4BURA

Crystal structure of the reduced human apoptosis inducing factor complexed with nad
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
484
structure length
450
Chain Sequence
APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
publication title Structural Insights Into the Coenzyme Mediated Monomer-Dimer Transition of the Pro-Apoptotic Apoptosis Inducing Factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 136
structure length 450
sequence length 484
chains with identical sequence B, C, D
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4burA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4burA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4burA01
2X50A 3SFDA 1NHQA 4OPCA 1CJ2A 2YLWA 1XANA 3CPIG 4N9XA 3DJJA 3GYIA 1PXBA 1H6VA 1GEUA 1PJ6A 3BNMA 1LVLA 1DJNA 2GEWA 5BULA 4H4RA 2BABA 2GAHB 3IC9A 4NEWA 1PBEA 2YG3A 4AT2A 3AYJA 2BC1A 3QSEA 2QCUA 5GRTA 1B5QA 4NTDA 2X8CA 2YR4A 2WPCA 2VQBA 3NRNA 1FL2A 2C70A 3CNDA 4H4YA 4U8IA 4J31A 4ADWA 1F3PA 1B8SA 3AEFA 1FEBA 4U8MA 1AOGA 1O95A 3DGZA 3AYIA 4Z43A 1ZOVA 1KFYA 4B1BA 1ZOYA 5U63A 4Z44A 4IA5A 1H82A 1PBCA 3ALJA 3EANA 1NAAA 2Z5XA 4B65A 1QLBA 4EMWA 3NN0X 4OPDA 1CJ4A 4UDRA 4M52A 1H84A 3PS9A 4OPIA 1F6MA 3VRDB 2BACA 2BK3A 2Q6UA 3LADA 3CPJG 1FCDA 3CGDA 4AT0A 1RSGA 2X8GA 4KPRA 1NG3A 3UTHA 4J36A 3QFAA 2OALA 3B3RA 1H86A 2B7RA 2YVFA 1D4DA 1NENA 2ZZCA 3NTDA 4Z2TA 1S2YA 2BK5A 5J7XA 4K7ZA 2TPRA 4AOXA 1TDKA 1JNRA 3NGCX 2X99A 3E1TA 2R0CA 1IUUA 1GERA 1IJHA 1Y56A 3VRAA 2BA9A 2AR8A 2YM1A 3UOVA 2APGA 3ZDNA 4KX6A 3D1CA 3IHMA 1VDCA 2GV8A 2V61A 3C4NA 3KVEA 4C3YA 3AE3A 2YLZA 2XCGA 2XLRA 2XLSA 2BK4A 4XWZA 4EIQA 2YWLA 3UTFA 1EL8A 4A79A 3P4QA 3ITJA 1PBFA 4GF7A 4OPTA 4EMJA 2WDVA 3UTEA 3B6DA 2GAGB 1CL0A 3KU9A 3AD9B 3NTAA 2BS4A 2E1MA 3NLCA 3NYFA 4RSLA 3GD3A 4D04A 2BC0A 2ACZA 1NDAA 1K0IA 1IUSA 3AWIA 3GSIA 4B64A 5HXIA 4A99A 1H81A 4LIIA 1DOCA 3AEDA 2FBWA 2XDOA 2XVFA 3CNSA 4ZCDA 4B66A 2FJEA 5M10A 2IVDA 4BK3A 3KKJA 2JK6A 1ZDLA 2GR1A 3NN6X 5EB4A 4H4VA 3P9UA 4B69A 1EBDA 2WOWA 1B4VA 2R4JA 2GRTA 1VRQB 1YKJA 1YQ4A 3I3LA 4IV9A 1CC2A 2HQMA 2YR5A 3PO7A 3URHA 4LA1A 1BF3A 3ATQA 4YTMA 1PXAA 3VRBA 5HYMA 1E39A 2JB1A 2BS3A 3JSKA 1PS9A 4XWRA 1DOEA 4J2WA 1MOKA 4UDQA 4GRTA 1SEZA 5C2TA 4JDRA 4U8LA 4C74A 3NYEA 1TDEA 3DK8A 2V60A 2WBAA 3G5QA 3LOVA 1GOSA 3AEBA 2R0GA 5FS6A 3AYLA 3CTYA 3KPFA 1GSNA 2GMHA 3BHFA 4ICYA 1Q9IA 1Y0PA 3LXDA 3DJDA 3K7MX 4C3XA 1N4WA 3NIXA 4H4UA 4WX1A 3AEEA 3DH9A 4U8NA 4JN9A 3CN8A 3GWDA 1OJDA 4BURA 3CNJA 5BUKA 1NEKA 2YG4A 4TM0A 4AP3A 1D7YA 2Q7VA 2VVLA 5KVHA 1JRYA 2WU5A 1IUWA 4EIPA 1KNRA 4USQA 3AE2A 2GF3A 3I6DA 3LJPA 1P2EA 2A8XA 3M0OA 3UCLA 4BJZA 5EB5A 3CNTA 2C66A 4U8JA 1E1MA 4YTPA 3DK4A 3K7QX 2OLOA 4YSHA 3AD8B 1ZMDA 4I58A 2JAEA 1DJQA 3QVPA 2F5ZA 2XLTA 1L9EA 2FJAA 1KSSA 2WDQA 2H89A 3NNEA 2XFPA 2NVKX 3ALMA 4NTCA 1NHPA 2B9WA 3BNUA 4NTEA 3Q9TA 3EF6A 1BGNA 3GWFA 4J33A 4EM3A 1CF3A 2FJDA 3UKLA 4DSGA 4EQWA 1MO9A 4GR1A 3P4PA 3D8XA 1E1NA 3UTGA 1JRZA 2RGOA 3EAOA 2YQUA 4FDCB 3QVRA 4PABA 4XXGA 1PDHA 3M13A 2EQ6A 5KOWA 3SGLA 1GRBA 4NEVA 3C4AA 1E7PA 4J57A 3M12A 4X9NA 2X8HA 1L0VA 1TDFA 1D7LA 4H4XA 3CGEA 1S2QA 4OPLA 4YKGA 4YXDA 3GRTA 3FMWA 1IUTA 2J3NA 2C76A 2OAMA 2C75A 2PYXA 1QO8A 4U8KA 3SFEA 4RG4A 2B9XA 4CNKA 3UKHA 1MXTA 2WPEA 1CC6A 2VZ2A 1LJ1A 2BS2A 1PHHA 4J34A 2Q0KA 4TLZA 4X4JA 4PAAA 3AE8A 1NPXA 2JBVA 1XPQA 1GRHA 4YSYA 4Z2UA 2QA2A 1KDGA 2C64A 1TYTA 1CJCA 2I0ZA 4K5SA 3RHAA 3GDPA 1ONFA 1PJ7A 2WOIA 5FS9A 4LU6A 3LZWA 4AP1A 5HY5A 3CNPA 3KD9A 4U2LA 2VOUA 1CJ3A 5HHFA 4K8DA 3V3OA 2YLXA 3ZYXA 3QJ4A 3H4KA 3QSMA 4B68A 2E5VA 3F8PA 4O5UA 2XVJA 1PBBA 3QSSA 1S3EA 1H83A 2BXSA 4A6NB 2BCGG 2O9ZA 2YM2A 3NT6A 3COXA 4H4SA 3UOZA 2Q0LA 4IA6A 2V6OA 2CFYA 3VR9A 4DSHA 3SQPA 3DA1A 2CDUA 2B76A 3SM8A 2E4GA 3T37A 4BJYA 4CNJA 5J60A 1P2HA 1EL5A 2R45A 1IUVA 4CCRA 4K22A 2Z5YA 1H7XA 4BK2A 1CBOA 2EQ7A 2V5ZA 1FOHA 5ER0A 5CQFA 2CVJA 1VQWA 2R0PA 4YKFA 2C3DA 2JB2A 3P1WA 2YVJA 4J56A 4Y4LA 3IHGA 4TM1A 1H7WA 2XFUA 4C5OA 2WDRA 3AE5A 4EQXA 3ATRA 1D4EA 3BI5A 3KA7A 4D03A 4EQRA 3GMBA 3PVCA 1Q1WA 2GR2A 1LTXR 4B63A 3H8LA 4K2XA 2VVMA 3S5WA 4H4ZA 2YLTA 4GDEA 3FIMB 4C77A 2WESA 1ELIA 4TLXA 2GR3A 5KRQA 2W0HA 4OPUA 4JNQA 4EQSA 1E1LA 4DNAA 3NHOX 3ICSA 3RP7A 5U25A 1ZP0A 2WHDA 2WOVA 3P4RA 2VRMA 1O5WA 4FK1C 4GUVA 4E0VA 1M64A 2FJBA 1GXFA 1YQZA 3DJGX 4YWOA 2ZZ0A 2C7GA 3AEGA 3GDNA 4IVOB 4Z26A 5JCLA 5JCNA 5KVIA 2AQJA 4ECHA 2VQ7A 2DKHA 2YG6A 1GRTA 2C72A 2GQWA 4P9SA 3K7TA 4YSZA 4TM4A 1GRGA 5KWFA 5FMHA 1K0JA 3AB1A 4HA6A 1RYIA 4H50A 2R46A 1LV0A 1D4CA 2IVEA 2UZZA 1GNDA 4JQ9A 1VG9A 3CGBA 1PJ5A 1DOBA 2YLRA 2YAUA 1X31B 4UP3A 4Z24A 1COYA 1ZKQA 3UKQA 3UP5A 3VR8A 3BHKA 2ARDA 2JKCA 1GRAA 2R9ZA 1FECA 2C3CA 2GB0A 2GMJA 4CBQA 2RGHA 3L8KA 4YSXA 1E6EA 2WP5A 2WU2A 3DMEA 5M0ZA 3C96A 4A9WA 4Z25A 4OPGA 2WQYA 3DK9A 3NK2X 1K0LA 2XVEA 4H2RA 1Y56B 3L1RA 1GREA 4NZHA 2XVIA 1FEAA 2A87A 4Y4MA 2WS3A 1BGJA 4B67A 4O5QA 1JOAA 5CKUA 1ZX9A 2R4EA 4RG3A 1F8WA 4GDPA 2XFQA 2Y6RA 2RGJA 2GR0A 2YLSA 2XYOA 3UKAA 1JRXA 2JB3A 4YT0A 2GVCA 2XLUA 1REOA 2XFNA 4X9MA 3UOXA 4U8OA 1TDNA 2IIDA 2X3NA 1D5TA 4GCMA 1RP0A 4FX9A 3ABVA 4Y4NA 1F8SA 1Z6LA 3ICRA 4BV6A 5JCKA 1S3BA 1E1KA 4CCQA 3AEAA 3UOYA 4A65A 4HB9A 1GT8A 3GD4A 1CC4A 1W4XA 1JNZA 4I59A 3GRSA 1KF6A 3AE7A 2NPXA 3O0HA 1GETA 4OCGA 4Z2RA 2GH5A 1TYPA 3G5RA 3H8IA 1BZLA 4H4PA 1ZMCA 2BCPA 1TDOA 2QA1A 2V3BA 2VRLA 4JY2A 1QJDA 3OC4A 1N1PA 1N4UA 2YR6A 4UDPA 3LZXA 3IWAA 3UKPA 1GV4A 3CGCA 2PHHA 2XFOA 5U1OA 1JU2A 1O94A 3K30A 5IPYA 3BI2A 2C67A 5BVAA 1NHSA 3R9UA 1V59A 5FS7A 3RP6A 1BKWA 3G5SA 1YQ3A 3DJEA 1GTHA 5IQ1A 1PXCA 3CPHG 5GSNA 2CULA 3AE6A 2ZBWA 3UKFA 1KSUA 2WEUA 1YY5A 4U2TA 4A7AA 3FBSA 3EPTA 1B37A 2A89A 4MJWA 3NYCA 1DXLA 2WP9A 2C65A 1UKVG 3CIRA 4TM3A 3NG7X 2B7SA 1OJCA 2C73A 3WE0A 4ZN0A 2EQ8A 2B9YA 1JEHA 2OLNA 3AE9A 3Q6JA 1NG4A 3GYJA 5DBJA 3NKSA 2YG5A 3UKKA 2ZZBA 3QFBA 4EM4A 2TMDA 1OJTA 3GMCA 3ISHA 4WCTA 3REDA 2WETA 1F8RA 1DODA 3HZLA 4H7UA 2BXRA 4JNAA 1L9CA 5TR3A 3FPZA 1L9DA 2WPFA 2DKIA 3AD7B 1GRFA 4CY6A 1ZK7A 4AOSA 2EQ9A 4FK1A 4U2SA 1LQTA 3AE1A 2XLPA 3ADAB 4BK1A 3NK0X 3V76A 4CY8A 4YTNA 1GESA 1PBDA 5EOWA 4OVIA 4U8PA 1XDIA 4H4WA 5FS8A 3NK1X 4USRA 1KNPA 2V3AA 4H4TA 3F8RA 3P4SA 1NHRA 1IUXA 1CHUA 4JY3A 4ZCCA 3LB8A 1GALA 1VG0A 3RNMA 4A6NA 3KLJA 1OJAA 2OA1A 3NH3X 5C3JA 4H4QA 4REKA 5EBKA 1GPEA 3IF9A 4H2NA 3FG2P 5JCMA 3S61A 4A5LA 3AECA 1TRBA 3AE4A 1N4VA 1PN0A 5KXJA 3ALLA 4DGKA 1EL9A 3ICTA 2QAEA 5BRTA 5IQ4A 1GTEA 1K4QA 3BI4A 2YVGA 2YG7A 4IVMB 1LQUA 3UP4A 5L46A 4EMIA 2GQFA 3II4A 1BWCA 3AXBA 3RP8A 3VQRA 1HYUA 2WP6A 3F8DA 4APNA 2AAQA 1ZY8A 1LPFA 1OJ9A 4K5RA 1Q1RA 5JCIA 1M6IA 1XHCA 1EL7A 5KOXA 1DNCA 4H2QA 3OZ2A 4H2PA 4CRTA 2RABA 2Y6QA 2VVLG 2XVHA 2H88A 3V3NA 5LV9A 2BYBA 3DGHA
chains in the Genus database with same CATH superfamily
4OPCA 3CPIG 3TQPA 3DJJA 4K1WA 1DJNA 4H4RA 3VCNA 2GAHB 3IC9A 4AT2A 1P48A 3CAWA 3CMMA 1B5QA 3UJ2A 2X8CA 4HNLA 1FL2A 3CNDA 3MKCA 3AEFA 1AOGA 3R10A 4Z44A 2PCEA 1H82A 3EANA 2Z5XA 1QLBA 4EMWA 1F6MA 2Q6UA 3V3WA 4AT0A 3Q4DA 3UTHA 1NG3A 1H86A 3RRAA 2YVFA 2ZZCA 4ROPA 2R0CA 1IUUA 2P8BA 2YM1A 3UOVA 4G7FA 2GV8A 2V61A 3C4NA 2YLZA 2P0IA 4EWJA 4XWZA 2YWLA 4ZCWA 3DG3A 1W6TA 4EMJA 3UTEA 1CL0A 3NLCA 3GD3A 2ACZA 1IUSA 2C4CA 3HRDC 3HYVA 3AEDA 1EBHA 3NN6X 3PWIA 2WOWA 4IV9A 1B4VA 1YKJA 1VRQB 1WUEA 1CC2A 4LA1A 3ATQA 3VRBA 5HYMA 2JB1A 3V5FA 2BS3A 4II3A 2QQ6A 4J1OA 1ONEA 4HYRA 3RCYA 1MOKA 3T31A 1SEZA 3P3BA 2CHRA 1TDEA 3DK8A 2V60A 2WBAA 1P43A 1GOSA 2R0GA 3AYLA 3CTYA 3ENLA 2BRAA 3A7UA 1Q9IA 3N4FA 2W3SA 3NIXA 4WX1A 4GIRA 4U8NA 4JN9A 1OJDA 4MMWA 2YG4A 2WU5A 2PTYA 4USQA 2A8XA 4F4RA 5EB5A 1VQZA 1SJAA 1F9CA 2JAEA 1N63C 1FO4A 4NTCA 3ES8A 3IJLA 3UKLA 2FJDA 4GR1A 5KNLA 1FFVC 3B97A 3SZCA 4PABA 2EQ6A 2XH4A 5KOWA 3C4AA 1MRAA 3SSZA 4J57A 3THUA 1S2QA 4YKGA 4OPLA 2NQLA 3GRTA 2OAMA 2C75A 1QO8A 4U8KA 4CNKA 2WPEA 2VZ2A 4J34A 4X4JA 3AE8A 1NPXA 1XPQA 2C64A 3RHAA 3VCCA 3CXOA 1PJ7A 3LZWA 2VOUA 4K8DA 2PSNA 4O5UA 1PBBA 1H83A 3NT6A 4YWSA 3COXA 1YEYA 4E4FA 1P2HA 3NVZB 1EL5A 3QKEA 4CCRA 4NWZA 2Z5YA 2V5ZA 5CQFA 2CVJA 1VQWA 4Y4LA 4II2A 4EQXA 3H8LA 3PK7A 4JN8A 4JNQA 4DNAA 3NRZB 3ICSA 2WHDA 3P4RA 3Q45A 1WUFA 1YQZA 5JCLA 2AQJA 3B9JB 6ENLA 4P9SA 2OVLA 4TM4A 5FMHA 3AB1A 2PODA 1D4CA 2UZZA 3FXGA 1VG9A 1PJ5A 4K2SA 1COYA 2GL5A 1GRAA 1H2IA 2GMJA 4YSXA 1E6EA 5M0ZA 4Z25A 4OPGA 2WQYA 1K0LA 2XVEA 3L1RA 1BGJA 1ZX9A 2R4EA 1F8WA 2PTXA 3UKAA 3UOXA 1PDZA 1REOA 2XFNA 4H2HA 2OKTA 2IIDA 1N5WC 2X3NA 3TWAA 3ABVA 2GGHA 3TWBA 1E1KA 3SZWA 3GD4A 1CC4A 2HNEA 1JNZA 3NZGA 1KKRA 4Z2RA 2GH5A 3UXKA 1MDRA 2VRLA 3ZVIA 5IPYA 3OP2A 5FS7A 3OZYA 5IQ1A 2CULA 3UKFA 3CT2A 1B37A 1MDLA 2C65A 3UJFA 2C73A 3AE9A 3Q6JA 3NKSA 3UKKA 2WETA 4DYEA 2BXRA 4JNAA 3FJ4A 4HCDA 2GSHA 1L9CA 1L9DA 2WPFA 4CY6A 1ZK7A 4AOSA 1RM6B 3SBFA 4CY8A 4H4WA 4GGBA 3F8RA 3P4SA 4JY3A 1VG0A 3NH3X 2OA1A 4GAVA 4REKA 5EBKA 1GPEA 3IF9A 3AE4A 1PDYA 4ZA0A 1GTEA 1K4QA 3TW9A 1IYXA 1BWCA 3AXBA 3F8DA 5KMQA 1Q1RA 4H2QA 3OZ2A 4CRTA 2VVLG 3V3NA 2H88A 3DGHA 4N9XA 3GYIA 1H6VA 1PJ6A 3QTPA 2GEWA 2BABA 1PBEA 4DWDA 2BC1A 3FYYA 3QSEA 2QCUA 5GRTA 2YR4A 2VQBA 4U8IA 4J31A 3DG7A 4ADWA 1F3PA 4U8MA 1ZOVA 3ALJA 4B65A 3ES7A 4OPDA 3V5CA 4UDRA 3VRDB 2BACA 2BK3A 3LADA 3CPJG 2PP1A 4KPRA 3QFAA 2OALA 4H83A 2B7RA 3MUCA 1D4DA 5J7XA 2PMQA 1JNRA 2X99A 1GERA 1Y56A 3VRAA 2BA9A 3ZDNA 4KX6A 5IDZA 3IHMA 1VDCA 4C3YA 3KVEA 3AE3A 2XLSA 3ITJA 1PBFA 5JRBA 2WDVA 2GAGB 3AD9B 2HZGA 1NDAA 3NVVB 4A99A 4LIIA 1DOCA 2FBWA 2XVFA 2FJEA 4BK3A 3EUB3 2JK6A 2GR1A 3I3LA 4JN7A 3IJIA 4YTMA 1NELA 4HN8A 3JSKA 1DOEA 4J2WA 4GRTA 5C2TA 4U8LA 3HPFA 3N6JA 3AEBA 5KMRA 3SXIA 4Z17A 3H8AA 4ICYA 1JDFA 3LXDA 1Y0PA 3K7MX 1N4WA 4H4UA 3DH9A 3UXLA 3GWDA 3TOYA 3H12A 5BUKA 1NEKA 3R25A 1D7YA 2Q7VA 2VVLA 5KVHA 3MY9A 4HNCA 1JRYA 3AE2A 3KPKA 3UCLA 4BJZA 3UCDA 3K7QX 2OLOA 3RO6A 4I58A 1DJQA 3QVPA 2XFPA 1NHPA 2B9WA 2QDEA 4MGGA 7ENLA 4EM3A 2GGIA 3D8XA 1E1NA 2RGOA 2YQUA 3QVRA 3M13A 1BQGA 4HCLA 1D7LA 4H4XA 3CGEA 4YXDA 3FMWA 2GGEA 2J3NA 4GGHA 1IUTA 4PAAA 4YSYA 4ZOHB 2ZADA 1KDGA 2I0ZA 1CJCA 4K5SA 3GDPA 5HY5A 3CNPA 1CJ3A 3QJ4A 3QLDA 2AKMA 2BXSA 2Q0LA 4GYPA 3VR9A 3A7RA 4CNJA 3RITA 3ZLHA 1H7XA 4BK2A 2EQ7A 2OZ3A 4YKFA 2YVJA 4ENLA 2E5AA 4C5OA 2WDRA 3AE5A 1D4EA 4EQRA 3GMBA 2PGEA 4B63A 2VVMA 3FIMB 2WESA 2GR3A 5KRQA 3EEZA 1E1LA 3S47A 3NHOX 3UJEA 1XS2A 4GUVA 3NVYB 3DJGX 2ZC8A 2C7GA 5JCNA 5KVIA 5FJTA 2DKHA 2YG6A 2C72A 3SYIA 1TE6A 3K7TA 1JCTA 3L5OA 4HA6A 1RYIA 4H50A 3CGBA 2YAUA 1ZKQA 5EU9A 1FECA 2C3CA 3L8KA 1EC8A 1R0MA 2WU2A 4A9WA 3DK9A 3R11A 3SN1A 1Y56B 3SZFA 2XVIA 2A87A 3UGVA 1JOAA 2XFQA 2Y6RA 2RGJA 5FJOA 2GR0A 3T14A 2YLSA 2XYOA 3U4FA 1BKHA 2JB3A 3DGBA 4IP4A 4Y4NA 1F8SA 4BV6A 2OQHA 4CCQA 3NO1A 3ZLFA 4HB9A 3GRSA 3JW7A 3O0HA 1GETA 3G5RA 2XH2A 1TDOA 1ZMCA 3OC4A 1N4UA 4UDPA 3IWAA 2DW7A 2PHHA 3BI2A 3TTEA 2C67A 1NHSA 3MWCA 3DJEA 3DFHA 1PXCA 3FVDA 5GSNA 4A7AA 2ZBWA 4KEMA 1DXLA 3VDGA 4TM3A 1OJCA 3WE0A 2PU0A 3TCSA 4IZGA 5BOEA 1DODA 2DKIA 3AD7B 3DERA 2EQ9A 5BOFA 1GESA 1PBDA 4IP5A 3I6EA 1GALA 4A6NA 5C3JA 4A5LA 1TRBA 1PN0A 3ALLA 4DGKA 1EL9A 2PTWA 3ICTA 5KMSA 5BRTA 5IQ4A 4GISA 2YVGA 2YG7A 1LQUA 5L46A 2GQFA 4K5RA 2MUCA 2P8CA 5JCIA 1M6IA 4H2PA 2PP0A 2X50A 1NHQA 1CJ2A 1FHVA 4IHCA 1XANA 1PXBA 1LVLA 2PA6A 5BULA 4A6GA 3AYJA 3R1ZA 3CK5A 1N62C 3UJRA 1B8SA 1FEBA 1O95A 3DGZA 1N60C 4Z43A 1ZOYA 5U63A 1NAAA 3SQSA 3TJ4A 3NN0X 4M52A 1H84A 3PS9A 2PU1A 1FCDA 2X8GA 4J36A 3B3RA 4Z2TA 2BK5A 4K7ZA 2TPRA 4FP1A 3NGCX 1IJHA 2AR8A 3H7VA 3D1CA 3DG6A 4G74A 3EKGA 4KPLA 3UTFA 1EL8A 2QDDA 4OPTA 3B6DA 2QJJA 3ETRB 3KU9A 3NTAA 2E1MA 4RSLA 3NYFA 2BC0A 3AWIA 3GSIA 4B64A 4B66A 5M10A 3GC2A 4B69A 3P9UA 1EBDA 2HQMA 3PO7A 3URHA 1BF3A 1PXAA 1E39A 3U9IA 4DX3A 4UDQA 4JDRA 3AN1A 2OZTA 4C74A 5G5HB 3NYEA 3PG6A 5FS6A 4G6HA 5ENLA 3KPFA 1GSNA 2GMHA 4J3ZA 3RR1A 3BHFA 2HXTA 4K8GA 4HCHA 3AEEA 3P0WA 3CN8A 4BURA 3MQTA 2QJNA 2OX4A 3SZ0A 1IUWA 1KNRA 3DEQA 3NXLA 2GF3A 3LJPA 4JHMA 3M0OA 1E1MA 2PPGA 3DK4A 1ZMDA 2F5ZA 2XLTA 1X2GA 2FJAA 2H89A 2GGGA 2NVKX 1XPYA 3BNUA 3EF6A 1BGNA 3SN0A 4M0XA 3H70A 2XGZA 1MO9A 3P4PA 3UTGA 3ZVHA 3EAOA 4FDCB 4XXGA 1GRBA 1E7PA 4X9NA 3M12A 3CYJA 1TDFA 3D9XA 3N4EA 1MUCA 3SFEA 2PYXA 1ZXIC 2B9XA 2PGWA 1MXTA 1LJ1A 3VFCA 2JBVA 2QA2A 1TYTA 2WOIA 4LU6A 4NNJA 4U2LA 3VC5A 1FHUA 3V3OA 1MNSA 1EC9A 2E5VA 2XVJA 3QSSA 1S3EA 4A6NB 2BCGG 2YM2A 4H4SA 3UOZA 4IA6A 2V6OA 2CFYA 4DSHA 3SQPA 3DA1A 2O56A 2B76A 3SM8A 5J04A 1SJDA 3T4WA 1IUVA 4E4UA 1X2HA 4K22A 3GY1A 1FOHA 2R0PA 2C3DA 2JB2A 4J56A 2QVHA 4TM1A 1H7WA 3ATRA 3BI5A 3KA7A 1LTXR 4K2XA 3VA8A 4H4ZA 3S5WA 2YLTA 4C77A 4EQSA 3OTRA 3RP7A 2WOVA 3GD6A 1O5WA 4E0VA 1GXFA 3GDNA 4IVOB 4Z26A 4G9KA 4GFIA 4ECHA 4G6GA 3STPA 1T3QC 2GQWA 2W55A 4YSZA 5KWFA 3PFRA 2R46A 1LV0A 1GNDA 4JQ9A 1X31B 4Z24A 3BHKA 1STZA 3NFUA 1KKOA 2GB0A 4CBQA 2RGHA 2WP5A 4G8TA 3DMEA 3C96A 4IL2A 3NK2X 4H2RA 4NZHA 1GREA 3GYXA 4Y4MA 3FV9A 4B67A 3BJSA 5CKUA 2AL2A 4RG3A 4GDPA 2ONEA 1JRXA 2P88A 4X9MA 2XLUA 2OLAA 4U8OA 3SR6B 3T8QA 4GCMA 4FX9A 3ICRA 5JCKA 1S3BA 3UOYA 1W4XA 4A35A 2NPXA 1TYPA 2V3BA 2QA1A 4JY2A 1N1PA 5FJPA 3LZXA 2XFOA 5U1OA 3K30A 3CXBA 1L8PA 3RP6A 4E6MA 1YQ3A 3CPHG 1YY5A 3VC6A 3EPTA 4MJWA 3NYCA 1EBGA 3CIRA 2W54A 1NG4A 2YG5A 2HXUA 2ZZBA 2TMDA 3ISHA 4WCTA 3REDA 1F8RA 3T2YA 4H7UA 5TR3A 1ELSA 2FYMA 1R6WA 4FK1A 1LQTA 3AE1A 3DESA 2XLPA 4BK1A 3D47A 3NK0X 4YTNA 2OG9A 4TVYA 4OVIA 4U8PA 4USRA 3GO2A 1ECQA 4H4TA 1NHRA 1CHUA 4DHGA 3LB8A 3KLJA 1OJAA 4H2NA 3FG2P 5JCMA 1N4VA 5KXJA 4TVWA 1V97A 4IVMB 3UP4A 3JZUA 4KT2A 1HYUA 2AAQA 1LPFA 2PTZA 2PP3A 3ZVHB 5KOXA 1EL7A 2OO6A 3R0KA 4H1ZA 2Y6QA 1DTNA 2POZA 3SFDA 2YLWA 3HYWA 1GEUA 3BNMA 3D46A 1NU5A 4NEWA 2YG3A 3AM9A 4NTDA 2WPCA 3NRNA 2C70A 4H4YA 3AYIA 1KFYA 4B1BA 4IA5A 1PBCA 4G73A 1WYGA 1CJ4A 4OPIA 4FI4A 1OEPA 3CGDA 1RSGA 3TJIA 1NENA 4E8GA 3NTDA 1S2YA 4AOXA 3IJQA 1TDKA 3E1TA 3OPSA 2APGA 3JVAA 3ZLGA 2XCGA 2XLRA 1EC7A 2BK4A 4EIQA 1TZZA 1FFUC 4A79A 3P4QA 4IT1A 2W3RA 4GF7A 2GDQA 3S5SA 2BS4A 4D04A 3SN4A 1K0IA 5HXIA 4GAPA 4Z1YA 1H81A 2OZ8A 4ZCDA 3CNSA 2XDOA 2IVDA 2GGJA 3KKJA 1ZDLA 3MSYA 3NS1B 4H4VA 5EB4A 2R4JA 5HHFA 2GRTA 1YQ4A 1SB3B 2YR5A 5G5GB 2PS2A 1PS9A 4XWRA 2XH0A 3DDMA 3FCPA 3LOVA 3G5QA 2XH7A 2FKPA 2AL2B 3DJDA 4C3XA 3DIPA 3CNJA 1KD0A 4TM0A 4AP3A 3HW2A 4EIPA 3I6DA 1P2EA 3CNTA 2C66A 4U8JA 3UJSA 4YTPA 4YSHA 3AD8B 5KMPA 1L9EA 2MNRA 1KSSA 4X2PA 2WDQA 3NNEA 4M6UA 3ALMA 4NTEA 3Q9TA 3GWFA 4J33A 1CF3A 4DSGA 4EQWA 2P3ZA 1JRZA 1PDHA 3SGLA 4NEVA 2X8HA 1L0VA 4HPNA 2C76A 4RG4A 3UKHA 1CC6A 2BS2A 1PHHA 3R0UA 3SX6A 2Q0KA 4TLZA 1E9IA 1SJCA 1GRHA 3T6CA 4Z2UA 3UCCA 1ONFA 5FS9A 4AP1A 2I5QA 3KD9A 2YLXA 3ZYXA 3H4KA 3QSMA 4B68A 3F8PA 1S7MA 2O9ZA 3IK4A 4MKSA 2CDUA 3T37A 2E4GA 4BJYA 5J60A 2R45A 3RGTA 4GYPC 1CBOA 3BOXA 5ER0A 3R07C 3P1WA 1N5XA 1KCZA 2AL1A 3IHGA 3DFYA 2XFUA 4D03A 3PVCA 1TKKA 1Q1WA 2GR2A 1N61C 3QN3A 4GDEA 4TLXA 1ELIA 2W0HA 4OPUA 5U25A 1ZP0A 2VRMA 4FK1C 2QGYA 4A3RA 3I6TA 1M64A 2FJBA 3PWGA 4YWOA 3AEGA 2ZZ0A 5FJRA 4DXKA 4DN1A 2VQ7A 2OPJA 1GRTA 1GRGA 1K0JA 2RDXA 3K1GA 2IVEA 4UP3A 1DOBA 2YLRA 3VR8A 3UKQA 3UP5A 2ARDA 2JKCA 2R9ZA 2E3TA 3T2ZA 1FEAA 3SJNA 2WS3A 4O5QA 2XSXA 3A7AA 4GMEA 4YT0A 2GVCA 3BSMA 1TDNA 1RVKA 1D5TA 1RP0A 1Z6LA 1FIQB 3AEAA 4A65A 1GT8A 3P93A 4I59A 1KF6A 3AE7A 4OCGA 2AKZA 3H8IA 1BZLA 4H4PA 2BCPA 1QJDA 2YR6A 3UKPA 1GV4A 3CB3A 3CGCA 2QJMA 1JU2A 1O94A 3T0KA 5BVAA 3R9UA 5FJUA 3V4BA 1V59A 3N6HA 1BKWA 3G5SA 1GTHA 3AE6A 1KSUA 2WEUA 4U2TA 1SJBA 3FBSA 4KWSA 2A89A 2WP9A 3NVWB 1UKVG 3NG7X 2B7SA 4ZN0A 2EQ8A 2B9YA 1JEHA 2OLNA 5DBJA 3GYJA 3QFBA 4EM4A 3GMCA 1OJTA 1JRPA 3QPEA 3HZLA 3OW1A 1JROA 3FPZA 2BRYA 3KUMA 1GRFA 4U2SA 4H19A 3ADAB 3V76A 3T9PA 1VDVA 5EOWA 1XDIA 5FS8A 3NK1X 2V3AA 1KNPA 4ZCCA 1IUXA 4E5TA 3RNMA 4IL0A 4H4QA 3S61A 2OQYA 3I4KA 3AECA 2DW6A 1KN0A 1JPMA 2QAEA 3HYXA 3BI4A 1JPDX 4EMIA 3II4A 3RP8A 3VQRA 2WP6A 3AMZA 4APNA 3T2KA 1ZY8A 1OJ9A 3OZMA 2OFJA 1XHCA 3MZNA 1DNCA 2RABA 3SY4A 2XVHA 5LV9A 2BYBA
chains in the Genus database with same CATH topology
2X50A 3SFDA 1NHQA 4OPCA 1CJ2A 2YLWA 1XANA 3HYWA 3CPIG 4N9XA 3DJJA 3GYIA 1PXBA 1H6VA 1GEUA 1PJ6A 3BNMA 1LVLA 1DJNA 2GEWA 5BULA 4H4RA 2BABA 2GAHB 3IC9A 4NEWA 1PBEA 2YG3A 4AT2A 3AYJA 2BC1A 3CMMA 3QSEA 2QCUA 5GRTA 1B5QA 4NTDA 2X8CA 2YR4A 2WPCA 2VQBA 3NRNA 1FL2A 2C70A 3CNDA 4H4YA 4U8IA 4J31A 4ADWA 1F3PA 1B8SA 3AEFA 1FEBA 4U8MA 1AOGA 1O95A 3DGZA 3AYIA 4Z43A 1ZOVA 1KFYA 4B1BA 1ZOYA 5U63A 4Z44A 4IA5A 1H82A 1PBCA 3ALJA 3EANA 1NAAA 2Z5XA 4B65A 4G73A 1QLBA 4EMWA 3NN0X 4OPDA 1CJ4A 4UDRA 4M52A 1H84A 3PS9A 4OPIA 1F6MA 3VRDB 2BACA 2BK3A 2Q6UA 3LADA 3CPJG 1FCDA 3CGDA 4AT0A 1RSGA 2X8GA 4KPRA 1NG3A 3UTHA 4J36A 3QFAA 2OALA 3B3RA 1H86A 2B7RA 2YVFA 1D4DA 1NENA 2ZZCA 3NTDA 4Z2TA 1S2YA 2BK5A 5J7XA 4K7ZA 2TPRA 4AOXA 1TDKA 1JNRA 3NGCX 2X99A 3E1TA 2R0CA 1IUUA 1GERA 1IJHA 1Y56A 3VRAA 2BA9A 2AR8A 2YM1A 3UOVA 2APGA 3ZDNA 4KX6A 3D1CA 3IHMA 1VDCA 2GV8A 2V61A 3C4NA 3KVEA 4G74A 4C3YA 3AE3A 2YLZA 2XCGA 2XLRA 2XLSA 2BK4A 4XWZA 4EIQA 2YWLA 3UTFA 1EL8A 4A79A 3P4QA 3ITJA 1PBFA 5JRBA 4GF7A 4OPTA 4EMJA 2WDVA 3UTEA 3B6DA 2GAGB 1CL0A 3KU9A 3AD9B 3NTAA 2BS4A 2E1MA 3NLCA 3NYFA 4RSLA 3GD3A 4D04A 2BC0A 2ACZA 1NDAA 1K0IA 1IUSA 2C4CA 3AWIA 3GSIA 4B64A 3HYVA 5HXIA 4GAPA 4A99A 1H81A 4LIIA 1DOCA 3AEDA 2FBWA 2XDOA 2XVFA 3CNSA 4ZCDA 4B66A 2FJEA 5M10A 2IVDA 4BK3A 3KKJA 2JK6A 1ZDLA 2GR1A 3NN6X 5EB4A 4H4VA 3P9UA 4B69A 1EBDA 2WOWA 1B4VA 2R4JA 2GRTA 1VRQB 1YKJA 1YQ4A 3I3LA 4IV9A 1CC2A 2HQMA 2YR5A 3PO7A 3URHA 4LA1A 1BF3A 3ATQA 4YTMA 1PXAA 3VRBA 5HYMA 1E39A 2JB1A 2BS3A 3JSKA 4II3A 1PS9A 4XWRA 1DOEA 4J2WA 1MOKA 4UDQA 3T31A 4GRTA 1SEZA 5C2TA 4JDRA 4U8LA 4C74A 3NYEA 1TDEA 3DK8A 2V60A 2WBAA 3G5QA 3LOVA 1GOSA 3AEBA 5KMRA 2R0GA 3PG6A 3SXIA 5FS6A 4G6HA 3AYLA 3CTYA 2BRAA 3KPFA 1GSNA 2GMHA 3BHFA 4ICYA 1Q9IA 1Y0PA 3LXDA 3DJDA 3K7MX 4C3XA 1N4WA 3NIXA 4H4UA 4WX1A 3AEEA 3DH9A 4U8NA 4JN9A 3CN8A 3GWDA 1OJDA 4BURA 3CNJA 5BUKA 1NEKA 2YG4A 4TM0A 4AP3A 1D7YA 3SZ0A 2Q7VA 2VVLA 5KVHA 1JRYA 2WU5A 1IUWA 4EIPA 1KNRA 4USQA 3AE2A 3KPKA 2GF3A 3I6DA 3LJPA 1P2EA 2A8XA 3M0OA 3UCLA 4BJZA 5EB5A 3CNTA 2C66A 4U8JA 1E1MA 4YTPA 3DK4A 3K7QX 2OLOA 4YSHA 3AD8B 5KMPA 1ZMDA 4I58A 2JAEA 1DJQA 3QVPA 2F5ZA 2XLTA 1L9EA 2FJAA 1KSSA 2WDQA 2H89A 3NNEA 2XFPA 2NVKX 3ALMA 4NTCA 1NHPA 2B9WA 3BNUA 4NTEA 3Q9TA 3EF6A 1BGNA 3GWFA 4J33A 4EM3A 1CF3A 2FJDA 3UKLA 4DSGA 4EQWA 1MO9A 4GR1A 3P4PA 5KNLA 3D8XA 1E1NA 3UTGA 1JRZA 2RGOA 3EAOA 2YQUA 4FDCB 3QVRA 3SZCA 4PABA 4XXGA 1PDHA 3M13A 2EQ6A 5KOWA 3SGLA 1GRBA 4NEVA 3C4AA 1E7PA 4J57A 3M12A 4X9NA 2X8HA 1L0VA 1TDFA 1D7LA 4H4XA 3CGEA 3D9XA 1S2QA 4OPLA 4YKGA 3GRTA 3FMWA 4YXDA 1IUTA 2J3NA 2C76A 2OAMA 2C75A 2PYXA 1QO8A 4U8KA 3SFEA 4RG4A 2B9XA 4CNKA 3UKHA 1MXTA 2WPEA 1CC6A 2VZ2A 1LJ1A 2BS2A 1PHHA 4J34A 3SX6A 2Q0KA 4TLZA 4X4JA 4PAAA 3AE8A 1NPXA 2JBVA 1XPQA 1GRHA 4YSYA 4Z2UA 2QA2A 1KDGA 2C64A 1TYTA 1CJCA 2I0ZA 4K5SA 3RHAA 3GDPA 1ONFA 1PJ7A 2WOIA 5FS9A 4LU6A 3LZWA 4NNJA 4AP1A 5HY5A 3CNPA 3KD9A 4U2LA 2VOUA 1CJ3A 5HHFA 4K8DA 3V3OA 2YLXA 3ZYXA 3QJ4A 3H4KA 3QSMA 4B68A 2E5VA 3F8PA 4O5UA 2XVJA 1S7MA 1PBBA 3QSSA 1S3EA 1H83A 2BXSA 4A6NB 2BCGG 2O9ZA 2YM2A 3NT6A 3COXA 4H4SA 3UOZA 2Q0LA 4IA6A 2V6OA 2CFYA 3VR9A 4DSHA 3SQPA 3DA1A 2CDUA 2B76A 3SM8A 2E4GA 3T37A 4BJYA 4CNJA 5J60A 1P2HA 1EL5A 2R45A 1IUVA 4CCRA 4NWZA 4K22A 2Z5YA 1H7XA 4BK2A 1CBOA 2EQ7A 2V5ZA 1FOHA 5ER0A 5CQFA 2CVJA 1VQWA 2R0PA 4YKFA 2C3DA 2JB2A 3P1WA 2YVJA 4J56A 4Y4LA 3IHGA 4II2A 4TM1A 1H7WA 2XFUA 4C5OA 2WDRA 3AE5A 4EQXA 3ATRA 1D4EA 3BI5A 3KA7A 4D03A 4EQRA 3GMBA 3PVCA 1Q1WA 2GR2A 1LTXR 4B63A 3H8LA 4K2XA 2VVMA 3S5WA 4H4ZA 2YLTA 4GDEA 3FIMB 4C77A 2WESA 1ELIA 4TLXA 2GR3A 5KRQA 2W0HA 4OPUA 4JNQA 4EQSA 1E1LA 4DNAA 3NHOX 3ICSA 3RP7A 5U25A 1ZP0A 2WHDA 2WOVA 3P4RA 2VRMA 1O5WA 4FK1C 4GUVA 4E0VA 1M64A 2FJBA 1GXFA 1YQZA 3DJGX 4YWOA 2ZZ0A 2C7GA 3AEGA 3GDNA 4IVOB 4Z26A 5JCLA 4G9KA 5JCNA 5KVIA 2AQJA 4ECHA 2VQ7A 2DKHA 2YG6A 4G6GA 1GRTA 2C72A 2GQWA 4P9SA 3SYIA 3K7TA 4YSZA 4TM4A 1GRGA 5KWFA 5FMHA 1K0JA 3L5OA 3AB1A 4HA6A 1RYIA 4H50A 2R46A 1LV0A 1D4CA 2IVEA 2UZZA 1GNDA 4JQ9A 1VG9A 3CGBA 1PJ5A 1DOBA 2YLRA 2YAUA 1X31B 4UP3A 4Z24A 1COYA 1ZKQA 3UKQA 3UP5A 3VR8A 3BHKA 2ARDA 2JKCA 1GRAA 2R9ZA 1FECA 2C3CA 1H2IA 2GB0A 2GMJA 4CBQA 2RGHA 3L8KA 4YSXA 1E6EA 2WP5A 2WU2A 3DMEA 5M0ZA 3C96A 4A9WA 4Z25A 4OPGA 3T2ZA 2WQYA 3DK9A 3NK2X 1K0LA 2XVEA 4H2RA 1Y56B 3L1RA 1GREA 4NZHA 2XVIA 1FEAA 3SZFA 2A87A 3GYXA 4Y4MA 2WS3A 1BGJA 4B67A 4O5QA 1JOAA 5CKUA 1ZX9A 2R4EA 4RG3A 1F8WA 4GDPA 2XFQA 2Y6RA 2RGJA 2GR0A 3T14A 2YLSA 2XYOA 3UKAA 1JRXA 2JB3A 4YT0A 2GVCA 2XLUA 1REOA 2XFNA 4X9MA 3UOXA 4U8OA 1TDNA 2IIDA 2X3NA 1D5TA 4GCMA 1RP0A 4FX9A 3ABVA 4Y4NA 1F8SA 1Z6LA 3ICRA 4BV6A 5JCKA 1S3BA 1E1KA 3SZWA 4CCQA 3AEAA 3UOYA 4A65A 4HB9A 1GT8A 3GD4A 1CC4A 1W4XA 1JNZA 4I59A 3GRSA 1KF6A 3AE7A 2NPXA 3O0HA 1GETA 4OCGA 4Z2RA 2GH5A 1TYPA 3G5RA 3H8IA 1BZLA 4H4PA 1ZMCA 2BCPA 2V3BA 1TDOA 2QA1A 2VRLA 4JY2A 1QJDA 3OC4A 1N1PA 1N4UA 2YR6A 4UDPA 3LZXA 3IWAA 3UKPA 1GV4A 3CGCA 2PHHA 2XFOA 3T0KA 5U1OA 1JU2A 1O94A 3K30A 5IPYA 3BI2A 2C67A 5BVAA 1NHSA 3R9UA 1V59A 5FS7A 3RP6A 1BKWA 3G5SA 1YQ3A 3DJEA 1GTHA 5IQ1A 1PXCA 3CPHG 5GSNA 2CULA 3AE6A 2ZBWA 3UKFA 1KSUA 2WEUA 1YY5A 4U2TA 4A7AA 3FBSA 3EPTA 1B37A 2A89A 4MJWA 3NYCA 1DXLA 2WP9A 2C65A 1UKVG 3CIRA 4TM3A 3NG7X 2B7SA 1OJCA 2C73A 3WE0A 4ZN0A 2EQ8A 2B9YA 1JEHA 2OLNA 3AE9A 3Q6JA 1NG4A 3GYJA 5DBJA 3NKSA 2YG5A 3UKKA 2ZZBA 3QFBA 4EM4A 2TMDA 1OJTA 3GMCA 3ISHA 4WCTA 3REDA 2WETA 1F8RA 1DODA 3HZLA 3T2YA 4H7UA 2BXRA 4JNAA 1L9CA 5TR3A 3FPZA 1L9DA 2WPFA 2BRYA 2DKIA 3AD7B 1GRFA 4CY6A 1ZK7A 4AOSA 2EQ9A 4FK1A 4U2SA 1LQTA 3AE1A 2XLPA 3ADAB 4BK1A 3NK0X 3V76A 4CY8A 4YTNA 1GESA 1PBDA 5EOWA 4OVIA 4U8PA 1XDIA 4H4WA 5FS8A 3NK1X 4USRA 1KNPA 2V3AA 4H4TA 3F8RA 3P4SA 1NHRA 1IUXA 1CHUA 4JY3A 4ZCCA 3LB8A 1GALA 1VG0A 3RNMA 4A6NA 3KLJA 1OJAA 2OA1A 3NH3X 4GAVA 5C3JA 4H4QA 4REKA 5EBKA 1GPEA 3IF9A 4H2NA 3FG2P 5JCMA 3S61A 4A5LA 3AECA 1TRBA 3AE4A 1N4VA 1PN0A 1KN0A 5KXJA 3ALLA 4DGKA 1EL9A 3ICTA 5KMSA 2QAEA 3HYXA 5BRTA 5IQ4A 1GTEA 1K4QA 3BI4A 2YVGA 2YG7A 4IVMB 1LQUA 3UP4A 5L46A 4EMIA 2GQFA 3II4A 1BWCA 3AXBA 3RP8A 3VQRA 1HYUA 2WP6A 3F8DA 4APNA 5KMQA 3T2KA 2AAQA 1ZY8A 1LPFA 1OJ9A 4K5RA 1Q1RA 5JCIA 1M6IA 1XHCA 1EL7A 5KOXA 1DNCA 4H2QA 3OZ2A 4H2PA 4CRTA 2RABA 2Y6QA 3SY4A 2VVLG 2XVHA 2H88A 3V3NA 5LV9A 2BYBA 3DGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X50 A;  3SFD A;  1NHQ A;  4OPC A;  1CJ2 A;  2YLW A;  1XAN A;  3CPI G;  4N9X A;  3DJJ A;  3GYI A;  1PXB A;  1H6V A;  1GEU A;  1PJ6 A;  3BNM A;  1LVL A;  1DJN A;  2GEW A;  5BUL A;  4H4R A;  2BAB A;  2GAH B;  3IC9 A;  4NEW A;  1PBE A;  2YG3 A;  4AT2 A;  3AYJ A;  2BC1 A;  3QSE A;  2QCU A;  5GRT A;  1B5Q A;  4NTD A;  2X8C A;  2YR4 A;  2WPC A;  2VQB A;  3NRN A;  1FL2 A;  2C70 A;  3CND A;  4H4Y A;  4U8I A;  4J31 A;  4ADW A;  1F3P A;  1B8S A;  3AEF A;  1FEB A;  4U8M A;  1AOG A;  1O95 A;  3DGZ A;  3AYI A;  4Z43 A;  1ZOV A;  1KFY A;  4B1B A;  1ZOY A;  5U63 A;  4Z44 A;  4IA5 A;  1H82 A;  1PBC A;  3ALJ A;  3EAN A;  1NAA A;  2Z5X A;  4B65 A;  1QLB A;  4EMW A;  3NN0 X;  4OPD A;  1CJ4 A;  4UDR A;  4M52 A;  1H84 A;  3PS9 A;  4OPI A;  1F6M A;  3VRD B;  2BAC A;  2BK3 A;  2Q6U A;  3LAD A;  3CPJ G;  1FCD A;  3CGD A;  4AT0 A;  1RSG A;  2X8G A;  4KPR A;  1NG3 A;  3UTH A;  4J36 A;  3QFA A;  2OAL A;  3B3R A;  1H86 A;  2B7R A;  2YVF A;  1D4D A;  1NEN A;  2ZZC A;  3NTD A;  4Z2T A;  1S2Y A;  2BK5 A;  5J7X A;  4K7Z A;  2TPR A;  4AOX A;  1TDK A;  1JNR A;  3NGC X;  2X99 A;  3E1T A;  2R0C A;  1IUU A;  1GER A;  1IJH A;  1Y56 A;  3VRA A;  2BA9 A;  2AR8 A;  2YM1 A;  3UOV A;  2APG A;  3ZDN A;  4KX6 A;  3D1C A;  3IHM A;  1VDC A;  2GV8 A;  2V61 A;  3C4N A;  3KVE A;  4C3Y A;  3AE3 A;  2YLZ A;  2XCG A;  2XLR A;  2XLS A;  2BK4 A;  4XWZ A;  4EIQ A;  2YWL A;  3UTF A;  1EL8 A;  4A79 A;  3P4Q A;  3ITJ A;  1PBF A;  4GF7 A;  4OPT A;  4EMJ A;  2WDV A;  3UTE A;  3B6D A;  2GAG B;  1CL0 A;  3KU9 A;  3AD9 B;  3NTA A;  2BS4 A;  2E1M A;  3NLC A;  3NYF A;  4RSL A;  3GD3 A;  4D04 A;  2BC0 A;  2ACZ A;  1NDA A;  1K0I A;  1IUS A;  3AWI A;  3GSI A;  4B64 A;  5HXI A;  4A99 A;  1H81 A;  4LII A;  1DOC A;  3AED A;  2FBW A;  2XDO A;  2XVF A;  3CNS A;  4ZCD A;  4B66 A;  2FJE A;  5M10 A;  2IVD A;  4BK3 A;  3KKJ A;  2JK6 A;  1ZDL A;  2GR1 A;  3NN6 X;  5EB4 A;  4H4V A;  3P9U A;  4B69 A;  1EBD A;  2WOW A;  1B4V A;  2R4J A;  2GRT A;  1VRQ B;  1YKJ A;  1YQ4 A;  3I3L A;  4IV9 A;  1CC2 A;  2HQM A;  2YR5 A;  3PO7 A;  3URH A;  4LA1 A;  1BF3 A;  3ATQ A;  4YTM A;  1PXA A;  3VRB A;  5HYM A;  1E39 A;  2JB1 A;  2BS3 A;  3JSK A;  1PS9 A;  4XWR A;  1DOE A;  4J2W A;  1MOK A;  4UDQ A;  4GRT A;  1SEZ A;  5C2T A;  4JDR A;  4U8L A;  4C74 A;  3NYE A;  1TDE A;  3DK8 A;  2V60 A;  2WBA A;  3G5Q A;  3LOV A;  1GOS A;  3AEB A;  2R0G A;  5FS6 A;  3AYL A;  3CTY A;  3KPF A;  1GSN A;  2GMH A;  3BHF A;  4ICY A;  1Q9I A;  1Y0P A;  3LXD A;  3DJD A;  3K7M X;  4C3X A;  1N4W A;  3NIX A;  4H4U A;  4WX1 A;  3AEE A;  3DH9 A;  4U8N A;  4JN9 A;  3CN8 A;  3GWD A;  1OJD A;  4BUR A;  3CNJ A;  5BUK A;  1NEK A;  2YG4 A;  4TM0 A;  4AP3 A;  1D7Y A;  2Q7V A;  2VVL A;  5KVH A;  1JRY A;  2WU5 A;  1IUW A;  4EIP A;  1KNR A;  4USQ A;  3AE2 A;  2GF3 A;  3I6D A;  3LJP A;  1P2E A;  2A8X A;  3M0O A;  3UCL A;  4BJZ A;  5EB5 A;  3CNT A;  2C66 A;  4U8J A;  1E1M A;  4YTP A;  3DK4 A;  3K7Q X;  2OLO A;  4YSH A;  3AD8 B;  1ZMD A;  4I58 A;  2JAE A;  1DJQ A;  3QVP A;  2F5Z A;  2XLT A;  1L9E A;  2FJA A;  1KSS A;  2WDQ A;  2H89 A;  3NNE A;  2XFP A;  2NVK X;  3ALM A;  4NTC A;  1NHP A;  2B9W A;  3BNU A;  4NTE A;  3Q9T A;  3EF6 A;  1BGN A;  3GWF A;  4J33 A;  4EM3 A;  1CF3 A;  2FJD A;  3UKL A;  4DSG A;  4EQW A;  1MO9 A;  4GR1 A;  3P4P A;  3D8X A;  1E1N A;  3UTG A;  1JRZ A;  2RGO A;  3EAO A;  2YQU A;  4FDC B;  3QVR A;  4PAB A;  4XXG A;  1PDH A;  3M13 A;  2EQ6 A;  5KOW A;  3SGL A;  1GRB A;  4NEV A;  3C4A A;  1E7P A;  4J57 A;  3M12 A;  4X9N A;  2X8H A;  1L0V A;  1TDF A;  1D7L A;  4H4X A;  3CGE A;  1S2Q A;  4OPL A;  4YKG A;  4YXD A;  3GRT A;  3FMW A;  1IUT A;  2J3N A;  2C76 A;  2OAM A;  2C75 A;  2PYX A;  1QO8 A;  4U8K A;  3SFE A;  4RG4 A;  2B9X A;  4CNK A;  3UKH A;  1MXT A;  2WPE A;  1CC6 A;  2VZ2 A;  1LJ1 A;  2BS2 A;  1PHH A;  4J34 A;  2Q0K A;  4TLZ A;  4X4J A;  4PAA A;  3AE8 A;  1NPX A;  2JBV A;  1XPQ A;  1GRH A;  4YSY A;  4Z2U A;  2QA2 A;  1KDG A;  2C64 A;  1TYT A;  1CJC A;  2I0Z A;  4K5S A;  3RHA A;  3GDP A;  1ONF A;  1PJ7 A;  2WOI A;  5FS9 A;  4LU6 A;  3LZW A;  4AP1 A;  5HY5 A;  3CNP A;  3KD9 A;  4U2L A;  2VOU A;  1CJ3 A;  5HHF A;  4K8D A;  3V3O A;  2YLX A;  3ZYX A;  3QJ4 A;  3H4K A;  3QSM A;  4B68 A;  2E5V A;  3F8P A;  4O5U A;  2XVJ A;  1PBB A;  3QSS A;  1S3E A;  1H83 A;  2BXS A;  4A6N B;  2BCG G;  2O9Z A;  2YM2 A;  3NT6 A;  3COX A;  4H4S A;  3UOZ A;  2Q0L A;  4IA6 A;  2V6O A;  2CFY A;  3VR9 A;  4DSH A;  3SQP A;  3DA1 A;  2CDU A;  2B76 A;  3SM8 A;  2E4G A;  3T37 A;  4BJY A;  4CNJ A;  5J60 A;  1P2H A;  1EL5 A;  2R45 A;  1IUV A;  4CCR A;  4K22 A;  2Z5Y A;  1H7X A;  4BK2 A;  1CBO A;  2EQ7 A;  2V5Z A;  1FOH A;  5ER0 A;  5CQF A;  2CVJ A;  1VQW A;  2R0P A;  4YKF A;  2C3D A;  2JB2 A;  3P1W A;  2YVJ A;  4J56 A;  4Y4L A;  3IHG A;  4TM1 A;  1H7W A;  2XFU A;  4C5O A;  2WDR A;  3AE5 A;  4EQX A;  3ATR A;  1D4E A;  3BI5 A;  3KA7 A;  4D03 A;  4EQR A;  3GMB A;  3PVC A;  1Q1W A;  2GR2 A;  1LTX R;  4B63 A;  3H8L A;  4K2X A;  2VVM A;  3S5W A;  4H4Z A;  2YLT A;  4GDE A;  3FIM B;  4C77 A;  2WES A;  1ELI A;  4TLX A;  2GR3 A;  5KRQ A;  2W0H A;  4OPU A;  4JNQ A;  4EQS A;  1E1L A;  4DNA A;  3NHO X;  3ICS A;  3RP7 A;  5U25 A;  1ZP0 A;  2WHD A;  2WOV A;  3P4R A;  2VRM A;  1O5W A;  4FK1 C;  4GUV A;  4E0V A;  1M64 A;  2FJB A;  1GXF A;  1YQZ A;  3DJG X;  4YWO A;  2ZZ0 A;  2C7G A;  3AEG A;  3GDN A;  4IVO B;  4Z26 A;  5JCL A;  5JCN A;  5KVI A;  2AQJ A;  4ECH A;  2VQ7 A;  2DKH A;  2YG6 A;  1GRT A;  2C72 A;  2GQW A;  4P9S A;  3K7T A;  4YSZ A;  4TM4 A;  1GRG A;  5KWF A;  5FMH A;  1K0J A;  3AB1 A;  4HA6 A;  1RYI A;  4H50 A;  2R46 A;  1LV0 A;  1D4C A;  2IVE A;  2UZZ A;  1GND A;  4JQ9 A;  1VG9 A;  3CGB A;  1PJ5 A;  1DOB A;  2YLR A;  2YAU A;  1X31 B;  4UP3 A;  4Z24 A;  1COY A;  1ZKQ A;  3UKQ A;  3UP5 A;  3VR8 A;  3BHK A;  2ARD A;  2JKC A;  1GRA A;  2R9Z A;  1FEC A;  2C3C A;  2GB0 A;  2GMJ A;  4CBQ A;  2RGH A;  3L8K A;  4YSX A;  1E6E A;  2WP5 A;  2WU2 A;  3DME A;  5M0Z A;  3C96 A;  4A9W A;  4Z25 A;  4OPG A;  2WQY A;  3DK9 A;  3NK2 X;  1K0L A;  2XVE A;  4H2R A;  1Y56 B;  3L1R A;  1GRE A;  4NZH A;  2XVI A;  1FEA A;  2A87 A;  4Y4M A;  2WS3 A;  1BGJ A;  4B67 A;  4O5Q A;  1JOA A;  5CKU A;  1ZX9 A;  2R4E A;  4RG3 A;  1F8W A;  4GDP A;  2XFQ A;  2Y6R A;  2RGJ A;  2GR0 A;  2YLS A;  2XYO A;  3UKA A;  1JRX A;  2JB3 A;  4YT0 A;  2GVC A;  2XLU A;  1REO A;  2XFN A;  4X9M A;  3UOX A;  4U8O A;  1TDN A;  2IID A;  2X3N A;  1D5T A;  4GCM A;  1RP0 A;  4FX9 A;  3ABV A;  4Y4N A;  1F8S A;  1Z6L A;  3ICR A;  4BV6 A;  5JCK A;  1S3B A;  1E1K A;  4CCQ A;  3AEA A;  3UOY A;  4A65 A;  4HB9 A;  1GT8 A;  3GD4 A;  1CC4 A;  1W4X A;  1JNZ A;  4I59 A;  3GRS A;  1KF6 A;  3AE7 A;  2NPX A;  3O0H A;  1GET A;  4OCG A;  4Z2R A;  2GH5 A;  1TYP A;  3G5R A;  3H8I A;  1BZL A;  4H4P A;  1ZMC A;  2BCP A;  1TDO A;  2QA1 A;  2V3B A;  2VRL A;  4JY2 A;  1QJD A;  3OC4 A;  1N1P A;  1N4U A;  2YR6 A;  4UDP A;  3LZX A;  3IWA A;  3UKP A;  1GV4 A;  3CGC A;  2PHH A;  2XFO A;  5U1O A;  1JU2 A;  1O94 A;  3K30 A;  5IPY A;  3BI2 A;  2C67 A;  5BVA A;  1NHS A;  3R9U A;  1V59 A;  5FS7 A;  3RP6 A;  1BKW A;  3G5S A;  1YQ3 A;  3DJE A;  1GTH A;  5IQ1 A;  1PXC A;  3CPH G;  5GSN A;  2CUL A;  3AE6 A;  2ZBW A;  3UKF A;  1KSU A;  2WEU A;  1YY5 A;  4U2T A;  4A7A A;  3FBS A;  3EPT A;  1B37 A;  2A89 A;  4MJW A;  3NYC A;  1DXL A;  2WP9 A;  2C65 A;  1UKV G;  3CIR A;  4TM3 A;  3NG7 X;  2B7S A;  1OJC A;  2C73 A;  3WE0 A;  4ZN0 A;  2EQ8 A;  2B9Y A;  1JEH A;  2OLN A;  3AE9 A;  3Q6J A;  1NG4 A;  3GYJ A;  5DBJ A;  3NKS A;  2YG5 A;  3UKK A;  2ZZB A;  3QFB A;  4EM4 A;  2TMD A;  1OJT A;  3GMC A;  3ISH A;  4WCT A;  3RED A;  2WET A;  1F8R A;  1DOD A;  3HZL A;  4H7U A;  2BXR A;  4JNA A;  1L9C A;  5TR3 A;  3FPZ A;  1L9D A;  2WPF A;  2DKI A;  3AD7 B;  1GRF A;  4CY6 A;  1ZK7 A;  4AOS A;  2EQ9 A;  4FK1 A;  4U2S A;  1LQT A;  3AE1 A;  2XLP A;  3ADA B;  4BK1 A;  3NK0 X;  3V76 A;  4CY8 A;  4YTN A;  1GES A;  1PBD A;  5EOW A;  4OVI A;  4U8P A;  1XDI A;  4H4W A;  5FS8 A;  3NK1 X;  4USR A;  1KNP A;  2V3A A;  4H4T A;  3F8R A;  3P4S A;  1NHR A;  1IUX A;  1CHU A;  4JY3 A;  4ZCC A;  3LB8 A;  1GAL A;  1VG0 A;  3RNM A;  4A6N A;  3KLJ A;  1OJA A;  2OA1 A;  3NH3 X;  5C3J A;  4H4Q A;  4REK A;  5EBK A;  1GPE A;  3IF9 A;  4H2N A;  3FG2 P;  5JCM A;  3S61 A;  4A5L A;  3AEC A;  1TRB A;  3AE4 A;  1N4V A;  1PN0 A;  5KXJ A;  3ALL A;  4DGK A;  1EL9 A;  3ICT A;  2QAE A;  5BRT A;  5IQ4 A;  1GTE A;  1K4Q A;  3BI4 A;  2YVG A;  2YG7 A;  4IVM B;  1LQU A;  3UP4 A;  5L46 A;  4EMI A;  2GQF A;  3II4 A;  1BWC A;  3AXB A;  3RP8 A;  3VQR A;  1HYU A;  2WP6 A;  3F8D A;  4APN A;  2AAQ A;  1ZY8 A;  1LPF A;  1OJ9 A;  4K5R A;  1Q1R A;  5JCI A;  1M6I A;  1XHC A;  1EL7 A;  5KOX A;  1DNC A;  4H2Q A;  3OZ2 A;  4H2P A;  4CRT A;  2RAB A;  2Y6Q A;  2VVL G;  2XVH A;  2H88 A;  3V3N A;  5LV9 A;  2BYB A;  3DGH A; 
#chains in the Genus database with same CATH topology
 4OPC A;  3CPI G;  3TQP A;  3DJJ A;  4K1W A;  1DJN A;  4H4R A;  3VCN A;  2GAH B;  3IC9 A;  4AT2 A;  1P48 A;  3CAW A;  3CMM A;  1B5Q A;  3UJ2 A;  2X8C A;  4HNL A;  1FL2 A;  3CND A;  3MKC A;  3AEF A;  1AOG A;  3R10 A;  4Z44 A;  2PCE A;  1H82 A;  3EAN A;  2Z5X A;  1QLB A;  4EMW A;  1F6M A;  2Q6U A;  3V3W A;  4AT0 A;  3Q4D A;  3UTH A;  1NG3 A;  1H86 A;  3RRA A;  2YVF A;  2ZZC A;  4ROP A;  2R0C A;  1IUU A;  2P8B A;  2YM1 A;  3UOV A;  4G7F A;  2GV8 A;  2V61 A;  3C4N A;  2YLZ A;  2P0I A;  4EWJ A;  4XWZ A;  2YWL A;  4ZCW A;  3DG3 A;  1W6T A;  4EMJ A;  3UTE A;  1CL0 A;  3NLC A;  3GD3 A;  2ACZ A;  1IUS A;  2C4C A;  3HRD C;  3HYV A;  3AED A;  1EBH A;  3NN6 X;  3PWI A;  2WOW A;  4IV9 A;  1B4V A;  1YKJ A;  1VRQ B;  1WUE A;  1CC2 A;  4LA1 A;  3ATQ A;  3VRB A;  5HYM A;  2JB1 A;  3V5F A;  2BS3 A;  4II3 A;  2QQ6 A;  4J1O A;  1ONE A;  4HYR A;  3RCY A;  1MOK A;  3T31 A;  1SEZ A;  3P3B A;  2CHR A;  1TDE A;  3DK8 A;  2V60 A;  2WBA A;  1P43 A;  1GOS A;  2R0G A;  3AYL A;  3CTY A;  3ENL A;  2BRA A;  3A7U A;  1Q9I A;  3N4F A;  2W3S A;  3NIX A;  4WX1 A;  4GIR A;  4U8N A;  4JN9 A;  1OJD A;  4MMW A;  2YG4 A;  2WU5 A;  2PTY A;  4USQ A;  2A8X A;  4F4R A;  5EB5 A;  1VQZ A;  1SJA A;  1F9C A;  2JAE A;  1N63 C;  1FO4 A;  4NTC A;  3ES8 A;  3IJL A;  3UKL A;  2FJD A;  4GR1 A;  5KNL A;  1FFV C;  3B97 A;  3SZC A;  4PAB A;  2EQ6 A;  2XH4 A;  5KOW A;  3C4A A;  1MRA A;  3SSZ A;  4J57 A;  3THU A;  1S2Q A;  4YKG A;  4OPL A;  2NQL A;  3GRT A;  2OAM A;  2C75 A;  1QO8 A;  4U8K A;  4CNK A;  2WPE A;  2VZ2 A;  4J34 A;  4X4J A;  3AE8 A;  1NPX A;  1XPQ A;  2C64 A;  3RHA A;  3VCC A;  3CXO A;  1PJ7 A;  3LZW A;  2VOU A;  4K8D A;  2PSN A;  4O5U A;  1PBB A;  1H83 A;  3NT6 A;  4YWS A;  3COX A;  1YEY A;  4E4F A;  1P2H A;  3NVZ B;  1EL5 A;  3QKE A;  4CCR A;  4NWZ A;  2Z5Y A;  2V5Z A;  5CQF A;  2CVJ A;  1VQW A;  4Y4L A;  4II2 A;  4EQX A;  3H8L A;  3PK7 A;  4JN8 A;  4JNQ A;  4DNA A;  3NRZ B;  3ICS A;  2WHD A;  3P4R A;  3Q45 A;  1WUF A;  1YQZ A;  5JCL A;  2AQJ A;  3B9J B;  6ENL A;  4P9S A;  2OVL A;  4TM4 A;  5FMH A;  3AB1 A;  2POD A;  1D4C A;  2UZZ A;  3FXG A;  1VG9 A;  1PJ5 A;  4K2S A;  1COY A;  2GL5 A;  1GRA A;  1H2I A;  2GMJ A;  4YSX A;  1E6E A;  5M0Z A;  4Z25 A;  4OPG A;  2WQY A;  1K0L A;  2XVE A;  3L1R A;  1BGJ A;  1ZX9 A;  2R4E A;  1F8W A;  2PTX A;  3UKA A;  3UOX A;  1PDZ A;  1REO A;  2XFN A;  4H2H A;  2OKT A;  2IID A;  1N5W C;  2X3N A;  3TWA A;  3ABV A;  2GGH A;  3TWB A;  1E1K A;  3SZW A;  3GD4 A;  1CC4 A;  2HNE A;  1JNZ A;  3NZG A;  1KKR A;  4Z2R A;  2GH5 A;  3UXK A;  1MDR A;  2VRL A;  3ZVI A;  5IPY A;  3OP2 A;  5FS7 A;  3OZY A;  5IQ1 A;  2CUL A;  3UKF A;  3CT2 A;  1B37 A;  1MDL A;  2C65 A;  3UJF A;  2C73 A;  3AE9 A;  3Q6J A;  3NKS A;  3UKK A;  2WET A;  4DYE A;  2BXR A;  4JNA A;  3FJ4 A;  4HCD A;  2GSH A;  1L9C A;  1L9D A;  2WPF A;  4CY6 A;  1ZK7 A;  4AOS A;  1RM6 B;  3SBF A;  4CY8 A;  4H4W A;  4GGB A;  3F8R A;  3P4S A;  4JY3 A;  1VG0 A;  3NH3 X;  2OA1 A;  4GAV A;  4REK A;  5EBK A;  1GPE A;  3IF9 A;  3AE4 A;  1PDY A;  4ZA0 A;  1GTE A;  1K4Q A;  3TW9 A;  1IYX A;  1BWC A;  3AXB A;  3F8D A;  5KMQ A;  1Q1R A;  4H2Q A;  3OZ2 A;  4CRT A;  2VVL G;  3V3N A;  2H88 A;  3DGH A;  4N9X A;  3GYI A;  1H6V A;  1PJ6 A;  3QTP A;  2GEW A;  2BAB A;  1PBE A;  4DWD A;  2BC1 A;  3FYY A;  3QSE A;  2QCU A;  5GRT A;  2YR4 A;  2VQB A;  4U8I A;  4J31 A;  3DG7 A;  4ADW A;  1F3P A;  4U8M A;  1ZOV A;  3ALJ A;  4B65 A;  3ES7 A;  4OPD A;  3V5C A;  4UDR A;  3VRD B;  2BAC A;  2BK3 A;  3LAD A;  3CPJ G;  2PP1 A;  4KPR A;  3QFA A;  2OAL A;  4H83 A;  2B7R A;  3MUC A;  1D4D A;  5J7X A;  2PMQ A;  1JNR A;  2X99 A;  1GER A;  1Y56 A;  3VRA A;  2BA9 A;  3ZDN A;  4KX6 A;  5IDZ A;  3IHM A;  1VDC A;  4C3Y A;  3KVE A;  3AE3 A;  2XLS A;  3ITJ A;  1PBF A;  5JRB A;  2WDV A;  2GAG B;  3AD9 B;  2HZG A;  1NDA A;  3NVV B;  4A99 A;  4LII A;  1DOC A;  2FBW A;  2XVF A;  2FJE A;  4BK3 A;  3EUB 3;  2JK6 A;  2GR1 A;  3I3L A;  4JN7 A;  3IJI A;  4YTM A;  1NEL A;  4HN8 A;  3JSK A;  1DOE A;  4J2W A;  4GRT A;  5C2T A;  4U8L A;  3HPF A;  3N6J A;  3AEB A;  5KMR A;  3SXI A;  4Z17 A;  3H8A A;  4ICY A;  1JDF A;  3LXD A;  1Y0P A;  3K7M X;  1N4W A;  4H4U A;  3DH9 A;  3UXL A;  3GWD A;  3TOY A;  3H12 A;  5BUK A;  1NEK A;  3R25 A;  1D7Y A;  2Q7V A;  2VVL A;  5KVH A;  3MY9 A;  4HNC A;  1JRY A;  3AE2 A;  3KPK A;  3UCL A;  4BJZ A;  3UCD A;  3K7Q X;  2OLO A;  3RO6 A;  4I58 A;  1DJQ A;  3QVP A;  2XFP A;  1NHP A;  2B9W A;  2QDE A;  4MGG A;  7ENL A;  4EM3 A;  2GGI A;  3D8X A;  1E1N A;  2RGO A;  2YQU A;  3QVR A;  3M13 A;  1BQG A;  4HCL A;  1D7L A;  4H4X A;  3CGE A;  4YXD A;  3FMW A;  2GGE A;  2J3N A;  4GGH A;  1IUT A;  4PAA A;  4YSY A;  4ZOH B;  2ZAD A;  1KDG A;  2I0Z A;  1CJC A;  4K5S A;  3GDP A;  5HY5 A;  3CNP A;  1CJ3 A;  3QJ4 A;  3QLD A;  2AKM A;  2BXS A;  2Q0L A;  4GYP A;  3VR9 A;  3A7R A;  4CNJ A;  3RIT A;  3ZLH A;  1H7X A;  4BK2 A;  2EQ7 A;  2OZ3 A;  4YKF A;  2YVJ A;  4ENL A;  2E5A A;  4C5O A;  2WDR A;  3AE5 A;  1D4E A;  4EQR A;  3GMB A;  2PGE A;  4B63 A;  2VVM A;  3FIM B;  2WES A;  2GR3 A;  5KRQ A;  3EEZ A;  1E1L A;  3S47 A;  3NHO X;  3UJE A;  1XS2 A;  4GUV A;  3NVY B;  3DJG X;  2ZC8 A;  2C7G A;  5JCN A;  5KVI A;  5FJT A;  2DKH A;  2YG6 A;  2C72 A;  3SYI A;  1TE6 A;  3K7T A;  1JCT A;  3L5O A;  4HA6 A;  1RYI A;  4H50 A;  3CGB A;  2YAU A;  1ZKQ A;  5EU9 A;  1FEC A;  2C3C A;  3L8K A;  1EC8 A;  1R0M A;  2WU2 A;  4A9W A;  3DK9 A;  3R11 A;  3SN1 A;  1Y56 B;  3SZF A;  2XVI A;  2A87 A;  3UGV A;  1JOA A;  2XFQ A;  2Y6R A;  2RGJ A;  5FJO A;  2GR0 A;  3T14 A;  2YLS A;  2XYO A;  3U4F A;  1BKH A;  2JB3 A;  3DGB A;  4IP4 A;  4Y4N A;  1F8S A;  4BV6 A;  2OQH A;  4CCQ A;  3NO1 A;  3ZLF A;  4HB9 A;  3GRS A;  3JW7 A;  3O0H A;  1GET A;  3G5R A;  2XH2 A;  1TDO A;  1ZMC A;  3OC4 A;  1N4U A;  4UDP A;  3IWA A;  2DW7 A;  2PHH A;  3BI2 A;  3TTE A;  2C67 A;  1NHS A;  3MWC A;  3DJE A;  3DFH A;  1PXC A;  3FVD A;  5GSN A;  4A7A A;  2ZBW A;  4KEM A;  1DXL A;  3VDG A;  4TM3 A;  1OJC A;  3WE0 A;  2PU0 A;  3TCS A;  4IZG A;  5BOE A;  1DOD A;  2DKI A;  3AD7 B;  3DER A;  2EQ9 A;  5BOF A;  1GES A;  1PBD A;  4IP5 A;  3I6E A;  1GAL A;  4A6N A;  5C3J A;  4A5L A;  1TRB A;  1PN0 A;  3ALL A;  4DGK A;  1EL9 A;  2PTW A;  3ICT A;  5KMS A;  5BRT A;  5IQ4 A;  4GIS A;  2YVG A;  2YG7 A;  1LQU A;  5L46 A;  2GQF A;  4K5R A;  2MUC A;  2P8C A;  5JCI A;  1M6I A;  4H2P A;  2PP0 A;  2X50 A;  1NHQ A;  1CJ2 A;  1FHV A;  4IHC A;  1XAN A;  1PXB A;  1LVL A;  2PA6 A;  5BUL A;  4A6G A;  3AYJ A;  3R1Z A;  3CK5 A;  1N62 C;  3UJR A;  1B8S A;  1FEB A;  1O95 A;  3DGZ A;  1N60 C;  4Z43 A;  1ZOY A;  5U63 A;  1NAA A;  3SQS A;  3TJ4 A;  3NN0 X;  4M52 A;  1H84 A;  3PS9 A;  2PU1 A;  1FCD A;  2X8G A;  4J36 A;  3B3R A;  4Z2T A;  2BK5 A;  4K7Z A;  2TPR A;  4FP1 A;  3NGC X;  1IJH A;  2AR8 A;  3H7V A;  3D1C A;  3DG6 A;  4G74 A;  3EKG A;  4KPL A;  3UTF A;  1EL8 A;  2QDD A;  4OPT A;  3B6D A;  2QJJ A;  3ETR B;  3KU9 A;  3NTA A;  2E1M A;  4RSL A;  3NYF A;  2BC0 A;  3AWI A;  3GSI A;  4B64 A;  4B66 A;  5M10 A;  3GC2 A;  4B69 A;  3P9U A;  1EBD A;  2HQM A;  3PO7 A;  3URH A;  1BF3 A;  1PXA A;  1E39 A;  3U9I A;  4DX3 A;  4UDQ A;  4JDR A;  3AN1 A;  2OZT A;  4C74 A;  5G5H B;  3NYE A;  3PG6 A;  5FS6 A;  4G6H A;  5ENL A;  3KPF A;  1GSN A;  2GMH A;  4J3Z A;  3RR1 A;  3BHF A;  2HXT A;  4K8G A;  4HCH A;  3AEE A;  3P0W A;  3CN8 A;  4BUR A;  3MQT A;  2QJN A;  2OX4 A;  3SZ0 A;  1IUW A;  1KNR A;  3DEQ A;  3NXL A;  2GF3 A;  3LJP A;  4JHM A;  3M0O A;  1E1M A;  2PPG A;  3DK4 A;  1ZMD A;  2F5Z A;  2XLT A;  1X2G A;  2FJA A;  2H89 A;  2GGG A;  2NVK X;  1XPY A;  3BNU A;  3EF6 A;  1BGN A;  3SN0 A;  4M0X A;  3H70 A;  2XGZ A;  1MO9 A;  3P4P A;  3UTG A;  3ZVH A;  3EAO A;  4FDC B;  4XXG A;  1GRB A;  1E7P A;  4X9N A;  3M12 A;  3CYJ A;  1TDF A;  3D9X A;  3N4E A;  1MUC A;  3SFE A;  2PYX A;  1ZXI C;  2B9X A;  2PGW A;  1MXT A;  1LJ1 A;  3VFC A;  2JBV A;  2QA2 A;  1TYT A;  2WOI A;  4LU6 A;  4NNJ A;  4U2L A;  3VC5 A;  1FHU A;  3V3O A;  1MNS A;  1EC9 A;  2E5V A;  2XVJ A;  3QSS A;  1S3E A;  4A6N B;  2BCG G;  2YM2 A;  4H4S A;  3UOZ A;  4IA6 A;  2V6O A;  2CFY A;  4DSH A;  3SQP A;  3DA1 A;  2O56 A;  2B76 A;  3SM8 A;  5J04 A;  1SJD A;  3T4W A;  1IUV A;  4E4U A;  1X2H A;  4K22 A;  3GY1 A;  1FOH A;  2R0P A;  2C3D A;  2JB2 A;  4J56 A;  2QVH A;  4TM1 A;  1H7W A;  3ATR A;  3BI5 A;  3KA7 A;  1LTX R;  4K2X A;  3VA8 A;  4H4Z A;  3S5W A;  2YLT A;  4C77 A;  4EQS A;  3OTR A;  3RP7 A;  2WOV A;  3GD6 A;  1O5W A;  4E0V A;  1GXF A;  3GDN A;  4IVO B;  4Z26 A;  4G9K A;  4GFI A;  4ECH A;  4G6G A;  3STP A;  1T3Q C;  2GQW A;  2W55 A;  4YSZ A;  5KWF A;  3PFR A;  2R46 A;  1LV0 A;  1GND A;  4JQ9 A;  1X31 B;  4Z24 A;  3BHK A;  1STZ A;  3NFU A;  1KKO A;  2GB0 A;  4CBQ A;  2RGH A;  2WP5 A;  4G8T A;  3DME A;  3C96 A;  4IL2 A;  3NK2 X;  4H2R A;  4NZH A;  1GRE A;  3GYX A;  4Y4M A;  3FV9 A;  4B67 A;  3BJS A;  5CKU A;  2AL2 A;  4RG3 A;  4GDP A;  2ONE A;  1JRX A;  2P88 A;  4X9M A;  2XLU A;  2OLA A;  4U8O A;  3SR6 B;  3T8Q A;  4GCM A;  4FX9 A;  3ICR A;  5JCK A;  1S3B A;  3UOY A;  1W4X A;  4A35 A;  2NPX A;  1TYP A;  2V3B A;  2QA1 A;  4JY2 A;  1N1P A;  5FJP A;  3LZX A;  2XFO A;  5U1O A;  3K30 A;  3CXB A;  1L8P A;  3RP6 A;  4E6M A;  1YQ3 A;  3CPH G;  1YY5 A;  3VC6 A;  3EPT A;  4MJW A;  3NYC A;  1EBG A;  3CIR A;  2W54 A;  1NG4 A;  2YG5 A;  2HXU A;  2ZZB A;  2TMD A;  3ISH A;  4WCT A;  3RED A;  1F8R A;  3T2Y A;  4H7U A;  5TR3 A;  1ELS A;  2FYM A;  1R6W A;  4FK1 A;  1LQT A;  3AE1 A;  3DES A;  2XLP A;  4BK1 A;  3D47 A;  3NK0 X;  4YTN A;  2OG9 A;  4TVY A;  4OVI A;  4U8P A;  4USR A;  3GO2 A;  1ECQ A;  4H4T A;  1NHR A;  1CHU A;  4DHG A;  3LB8 A;  3KLJ A;  1OJA A;  4H2N A;  3FG2 P;  5JCM A;  1N4V A;  5KXJ A;  4TVW A;  1V97 A;  4IVM B;  3UP4 A;  3JZU A;  4KT2 A;  1HYU A;  2AAQ A;  1LPF A;  2PTZ A;  2PP3 A;  3ZVH B;  5KOX A;  1EL7 A;  2OO6 A;  3R0K A;  4H1Z A;  2Y6Q A;  1DTN A;  2POZ A;  3SFD A;  2YLW A;  3HYW A;  1GEU A;  3BNM A;  3D46 A;  1NU5 A;  4NEW A;  2YG3 A;  3AM9 A;  4NTD A;  2WPC A;  3NRN A;  2C70 A;  4H4Y A;  3AYI A;  1KFY A;  4B1B A;  4IA5 A;  1PBC A;  4G73 A;  1WYG A;  1CJ4 A;  4OPI A;  4FI4 A;  1OEP A;  3CGD A;  1RSG A;  3TJI A;  1NEN A;  4E8G A;  3NTD A;  1S2Y A;  4AOX A;  3IJQ A;  1TDK A;  3E1T A;  3OPS A;  2APG A;  3JVA A;  3ZLG A;  2XCG A;  2XLR A;  1EC7 A;  2BK4 A;  4EIQ A;  1TZZ A;  1FFU C;  4A79 A;  3P4Q A;  4IT1 A;  2W3R A;  4GF7 A;  2GDQ A;  3S5S A;  2BS4 A;  4D04 A;  3SN4 A;  1K0I A;  5HXI A;  4GAP A;  4Z1Y A;  1H81 A;  2OZ8 A;  4ZCD A;  3CNS A;  2XDO A;  2IVD A;  2GGJ A;  3KKJ A;  1ZDL A;  3MSY A;  3NS1 B;  4H4V A;  5EB4 A;  2R4J A;  5HHF A;  2GRT A;  1YQ4 A;  1SB3 B;  2YR5 A;  5G5G B;  2PS2 A;  1PS9 A;  4XWR A;  2XH0 A;  3DDM A;  3FCP A;  3LOV A;  3G5Q A;  2XH7 A;  2FKP A;  2AL2 B;  3DJD A;  4C3X A;  3DIP A;  3CNJ A;  1KD0 A;  4TM0 A;  4AP3 A;  3HW2 A;  4EIP A;  3I6D A;  1P2E A;  3CNT A;  2C66 A;  4U8J A;  3UJS A;  4YTP A;  4YSH A;  3AD8 B;  5KMP A;  1L9E A;  2MNR A;  1KSS A;  4X2P A;  2WDQ A;  3NNE A;  4M6U A;  3ALM A;  4NTE A;  3Q9T A;  3GWF A;  4J33 A;  1CF3 A;  4DSG A;  4EQW A;  2P3Z A;  1JRZ A;  1PDH A;  3SGL A;  4NEV A;  2X8H A;  1L0V A;  4HPN A;  2C76 A;  4RG4 A;  3UKH A;  1CC6 A;  2BS2 A;  1PHH A;  3R0U A;  3SX6 A;  2Q0K A;  4TLZ A;  1E9I A;  1SJC A;  1GRH A;  3T6C A;  4Z2U A;  3UCC A;  1ONF A;  5FS9 A;  4AP1 A;  2I5Q A;  3KD9 A;  2YLX A;  3ZYX A;  3H4K A;  3QSM A;  4B68 A;  3F8P A;  1S7M A;  2O9Z A;  3IK4 A;  4MKS A;  2CDU A;  3T37 A;  2E4G A;  4BJY A;  5J60 A;  2R45 A;  3RGT A;  4GYP C;  1CBO A;  3BOX A;  5ER0 A;  3R07 C;  3P1W A;  1N5X A;  1KCZ A;  2AL1 A;  3IHG A;  3DFY A;  2XFU A;  4D03 A;  3PVC A;  1TKK A;  1Q1W A;  2GR2 A;  1N61 C;  3QN3 A;  4GDE A;  4TLX A;  1ELI A;  2W0H A;  4OPU A;  5U25 A;  1ZP0 A;  2VRM A;  4FK1 C;  2QGY A;  4A3R A;  3I6T A;  1M64 A;  2FJB A;  3PWG A;  4YWO A;  3AEG A;  2ZZ0 A;  5FJR A;  4DXK A;  4DN1 A;  2VQ7 A;  2OPJ A;  1GRT A;  1GRG A;  1K0J A;  2RDX A;  3K1G A;  2IVE A;  4UP3 A;  1DOB A;  2YLR A;  3VR8 A;  3UKQ A;  3UP5 A;  2ARD A;  2JKC A;  2R9Z A;  2E3T A;  3T2Z A;  1FEA A;  3SJN A;  2WS3 A;  4O5Q A;  2XSX A;  3A7A A;  4GME A;  4YT0 A;  2GVC A;  3BSM A;  1TDN A;  1RVK A;  1D5T A;  1RP0 A;  1Z6L A;  1FIQ B;  3AEA A;  4A65 A;  1GT8 A;  3P93 A;  4I59 A;  1KF6 A;  3AE7 A;  4OCG A;  2AKZ A;  3H8I A;  1BZL A;  4H4P A;  2BCP A;  1QJD A;  2YR6 A;  3UKP A;  1GV4 A;  3CB3 A;  3CGC A;  2QJM A;  1JU2 A;  1O94 A;  3T0K A;  5BVA A;  3R9U A;  5FJU A;  3V4B A;  1V59 A;  3N6H A;  1BKW A;  3G5S A;  1GTH A;  3AE6 A;  1KSU A;  2WEU A;  4U2T A;  1SJB A;  3FBS A;  4KWS A;  2A89 A;  2WP9 A;  3NVW B;  1UKV G;  3NG7 X;  2B7S A;  4ZN0 A;  2EQ8 A;  2B9Y A;  1JEH A;  2OLN A;  5DBJ A;  3GYJ A;  3QFB A;  4EM4 A;  3GMC A;  1OJT A;  1JRP A;  3QPE A;  3HZL A;  3OW1 A;  1JRO A;  3FPZ A;  2BRY A;  3KUM A;  1GRF A;  4U2S A;  4H19 A;  3ADA B;  3V76 A;  3T9P A;  1VDV A;  5EOW A;  1XDI A;  5FS8 A;  3NK1 X;  2V3A A;  1KNP A;  4ZCC A;  1IUX A;  4E5T A;  3RNM A;  4IL0 A;  4H4Q A;  3S61 A;  2OQY A;  3I4K A;  3AEC A;  2DW6 A;  1KN0 A;  1JPM A;  2QAE A;  3HYX A;  3BI4 A;  1JPD X;  4EMI A;  3II4 A;  3RP8 A;  3VQR A;  2WP6 A;  3AMZ A;  4APN A;  3T2K A;  1ZY8 A;  1OJ9 A;  3OZM A;  2OFJ A;  1XHC A;  3MZN A;  1DNC A;  2RAB A;  3SY4 A;  2XVH A;  5LV9 A;  2BYB A; 
#chains in the Genus database with same CATH homology
 2X50 A;  3SFD A;  1NHQ A;  4OPC A;  1CJ2 A;  2YLW A;  1XAN A;  3HYW A;  3CPI G;  4N9X A;  3DJJ A;  3GYI A;  1PXB A;  1H6V A;  1GEU A;  1PJ6 A;  3BNM A;  1LVL A;  1DJN A;  2GEW A;  5BUL A;  4H4R A;  2BAB A;  2GAH B;  3IC9 A;  4NEW A;  1PBE A;  2YG3 A;  4AT2 A;  3AYJ A;  2BC1 A;  3CMM A;  3QSE A;  2QCU A;  5GRT A;  1B5Q A;  4NTD A;  2X8C A;  2YR4 A;  2WPC A;  2VQB A;  3NRN A;  1FL2 A;  2C70 A;  3CND A;  4H4Y A;  4U8I A;  4J31 A;  4ADW A;  1F3P A;  1B8S A;  3AEF A;  1FEB A;  4U8M A;  1AOG A;  1O95 A;  3DGZ A;  3AYI A;  4Z43 A;  1ZOV A;  1KFY A;  4B1B A;  1ZOY A;  5U63 A;  4Z44 A;  4IA5 A;  1H82 A;  1PBC A;  3ALJ A;  3EAN A;  1NAA A;  2Z5X A;  4B65 A;  4G73 A;  1QLB A;  4EMW A;  3NN0 X;  4OPD A;  1CJ4 A;  4UDR A;  4M52 A;  1H84 A;  3PS9 A;  4OPI A;  1F6M A;  3VRD B;  2BAC A;  2BK3 A;  2Q6U A;  3LAD A;  3CPJ G;  1FCD A;  3CGD A;  4AT0 A;  1RSG A;  2X8G A;  4KPR A;  1NG3 A;  3UTH A;  4J36 A;  3QFA A;  2OAL A;  3B3R A;  1H86 A;  2B7R A;  2YVF A;  1D4D A;  1NEN A;  2ZZC A;  3NTD A;  4Z2T A;  1S2Y A;  2BK5 A;  5J7X A;  4K7Z A;  2TPR A;  4AOX A;  1TDK A;  1JNR A;  3NGC X;  2X99 A;  3E1T A;  2R0C A;  1IUU A;  1GER A;  1IJH A;  1Y56 A;  3VRA A;  2BA9 A;  2AR8 A;  2YM1 A;  3UOV A;  2APG A;  3ZDN A;  4KX6 A;  3D1C A;  3IHM A;  1VDC A;  2GV8 A;  2V61 A;  3C4N A;  3KVE A;  4G74 A;  4C3Y A;  3AE3 A;  2YLZ A;  2XCG A;  2XLR A;  2XLS A;  2BK4 A;  4XWZ A;  4EIQ A;  2YWL A;  3UTF A;  1EL8 A;  4A79 A;  3P4Q A;  3ITJ A;  1PBF A;  5JRB A;  4GF7 A;  4OPT A;  4EMJ A;  2WDV A;  3UTE A;  3B6D A;  2GAG B;  1CL0 A;  3KU9 A;  3AD9 B;  3NTA A;  2BS4 A;  2E1M A;  3NLC A;  3NYF A;  4RSL A;  3GD3 A;  4D04 A;  2BC0 A;  2ACZ A;  1NDA A;  1K0I A;  1IUS A;  2C4C A;  3AWI A;  3GSI A;  4B64 A;  3HYV A;  5HXI A;  4GAP A;  4A99 A;  1H81 A;  4LII A;  1DOC A;  3AED A;  2FBW A;  2XDO A;  2XVF A;  3CNS A;  4ZCD A;  4B66 A;  2FJE A;  5M10 A;  2IVD A;  4BK3 A;  3KKJ A;  2JK6 A;  1ZDL A;  2GR1 A;  3NN6 X;  5EB4 A;  4H4V A;  3P9U A;  4B69 A;  1EBD A;  2WOW A;  1B4V A;  2R4J A;  2GRT A;  1VRQ B;  1YKJ A;  1YQ4 A;  3I3L A;  4IV9 A;  1CC2 A;  2HQM A;  2YR5 A;  3PO7 A;  3URH A;  4LA1 A;  1BF3 A;  3ATQ A;  4YTM A;  1PXA A;  3VRB A;  5HYM A;  1E39 A;  2JB1 A;  2BS3 A;  3JSK A;  4II3 A;  1PS9 A;  4XWR A;  1DOE A;  4J2W A;  1MOK A;  4UDQ A;  3T31 A;  4GRT A;  1SEZ A;  5C2T A;  4JDR A;  4U8L A;  4C74 A;  3NYE A;  1TDE A;  3DK8 A;  2V60 A;  2WBA A;  3G5Q A;  3LOV A;  1GOS A;  3AEB A;  5KMR A;  2R0G A;  3PG6 A;  3SXI A;  5FS6 A;  4G6H A;  3AYL A;  3CTY A;  2BRA A;  3KPF A;  1GSN A;  2GMH A;  3BHF A;  4ICY A;  1Q9I A;  1Y0P A;  3LXD A;  3DJD A;  3K7M X;  4C3X A;  1N4W A;  3NIX A;  4H4U A;  4WX1 A;  3AEE A;  3DH9 A;  4U8N A;  4JN9 A;  3CN8 A;  3GWD A;  1OJD A;  4BUR A;  3CNJ A;  5BUK A;  1NEK A;  2YG4 A;  4TM0 A;  4AP3 A;  1D7Y A;  3SZ0 A;  2Q7V A;  2VVL A;  5KVH A;  1JRY A;  2WU5 A;  1IUW A;  4EIP A;  1KNR A;  4USQ A;  3AE2 A;  3KPK A;  2GF3 A;  3I6D A;  3LJP A;  1P2E A;  2A8X A;  3M0O A;  3UCL A;  4BJZ A;  5EB5 A;  3CNT A;  2C66 A;  4U8J A;  1E1M A;  4YTP A;  3DK4 A;  3K7Q X;  2OLO A;  4YSH A;  3AD8 B;  5KMP A;  1ZMD A;  4I58 A;  2JAE A;  1DJQ A;  3QVP A;  2F5Z A;  2XLT A;  1L9E A;  2FJA A;  1KSS A;  2WDQ A;  2H89 A;  3NNE A;  2XFP A;  2NVK X;  3ALM A;  4NTC A;  1NHP A;  2B9W A;  3BNU A;  4NTE A;  3Q9T A;  3EF6 A;  1BGN A;  3GWF A;  4J33 A;  4EM3 A;  1CF3 A;  2FJD A;  3UKL A;  4DSG A;  4EQW A;  1MO9 A;  4GR1 A;  3P4P A;  5KNL A;  3D8X A;  1E1N A;  3UTG A;  1JRZ A;  2RGO A;  3EAO A;  2YQU A;  4FDC B;  3QVR A;  3SZC A;  4PAB A;  4XXG A;  1PDH A;  3M13 A;  2EQ6 A;  5KOW A;  3SGL A;  1GRB A;  4NEV A;  3C4A A;  1E7P A;  4J57 A;  3M12 A;  4X9N A;  2X8H A;  1L0V A;  1TDF A;  1D7L A;  4H4X A;  3CGE A;  3D9X A;  1S2Q A;  4OPL A;  4YKG A;  3GRT A;  3FMW A;  4YXD A;  1IUT A;  2J3N A;  2C76 A;  2OAM A;  2C75 A;  2PYX A;  1QO8 A;  4U8K A;  3SFE A;  4RG4 A;  2B9X A;  4CNK A;  3UKH A;  1MXT A;  2WPE A;  1CC6 A;  2VZ2 A;  1LJ1 A;  2BS2 A;  1PHH A;  4J34 A;  3SX6 A;  2Q0K A;  4TLZ A;  4X4J A;  4PAA A;  3AE8 A;  1NPX A;  2JBV A;  1XPQ A;  1GRH A;  4YSY A;  4Z2U A;  2QA2 A;  1KDG A;  2C64 A;  1TYT A;  1CJC A;  2I0Z A;  4K5S A;  3RHA A;  3GDP A;  1ONF A;  1PJ7 A;  2WOI A;  5FS9 A;  4LU6 A;  3LZW A;  4NNJ A;  4AP1 A;  5HY5 A;  3CNP A;  3KD9 A;  4U2L A;  2VOU A;  1CJ3 A;  5HHF A;  4K8D A;  3V3O A;  2YLX A;  3ZYX A;  3QJ4 A;  3H4K A;  3QSM A;  4B68 A;  2E5V A;  3F8P A;  4O5U A;  2XVJ A;  1S7M A;  1PBB A;  3QSS A;  1S3E A;  1H83 A;  2BXS A;  4A6N B;  2BCG G;  2O9Z A;  2YM2 A;  3NT6 A;  3COX A;  4H4S A;  3UOZ A;  2Q0L A;  4IA6 A;  2V6O A;  2CFY A;  3VR9 A;  4DSH A;  3SQP A;  3DA1 A;  2CDU A;  2B76 A;  3SM8 A;  2E4G A;  3T37 A;  4BJY A;  4CNJ A;  5J60 A;  1P2H A;  1EL5 A;  2R45 A;  1IUV A;  4CCR A;  4NWZ A;  4K22 A;  2Z5Y A;  1H7X A;  4BK2 A;  1CBO A;  2EQ7 A;  2V5Z A;  1FOH A;  5ER0 A;  5CQF A;  2CVJ A;  1VQW A;  2R0P A;  4YKF A;  2C3D A;  2JB2 A;  3P1W A;  2YVJ A;  4J56 A;  4Y4L A;  3IHG A;  4II2 A;  4TM1 A;  1H7W A;  2XFU A;  4C5O A;  2WDR A;  3AE5 A;  4EQX A;  3ATR A;  1D4E A;  3BI5 A;  3KA7 A;  4D03 A;  4EQR A;  3GMB A;  3PVC A;  1Q1W A;  2GR2 A;  1LTX R;  4B63 A;  3H8L A;  4K2X A;  2VVM A;  3S5W A;  4H4Z A;  2YLT A;  4GDE A;  3FIM B;  4C77 A;  2WES A;  1ELI A;  4TLX A;  2GR3 A;  5KRQ A;  2W0H A;  4OPU A;  4JNQ A;  4EQS A;  1E1L A;  4DNA A;  3NHO X;  3ICS A;  3RP7 A;  5U25 A;  1ZP0 A;  2WHD A;  2WOV A;  3P4R A;  2VRM A;  1O5W A;  4FK1 C;  4GUV A;  4E0V A;  1M64 A;  2FJB A;  1GXF A;  1YQZ A;  3DJG X;  4YWO A;  2ZZ0 A;  2C7G A;  3AEG A;  3GDN A;  4IVO B;  4Z26 A;  5JCL A;  4G9K A;  5JCN A;  5KVI A;  2AQJ A;  4ECH A;  2VQ7 A;  2DKH A;  2YG6 A;  4G6G A;  1GRT A;  2C72 A;  2GQW A;  4P9S A;  3SYI A;  3K7T A;  4YSZ A;  4TM4 A;  1GRG A;  5KWF A;  5FMH A;  1K0J A;  3L5O A;  3AB1 A;  4HA6 A;  1RYI A;  4H50 A;  2R46 A;  1LV0 A;  1D4C A;  2IVE A;  2UZZ A;  1GND A;  4JQ9 A;  1VG9 A;  3CGB A;  1PJ5 A;  1DOB A;  2YLR A;  2YAU A;  1X31 B;  4UP3 A;  4Z24 A;  1COY A;  1ZKQ A;  3UKQ A;  3UP5 A;  3VR8 A;  3BHK A;  2ARD A;  2JKC A;  1GRA A;  2R9Z A;  1FEC A;  2C3C A;  1H2I A;  2GB0 A;  2GMJ A;  4CBQ A;  2RGH A;  3L8K A;  4YSX A;  1E6E A;  2WP5 A;  2WU2 A;  3DME A;  5M0Z A;  3C96 A;  4A9W A;  4Z25 A;  4OPG A;  3T2Z A;  2WQY A;  3DK9 A;  3NK2 X;  1K0L A;  2XVE A;  4H2R A;  1Y56 B;  3L1R A;  1GRE A;  4NZH A;  2XVI A;  1FEA A;  3SZF A;  2A87 A;  3GYX A;  4Y4M A;  2WS3 A;  1BGJ A;  4B67 A;  4O5Q A;  1JOA A;  5CKU A;  1ZX9 A;  2R4E A;  4RG3 A;  1F8W A;  4GDP A;  2XFQ A;  2Y6R A;  2RGJ A;  2GR0 A;  3T14 A;  2YLS A;  2XYO A;  3UKA A;  1JRX A;  2JB3 A;  4YT0 A;  2GVC A;  2XLU A;  1REO A;  2XFN A;  4X9M A;  3UOX A;  4U8O A;  1TDN A;  2IID A;  2X3N A;  1D5T A;  4GCM A;  1RP0 A;  4FX9 A;  3ABV A;  4Y4N A;  1F8S A;  1Z6L A;  3ICR A;  4BV6 A;  5JCK A;  1S3B A;  1E1K A;  3SZW A;  4CCQ A;  3AEA A;  3UOY A;  4A65 A;  4HB9 A;  1GT8 A;  3GD4 A;  1CC4 A;  1W4X A;  1JNZ A;  4I59 A;  3GRS A;  1KF6 A;  3AE7 A;  2NPX A;  3O0H A;  1GET A;  4OCG A;  4Z2R A;  2GH5 A;  1TYP A;  3G5R A;  3H8I A;  1BZL A;  4H4P A;  1ZMC A;  2BCP A;  2V3B A;  1TDO A;  2QA1 A;  2VRL A;  4JY2 A;  1QJD A;  3OC4 A;  1N1P A;  1N4U A;  2YR6 A;  4UDP A;  3LZX A;  3IWA A;  3UKP A;  1GV4 A;  3CGC A;  2PHH A;  2XFO A;  3T0K A;  5U1O A;  1JU2 A;  1O94 A;  3K30 A;  5IPY A;  3BI2 A;  2C67 A;  5BVA A;  1NHS A;  3R9U A;  1V59 A;  5FS7 A;  3RP6 A;  1BKW A;  3G5S A;  1YQ3 A;  3DJE A;  1GTH A;  5IQ1 A;  1PXC A;  3CPH G;  5GSN A;  2CUL A;  3AE6 A;  2ZBW A;  3UKF A;  1KSU A;  2WEU A;  1YY5 A;  4U2T A;  4A7A A;  3FBS A;  3EPT A;  1B37 A;  2A89 A;  4MJW A;  3NYC A;  1DXL A;  2WP9 A;  2C65 A;  1UKV G;  3CIR A;  4TM3 A;  3NG7 X;  2B7S A;  1OJC A;  2C73 A;  3WE0 A;  4ZN0 A;  2EQ8 A;  2B9Y A;  1JEH A;  2OLN A;  3AE9 A;  3Q6J A;  1NG4 A;  3GYJ A;  5DBJ A;  3NKS A;  2YG5 A;  3UKK A;  2ZZB A;  3QFB A;  4EM4 A;  2TMD A;  1OJT A;  3GMC A;  3ISH A;  4WCT A;  3RED A;  2WET A;  1F8R A;  1DOD A;  3HZL A;  3T2Y A;  4H7U A;  2BXR A;  4JNA A;  1L9C A;  5TR3 A;  3FPZ A;  1L9D A;  2WPF A;  2BRY A;  2DKI A;  3AD7 B;  1GRF A;  4CY6 A;  1ZK7 A;  4AOS A;  2EQ9 A;  4FK1 A;  4U2S A;  1LQT A;  3AE1 A;  2XLP A;  3ADA B;  4BK1 A;  3NK0 X;  3V76 A;  4CY8 A;  4YTN A;  1GES A;  1PBD A;  5EOW A;  4OVI A;  4U8P A;  1XDI A;  4H4W A;  5FS8 A;  3NK1 X;  4USR A;  1KNP A;  2V3A A;  4H4T A;  3F8R A;  3P4S A;  1NHR A;  1IUX A;  1CHU A;  4JY3 A;  4ZCC A;  3LB8 A;  1GAL A;  1VG0 A;  3RNM A;  4A6N A;  3KLJ A;  1OJA A;  2OA1 A;  3NH3 X;  4GAV A;  5C3J A;  4H4Q A;  4REK A;  5EBK A;  1GPE A;  3IF9 A;  4H2N A;  3FG2 P;  5JCM A;  3S61 A;  4A5L A;  3AEC A;  1TRB A;  3AE4 A;  1N4V A;  1PN0 A;  1KN0 A;  5KXJ A;  3ALL A;  4DGK A;  1EL9 A;  3ICT A;  5KMS A;  2QAE A;  3HYX A;  5BRT A;  5IQ4 A;  1GTE A;  1K4Q A;  3BI4 A;  2YVG A;  2YG7 A;  4IVM B;  1LQU A;  3UP4 A;  5L46 A;  4EMI A;  2GQF A;  3II4 A;  1BWC A;  3AXB A;  3RP8 A;  3VQR A;  1HYU A;  2WP6 A;  3F8D A;  4APN A;  5KMQ A;  3T2K A;  2AAQ A;  1ZY8 A;  1LPF A;  1OJ9 A;  4K5R A;  1Q1R A;  5JCI A;  1M6I A;  1XHC A;  1EL7 A;  5KOX A;  1DNC A;  4H2Q A;  3OZ2 A;  4H2P A;  4CRT A;  2RAB A;  2Y6Q A;  3SY4 A;  2VVL G;  2XVH A;  2H88 A;  3V3N A;  5LV9 A;  2BYB A;  3DGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...