1TUB A;  3MCA B;  3PLA C;  1W3E X;  5LP6 A;  1W58 1;  1VQL F;  4IIJ A;  3CB2 A;  1J7H A;  3JAK B;  4LNU B;  5FJ4 C;  1E7K A;  3OW2 F;  4O4I B;  3N2G A;  4NQ3 A;  1U3P A;  3ZP7 A;  5CB4 B;  2QTP A;  1CLI A;  2LBX A;  2NMU A;  3RYF B;  3P0Z A;  3CPQ A;  5AVM A;  1U43 A;  4C8E A;  5ITZ B;  5B8F A;  4F6R A;  1JN1 A;  5KMG B;  3WJP A;  5BMV B;  1K8A H;  3O85 A;  5FNV B;  2HS0 A;  3VYT C;  3TD3 A;  3K12 A;  3F0D A;  3F0G A;  3M4S A;  5GAN K;  4G88 A;  1OFU A;  3OBW A;  2Z1E A;  3P10 A;  1H48 A;  2HS4 A;  3ESJ A;  3J81 M;  3LFO A;  1S72 F;  4YJ3 B;  4C4W C;  2ALE A;  2ZAU A;  3WGN A;  4TUY B;  5GAP K;  1CN7 A;  2Z1F A;  3JAT A;  3HKB B;  3JAL B;  1YJN F;  5HY4 A;  2OZB A;  4IHJ B;  1Q86 H;  4WBN A;  3M1X A;  4NWO B;  3HKE B;  3CMA F;  4DRX B;  2KTV A;  4I50 B;  5LOV A;  1K9M H;  1VQN F;  4TZZ A;  4FFB B;  1X52 A;  1SZQ A;  2Z1U A;  3ZOP A;  4HNA B;  2H8E A;  3JAW B;  2GLZ A;  1XV2 A;  3S06 A;  3VI6 A;  3E20 B;  4ERH A;  2OTL F;  5HXZ A;  5MN5 A;  1YQN A;  2ZF8 A;  3CC7 F;  1KD1 H;  3GHZ A;  1W57 A;  1X7O A;  1RLG A;  3WPX A;  3JAK A;  4LNU A;  4C82 A;  4ZI7 A;  1KC8 H;  1SDS A;  3S0Y A;  4O4I A;  2H8C A;  5CB4 A;  4X3L A;  3UT5 B;  2R6R 1;  3C9T A;  1GO0 A;  3RE3 A;  1VHA A;  3RYF A;  1Q81 H;  3E1Y A;  3K0T A;  2CWJ A;  1XRG A;  5ITZ A;  3K14 A;  3JVH A;  3LWV C;  5KMG A;  5HWE A;  1JJ2 F;  2HRY A;  3C9S A;  5BMV A;  2ZOV A;  2QEX F;  3JAM M;  5FNV A;  1JFF B;  2QI2 A;  3KIZ A;  3VTI C;  1FSZ A;  4O2A B;  3EOR A;  3G4S F;  5HP7 A;  3CME F;  1W2B F;  4ZK7 A;  1ONI A;  2Q1Y A;  2RHH A;  5JCO C;  2CSL A;  4TUY A;  5HY0 A;  3HKB A;  3SIV A;  3JAL A;  4IHJ A;  3RYH B;  2DYY A;  1W5B A;  3F0F A;  3CCQ F;  1VQ5 F;  1SA0 B;  2AIZ P;  3HJW C;  2ZVZ A;  3HKE A;  4DRX A;  4TV9 B;  3JAT B;  2CHT A;  5EWR A;  3IKE A;  4I50 A;  1KNK A;  3LYB A;  4FFB A;  1YJ9 F;  4BT7 A;  3TD4 A;  3CPW F;  3JAR B;  1GX1 A;  4HNA A;  4XCQ A;  2CVL A;  4B45 A;  4YJ2 B;  1YIJ F;  4BVQ A;  5LOV B;  3SIU A;  3S0W A;  5CA0 B;  4EI8 A;  1QAH A;  1T0A A;  4O4H A;  3WPW A;  4EI9 A;  1RQ7 A;  4U3J B;  1GZ0 A;  4G4W A;  3VOA A;  3UT5 A;  3MBM A;  4I4T A;  3FD5 A;  2WAL A;  4G4Z A;  4DXD A;  5CA1 B;  3IR9 A;  1Q7Y H;  3JCM M;  4BW0 B;  3QUW A;  4ZI7 B;  2UYJ A;  2LCA A;  3U0O A;  5EAZ A;  5EYP B;  3V7Q A;  4BT5 A;  2DT4 A;  1U40 A;  2VAP A;  5G4U C;  2V9Y A;  1JFF A;  1TVK B;  4O2A A;  4EB6 A;  4U39 A;  3S03 A;  4TV8 A;  4X1Y B;  2HP3 A;  1VQO F;  3ELC A;  2JNB A;  3JAS B;  4X1K B;  3GYQ A; 
#chains in the Genus database with same CATH homology
 3NMU C;  2GLZ A;  3ON1 A;  1W41 A;  3VI6 A;  3E20 B;  4BVS A;  4EI7 A;  2OTL F;  4BVT A;  1IPA A;  3AGK A;  5HXZ A;  3CC7 F;  5GIN C;  3CCV F;  1KD1 H;  1VQ8 F;  1X7O A;  2VGN A;  5DCV A;  2CZW A;  1RLG A;  5GIP C;  3LWO C;  1H7M A;  2OHW A;  3CG6 A;  1YI2 F;  1N8R H;  1SDS A;  1CK2 A;  3CCR F;  1KC8 H;  1RA4 A;  1VQ4 F;  2KTU A;  3NK7 A;  1VQ9 F;  4X3L A;  1GO0 A;  3FFM A;  2FGY A;  3CCS F;  1M90 H;  1Q81 H;  3CCJ F;  3CC2 F;  3E1Y A;  1T0K B;  5HXU A;  3PAF A;  1KQS F;  1VQ6 F;  1NMU B;  3CCM F;  3LWV C;  1VQM F;  1NJI H;  5HWE A;  1JJ2 F;  3NVK E;  1ZWZ A;  3G71 F;  2QEX F;  3JAM M;  4BVR A;  2QI2 A;  1QVG F;  3RA6 A;  2OTJ F;  1DT9 A;  3G4S F;  3CME F;  5EO3 A;  1W2B F;  3OBY A;  1YHQ F;  2HVY D;  3I55 F;  5HY0 A;  3J80 M;  1VQP F;  3SIV A;  1M1K H;  3J7A R;  3CXC F;  3MCA B;  3PLA C;  3CCQ F;  1VQ5 F;  1W3E X;  3HJW C;  3LWP C;  1VQL F;  5A2Q M;  1VQ7 F;  3CC4 F;  5HY1 A;  5EWR A;  2FC3 A;  3CCU F;  3CD6 F;  5FJ4 C;  4X3M A;  1E7K A;  3OW2 F;  4NQ3 A;  5G4V C;  4LCK A;  2LBX A;  3LWQ C;  1YJ9 F;  3CPW F;  4XCQ A;  1X7P A;  3CPQ A;  1VQK F;  2F9Z C;  1YIJ F;  4BVQ A;  3SIU A;  5FLX M;  4EI8 A;  3RA5 A;  3N4Y A;  4EI9 A;  3O85 A;  2LBW A;  1K8A H;  1GO1 A;  4BY9 D;  1GZ0 A;  1XBI A;  5GAN K;  3V7E A;  3OBW A;  1W42 A;  3CCE F;  3WXM B;  2WAL A;  3LWR C;  3V3T A;  3IR9 A;  1Q7Y H;  3JCM M;  3J81 M;  4BW0 B;  1W40 A;  3LFO A;  1PXW A;  1S72 F;  3I56 F;  4C4W C;  2ALE A;  3V7Q A;  5GAP K;  1CN7 A;  2VGM A;  5GIO C;  3NVI B;  3NK6 A;  1YIT F;  3CCL F;  2QA4 F;  1YJN F;  3N4Z A;  5HY4 A;  5IT9 M;  2OZB A;  5G4U C;  1Q86 H;  1K73 H;  2BO1 A;  3G6E F;  3CMA F;  2AIF A;  3HAX D;  2KG4 A;  3D00 A;  2KTV A;  1VQO F;  1QVF F;  2JNB A;  1K9M H;  2I6D A;  1VQN F;  4TZZ A;  5HY2 A;  1YJW F;  4NUT A;  1X52 A;  3VMF B;  3GYQ A;  1Q82 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...