3NVIB

Structure of n-terminal truncated nop56/58 bound with l7ae and box c/d rna
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
b'KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NOP5/NOP56 related protein
publication title Structural basis for substrate placement by an archaeal box C/D ribonucleoprotein particle.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase/rna
total genus 35
structure length 121
sequence length 121
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3nviB00
1YHQF 5G4VC 1W2BF 2QI2A 3IR9A 1YIJF 2QA4F 3CG6A 3CC7F 1VQ5F 4TZZA 3CMAF 1K73H 5EO3A 2JNBA 3JAMM 3CCUF 1VQ6F 3CCVF 1IPAA 1PXWA 4LCKA 3G71F 1Q82H 1YI2F 3VI6A 5GAPK 2I6DA 3NK7A 1CN7A 1VQ9F 1VQMF 1W42A 2KTUA 1W41A 1Q7YH 2ALEA 1X7OA 3CXCF 1GO0A 1ZWZA 3J81M 1VQNF 3CCRF 3LFOA 3J7AR 3NMUC 3CC2F 1K8AH 1YJNF 3AGKA 4NUTA 1GZ0A 2KTVA 2OHWA 2BO1A 1VQ7F 1DT9A 2CZWA 3PAFA 1N8RH 3NVKE 3J80M 1CK2A 1W3EX 5GIOC 3G6EF 1KQSF 5DCVA 5IT9M 3CPWF 3PLAC 3HAXD 1X7PA 4BW0B 3E20B 1Q86H 3N4YA 3CMEF 3LWRC 3O85A 3ON1A 3CD6F 2OZBA 3SIVA 5G4UC 1RA4A 2LBWA 3VMFB 1VQOF 1YJ9F 3HJWC 2WALA 2VGMA 1M1KH 3RA6A 1VQKF 3CCMF 3CCEF 5GIPC 1YJWF 3SIUA 1W40A 1SDSA 3MCAB 3LWOC 3OW2F 3JCMM 3OBWA 3LWVC 3I55F 1GO1A 3V7EA 1Q81H 1VQ8F 3WXMB 3CCQF 1T0KB 1VQ4F 1E7KA 2HVYD 3GYQA 1NJIH 2KG4A 2OTLF 1QVGF 4X3LA 5FLXM 1S72F 1VQPF 5FJ4C 1X52A 1H7MA 1NMUB 3FFMA 3LWPC 3I56F 2AIFA 4X3MA 5A2QM 3LWQC 4BY9D 2LBXA 1M90H 1KC8H 3NVIB 2VGNA 3CPQA 1QVFF 3E1YA 5EWRA 1XBIA 3CC4F 2FC3A 3V7QA 2QEXF 2OTJF 3N4ZA 3G4SF 5GINC 3RA5A 1YITF 1KD1H 3NK6A 1VQLF 1JJ2F 1K9MH 3CCSF 1RLGA 5GANK 3CCLF 3CCJF 3OBYA 4C4WC
chains in the Genus database with same CATH superfamily
1X25A 4O4HB 4TV9A 1W2BF 3IR9A 2QA4F 3F0EA 3UT5A 1FFXB 2EWCA 3CC7F 1YGYA 4I50A 4XCQA 5LA6A 3JAWA 3HKBB 3FD6A 4X1KB 2QTPA 1VK3A 1PXWA 5CB4B 4YJ3A 2IG8A 1Z5VA 4B45A 4C81A 5KX5B 5J2UA 1YI2F 2GLZA 3RE3A 5GAPK 1U40A 2I6DA 1XRGA 3NK7A 1VQMF 1VQVA 2ZODA 3F0DA 3RYFA 3VO8A 1Q7YH 2ALEA 4O2BB 3JAKA 3J81M 2YYEA 4O2AA 3K12A 2CVLA 1Z5WA 4WBNB 3CYQA 2OHWA 1TVKA 1KQSF 5FNVB 4O4LA 2H8CA 1ONIA 1U43A 3E20B 4DXDA 3QHDA 3CMEF 5LP6A 4BT2A 4IHJA 2RHHA 3RYIA 4PWTA 4EI9A 5JQGA 3RYHB 3CYPB 3WGKA 2ZVZA 5HY0A 4C8GA 4O4IA 5IJ9B 3LYBA 2LBWA 2P6YA 3ELCA 2PHNA 1VQOF 2UYPA 3UT5B 4R40B 1JN1A 3RA6A 5CA1B 1JFFA 5CA0B 5LA6B 3JASA 5EB0A 4G88A 3ZOPA 4BVSA 3D00A 3LDTA 3I55F 1IV2A 2UZHA 3C9SA 2L26A 3CCQF 2Z1UA 2HS3A 2KG4A 1FFXA 3JALB 1W5BA 1ODEA 3HKBA 3BYQA 1NMUB 4X1KA 3LWPC 3S0YA 1YQNA 3LWQC 5JCOC 4BY9D 4EB6A 5CB4A 1M90H 3MQWA 2VAMA 3E1YA 5EYPB 3S06A 1R1MA 5JVDB 3V7QA 2F9ZC 1YITF 3HWUA 3NK6A 1RLGA 3CCSF 2LCAA 1OAPA 3CCLF 3I3FA 2IAFA 2HP3A 2Z01A 5KMGB 2HS0A 1YHQF 5LXTA 2QI2A 4IHJB 4ZOLA 5AVMA 3KIZA 4O4IB 3ZP7A 4TZZA 1VQ5F 3CMAF 4WBNA 5EZYA 4DRXA 5EO3A 3JAMM 3VCZA 4YJ2B 5HP7A 5HY2A 1IPAA 1JFFB 4F6RB 3WPWA 3G71F 3JASB 5MN6A 4TUYB 4X1YA 4BT4A 3VI6A 3EORA 1QD9A 2BTOA 2DT4A 1W41A 3MDOA 3MBMA 4M8IA 3HKCB 5CA1A 5CA0A 1YJNF 3JATB 3AGKA 4NUTA 1W5FA 2RHOA 1N8RH 2IQQA 4RHAA 1H47A 4BVQA 5DCVA 2Z1FA 3CPWF 2HQSC 4EB6B 2V9YA 3KJJA 3HAXD 4BW0B 5ITZA 4ZK7A 1KNJA 4ZHYB 5JCOA 3JALA 4ZHQB 2CSLA 3N2KB 1W581 3FPIA 3P4EA 2OZBA 3SIVA 5EIBD 3VMFB 3F6MA 4G4WA 5LXTB 3HKDA 4ZOLB 3WGJA 5JH7A 1YJ9F 2RB9A 2DYYA 1M1KH 5EZYB 5EYPA 4DRXB 2ZF8A 3FD5A 5EB1B 5JVDA 3LWOC 3OW2F 3M1XA 3WGMA 3WJPA 2AMTA 3V7EA 5KMGA 3MCQA 1VQ8F 3WXMB 4X1YB 4E6EA 3R0PA 2RHJA 3TD5A 1VQ4F 4X20A 2BTQB 1VHAA 4EI7A 4O4JB 2OTLF 5HY1A 4RQOA 5FLXM 5FJ4C 5HXUA 3QUWA 1H7MA 3ESJA 3VOAA 5IJ0B 2H8EA 3D01A 4YJ2A 3I56F 2ZOVA 5A2QM 1U3PA 3M84A 2B33A 2RHLA 4F6RA 1KC8H 2YXZA 4TUYA 1QU9A 2PMPA 1OFUA 2FC3A 3OONA 2OTJF 4G4XA 3RA5A 1NQ3A 2VAWA 3T80A 2R6R1 4C8EA 2W8BC 3OBYA 2Z1EA 3C9RA 1VH8A 4BVTA 4C4WC 3KJKA 5ITZB 1U3LA 5G4VC 3E22B 4BT3A 3HKCA 3D54A 5HXZA 2NMUA 1RLUA 3JATA 3IKFA 2HRYA 2Z1TA 5LOVA 4X1IB 3HKDB 3P10A 5JH7B 1VQ6F 2CW4A 3WJQA 2CWJA 3KHNA 4U3JB 2Q1XA 3HTNA 5B8FA 5EIBC 3C9UA 4ZHQA 3N2KA 5HP8A 2KGWA 2HP0B 1IV1A 3CXCF 1ZWZA 4X20B 3WJRA 1W55A 4NQ3A 1VQNF 3J7AR 2H6LA 3DC2A 3IMPA 1IV3A 1GZ0A 2KTVA 2BO1A 1DT9A 4G4YA 2G9IA 1W3EX 2CHTA 1H48A 1QAHA 2HX0A 4FFBB 5LYJB 3N2GB 1X7PA 4B46A 4IIJB 1Q86H 4LNUA 3N4YA 4EI8A 3K14A 4TV8B 4O4JA 3LWRC 3QTYA 3S0HA 3O85A 3TD4A 1RA4A 4C82A 4B5CA 5IJ0A 1UFYA 2WALA 2VGMA 1COMA 2UYKA 1CLIA 1VQKF 5LOVB 1TUBB 2K1SA 1YJWF 1W40A 3VYSC 4I4TA 3MCAB 1SDSA 3V3TA 3OBWA 3LWVC 2OTMA 1W57A 2VAPA 3F0FA 3E22A 5BMVA 3S02A 3FBAA 3WGNA 5IYZB 1T0AA 3GYQA 2UYNB 3VIUA 3ZO8A 1FNKA 2GVIA 4C8IA 4X3LA 1S72F 1W5EA 5HWEA 2ZVYA 4G4VA 5J2TA 2UYJA 3CB2A 1IV4A 4X1IA 3FFMA 5GONA 1DBFA 3ZP4A 1KNKA 4NWOB 3Q8HA 5MN5A 4X3MA 4BT6A 4U39A 4U3JA 2LBXA 4B62A 4BT7A 3HKEB 4BVRA 3NVIB 3CPQA 2FGYA 1QVFF 4ZI7A 2CHSA 1XBIA 3CC4F 5GINC 1VQLF 3LMEA 4I55B 3VYUC 1K9MH 3RYCB 3CCJF 1UI9A 1JD1A 2HP0A 4LNUB 3C8LA 1YIJF 2GZLA 3CG6A 1K73H 2JNBA 3CCUF 2MQEA 4HNAB 2R751 3JVHA 1PF5A 3VYTC 4FFBA 3CCVF 2HRUA 5LYJA 3N2GA 1XV2A 4LCKA 4IIJA 3GTZA 1Q82H 3S03A 3GHZA 4I4TB 4TV8A 1CN7A 1VQ9F 2BTUA 1W42A 5MN4A 5C8YB 1SA0B 2KTUA 2VXYA 1X7OA 5BMVB 4TV9B 3IKEA 1GO0A 3K2XA 3CCRF 3LFOA 3NMUC 3CC2F 1K8AH 1Q8RA 4I50B 1TUBA 3JAWB 1XHOA 5J2TB 1VQ7F 5GONB 3V4DA 2ZAUA 2CZWA 3PAFA 3ERNA 5EAZA 3NVKE 3J80M 1CK2A 5GIOC 3G6EF 3JARA 5IT9M 4G4ZA 3L7QA 3PLAC 4YJ3B 4ZI7B 4ERHA 5J2UB 4O4HA 5IYZA 2N48A 1RQ2A 3WGLA 2UYNA 3ON1A 3CD6F 1SZQA 5G4UC 3VTIC 3RYFB 1J7HA 3F0GA 3JAKB 3HJWC 2HS4A 3I7TA 4O2AB 3HKEA 3CCMF 3CCEF 4ZHWA 4ZHVA 3M4SA 5GIPC 4KWEA 3SIUA 3IEWA 5KX5A 2AIZP 4BT5A 3P0ZA 1TVKB 3DDNA 3S0WA 4I55A 1FNJA 3JCMM 3RYCA 2LBTA 4O4LB 1GX1A 1GO1A 5HY4A 1Q81H 1RQ7A 3WPXA 3C9TA 1T0KB 4O2BA 5LP6B 1E7KA 5JQGB 2HVYD 3RYIB 3K0TA 3IEQA 3TD3A 1NJIH 1W59A 2I6RA 1QVGF 1VQPF 1X52A 2Q1YA 1W5AA 3KE1A 3VOBA 4HNAA 3U0OA 1FSZA 5LP6C 2AIFA 5FNVA 3B6NA 2VGNA 5EWRA 2QEXF 3N4ZA 3G4SF 3JARB 1KD1H 1JJ2F 3RYHA 5GANK 5IJ9A 5C8YA 1SA0A 1JY8A
chains in the Genus database with same CATH topology
1YHQF 5G4VC 1W2BF 2QI2A 3IR9A 1YIJF 2QA4F 3CG6A 5HXZA 3CC7F 1VQ5F 4TZZA 4XCQA 3CMAF 1K73H 5EO3A 2JNBA 3JAMM 3CCUF 5HY2A 1VQ6F 3CCVF 1IPAA 1PXWA 4LCKA 3G71F 1Q82H 1YI2F 2GLZA 3VI6A 5GAPK 2I6DA 3NK7A 1CN7A 1VQ9F 1VQMF 1W42A 2KTUA 1W41A 1Q7YH 2ALEA 1X7OA 3CXCF 1GO0A 1ZWZA 3J81M 4NQ3A 1VQNF 3CCRF 3LFOA 3J7AR 3NMUC 3CC2F 1K8AH 1YJNF 3AGKA 4NUTA 1GZ0A 2KTVA 2OHWA 2BO1A 1VQ7F 1DT9A 2CZWA 3PAFA 1N8RH 3NVKE 3J80M 1CK2A 1W3EX 5GIOC 4BVQA 3G6EF 1KQSF 5DCVA 5IT9M 3CPWF 3PLAC 3HAXD 1X7PA 4BW0B 3E20B 1Q86H 3N4YA 3CMEF 4EI8A 4EI9A 3LWRC 5HY0A 3O85A 3ON1A 3CD6F 2OZBA 3SIVA 5G4UC 1RA4A 2LBWA 3VMFB 1VQOF 1YJ9F 3HJWC 2WALA 2VGMA 1M1KH 3RA6A 1VQKF 3CCMF 3CCEF 5GIPC 1YJWF 3SIUA 1W40A 1SDSA 3MCAB 3LWOC 4BVSA 3V3TA 3JCMM 3OW2F 3D00A 3OBWA 3LWVC 3I55F 1GO1A 5HY4A 3V7EA 1Q81H 1VQ8F 3WXMB 3CCQF 1T0KB 1VQ4F 1E7KA 2HVYD 3GYQA 1NJIH 2KG4A 4EI7A 2OTLF 1QVGF 5HY1A 4X3LA 5FLXM 1S72F 5HWEA 1VQPF 5FJ4C 1X52A 5HXUA 1H7MA 1NMUB 3FFMA 3LWPC 3I56F 2AIFA 4X3MA 5A2QM 3LWQC 4BY9D 2LBXA 4BVRA 1M90H 1KC8H 3NVIB 2VGNA 3CPQA 2FGYA 1QVFF 3E1YA 5EWRA 1XBIA 3CC4F 2FC3A 3V7QA 2QEXF 2F9ZC 2OTJF 3N4ZA 3G4SF 5GINC 3RA5A 1YITF 1KD1H 3NK6A 1VQLF 1JJ2F 1K9MH 3CCSF 1RLGA 5GANK 3CCLF 3CCJF 3OBYA 4C4WC 4BVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ F;  5G4V C;  1W2B F;  2QI2 A;  3IR9 A;  1YIJ F;  2QA4 F;  3CG6 A;  3CC7 F;  1VQ5 F;  4TZZ A;  3CMA F;  1K73 H;  5EO3 A;  2JNB A;  3JAM M;  3CCU F;  1VQ6 F;  3CCV F;  1IPA A;  1PXW A;  4LCK A;  3G71 F;  1Q82 H;  1YI2 F;  3VI6 A;  5GAP K;  2I6D A;  3NK7 A;  1CN7 A;  1VQ9 F;  1VQM F;  1W42 A;  2KTU A;  1W41 A;  1Q7Y H;  2ALE A;  1X7O A;  3CXC F;  1GO0 A;  1ZWZ A;  3J81 M;  1VQN F;  3CCR F;  3LFO A;  3J7A R;  3NMU C;  3CC2 F;  1K8A H;  1YJN F;  3AGK A;  4NUT A;  1GZ0 A;  2KTV A;  2OHW A;  2BO1 A;  1VQ7 F;  1DT9 A;  2CZW A;  3PAF A;  1N8R H;  3NVK E;  3J80 M;  1CK2 A;  1W3E X;  5GIO C;  3G6E F;  1KQS F;  5DCV A;  5IT9 M;  3CPW F;  3PLA C;  3HAX D;  1X7P A;  4BW0 B;  3E20 B;  1Q86 H;  3N4Y A;  3CME F;  3LWR C;  3O85 A;  3ON1 A;  3CD6 F;  2OZB A;  3SIV A;  5G4U C;  1RA4 A;  2LBW A;  3VMF B;  1VQO F;  1YJ9 F;  3HJW C;  2WAL A;  2VGM A;  1M1K H;  3RA6 A;  1VQK F;  3CCM F;  3CCE F;  5GIP C;  1YJW F;  3SIU A;  1W40 A;  1SDS A;  3MCA B;  3LWO C;  3OW2 F;  3JCM M;  3OBW A;  3LWV C;  3I55 F;  1GO1 A;  3V7E A;  1Q81 H;  1VQ8 F;  3WXM B;  3CCQ F;  1T0K B;  1VQ4 F;  1E7K A;  2HVY D;  3GYQ A;  1NJI H;  2KG4 A;  2OTL F;  1QVG F;  4X3L A;  5FLX M;  1S72 F;  1VQP F;  5FJ4 C;  1X52 A;  1H7M A;  1NMU B;  3FFM A;  3LWP C;  3I56 F;  2AIF A;  4X3M A;  5A2Q M;  3LWQ C;  4BY9 D;  2LBX A;  1M90 H;  1KC8 H;  3NVI B;  2VGN A;  3CPQ A;  1QVF F;  3E1Y A;  5EWR A;  1XBI A;  3CC4 F;  2FC3 A;  3V7Q A;  2QEX F;  2OTJ F;  3N4Z A;  3G4S F;  5GIN C;  3RA5 A;  1YIT F;  1KD1 H;  3NK6 A;  1VQL F;  1JJ2 F;  1K9M H;  3CCS F;  1RLG A;  5GAN K;  3CCL F;  3CCJ F;  3OBY A;  4C4W C; 
#chains in the Genus database with same CATH topology
 1X25 A;  4O4H B;  4TV9 A;  1W2B F;  3IR9 A;  2QA4 F;  3F0E A;  3UT5 A;  1FFX B;  2EWC A;  3CC7 F;  1YGY A;  4I50 A;  4XCQ A;  5LA6 A;  3JAW A;  3HKB B;  3FD6 A;  4X1K B;  2QTP A;  1VK3 A;  1PXW A;  5CB4 B;  4YJ3 A;  2IG8 A;  1Z5V A;  4B45 A;  4C81 A;  5KX5 B;  5J2U A;  1YI2 F;  2GLZ A;  3RE3 A;  5GAP K;  1U40 A;  2I6D A;  1XRG A;  3NK7 A;  1VQM F;  1VQV A;  2ZOD A;  3F0D A;  3RYF A;  3VO8 A;  1Q7Y H;  2ALE A;  4O2B B;  3JAK A;  3J81 M;  2YYE A;  4O2A A;  3K12 A;  2CVL A;  1Z5W A;  4WBN B;  3CYQ A;  2OHW A;  1TVK A;  1KQS F;  5FNV B;  4O4L A;  2H8C A;  1ONI A;  1U43 A;  3E20 B;  4DXD A;  3QHD A;  3CME F;  5LP6 A;  4BT2 A;  4IHJ A;  2RHH A;  3RYI A;  4PWT A;  4EI9 A;  5JQG A;  3RYH B;  3CYP B;  3WGK A;  2ZVZ A;  5HY0 A;  4C8G A;  4O4I A;  5IJ9 B;  3LYB A;  2LBW A;  2P6Y A;  3ELC A;  2PHN A;  1VQO F;  2UYP A;  3UT5 B;  4R40 B;  1JN1 A;  3RA6 A;  5CA1 B;  1JFF A;  5CA0 B;  5LA6 B;  3JAS A;  5EB0 A;  4G88 A;  3ZOP A;  4BVS A;  3D00 A;  3LDT A;  3I55 F;  1IV2 A;  2UZH A;  3C9S A;  2L26 A;  3CCQ F;  2Z1U A;  2HS3 A;  2KG4 A;  1FFX A;  3JAL B;  1W5B A;  1ODE A;  3HKB A;  3BYQ A;  1NMU B;  4X1K A;  3LWP C;  3S0Y A;  1YQN A;  3LWQ C;  5JCO C;  4BY9 D;  4EB6 A;  5CB4 A;  1M90 H;  3MQW A;  2VAM A;  3E1Y A;  5EYP B;  3S06 A;  1R1M A;  5JVD B;  3V7Q A;  2F9Z C;  1YIT F;  3HWU A;  3NK6 A;  1RLG A;  3CCS F;  2LCA A;  1OAP A;  3CCL F;  3I3F A;  2IAF A;  2HP3 A;  2Z01 A;  5KMG B;  2HS0 A;  1YHQ F;  5LXT A;  2QI2 A;  4IHJ B;  4ZOL A;  5AVM A;  3KIZ A;  4O4I B;  3ZP7 A;  4TZZ A;  1VQ5 F;  3CMA F;  4WBN A;  5EZY A;  4DRX A;  5EO3 A;  3JAM M;  3VCZ A;  4YJ2 B;  5HP7 A;  5HY2 A;  1IPA A;  1JFF B;  4F6R B;  3WPW A;  3G71 F;  3JAS B;  5MN6 A;  4TUY B;  4X1Y A;  4BT4 A;  3VI6 A;  3EOR A;  1QD9 A;  2BTO A;  2DT4 A;  1W41 A;  3MDO A;  3MBM A;  4M8I A;  3HKC B;  5CA1 A;  5CA0 A;  1YJN F;  3JAT B;  3AGK A;  4NUT A;  1W5F A;  2RHO A;  1N8R H;  2IQQ A;  4RHA A;  1H47 A;  4BVQ A;  5DCV A;  2Z1F A;  3CPW F;  2HQS C;  4EB6 B;  2V9Y A;  3KJJ A;  3HAX D;  4BW0 B;  5ITZ A;  4ZK7 A;  1KNJ A;  4ZHY B;  5JCO A;  3JAL A;  4ZHQ B;  2CSL A;  3N2K B;  1W58 1;  3FPI A;  3P4E A;  2OZB A;  3SIV A;  5EIB D;  3VMF B;  3F6M A;  4G4W A;  5LXT B;  3HKD A;  4ZOL B;  3WGJ A;  5JH7 A;  1YJ9 F;  2RB9 A;  2DYY A;  1M1K H;  5EZY B;  5EYP A;  4DRX B;  2ZF8 A;  3FD5 A;  5EB1 B;  5JVD A;  3LWO C;  3OW2 F;  3M1X A;  3WGM A;  3WJP A;  2AMT A;  3V7E A;  5KMG A;  3MCQ A;  1VQ8 F;  3WXM B;  4X1Y B;  4E6E A;  3R0P A;  2RHJ A;  3TD5 A;  1VQ4 F;  4X20 A;  2BTQ B;  1VHA A;  4EI7 A;  4O4J B;  2OTL F;  5HY1 A;  4RQO A;  5FLX M;  5FJ4 C;  5HXU A;  3QUW A;  1H7M A;  3ESJ A;  3VOA A;  5IJ0 B;  2H8E A;  3D01 A;  4YJ2 A;  3I56 F;  2ZOV A;  5A2Q M;  1U3P A;  3M84 A;  2B33 A;  2RHL A;  4F6R A;  1KC8 H;  2YXZ A;  4TUY A;  1QU9 A;  2PMP A;  1OFU A;  2FC3 A;  3OON A;  2OTJ F;  4G4X A;  3RA5 A;  1NQ3 A;  2VAW A;  3T80 A;  2R6R 1;  4C8E A;  2W8B C;  3OBY A;  2Z1E A;  3C9R A;  1VH8 A;  4BVT A;  4C4W C;  3KJK A;  5ITZ B;  1U3L A;  5G4V C;  3E22 B;  4BT3 A;  3HKC A;  3D54 A;  5HXZ A;  2NMU A;  1RLU A;  3JAT A;  3IKF A;  2HRY A;  2Z1T A;  5LOV A;  4X1I B;  3HKD B;  3P10 A;  5JH7 B;  1VQ6 F;  2CW4 A;  3WJQ A;  2CWJ A;  3KHN A;  4U3J B;  2Q1X A;  3HTN A;  5B8F A;  5EIB C;  3C9U A;  4ZHQ A;  3N2K A;  5HP8 A;  2KGW A;  2HP0 B;  1IV1 A;  3CXC F;  1ZWZ A;  4X20 B;  3WJR A;  1W55 A;  4NQ3 A;  1VQN F;  3J7A R;  2H6L A;  3DC2 A;  3IMP A;  1IV3 A;  1GZ0 A;  2KTV A;  2BO1 A;  1DT9 A;  4G4Y A;  2G9I A;  1W3E X;  2CHT A;  1H48 A;  1QAH A;  2HX0 A;  4FFB B;  5LYJ B;  3N2G B;  1X7P A;  4B46 A;  4IIJ B;  1Q86 H;  4LNU A;  3N4Y A;  4EI8 A;  3K14 A;  4TV8 B;  4O4J A;  3LWR C;  3QTY A;  3S0H A;  3O85 A;  3TD4 A;  1RA4 A;  4C82 A;  4B5C A;  5IJ0 A;  1UFY A;  2WAL A;  2VGM A;  1COM A;  2UYK A;  1CLI A;  1VQK F;  5LOV B;  1TUB B;  2K1S A;  1YJW F;  1W40 A;  3VYS C;  4I4T A;  3MCA B;  1SDS A;  3V3T A;  3OBW A;  3LWV C;  2OTM A;  1W57 A;  2VAP A;  3F0F A;  3E22 A;  5BMV A;  3S02 A;  3FBA A;  3WGN A;  5IYZ B;  1T0A A;  3GYQ A;  2UYN B;  3VIU A;  3ZO8 A;  1FNK A;  2GVI A;  4C8I A;  4X3L A;  1S72 F;  1W5E A;  5HWE A;  2ZVY A;  4G4V A;  5J2T A;  2UYJ A;  3CB2 A;  1IV4 A;  4X1I A;  3FFM A;  5GON A;  1DBF A;  3ZP4 A;  1KNK A;  4NWO B;  3Q8H A;  5MN5 A;  4X3M A;  4BT6 A;  4U39 A;  4U3J A;  2LBX A;  4B62 A;  4BT7 A;  3HKE B;  4BVR A;  3NVI B;  3CPQ A;  2FGY A;  1QVF F;  4ZI7 A;  2CHS A;  1XBI A;  3CC4 F;  5GIN C;  1VQL F;  3LME A;  4I55 B;  3VYU C;  1K9M H;  3RYC B;  3CCJ F;  1UI9 A;  1JD1 A;  2HP0 A;  4LNU B;  3C8L A;  1YIJ F;  2GZL A;  3CG6 A;  1K73 H;  2JNB A;  3CCU F;  2MQE A;  4HNA B;  2R75 1;  3JVH A;  1PF5 A;  3VYT C;  4FFB A;  3CCV F;  2HRU A;  5LYJ A;  3N2G A;  1XV2 A;  4LCK A;  4IIJ A;  3GTZ A;  1Q82 H;  3S03 A;  3GHZ A;  4I4T B;  4TV8 A;  1CN7 A;  1VQ9 F;  2BTU A;  1W42 A;  5MN4 A;  5C8Y B;  1SA0 B;  2KTU A;  2VXY A;  1X7O A;  5BMV B;  4TV9 B;  3IKE A;  1GO0 A;  3K2X A;  3CCR F;  3LFO A;  3NMU C;  3CC2 F;  1K8A H;  1Q8R A;  4I50 B;  1TUB A;  3JAW B;  1XHO A;  5J2T B;  1VQ7 F;  5GON B;  3V4D A;  2ZAU A;  2CZW A;  3PAF A;  3ERN A;  5EAZ A;  3NVK E;  3J80 M;  1CK2 A;  5GIO C;  3G6E F;  3JAR A;  5IT9 M;  4G4Z A;  3L7Q A;  3PLA C;  4YJ3 B;  4ZI7 B;  4ERH A;  5J2U B;  4O4H A;  5IYZ A;  2N48 A;  1RQ2 A;  3WGL A;  2UYN A;  3ON1 A;  3CD6 F;  1SZQ A;  5G4U C;  3VTI C;  3RYF B;  1J7H A;  3F0G A;  3JAK B;  3HJW C;  2HS4 A;  3I7T A;  4O2A B;  3HKE A;  3CCM F;  3CCE F;  4ZHW A;  4ZHV A;  3M4S A;  5GIP C;  4KWE A;  3SIU A;  3IEW A;  5KX5 A;  2AIZ P;  4BT5 A;  3P0Z A;  1TVK B;  3DDN A;  3S0W A;  4I55 A;  1FNJ A;  3JCM M;  3RYC A;  2LBT A;  4O4L B;  1GX1 A;  1GO1 A;  5HY4 A;  1Q81 H;  1RQ7 A;  3WPX A;  3C9T A;  1T0K B;  4O2B A;  5LP6 B;  1E7K A;  5JQG B;  2HVY D;  3RYI B;  3K0T A;  3IEQ A;  3TD3 A;  1NJI H;  1W59 A;  2I6R A;  1QVG F;  1VQP F;  1X52 A;  2Q1Y A;  1W5A A;  3KE1 A;  3VOB A;  4HNA A;  3U0O A;  1FSZ A;  5LP6 C;  2AIF A;  5FNV A;  3B6N A;  2VGN A;  5EWR A;  2QEX F;  3N4Z A;  3G4S F;  3JAR B;  1KD1 H;  1JJ2 F;  3RYH A;  5GAN K;  5IJ9 A;  5C8Y A;  1SA0 A;  1JY8 A; 
#chains in the Genus database with same CATH homology
 1YHQ F;  5G4V C;  1W2B F;  2QI2 A;  3IR9 A;  1YIJ F;  2QA4 F;  3CG6 A;  5HXZ A;  3CC7 F;  1VQ5 F;  4TZZ A;  4XCQ A;  3CMA F;  1K73 H;  5EO3 A;  2JNB A;  3JAM M;  3CCU F;  5HY2 A;  1VQ6 F;  3CCV F;  1IPA A;  1PXW A;  4LCK A;  3G71 F;  1Q82 H;  1YI2 F;  2GLZ A;  3VI6 A;  5GAP K;  2I6D A;  3NK7 A;  1CN7 A;  1VQ9 F;  1VQM F;  1W42 A;  2KTU A;  1W41 A;  1Q7Y H;  2ALE A;  1X7O A;  3CXC F;  1GO0 A;  1ZWZ A;  3J81 M;  4NQ3 A;  1VQN F;  3CCR F;  3LFO A;  3J7A R;  3NMU C;  3CC2 F;  1K8A H;  1YJN F;  3AGK A;  4NUT A;  1GZ0 A;  2KTV A;  2OHW A;  2BO1 A;  1VQ7 F;  1DT9 A;  2CZW A;  3PAF A;  1N8R H;  3NVK E;  3J80 M;  1CK2 A;  1W3E X;  5GIO C;  4BVQ A;  3G6E F;  1KQS F;  5DCV A;  5IT9 M;  3CPW F;  3PLA C;  3HAX D;  1X7P A;  4BW0 B;  3E20 B;  1Q86 H;  3N4Y A;  3CME F;  4EI8 A;  4EI9 A;  3LWR C;  5HY0 A;  3O85 A;  3ON1 A;  3CD6 F;  2OZB A;  3SIV A;  5G4U C;  1RA4 A;  2LBW A;  3VMF B;  1VQO F;  1YJ9 F;  3HJW C;  2WAL A;  2VGM A;  1M1K H;  3RA6 A;  1VQK F;  3CCM F;  3CCE F;  5GIP C;  1YJW F;  3SIU A;  1W40 A;  1SDS A;  3MCA B;  3LWO C;  4BVS A;  3V3T A;  3JCM M;  3OW2 F;  3D00 A;  3OBW A;  3LWV C;  3I55 F;  1GO1 A;  5HY4 A;  3V7E A;  1Q81 H;  1VQ8 F;  3WXM B;  3CCQ F;  1T0K B;  1VQ4 F;  1E7K A;  2HVY D;  3GYQ A;  1NJI H;  2KG4 A;  4EI7 A;  2OTL F;  1QVG F;  5HY1 A;  4X3L A;  5FLX M;  1S72 F;  5HWE A;  1VQP F;  5FJ4 C;  1X52 A;  5HXU A;  1H7M A;  1NMU B;  3FFM A;  3LWP C;  3I56 F;  2AIF A;  4X3M A;  5A2Q M;  3LWQ C;  4BY9 D;  2LBX A;  4BVR A;  1M90 H;  1KC8 H;  3NVI B;  2VGN A;  3CPQ A;  2FGY A;  1QVF F;  3E1Y A;  5EWR A;  1XBI A;  3CC4 F;  2FC3 A;  3V7Q A;  2QEX F;  2F9Z C;  2OTJ F;  3N4Z A;  3G4S F;  5GIN C;  3RA5 A;  1YIT F;  1KD1 H;  3NK6 A;  1VQL F;  1JJ2 F;  1K9M H;  3CCS F;  1RLG A;  5GAN K;  3CCL F;  3CCJ F;  3OBY A;  4C4W C;  4BVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...