4BV6A

Refined crystal structure of the human apoptosis inducing factor
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
Knots found
sequence length
484
structure length
471
Chain Sequence
KAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
publication title Structural Insights Into the Coenzyme Mediated Monomer-Dimer Transition of the Pro-Apoptotic Apoptosis Inducing Factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 147
structure length 471
sequence length 484
other databases KnotProt 2.0: S -31
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4bv6A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4bv6A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4bv6A01
2WDRA 1TYPA 1RSGA 1O5WA 3VRDB 5HYMA 4J2WA 3ABVA 2WEUA 4A65A 1F6MA 3ADAB 1QJDA 4EIPA 5LV9A 3QVPA 1GV4A 5CQFA 4K22A 3ZDNA 3H4KA 3LZWA 3NIXA 1CC6A 4B67A 4ECHA 3AD7B 4A9WA 1TDOA 5IPYA 2ACZA 2TMDA 4O5UA 1O95A 3DK8A 2AR8A 2VRLA 3AE2A 3ATQA 2JB2A 1IUVA 2VQ7A 4AP1A 2FBWA 3P4QA 3BI4A 4BK2A 3UCLA 1PXAA 3SFDA 2CVJA 3P4PA 2FJEA 4USQA 3NYCA 2B76A 3D8XA 3CGDA 4CCRA 1XDIA 5HXIA 2V5ZA 1CJCA 1S2YA 1PJ7A 1LQTA 2XFNA 3GMCA 3IF9A 4K8DA 2JB3A 3QFBA 1JNRA 3LB8A 2YWLA 5FS7A 2YM2A 3F8RA 5U25A 4M52A 2GR1A 5FS9A 4H4ZA 2XVFA 4X4JA 3UTEA 3CPJG 3SM8A 3AE8A 2IVDA 5L46A 1PBFA 1PBDA 3CPHG 2C72A 4XWRA 2IIDA 1YY5A 4JDRA 4EQRA 4EMWA 3OZ2A 2YVGA 2Z5YA 3Q9TA 4YTNA 2CFYA 2FJAA 2C3DA 1GXFA 4RG3A 3AEDA 4U8IA 1B37A 4GDEA 4CNKA 3B6DA 2VZ2A 4OPTA 2WS3A 5IQ4A 3EAOA 4H4WA 4NTEA 4CBQA 1FEAA 4HB9A 4E0VA 3AXBA 3BI5A 4H2QA 4D04A 1YKJA 1H83A 1GPEA 1ZX9A 2QCUA 2WOVA 1K0IA 5U63A 4OCGA 4C3XA 1XANA 1VG9A 3NN6X 5CKUA 3NLCA 1F3PA 3AE7A 1LJ1A 1PBEA 1X31B 1M64A 2OAMA 1NENA 4YSYA 1Q1RA 5KVIA 1IUUA 4H2PA 2JKCA 2R0GA 1OJTA 2BK5A 4A5LA 4YTPA 5J60A 1TYTA 3E1TA 1FECA 2WPEA 3BI2A 3KVEA 2RGJA 4GR1A 1D4DA 3ITJA 3NHOX 3EPTA 2XFQA 1GEUA 3FG2P 1H81A 2BCGG 2R4EA 2WETA 1GRGA 5BULA 4J33A 3DGHA 3GMBA 4ZCCA 2CULA 3LZXA 4ZCDA 4B1BA 5KXJA 3RP6A 4H4SA 2XCGA 1IUTA 2WDQA 3CNDA 3UOYA 3FBSA 1BWCA 3KKJA 4I58A 4XXGA 3REDA 2Y6RA 5C3JA 1ZKQA 2B9WA 3AE4A 3AYJA 3CNJA 1TDNA 2QA2A 2TPRA 3LJPA 1Y56A 1GESA 2FJDA 4FK1C 5KRQA 2V60A 3NGCX 1PBCA 1NHQA 2BXSA 2GMJA 1LV0A 3GDPA 2WPCA 2APGA 3QSMA 4IA6A 4YSZA 4AP3A 4TM0A 3QSSA 5BUKA 3L1RA 2Q0KA 2B9XA 2VQBA 3UP4A 4O5QA 2JBVA 1NDAA 2YLWA 1E1MA 2GAHB 4K5SA 4J57A 3DJEA 2V6OA 1FL2A 4J56A 1VRQB 1YQ4A 1B4VA 2ZZ0A 1YQ3A 3H8LA 1H84A 4WCTA 3AD8B 3DK9A 4TM3A 1DXLA 3PS9A 3NNEA 2R4JA 3G5SA 2R0CA 3S5WA 1PHHA 1DJNA 3COXA 1F8SA 3P4RA 3CTYA 2JAEA 2VRMA 2C73A 2H89A 4C3YA 2AQJA 5KWFA 3V76A 1NAAA 3M12A 5M0ZA 4OPLA 1Q9IA 4EQSA 1COYA 1F8RA 2R0PA 1GT8A 3G5QA 1GNDA 2B9YA 2GEWA 2FJBA 3DH9A 2ZZCA 1AOGA 1MO9A 4WX1A 4B68A 3CNPA 2GRTA 3I3LA 4APNA 1ELIA 5GRTA 1GRAA 1EL9A 4Z2UA 1CHUA 4H4QA 1D5TA 1S3BA 4C77A 1DOEA 1ZY8A 1H7XA 1F8WA 2X99A 1IUXA 3GYJA 1GSNA 2YAUA 1KSUA 2E1MA 2BXRA 4PAAA 4EQWA 4GCMA 1GOSA 3GSIA 4P9SA 3OC4A 1CC4A 1SEZA 2YR4A 3C4NA 1ONFA 4Z25A 2NVKX 1D4CA 4Z2RA 4RSLA 2YG5A 4B65A 2XLTA 1CJ2A 1L0VA 4OPUA 2X8HA 1CJ4A 2BK4A 4H2RA 3UKAA 3UKKA 1K0JA 1V59A 5BVAA 5KOWA 1IUWA 2EQ7A 2C67A 3FPZA 4Y4MA 4C5OA 2Z5XA 3AEFA 2YVFA 5J7XA 2YR5A 1L9CA 3AB1A 2X8GA 4H4RA 1DODA 1N1PA 2XDOA 2BA9A 4B66A 2JB1A 1CJ3A 2GV8A 3I6DA 3ALLA 4H4TA 1TDEA 2GR0A 3IC9A 3ATRA 3AYLA 3AE1A 3PVCA 3K7QX 4U2SA 3V3NA 1OJCA 2VOUA 3RHAA 4IVMB 4U8NA 3R9UA 3VRBA 3D1CA 3GD3A 5DBJA 1JRYA 2C65A 2Q7VA 1LTXR 3DJDA 4BV6A 3QVRA 4EQXA 2A89A 2YG4A 1UKVG 3NYEA 3SFEA 1FOHA 3NT6A 4N9XA 3AE5A 1DOBA 1GETA 1GALA 1ZOVA 4MJWA 4YWOA 3H8IA 4IA5A 2GB0A 3KPFA 5KOXA 5KVHA 2YLXA 2YG6A 1P2HA 1MOKA 4DSHA 1JNZA 4J36A 2XLSA 2WP6A 1ZK7A 1H6VA 3K30A 4PABA 1PN0A 4B63A 4K7ZA 2WQYA 2ARDA 2QA1A 1VDCA 1ZMDA 3CGEA 4ADWA 4EM3A 4A7AA 4H2NA 1B8SA 1RP0A 2X3NA 3FMWA 2WOWA 2W0HA 1PJ5A 1ZOYA 2Q6UA 3EANA 2YG7A 4H4XA 1JRXA 2V3AA 3UTFA 5FS6A 1W4XA 5JCMA 3GDNA 1NG4A 4X9NA 3PO7A 3UP5A 4EM4A 5JCKA 2YLRA 2V61A 2C3CA 4U2TA 1NPXA 4X9MA 3AE6A 2XLUA 2YVJA 3Q6JA 5U1OA 2A8XA 4H4YA 4Z44A 4OVIA 3AEBA 4REKA 1N4UA 3P1WA 4BJZA 2WDVA 1VQWA 3ALJA 3P9UA 4C74A 4U8LA 4U8JA 4CY8A 1NHPA 2X50A 1GRBA 1E39A 3UKPA 4A6NB 5TR3A 1H7WA 1JU2A 3FIMB 4B69A 2NPXA 1S3EA 2WP9A 3C4AA 3DGZA 2GQWA 5JCNA 1TDFA 4YT0A 1L9DA 4LU6A 3CGBA 3AYIA 1FEBA 4TLZA 4J31A 2C75A 1E1NA 5JCLA 1CL0A 2YR6A 3CNSA 4Y4NA 4HA6A 2XFUA 4DSGA 1KDGA 2BC0A 1KNPA 1PBBA 2IVEA 3LADA 2WBAA 3AEEA 4BURA 2EQ8A 3QJ4A 2PHHA 2OA1A 3GYIA 4IVOB 5EB5A 4H50A 3SGLA 3CGCA 4GF7A 2VVLA 2GQFA 1BGNA 3NKSA 1E6EA 2WU2A 1XPQA 1OJAA 2XVHA 4K2XA 1LPFA 4TM1A 1EL8A 2DKHA 2B7SA 3F8DA 3QSEA 4JNQA 1YQZA 1RYIA 1B5QA 2RGOA 4ICYA 1QO8A 3ICTA 2UZZA 3UTHA 2GF3A 3P4SA 1S2QA 4Z43A 5C2TA 1BZLA 1REOA 4A79A 1GERA 2V3BA 3GWFA 4KX6A 1E7PA 3KA7A 2BS2A 3NH3X 4JY2A 2XVIA 3CN8A 1ZP0A 3ISHA 3NK2X 4CY6A 3ALMA 1OJ9A 2YLSA 3NTDA 4D03A 4NEVA 5M10A 5FMHA 1EL5A 2O9ZA 5GSNA 4JN9A 2CDUA 3DK4A 3GD4A 4LA1A 1PXCA 3G5RA 2VVLG 4GDPA 4I59A 5IQ1A 4EMJA 1FCDA 2BABA 3VQRA 1KFYA 2A87A 3RP7A 1NHRA 1DJQA 1TRBA 1LQUA 3IWAA 3CNTA 1IUSA 3VR8A 3BNUA 4NTCA 4OPIA 1GRFA 2YM1A 1HYUA 3DJJA 1Z6LA 2H88A 4RG4A 3NYFA 2PYXA 1JOAA 5EOWA 1K4QA 2EQ9A 2YLZA 4OPGA 1JEHA 1PXBA 2XVEA 2BK3A 1OJDA 1E1KA 4UDPA 2VVMA 1BF3A 1NEKA 1KNRA 3F8PA 4NZHA 3IHGA 1PDHA 3KD9A 4FK1A 1DOCA 1QLBA 3GRSA 3GRTA 3ICSA 2E5VA 1GRHA 3UKQA 3UOZA 1LVLA 3EF6A 4IV9A 4UP3A 4BJYA 2GMHA 5EB4A 4GUVA 3DA1A 4BK1A 4GRTA 2WU5A 4Z2TA 4NTDA 4H7UA 2C76A 4XWZA 5HY5A 4ZN0A 4JQ9A 1JRZA 3AECA 4USRA 1XHCA 3T37A 3UKHA 1D7YA 3BNMA 3ICRA 2OLOA 3M13A 4U8KA 4CNJA 5HHFA 1M6IA 4TM4A 2AAQA 4DGKA 1TDKA 3IHMA 1EL7A 1GRTA 2OALA 1KF6A 2XVJA 3UKLA 4JNAA 2BS4A 2R46A 4UDQA 5JCIA 2XLRA 1CBOA 4EMIA 1NHSA 1D7LA 3K7MX 5FS8A 3KU9A 2Y6QA 2WHDA 4Z24A 4A99A 1H86A 3UOVA 1D4EA 3NG7X 2C64A 2HQMA 4JY3A 1N4VA 4J34A 4Y4LA 3UKFA 2R9ZA 3NRNA 4YXDA 2J3NA 2GR2A 4LIIA 3RNMA 3NK1X 2I0ZA 3O0HA 5ER0A 4OPDA 3C96A 4Z26A 4K5RA 2QAEA 2RGHA 3K7TA 2DKIA 2XFOA 3ZYXA 3CPIG 1BKWA 1GREA 4KPRA 3NN0X 1L9EA 4AT0A 3S61A 1GTEA 3DJGX 3VRAA 4FDCB 2ZZBA 2JK6A 4H4VA 3QFAA 3LOVA 2C70A 4DNAA 4FX9A 3KLJA 2BS3A 4NEWA 1Q1WA 1N4WA 1ZDLA 1P2EA 4YKGA 4A6NA 3II4A 2XLPA 4YSHA 3VR9A 1PS9A 2E4GA 3JSKA 5BRTA 3LXDA 2F5ZA 4CCQA 3AEAA 4AOSA 3B3RA 3AE3A 4YTMA 4U8PA 1BGJA 2RABA 3AE9A 3GWDA 1DNCA 3NK0X 4EIQA 3UOXA 1Y56B 4TLXA 4BK3A 1IJHA 1E1LA 1PJ6A 2C7GA 4U2LA 4U8OA 2YQUA 3HZLA 3WE0A 2GH5A 2GAGB 2OLNA 1NG3A 3UTGA 2GR3A 3BHKA 2BCPA 1O94A 2BACA 1CC2A 1K0LA 1ZMCA 1CF3A 2WPFA 1KSSA 2YG3A 3SQPA 2X8CA 2XFPA 2XYOA 3DMEA 3NTAA 4YSXA 4U8MA 2YLTA 1MXTA 5EBKA 2B7RA 2GVCA 1H82A 2BYBA 4UDRA 4YKFA 2WESA 4CRTA 2WP5A 4AT2A 4AOXA 2C66A 3BHFA 1VG0A 3AD9B 2EQ6A 3L8KA 4H4UA 3AWIA 2R45A 3CIRA 4OPCA 1EBDA 3M0OA 3RP8A 3V3OA 4B64A 2WOIA 2Q0LA 1Y0PA 2ZBWA 4H4PA 1GTHA 3URHA 3AEGA 2BC1A
chains in the Genus database with same CATH superfamily
3N4FA 2WDRA 1TYPA 1RSGA 5HYMA 4J2WA 4A65A 3ADAB 3MWCA 4EIPA 2PGEA 1R6WA 3LZWA 4B67A 4H2HA 3ATQA 2FBWA 3VCNA 3K1GA 1H2IA 2OX4A 2QJNA 4USQA 4CCRA 1XDIA 5HXIA 1CJCA 1LQTA 2AKZA 3LB8A 2YWLA 3IK4A 3MY9A 4M52A 2GR1A 5FS9A 4H4ZA 3CPJG 3SM8A 3CPHG 3Q9TA 2CFYA 2NQLA 1B37A 1N5XA 1KD0A 2VZ2A 4OPTA 5IQ4A 4NTEA 2OFJA 4GGHA 1GPEA 1K0IA 1WYGA 2AKMA 3NN6X 5CKUA 3KUMA 2E5AA 1LJ1A 1N63C 1M64A 2OAMA 1Q1RA 1OJTA 3TWAA 4GR1A 1D4DA 4G9KA 3EPTA 3FG2P 3DGHA 4ZCCA 4ZCDA 2XCGA 1IUTA 3CNDA 3UOYA 3KKJA 1BWCA 3R0KA 3AYJA 2TPRA 3LJPA 5KRQA 2GMJA 2APGA 3QSMA 4YSZA 2XH2A 1BQGA 2B9XA 3NVVB 1T3QC 1E1MA 3H8LA 1H84A 3T2KA 4TM3A 3S5WA 1PHHA 3SQSA 4YWSA 3CTYA 2VRMA 4M6UA 3VDGA 3NFUA 3NZGA 2GRTA 4APNA 1ELIA 1D5TA 1DOEA 1H7XA 2X99A 5KMSA 1GSNA 1KSUA 2E1MA 4PAAA 2HZGA 4Z25A 2NVKX 4DWDA 1L0VA 4OPUA 1CJ4A 1K0JA 1V59A 5KOWA 3FPZA 3V3WA 4C5OA 2Z5XA 3ES8A 5J7XA 2GSHA 2X8GA 1N60C 4MGGA 1N1PA 3I6DA 4H4TA 2GR0A 3IC9A 3AE1A 3K7QX 4DHGA 2VOUA 3VRBA 3R9UA 1JRYA 2C65A 2Q7VA 4TVYA 3VC6A 3NYEA 3SFEA 1JROA 4N9XA 4YWOA 2GB0A 4J36A 4ZCWA 4GIRA 4K7ZA 1VQZA 1ZMDA 4ADWA 4EM3A 4H2NA 2X3NA 3NXLA 4DX3A 4G7FA 4H4XA 1P48A 2V61A 3D47A 2FYMA 3AE6A 3STPA 3TQPA 2A8XA 3GYXA 4REKA 3CXOA 3P1WA 4CY8A 2X50A 1GRBA 3UKPA 4A6NB 3JVAA 1JU2A 3FIMB 2NPXA 3CGBA 3AYIA 1FEBA 2C75A 4HCDA 1KNPA 2IVEA 3LADA 1EBGA 2EQ8A 2PHHA 4IVOB 2VVLA 2WU2A 3PK7A 2PSNA 3B97A 3V5CA 2DKHA 3F8DA 1RYIA 2RGOA 1MNSA 1QO8A 2O56A 1REOA 4A79A 5G5GB 1E7PA 4JY2A 3CN8A 1ZP0A 3JZUA 5M10A 2YLSA 5FMHA 3T6CA 2VVLG 5IQ1A 3UCCA 3TJ4A 1KFYA 1NHRA 1TRBA 3IWAA 3CNTA 1Z6LA 2PYXA 4FP1A 3T0KA 2EQ9A 1P43A 2BK3A 6ENLA 1NEKA 3F8PA 3QPEA 3A7AA 5FJRA 3ICSA 2E5VA 4BJYA 2C76A 4XWZA 1XHCA 4KWSA 4Z1YA 2OLOA 4U8KA 1JRPA 5HHFA 4DGKA 1JPDX 4K8GA 4EMIA 2OQHA 4Z24A 5ENLA 4J34A 4JY3A 3UKFA 3U4FA 3O0HA 2GL5A 2RGHA 3K7TA 4HN8A 4AT0A 4H4VA 3H8AA 4DNAA 1N4WA 1P2EA 2OO6A 3II4A 4YSHA 3N6HA 4MMWA 4AOSA 4YTMA 3AE9A 4Z17A 3GWDA 4BK3A 5KMPA 4U2LA 3HZLA 1S7MA 4M0XA 2GAGB 1NU5A 2PTZA 2C4CA 2BACA 1CC2A 4YSXA 1MXTA 5EBKA 1H82A 4UDRA 4CRTA 3QLDA 2WP5A 2GGIA 3CAWA 3DGBA 3AD9B 2EQ6A 4A3RA 4Z2UA 4OPCA 4B64A 2ZBWA 2PMQA 1XPQA 1N5WC 2BC1A 3VA8A 2P88A 1F6MA 2QDEA 5LV9A 3QVPA 1GV4A 5CQFA 1R0MA 3ES7A 2ACZA 1O95A 3ZLGA 2VRLA 2JB2A 4AP1A 3NS1B 3BI4A 4BK2A 3UCLA 1PXAA 3SFDA 2CVJA 2FJEA 1JNRA 4II2A 3AE8A 1PBDA 2C72A 1YY5A 3OZ2A 4NNJA 4YTNA 2C3DA 5JRBA 4U8IA 2GGGA 4GDEA 3B6DA 3HPFA 2HNEA 1FEAA 3AXBA 3BI5A 1YKJA 3OW1A 2QCUA 3NLCA 3FVDA 2XH4A 2PODA 4YSYA 5KVIA 4H2PA 1TYTA 3E1TA 2RGJA 3ITJA 1H81A 2BCGG 2R4EA 1GRGA 1JCTA 5KXJA 3RP6A 1SJBA 4I58A 2PU1A 1ZXIC 3R1ZA 3ZLFA 1TDNA 4FK1C 2V60A 1NHQA 2W54A 3GDPA 5BUKA 3DERA 3L1RA 3SZCA 4O5QA 2JBVA 1NDAA 2YLWA 2QQ6A 2GAHB 3DJEA 2V6OA 3HW2A 1YQ4A 1B4VA 3AD8B 4IP5A 1DXLA 3SBFA 3SZ0A 3NNEA 1DJNA 3N6JA 2PCEA 2JAEA 2H89A 5KWFA 3V76A 4H19A 1COYA 1F8RA 1GT8A 3G5QA 2GEWA 3IJLA 2ZZCA 3T14A 3CYJA 3ZVIA 3CNPA 4B68A 1CHUA 4HCHA 2P8CA 2YAUA 2BXRA 1JPMA 3GSIA 2ONEA 1CC4A 2YR4A 1ONFA 4RSLA 4B65A 4H2RA 4E4UA 3UKKA 1IUWA 2EQ7A 2DW6A 2C67A 3SN4A 2YR5A 4H4RA 1DODA 2XDOA 4B66A 1CJ3A 3ALLA 3PVCA 1MDLA 4EQXA 1KKOA 4GYPA 3AE5A 2MUCA 4IA5A 2YLXA 1MOKA 2GDQA 1ZK7A 3T9PA 3SN0A 2ARDA 1MUCA 3FMWA 1ZOYA 1JRXA 3DESA 2OZ8A 5JCMA 1FHVA 1N62C 1NG4A 2QVHA 2YLRA 4U2TA 4X9MA 2YVJA 3Q6JA 2OLAA 1IYXA 1VQWA 1RM6B 1H7WA 3C4AA 1X2GA 1L9DA 4LU6A 2RDXA 4TLZA 3CNSA 1CL0A 1E1NA 4Y4NA 4HA6A 1PBBA 1TZZA 3AEEA 2OA1A 3SGLA 1BGNA 4II3A 2B7SA 3ZLHA 5BOEA 3ICTA 3UTHA 5C2TA 3DG3A 3VFCA 3GWFA 4KX6A 4J1OA 3PFRA 4CY6A 1OJ9A 3NTDA 2O9ZA 4JN9A 3G5RA 4GDPA 3CK5A 4HPNA 5EU9A 1LQUA 2BRAA 4NTCA 3DJJA 3NYFA 2PTWA 3S5SA 3OZYA 1BF3A 3KD9A 4FK1A 1DOCA 1QLBA 3UKQA 4IV9A 1SJCA 2GMHA 4GUVA 4BK1A 4GRTA 3EUB3 4NTDA 3DFYA 4JQ9A 1JRZA 3AECA 3T37A 4GISA 3H70A 3SX6A 4CNJA 3H12A 1TDKA 1EL7A 2P8BA 2XVJA 4JNAA 2BS4A 1SJDA 2R46A 3KU9A 1BKHA 2WHDA 4A99A 1H86A 2QDDA 3Q4DA 1F9CA 2HQMA 1XPYA 4Y4LA 3NRNA 2I5QA 2GR2A 4LIIA 3NK1X 1W6TA 4OPDA 3SSZA 4K5RA 1KN0A 3IJQA 3OPSA 2XFOA 3ZYXA 3NVWB 1GTEA 2ZZBA 3QFAA 3HYXA 3PWIA 3GC2A 3KLJA 3R10A 1PDZA 3JSKA 4CCQA 3B3RA 4U8PA 1BGJA 2RABA 1DNCA 3UOXA 1PJ6A 3QKEA 2YQUA 3WE0A 4J3ZA 2OLNA 3UTGA 1K0LA 1ZMCA 1CF3A 1KSSA 3OTRA 3SQPA 2X8CA 3DMEA 3NTAA 4U8MA 2YLTA 2BYBA 4YKFA 4AT2A 4AOXA 1VG0A 3M0OA 5G5HB 2WOIA 2Q0LA 1GTHA 3RGTA 1ECQA 1O5WA 4IP4A 2AL1A 2XH0A 4K22A 5FJUA 3H4KA 3ZDNA 3NIXA 3AD7B 4A9WA 4G73A 4O5UA 3AE2A 3P4PA 3NYCA 2B76A 4JN7A 3D8XA 3CGDA 2HXUA 3L5OA 2ZADA 2V5ZA 3GMCA 4K8DA 2PPGA 2YM2A 3TTEA 5L46A 2E3TA 2IIDA 4JDRA 1ELSA 4RG3A 3AEDA 4CNKA 3EAOA 2PU0A 4HB9A 4E0VA 4D04A 1H83A 1ZX9A 2WOVA 1MDRA 4OCGA 2P0IA 1F3PA 3AE7A 4IHCA 1IUUA 2JKCA 4A5LA 4YTPA 5J60A 1FECA 2WPEA 3BI2A 3NHOX 2WETA 1FO4A 2CULA 4B1BA 3SY4A 4H4SA 3HYVA 2WDQA 3FBSA 4XXGA 2W3SA 3DG6A 2Y6RA 5C3JA 3AE4A 3AM9A 3DG7A 1Y56A 1GESA 2FJDA 3NGCX 1DTNA 1PBCA 2BXSA 3Q45A 4DXKA 3TW9A 3V4BA 2VQBA 4GYPC 3QN3A 3ZVHA 4K5SA 3P0WA 4J57A 1YQ3A 4J56A 3P3BA 3MKCA 3PS9A 1EC7A 3FV9A 2R4JA 3AMZA 3UJEA 1F8SA 3OP2A 3P4RA 3TWBA 3DIPA 2C73A 4C3YA 2AQJA 1NAAA 3M12A 4ZOHB 4FI4A 2R0PA 3R07C 3DH9A 3I3LA 5GRTA 1GRAA 4H4QA 1ZY8A 4EQWA 3NVYB 4GCMA 1GOSA 4E8GA 4P9SA 3CXBA 1SEZA 5J04A 1D4CA 3UGVA 2XLTA 1CJ2A 2PP1A 2X8HA 3UKAA 5BVAA 3TCSA 3R11A 1ONEA 4MKSA 3PG6A 1N61C 3AB1A 2JB1A 2GV8A 4K2SA 1PDYA 3V3NA 2FKPA 3ATRA 3H7VA 1OJCA 2W55A 5IDZA 3GD3A 3UXKA 3DJDA 4BV6A 2YG4A 1UKVG 1FOHA 3NT6A 1GALA 1ZOVA 4MJWA 3H8IA 1P2HA 4DSHA 2XLSA 1H6VA 1PN0A 2QA1A 1VDCA 4A7AA 1B8SA 1RP0A 2WOWA 2W0HA 3HYWA 1PJ5A 1SJAA 3UTFA 4X9NA 2C3CA 3V5FA 3SR6B 5U1OA 4Z44A 1N4UA 2WDVA 4C74A 4U8LA 4U8JA 1NHPA 1E39A 3SZFA 5TR3A 3SYIA 4B69A 1S3EA 3DGZA 5FJPA 4IL0A 5JCNA 1TDFA 3IJIA 4J31A 3CB3A 1NELA 3SJNA 2YR6A 2XFUA 4DSGA 1KDGA 3QJ4A 5EB5A 4H50A 4GF7A 2GQFA 1MRAA 1OJAA 4K2XA 1LPFA 1EL8A 4Z43A 5KMQA 1S2QA 1GERA 2OZ3A 2V3BA 3KA7A 3NH3X 2BS2A 1V97A 5KOXA 3NK2X 4D03A 1RVKA 3ALMA 3UJFA 1EL5A 5GSNA 2CDUA 3DK4A 1PXCA 4EMJA 3RP7A 1DJQA 4OPIA 2YM1A 5EOWA 2YLZA 1KCZA 4OPGA 3R25A 3GD6A 1PXBA 2XVEA 3BSMA 1OJDA 1E1KA 4UDPA 2VVMA 1KNRA 4NZHA 3IHGA 3T4WA 3FYYA 3I6TA 3GRSA 4ROPA 1GRHA 3UOZA 1LVLA 5EB4A 3DA1A 4Z2TA 4USRA 3BNMA 3A7UA 3ETRB 4TM4A 2AAQA 3IHMA 2XGZA 4ENLA 2OALA 1KF6A 5JCIA 2XLRA 1D7LA 3K7MX 4H83A 5FS8A 3GO2A 3UOVA 2PA6A 1D4EA 3NG7X 1N4VA 2OKTA 2J3NA 2PS2A 3CMMA 3RNMA 2I0ZA 5ER0A 3OZMA 4Z26A 3RR1A 4A35A 3JW7A 3CPIG 1BKWA 1L9EA 3S61A 3DJGX 3VRAA 2XH7A 2CHRA 3BJSA 3LOVA 2C70A 3T2YA 4FX9A 3RITA 1SB3B 1ZDLA 2XLPA 2DW7A 4K1WA 3D9XA 3LXDA 2F5ZA 3MSYA 3AEAA 2QJMA 1YEYA 4EIQA 2AL2A 1Y56B 4TLXA 1IJHA 1FFUC 2HXTA 1O94A 2ZC8A 2YG3A 3ZVHB 2XYOA 1OEPA 3MUCA 2GGEA 4DN1A 2C66A 3UJ2A 3CT2A 4H4UA 3AWIA 3CIRA 3RP8A 2WP9A 3URHA 3GY1A 3NVZB 3VRDB 3ABVA 2WEUA 1QJDA 1CC6A 5KMRA 4ECHA 5IPYA 1TDOA 2TMDA 3DK8A 2AR8A 3SXIA 5FJTA 1IUVA 2VQ7A 3N4EA 3HRDC 4EWJA 3P4QA 1WUEA 1S2YA 1PJ7A 2XFNA 3IF9A 2JB3A 3QFBA 3DEQA 4G8TA 5FS7A 3F8RA 2OZTA 5U25A 3EEZA 2XVFA 4X4JA 3UTEA 2IVDA 3NRZB 1PBFA 4XWRA 4EQRA 4EMWA 2YVGA 2Z5YA 2FJAA 1GXFA 3PWGA 2WS3A 4H4WA 4CBQA 2PP3A 1EC8A 4H2QA 1VDVA 3RRAA 5U63A 3T2ZA 4C3XA 1XANA 2POZA 1VG9A 3VCCA 1PBEA 1X31B 2MNRA 1NENA 1EC9A 2R0GA 3KPKA 2BK5A 2QGYA 4DYEA 3KVEA 2XFQA 1GEUA 5BULA 4J33A 3GMBA 3LZXA 2W3RA 4HYRA 3REDA 3AN1A 1ZKQA 2P3ZA 2B9WA 3CNJA 2QA2A 2OG9A 4KEMA 1LV0A 2WPCA 4JHMA 4IZGA 4IA6A 4AP3A 4X2PA 3QSSA 4TM0A 4KPLA 2Q0KA 3UP4A 3P93A 1TE6A 4GFIA 1FL2A 1VRQB 4WCTA 2ZZ0A 3DK9A 3G5SA 2R0CA 3COXA 2PTXA 3THUA 4IL2A 5M0ZA 1EBHA 4E4FA 4OPLA 1Q9IA 3R0UA 4EQSA 5KNLA 1GNDA 2B9YA 2FJBA 1AOGA 1MO9A 3TJIA 4WX1A 1EL9A 1S3BA 4G6HA 3NO1A 4IT1A 4C77A 1F8WA 1IUXA 3GYJA 3UJRA 1E9IA 4A6GA 3OC4A 3C4NA 4Z2RA 1STZA 2YG5A 3I4KA 4F4RA 2BK4A 3T8QA 4Y4MA 3AEFA 2YVFA 1L9CA 5FJOA 2BA9A 4HNLA 1TDEA 3AYLA 4U2SA 3RHAA 4IVMB 4U8NA 3D1CA 5DBJA 3DDMA 1LTXR 3QVRA 2A89A 3A7RA 1DOBA 1GETA 3KPFA 5KVHA 2YG6A 4H1ZA 1JNZA 4JN8A 2WP6A 3K30A 4PABA 4B63A 1KKRA 4GAVA 2WQYA 3CGEA 3UJSA 4E5TA 4GMEA 2Q6UA 2YG7A 3EANA 2V3AA 5FS6A 1W4XA 3GDNA 3PO7A 3UP5A 4EM4A 5JCKA 1FIQB 1NPXA 2XLUA 4H4YA 4OVIA 3AEBA 4BJZA 3ALJA 3P9UA 4G74A 2PGWA 2GQWA 4YT0A 3MZNA 4GGBA 2AL2B 5JCLA 2OQYA 1X2HA 2BC0A 2WBAA 4BURA 1FFVC 3ENLA 3GYIA 3SZWA 3CGCA 3NKSA 1E6EA 1L8PA 2XVHA 1WUFA 4TM1A 3QSEA 4JNQA 3RCYA 1YQZA 4ICYA 1B5QA 4HNCA 1TKKA 3DFHA 2UZZA 2GF3A 3P4SA 1BZLA 3RO6A 2XVIA 3ISHA 4NEVA 3GD4A 4LA1A 5BOFA 4I59A 4E6MA 1FCDA 2BABA 3VQRA 2A87A 3VR8A 1IUSA 3BNUA 1GRFA 4GAPA 1HYUA 2H88A 4RG4A 4KT2A 1JOAA 1K4QA 3FCPA 2PP0A 1JEHA 1JDFA 2PTYA 1PDHA 3GRTA 3VC5A 3EF6A 4UP3A 2QJJA 2WU5A 5HY5A 4H7UA 4ZN0A 3UKHA 1D7YA 3ICRA 3M13A 3UCDA 1M6IA 1GRTA 2OPJA 3T31A 3U9IA 3UKLA 4UDQA 3I6EA 4G6GA 4NWZA 1CBOA 1NHSA 2Y6QA 2XSXA 2C64A 4TVWA 7ENLA 2R9ZA 4YXDA 1XS2A 3MQTA 3SN1A 3C96A 2QAEA 2DKIA 2BRYA 3NN0X 1GREA 4KPRA 4FDCB 3BOXA 4HCLA 2JK6A 3QTPA 3FXGA 2BS3A 4NEWA 1Q1WA 4YKGA 4A6NA 3VR9A 1PS9A 2E4GA 5BRTA 2OVLA 3AE3A 3NK0X 2C7GA 1FHUA 1E1LA 3UXLA 4U8OA 2GH5A 1NG3A 3B9JB 2GR3A 3BHKA 2BCPA 4ZA0A 3TOYA 2WPFA 2GGJA 2XFPA 3FJ4A 2B7RA 2GVCA 2WESA 3BHFA 3EKGA 2GGHA 3L8KA 2R45A 1EBDA 3V3OA 1Y0PA 3D46A 4H4PA 3AEGA 3S47A
chains in the Genus database with same CATH topology
2WDRA 1TYPA 1RSGA 1O5WA 3VRDB 5HYMA 4J2WA 3ABVA 2WEUA 4A65A 1F6MA 3ADAB 1QJDA 4EIPA 5LV9A 3QVPA 1GV4A 5CQFA 4K22A 3ZDNA 3H4KA 3LZWA 3NIXA 1CC6A 5KMRA 4B67A 4ECHA 3AD7B 4A9WA 1TDOA 5IPYA 2ACZA 2TMDA 4G73A 4O5UA 1O95A 3DK8A 2AR8A 3SXIA 2VRLA 3AE2A 3ATQA 2JB2A 1IUVA 2VQ7A 4AP1A 2FBWA 3P4QA 3BI4A 4BK2A 3UCLA 1PXAA 3SFDA 2CVJA 3P4PA 1H2IA 2FJEA 4USQA 3NYCA 2B76A 3D8XA 3CGDA 4CCRA 3L5OA 1XDIA 5HXIA 2V5ZA 1CJCA 1S2YA 1PJ7A 1LQTA 2XFNA 3GMCA 3IF9A 4K8DA 2JB3A 3QFBA 1JNRA 3LB8A 2YWLA 5FS7A 2YM2A 3F8RA 5U25A 4M52A 2GR1A 5FS9A 4H4ZA 2XVFA 4X4JA 3UTEA 3CPJG 4II2A 3AE8A 2IVDA 3SM8A 5L46A 1PBFA 1PBDA 3CPHG 2C72A 4XWRA 2IIDA 1YY5A 4JDRA 4EQRA 4EMWA 3OZ2A 2YVGA 2Z5YA 3Q9TA 4NNJA 2CFYA 4YTNA 2FJAA 2C3DA 1GXFA 5JRBA 4RG3A 3AEDA 4U8IA 1B37A 4GDEA 4CNKA 3B6DA 2VZ2A 4OPTA 2WS3A 5IQ4A 3EAOA 4H4WA 4NTEA 4CBQA 1FEAA 4HB9A 4E0VA 3AXBA 3BI5A 4H2QA 4D04A 1YKJA 1H83A 1GPEA 1ZX9A 2QCUA 2WOVA 1K0IA 5U63A 4OCGA 3T2ZA 4C3XA 1XANA 1VG9A 3NN6X 5CKUA 3NLCA 1F3PA 3AE7A 1LJ1A 1PBEA 1X31B 1M64A 2OAMA 1NENA 4YSYA 1Q1RA 5KVIA 1IUUA 4H2PA 2JKCA 2R0GA 1OJTA 3KPKA 2BK5A 4A5LA 4YTPA 5J60A 1TYTA 3E1TA 1FECA 2WPEA 3BI2A 3KVEA 2RGJA 4GR1A 1D4DA 3ITJA 3NHOX 4G9KA 3EPTA 2XFQA 1GEUA 3FG2P 1H81A 2BCGG 2R4EA 2WETA 1GRGA 5BULA 4J33A 3DGHA 3GMBA 4ZCCA 2CULA 3LZXA 4ZCDA 4B1BA 5KXJA 3RP6A 3SY4A 4H4SA 3HYVA 2XCGA 1IUTA 2WDQA 3CNDA 3UOYA 3FBSA 1BWCA 3KKJA 4I58A 4XXGA 3REDA 2Y6RA 5C3JA 1ZKQA 2B9WA 3AE4A 3AYJA 3CNJA 1TDNA 2QA2A 2TPRA 3LJPA 1Y56A 1GESA 2FJDA 4FK1C 5KRQA 2V60A 3NGCX 1PBCA 1NHQA 2BXSA 2GMJA 1LV0A 3GDPA 2WPCA 2APGA 3QSMA 4IA6A 4YSZA 4AP3A 4TM0A 3QSSA 5BUKA 3L1RA 2Q0KA 2B9XA 2VQBA 3UP4A 3SZCA 4O5QA 2JBVA 1NDAA 2YLWA 1E1MA 2GAHB 4K5SA 4J57A 3DJEA 2V6OA 1FL2A 4J56A 1VRQB 1YQ4A 1B4VA 2ZZ0A 1YQ3A 3H8LA 1H84A 4WCTA 3AD8B 3T2KA 3DK9A 4TM3A 1DXLA 3PS9A 3SZ0A 3NNEA 2R4JA 3G5SA 2R0CA 3S5WA 1PHHA 1DJNA 3COXA 1F8SA 3P4RA 3CTYA 2JAEA 2VRMA 2C73A 2H89A 4C3YA 2AQJA 5KWFA 3V76A 1NAAA 3M12A 5M0ZA 4OPLA 1Q9IA 4EQSA 1COYA 1F8RA 5KNLA 2R0PA 1GT8A 3G5QA 1GNDA 2B9YA 2GEWA 2FJBA 3DH9A 2ZZCA 3T14A 1AOGA 1MO9A 4WX1A 4B68A 3CNPA 2GRTA 3I3LA 4APNA 1ELIA 5GRTA 1GRAA 1EL9A 4Z2UA 1CHUA 4H4QA 1D5TA 1S3BA 4G6HA 4C77A 1DOEA 1ZY8A 1H7XA 1F8WA 2X99A 1IUXA 3GYJA 1GSNA 2YAUA 5KMSA 1KSUA 2E1MA 2BXRA 4PAAA 4EQWA 4GCMA 1GOSA 3GSIA 4P9SA 3OC4A 1CC4A 1SEZA 2YR4A 3C4NA 1ONFA 4Z25A 2NVKX 1D4CA 4Z2RA 4RSLA 2YG5A 4B65A 2XLTA 1CJ2A 1L0VA 4OPUA 2X8HA 1CJ4A 2BK4A 4H2RA 3UKAA 3UKKA 1K0JA 1V59A 5BVAA 5KOWA 1IUWA 2EQ7A 2C67A 3PG6A 3FPZA 4Y4MA 4C5OA 2Z5XA 3AEFA 2YVFA 5J7XA 2YR5A 1L9CA 3AB1A 2X8GA 4H4RA 1DODA 1N1PA 2XDOA 2BA9A 4B66A 2JB1A 1CJ3A 2GV8A 3I6DA 3ALLA 4H4TA 1TDEA 2GR0A 3IC9A 3ATRA 3AYLA 3AE1A 3PVCA 3K7QX 4U2SA 3V3NA 1OJCA 2VOUA 3RHAA 4IVMB 4U8NA 3R9UA 3VRBA 3D1CA 3GD3A 5DBJA 1JRYA 2C65A 2Q7VA 1LTXR 3DJDA 4BV6A 3QVRA 4EQXA 2A89A 2YG4A 1UKVG 3NYEA 3SFEA 1FOHA 3NT6A 4N9XA 3AE5A 1DOBA 1GETA 1GALA 1ZOVA 4MJWA 4YWOA 3H8IA 4IA5A 2GB0A 3KPFA 5KOXA 5KVHA 2YLXA 2YG6A 1P2HA 1MOKA 4DSHA 1JNZA 4J36A 2XLSA 2WP6A 1ZK7A 1H6VA 3K30A 4PABA 1PN0A 4B63A 4K7ZA 4GAVA 2WQYA 2ARDA 2QA1A 1VDCA 1ZMDA 3CGEA 4ADWA 4EM3A 4A7AA 4H2NA 1B8SA 1RP0A 2X3NA 3FMWA 2WOWA 2W0HA 3HYWA 1PJ5A 1ZOYA 2Q6UA 3EANA 2YG7A 4H4XA 1JRXA 2V3AA 3UTFA 5FS6A 1W4XA 5JCMA 3GDNA 1NG4A 4X9NA 3PO7A 3UP5A 4EM4A 5JCKA 2YLRA 2V61A 2C3CA 4U2TA 1NPXA 4X9MA 3AE6A 2XLUA 2YVJA 3Q6JA 5U1OA 2A8XA 4H4YA 3GYXA 4Z44A 4OVIA 3AEBA 4REKA 1N4UA 3P1WA 4BJZA 2WDVA 1VQWA 3ALJA 3P9UA 4C74A 4U8LA 4U8JA 4CY8A 1NHPA 2X50A 4G74A 1GRBA 1E39A 3SZFA 3UKPA 4A6NB 5TR3A 1H7WA 1JU2A 3FIMB 3SYIA 4B69A 2NPXA 1S3EA 2WP9A 3C4AA 3DGZA 2GQWA 5JCNA 1TDFA 4YT0A 1L9DA 4LU6A 3CGBA 3AYIA 1FEBA 4TLZA 4J31A 2C75A 1E1NA 5JCLA 1CL0A 2YR6A 3CNSA 4Y4NA 4HA6A 2XFUA 4DSGA 1KDGA 2BC0A 1KNPA 1PBBA 2IVEA 3LADA 2WBAA 3AEEA 4BURA 2EQ8A 3QJ4A 2PHHA 2OA1A 3GYIA 4IVOB 5EB5A 4H50A 3SGLA 3SZWA 3CGCA 4GF7A 2VVLA 2GQFA 1BGNA 3NKSA 1E6EA 2WU2A 1XPQA 1OJAA 4II3A 2XVHA 4K2XA 1LPFA 4TM1A 1EL8A 2DKHA 2B7SA 3F8DA 3QSEA 4JNQA 1YQZA 1RYIA 1B5QA 2RGOA 4ICYA 1QO8A 3ICTA 2UZZA 3UTHA 2GF3A 3P4SA 1S2QA 5KMQA 4Z43A 1BZLA 5C2TA 1REOA 4A79A 1GERA 2V3BA 3GWFA 4KX6A 1E7PA 3KA7A 2BS2A 3NH3X 4JY2A 2XVIA 3CN8A 1ZP0A 3ISHA 3NK2X 4CY6A 3ALMA 1OJ9A 2YLSA 3NTDA 4D03A 4NEVA 5M10A 5FMHA 1EL5A 2O9ZA 5GSNA 4JN9A 2CDUA 3DK4A 3GD4A 4LA1A 1PXCA 3G5RA 2VVLG 4GDPA 4I59A 5IQ1A 4EMJA 1FCDA 2BABA 3VQRA 1KFYA 2A87A 3RP7A 1NHRA 1DJQA 1TRBA 1LQUA 3IWAA 2BRAA 1IUSA 3CNTA 3BNUA 4NTCA 3VR8A 4OPIA 1GRFA 2YM1A 4GAPA 1HYUA 3DJJA 1Z6LA 2H88A 4RG4A 3NYFA 2PYXA 1JOAA 5EOWA 1K4QA 3T0KA 2EQ9A 2YLZA 4OPGA 1JEHA 1PXBA 2XVEA 2BK3A 1OJDA 1E1KA 4UDPA 2VVMA 1BF3A 1NEKA 1KNRA 3F8PA 4NZHA 3IHGA 1PDHA 3KD9A 4FK1A 1DOCA 1QLBA 3GRSA 3GRTA 3ICSA 2E5VA 1GRHA 3UKQA 3UOZA 1LVLA 3EF6A 4IV9A 4UP3A 4BJYA 2GMHA 5EB4A 4GUVA 3DA1A 4BK1A 4GRTA 2WU5A 4Z2TA 4NTDA 4H7UA 2C76A 4XWZA 5HY5A 4ZN0A 4JQ9A 1JRZA 3AECA 4USRA 1XHCA 3T37A 3UKHA 1D7YA 3BNMA 3ICRA 2OLOA 3M13A 4U8KA 3SX6A 4CNJA 5HHFA 1M6IA 4TM4A 2AAQA 4DGKA 1TDKA 3IHMA 1EL7A 1GRTA 3T31A 2OALA 1KF6A 2XVJA 3UKLA 4JNAA 2BS4A 2R46A 4UDQA 4G6GA 5JCIA 2XLRA 1CBOA 4NWZA 4EMIA 1NHSA 1D7LA 3K7MX 5FS8A 3KU9A 2Y6QA 2WHDA 4Z24A 4A99A 1H86A 3UOVA 1D4EA 3NG7X 2C64A 2HQMA 4JY3A 1N4VA 4J34A 4Y4LA 3UKFA 2R9ZA 3NRNA 4YXDA 2J3NA 3CMMA 2GR2A 4LIIA 3RNMA 3NK1X 2I0ZA 3O0HA 5ER0A 4OPDA 3C96A 4Z26A 4K5RA 2QAEA 2RGHA 3K7TA 2DKIA 2BRYA 1KN0A 2XFOA 3ZYXA 3CPIG 1BKWA 1GREA 4KPRA 3NN0X 1L9EA 4AT0A 3S61A 1GTEA 3DJGX 3VRAA 4FDCB 2ZZBA 2JK6A 4H4VA 3QFAA 3HYXA 3LOVA 2C70A 4DNAA 3T2YA 4FX9A 3KLJA 2BS3A 4NEWA 1Q1WA 1N4WA 1ZDLA 1P2EA 4YKGA 4A6NA 3II4A 2XLPA 4YSHA 3VR9A 1PS9A 2E4GA 3D9XA 3JSKA 5BRTA 3LXDA 2F5ZA 4CCQA 3AEAA 4AOSA 3B3RA 3AE3A 4YTMA 4U8PA 1BGJA 2RABA 3AE9A 3GWDA 1DNCA 3NK0X 4EIQA 3UOXA 1Y56B 4TLXA 4BK3A 1IJHA 1E1LA 1PJ6A 2C7GA 4U2LA 5KMPA 4U8OA 2YQUA 3HZLA 1S7MA 3WE0A 2GH5A 2GAGB 2OLNA 1NG3A 3UTGA 2GR3A 3BHKA 2BCPA 2C4CA 1O94A 2BACA 1CC2A 1K0LA 1ZMCA 1CF3A 2WPFA 1KSSA 2YG3A 3SQPA 2X8CA 2XFPA 2XYOA 3DMEA 3NTAA 4YSXA 4U8MA 2YLTA 1MXTA 5EBKA 2B7RA 2GVCA 1H82A 2BYBA 4UDRA 4YKFA 2WESA 4CRTA 2WP5A 4AT2A 4AOXA 2C66A 3BHFA 1VG0A 3AD9B 2EQ6A 3L8KA 4H4UA 3AWIA 2R45A 3CIRA 4OPCA 1EBDA 3M0OA 3RP8A 3V3OA 4B64A 2WOIA 2Q0LA 1Y0PA 2ZBWA 4H4PA 1GTHA 3URHA 3AEGA 2BC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WDR A;  1TYP A;  1RSG A;  1O5W A;  3VRD B;  5HYM A;  4J2W A;  3ABV A;  2WEU A;  4A65 A;  1F6M A;  3ADA B;  1QJD A;  4EIP A;  5LV9 A;  3QVP A;  1GV4 A;  5CQF A;  4K22 A;  3ZDN A;  3H4K A;  3LZW A;  3NIX A;  1CC6 A;  4B67 A;  4ECH A;  3AD7 B;  4A9W A;  1TDO A;  5IPY A;  2ACZ A;  2TMD A;  4O5U A;  1O95 A;  3DK8 A;  2AR8 A;  2VRL A;  3AE2 A;  3ATQ A;  2JB2 A;  1IUV A;  2VQ7 A;  4AP1 A;  2FBW A;  3P4Q A;  3BI4 A;  4BK2 A;  3UCL A;  1PXA A;  3SFD A;  2CVJ A;  3P4P A;  2FJE A;  4USQ A;  3NYC A;  2B76 A;  3D8X A;  3CGD A;  4CCR A;  1XDI A;  5HXI A;  2V5Z A;  1CJC A;  1S2Y A;  1PJ7 A;  1LQT A;  2XFN A;  3GMC A;  3IF9 A;  4K8D A;  2JB3 A;  3QFB A;  1JNR A;  3LB8 A;  2YWL A;  5FS7 A;  2YM2 A;  3F8R A;  5U25 A;  4M52 A;  2GR1 A;  5FS9 A;  4H4Z A;  2XVF A;  4X4J A;  3UTE A;  3CPJ G;  3SM8 A;  3AE8 A;  2IVD A;  5L46 A;  1PBF A;  1PBD A;  3CPH G;  2C72 A;  4XWR A;  2IID A;  1YY5 A;  4JDR A;  4EQR A;  4EMW A;  3OZ2 A;  2YVG A;  2Z5Y A;  3Q9T A;  4YTN A;  2CFY A;  2FJA A;  2C3D A;  1GXF A;  4RG3 A;  3AED A;  4U8I A;  1B37 A;  4GDE A;  4CNK A;  3B6D A;  2VZ2 A;  4OPT A;  2WS3 A;  5IQ4 A;  3EAO A;  4H4W A;  4NTE A;  4CBQ A;  1FEA A;  4HB9 A;  4E0V A;  3AXB A;  3BI5 A;  4H2Q A;  4D04 A;  1YKJ A;  1H83 A;  1GPE A;  1ZX9 A;  2QCU A;  2WOV A;  1K0I A;  5U63 A;  4OCG A;  4C3X A;  1XAN A;  1VG9 A;  3NN6 X;  5CKU A;  3NLC A;  1F3P A;  3AE7 A;  1LJ1 A;  1PBE A;  1X31 B;  1M64 A;  2OAM A;  1NEN A;  4YSY A;  1Q1R A;  5KVI A;  1IUU A;  4H2P A;  2JKC A;  2R0G A;  1OJT A;  2BK5 A;  4A5L A;  4YTP A;  5J60 A;  1TYT A;  3E1T A;  1FEC A;  2WPE A;  3BI2 A;  3KVE A;  2RGJ A;  4GR1 A;  1D4D A;  3ITJ A;  3NHO X;  3EPT A;  2XFQ A;  1GEU A;  3FG2 P;  1H81 A;  2BCG G;  2R4E A;  2WET A;  1GRG A;  5BUL A;  4J33 A;  3DGH A;  3GMB A;  4ZCC A;  2CUL A;  3LZX A;  4ZCD A;  4B1B A;  5KXJ A;  3RP6 A;  4H4S A;  2XCG A;  1IUT A;  2WDQ A;  3CND A;  3UOY A;  3FBS A;  1BWC A;  3KKJ A;  4I58 A;  4XXG A;  3RED A;  2Y6R A;  5C3J A;  1ZKQ A;  2B9W A;  3AE4 A;  3AYJ A;  3CNJ A;  1TDN A;  2QA2 A;  2TPR A;  3LJP A;  1Y56 A;  1GES A;  2FJD A;  4FK1 C;  5KRQ A;  2V60 A;  3NGC X;  1PBC A;  1NHQ A;  2BXS A;  2GMJ A;  1LV0 A;  3GDP A;  2WPC A;  2APG A;  3QSM A;  4IA6 A;  4YSZ A;  4AP3 A;  4TM0 A;  3QSS A;  5BUK A;  3L1R A;  2Q0K A;  2B9X A;  2VQB A;  3UP4 A;  4O5Q A;  2JBV A;  1NDA A;  2YLW A;  1E1M A;  2GAH B;  4K5S A;  4J57 A;  3DJE A;  2V6O A;  1FL2 A;  4J56 A;  1VRQ B;  1YQ4 A;  1B4V A;  2ZZ0 A;  1YQ3 A;  3H8L A;  1H84 A;  4WCT A;  3AD8 B;  3DK9 A;  4TM3 A;  1DXL A;  3PS9 A;  3NNE A;  2R4J A;  3G5S A;  2R0C A;  3S5W A;  1PHH A;  1DJN A;  3COX A;  1F8S A;  3P4R A;  3CTY A;  2JAE A;  2VRM A;  2C73 A;  2H89 A;  4C3Y A;  2AQJ A;  5KWF A;  3V76 A;  1NAA A;  3M12 A;  5M0Z A;  4OPL A;  1Q9I A;  4EQS A;  1COY A;  1F8R A;  2R0P A;  1GT8 A;  3G5Q A;  1GND A;  2B9Y A;  2GEW A;  2FJB A;  3DH9 A;  2ZZC A;  1AOG A;  1MO9 A;  4WX1 A;  4B68 A;  3CNP A;  2GRT A;  3I3L A;  4APN A;  1ELI A;  5GRT A;  1GRA A;  1EL9 A;  4Z2U A;  1CHU A;  4H4Q A;  1D5T A;  1S3B A;  4C77 A;  1DOE A;  1ZY8 A;  1H7X A;  1F8W A;  2X99 A;  1IUX A;  3GYJ A;  1GSN A;  2YAU A;  1KSU A;  2E1M A;  2BXR A;  4PAA A;  4EQW A;  4GCM A;  1GOS A;  3GSI A;  4P9S A;  3OC4 A;  1CC4 A;  1SEZ A;  2YR4 A;  3C4N A;  1ONF A;  4Z25 A;  2NVK X;  1D4C A;  4Z2R A;  4RSL A;  2YG5 A;  4B65 A;  2XLT A;  1CJ2 A;  1L0V A;  4OPU A;  2X8H A;  1CJ4 A;  2BK4 A;  4H2R A;  3UKA A;  3UKK A;  1K0J A;  1V59 A;  5BVA A;  5KOW A;  1IUW A;  2EQ7 A;  2C67 A;  3FPZ A;  4Y4M A;  4C5O A;  2Z5X A;  3AEF A;  2YVF A;  5J7X A;  2YR5 A;  1L9C A;  3AB1 A;  2X8G A;  4H4R A;  1DOD A;  1N1P A;  2XDO A;  2BA9 A;  4B66 A;  2JB1 A;  1CJ3 A;  2GV8 A;  3I6D A;  3ALL A;  4H4T A;  1TDE A;  2GR0 A;  3IC9 A;  3ATR A;  3AYL A;  3AE1 A;  3PVC A;  3K7Q X;  4U2S A;  3V3N A;  1OJC A;  2VOU A;  3RHA A;  4IVM B;  4U8N A;  3R9U A;  3VRB A;  3D1C A;  3GD3 A;  5DBJ A;  1JRY A;  2C65 A;  2Q7V A;  1LTX R;  3DJD A;  4BV6 A;  3QVR A;  4EQX A;  2A89 A;  2YG4 A;  1UKV G;  3NYE A;  3SFE A;  1FOH A;  3NT6 A;  4N9X A;  3AE5 A;  1DOB A;  1GET A;  1GAL A;  1ZOV A;  4MJW A;  4YWO A;  3H8I A;  4IA5 A;  2GB0 A;  3KPF A;  5KOX A;  5KVH A;  2YLX A;  2YG6 A;  1P2H A;  1MOK A;  4DSH A;  1JNZ A;  4J36 A;  2XLS A;  2WP6 A;  1ZK7 A;  1H6V A;  3K30 A;  4PAB A;  1PN0 A;  4B63 A;  4K7Z A;  2WQY A;  2ARD A;  2QA1 A;  1VDC A;  1ZMD A;  3CGE A;  4ADW A;  4EM3 A;  4A7A A;  4H2N A;  1B8S A;  1RP0 A;  2X3N A;  3FMW A;  2WOW A;  2W0H A;  1PJ5 A;  1ZOY A;  2Q6U A;  3EAN A;  2YG7 A;  4H4X A;  1JRX A;  2V3A A;  3UTF A;  5FS6 A;  1W4X A;  5JCM A;  3GDN A;  1NG4 A;  4X9N A;  3PO7 A;  3UP5 A;  4EM4 A;  5JCK A;  2YLR A;  2V61 A;  2C3C A;  4U2T A;  1NPX A;  4X9M A;  3AE6 A;  2XLU A;  2YVJ A;  3Q6J A;  5U1O A;  2A8X A;  4H4Y A;  4Z44 A;  4OVI A;  3AEB A;  4REK A;  1N4U A;  3P1W A;  4BJZ A;  2WDV A;  1VQW A;  3ALJ A;  3P9U A;  4C74 A;  4U8L A;  4U8J A;  4CY8 A;  1NHP A;  2X50 A;  1GRB A;  1E39 A;  3UKP A;  4A6N B;  5TR3 A;  1H7W A;  1JU2 A;  3FIM B;  4B69 A;  2NPX A;  1S3E A;  2WP9 A;  3C4A A;  3DGZ A;  2GQW A;  5JCN A;  1TDF A;  4YT0 A;  1L9D A;  4LU6 A;  3CGB A;  3AYI A;  1FEB A;  4TLZ A;  4J31 A;  2C75 A;  1E1N A;  5JCL A;  1CL0 A;  2YR6 A;  3CNS A;  4Y4N A;  4HA6 A;  2XFU A;  4DSG A;  1KDG A;  2BC0 A;  1KNP A;  1PBB A;  2IVE A;  3LAD A;  2WBA A;  3AEE A;  4BUR A;  2EQ8 A;  3QJ4 A;  2PHH A;  2OA1 A;  3GYI A;  4IVO B;  5EB5 A;  4H50 A;  3SGL A;  3CGC A;  4GF7 A;  2VVL A;  2GQF A;  1BGN A;  3NKS A;  1E6E A;  2WU2 A;  1XPQ A;  1OJA A;  2XVH A;  4K2X A;  1LPF A;  4TM1 A;  1EL8 A;  2DKH A;  2B7S A;  3F8D A;  3QSE A;  4JNQ A;  1YQZ A;  1RYI A;  1B5Q A;  2RGO A;  4ICY A;  1QO8 A;  3ICT A;  2UZZ A;  3UTH A;  2GF3 A;  3P4S A;  1S2Q A;  4Z43 A;  5C2T A;  1BZL A;  1REO A;  4A79 A;  1GER A;  2V3B A;  3GWF A;  4KX6 A;  1E7P A;  3KA7 A;  2BS2 A;  3NH3 X;  4JY2 A;  2XVI A;  3CN8 A;  1ZP0 A;  3ISH A;  3NK2 X;  4CY6 A;  3ALM A;  1OJ9 A;  2YLS A;  3NTD A;  4D03 A;  4NEV A;  5M10 A;  5FMH A;  1EL5 A;  2O9Z A;  5GSN A;  4JN9 A;  2CDU A;  3DK4 A;  3GD4 A;  4LA1 A;  1PXC A;  3G5R A;  2VVL G;  4GDP A;  4I59 A;  5IQ1 A;  4EMJ A;  1FCD A;  2BAB A;  3VQR A;  1KFY A;  2A87 A;  3RP7 A;  1NHR A;  1DJQ A;  1TRB A;  1LQU A;  3IWA A;  3CNT A;  1IUS A;  3VR8 A;  3BNU A;  4NTC A;  4OPI A;  1GRF A;  2YM1 A;  1HYU A;  3DJJ A;  1Z6L A;  2H88 A;  4RG4 A;  3NYF A;  2PYX A;  1JOA A;  5EOW A;  1K4Q A;  2EQ9 A;  2YLZ A;  4OPG A;  1JEH A;  1PXB A;  2XVE A;  2BK3 A;  1OJD A;  1E1K A;  4UDP A;  2VVM A;  1BF3 A;  1NEK A;  1KNR A;  3F8P A;  4NZH A;  3IHG A;  1PDH A;  3KD9 A;  4FK1 A;  1DOC A;  1QLB A;  3GRS A;  3GRT A;  3ICS A;  2E5V A;  1GRH A;  3UKQ A;  3UOZ A;  1LVL A;  3EF6 A;  4IV9 A;  4UP3 A;  4BJY A;  2GMH A;  5EB4 A;  4GUV A;  3DA1 A;  4BK1 A;  4GRT A;  2WU5 A;  4Z2T A;  4NTD A;  4H7U A;  2C76 A;  4XWZ A;  5HY5 A;  4ZN0 A;  4JQ9 A;  1JRZ A;  3AEC A;  4USR A;  1XHC A;  3T37 A;  3UKH A;  1D7Y A;  3BNM A;  3ICR A;  2OLO A;  3M13 A;  4U8K A;  4CNJ A;  5HHF A;  1M6I A;  4TM4 A;  2AAQ A;  4DGK A;  1TDK A;  3IHM A;  1EL7 A;  1GRT A;  2OAL A;  1KF6 A;  2XVJ A;  3UKL A;  4JNA A;  2BS4 A;  2R46 A;  4UDQ A;  5JCI A;  2XLR A;  1CBO A;  4EMI A;  1NHS A;  1D7L A;  3K7M X;  5FS8 A;  3KU9 A;  2Y6Q A;  2WHD A;  4Z24 A;  4A99 A;  1H86 A;  3UOV A;  1D4E A;  3NG7 X;  2C64 A;  2HQM A;  4JY3 A;  1N4V A;  4J34 A;  4Y4L A;  3UKF A;  2R9Z A;  3NRN A;  4YXD A;  2J3N A;  2GR2 A;  4LII A;  3RNM A;  3NK1 X;  2I0Z A;  3O0H A;  5ER0 A;  4OPD A;  3C96 A;  4Z26 A;  4K5R A;  2QAE A;  2RGH A;  3K7T A;  2DKI A;  2XFO A;  3ZYX A;  3CPI G;  1BKW A;  1GRE A;  4KPR A;  3NN0 X;  1L9E A;  4AT0 A;  3S61 A;  1GTE A;  3DJG X;  3VRA A;  4FDC B;  2ZZB A;  2JK6 A;  4H4V A;  3QFA A;  3LOV A;  2C70 A;  4DNA A;  4FX9 A;  3KLJ A;  2BS3 A;  4NEW A;  1Q1W A;  1N4W A;  1ZDL A;  1P2E A;  4YKG A;  4A6N A;  3II4 A;  2XLP A;  4YSH A;  3VR9 A;  1PS9 A;  2E4G A;  3JSK A;  5BRT A;  3LXD A;  2F5Z A;  4CCQ A;  3AEA A;  4AOS A;  3B3R A;  3AE3 A;  4YTM A;  4U8P A;  1BGJ A;  2RAB A;  3AE9 A;  3GWD A;  1DNC A;  3NK0 X;  4EIQ A;  3UOX A;  1Y56 B;  4TLX A;  4BK3 A;  1IJH A;  1E1L A;  1PJ6 A;  2C7G A;  4U2L A;  4U8O A;  2YQU A;  3HZL A;  3WE0 A;  2GH5 A;  2GAG B;  2OLN A;  1NG3 A;  3UTG A;  2GR3 A;  3BHK A;  2BCP A;  1O94 A;  2BAC A;  1CC2 A;  1K0L A;  1ZMC A;  1CF3 A;  2WPF A;  1KSS A;  2YG3 A;  3SQP A;  2X8C A;  2XFP A;  2XYO A;  3DME A;  3NTA A;  4YSX A;  4U8M A;  2YLT A;  1MXT A;  5EBK A;  2B7R A;  2GVC A;  1H82 A;  2BYB A;  4UDR A;  4YKF A;  2WES A;  4CRT A;  2WP5 A;  4AT2 A;  4AOX A;  2C66 A;  3BHF A;  1VG0 A;  3AD9 B;  2EQ6 A;  3L8K A;  4H4U A;  3AWI A;  2R45 A;  3CIR A;  4OPC A;  1EBD A;  3M0O A;  3RP8 A;  3V3O A;  4B64 A;  2WOI A;  2Q0L A;  1Y0P A;  2ZBW A;  4H4P A;  1GTH A;  3URH A;  3AEG A;  2BC1 A; 
#chains in the Genus database with same CATH topology
 3N4F A;  2WDR A;  1TYP A;  1RSG A;  5HYM A;  4J2W A;  4A65 A;  3ADA B;  3MWC A;  4EIP A;  2PGE A;  1R6W A;  3LZW A;  4B67 A;  4H2H A;  3ATQ A;  2FBW A;  3VCN A;  3K1G A;  1H2I A;  2OX4 A;  2QJN A;  4USQ A;  4CCR A;  1XDI A;  5HXI A;  1CJC A;  1LQT A;  2AKZ A;  3LB8 A;  2YWL A;  3IK4 A;  3MY9 A;  4M52 A;  2GR1 A;  5FS9 A;  4H4Z A;  3CPJ G;  3SM8 A;  3CPH G;  3Q9T A;  2CFY A;  2NQL A;  1B37 A;  1N5X A;  1KD0 A;  2VZ2 A;  4OPT A;  5IQ4 A;  4NTE A;  2OFJ A;  4GGH A;  1GPE A;  1K0I A;  1WYG A;  2AKM A;  3NN6 X;  5CKU A;  3KUM A;  2E5A A;  1LJ1 A;  1N63 C;  1M64 A;  2OAM A;  1Q1R A;  1OJT A;  3TWA A;  4GR1 A;  1D4D A;  4G9K A;  3EPT A;  3FG2 P;  3DGH A;  4ZCC A;  4ZCD A;  2XCG A;  1IUT A;  3CND A;  3UOY A;  3KKJ A;  1BWC A;  3R0K A;  3AYJ A;  2TPR A;  3LJP A;  5KRQ A;  2GMJ A;  2APG A;  3QSM A;  4YSZ A;  2XH2 A;  1BQG A;  2B9X A;  3NVV B;  1T3Q C;  1E1M A;  3H8L A;  1H84 A;  3T2K A;  4TM3 A;  3S5W A;  1PHH A;  3SQS A;  4YWS A;  3CTY A;  2VRM A;  4M6U A;  3VDG A;  3NFU A;  3NZG A;  2GRT A;  4APN A;  1ELI A;  1D5T A;  1DOE A;  1H7X A;  2X99 A;  5KMS A;  1GSN A;  1KSU A;  2E1M A;  4PAA A;  2HZG A;  4Z25 A;  2NVK X;  4DWD A;  1L0V A;  4OPU A;  1CJ4 A;  1K0J A;  1V59 A;  5KOW A;  3FPZ A;  3V3W A;  4C5O A;  2Z5X A;  3ES8 A;  5J7X A;  2GSH A;  2X8G A;  1N60 C;  4MGG A;  1N1P A;  3I6D A;  4H4T A;  2GR0 A;  3IC9 A;  3AE1 A;  3K7Q X;  4DHG A;  2VOU A;  3VRB A;  3R9U A;  1JRY A;  2C65 A;  2Q7V A;  4TVY A;  3VC6 A;  3NYE A;  3SFE A;  1JRO A;  4N9X A;  4YWO A;  2GB0 A;  4J36 A;  4ZCW A;  4GIR A;  4K7Z A;  1VQZ A;  1ZMD A;  4ADW A;  4EM3 A;  4H2N A;  2X3N A;  3NXL A;  4DX3 A;  4G7F A;  4H4X A;  1P48 A;  2V61 A;  3D47 A;  2FYM A;  3AE6 A;  3STP A;  3TQP A;  2A8X A;  3GYX A;  4REK A;  3CXO A;  3P1W A;  4CY8 A;  2X50 A;  1GRB A;  3UKP A;  4A6N B;  3JVA A;  1JU2 A;  3FIM B;  2NPX A;  3CGB A;  3AYI A;  1FEB A;  2C75 A;  4HCD A;  1KNP A;  2IVE A;  3LAD A;  1EBG A;  2EQ8 A;  2PHH A;  4IVO B;  2VVL A;  2WU2 A;  3PK7 A;  2PSN A;  3B97 A;  3V5C A;  2DKH A;  3F8D A;  1RYI A;  2RGO A;  1MNS A;  1QO8 A;  2O56 A;  1REO A;  4A79 A;  5G5G B;  1E7P A;  4JY2 A;  3CN8 A;  1ZP0 A;  3JZU A;  5M10 A;  2YLS A;  5FMH A;  3T6C A;  2VVL G;  5IQ1 A;  3UCC A;  3TJ4 A;  1KFY A;  1NHR A;  1TRB A;  3IWA A;  3CNT A;  1Z6L A;  2PYX A;  4FP1 A;  3T0K A;  2EQ9 A;  1P43 A;  2BK3 A;  6ENL A;  1NEK A;  3F8P A;  3QPE A;  3A7A A;  5FJR A;  3ICS A;  2E5V A;  4BJY A;  2C76 A;  4XWZ A;  1XHC A;  4KWS A;  4Z1Y A;  2OLO A;  4U8K A;  1JRP A;  5HHF A;  4DGK A;  1JPD X;  4K8G A;  4EMI A;  2OQH A;  4Z24 A;  5ENL A;  4J34 A;  4JY3 A;  3UKF A;  3U4F A;  3O0H A;  2GL5 A;  2RGH A;  3K7T A;  4HN8 A;  4AT0 A;  4H4V A;  3H8A A;  4DNA A;  1N4W A;  1P2E A;  2OO6 A;  3II4 A;  4YSH A;  3N6H A;  4MMW A;  4AOS A;  4YTM A;  3AE9 A;  4Z17 A;  3GWD A;  4BK3 A;  5KMP A;  4U2L A;  3HZL A;  1S7M A;  4M0X A;  2GAG B;  1NU5 A;  2PTZ A;  2C4C A;  2BAC A;  1CC2 A;  4YSX A;  1MXT A;  5EBK A;  1H82 A;  4UDR A;  4CRT A;  3QLD A;  2WP5 A;  2GGI A;  3CAW A;  3DGB A;  3AD9 B;  2EQ6 A;  4A3R A;  4Z2U A;  4OPC A;  4B64 A;  2ZBW A;  2PMQ A;  1XPQ A;  1N5W C;  2BC1 A;  3VA8 A;  2P88 A;  1F6M A;  2QDE A;  5LV9 A;  3QVP A;  1GV4 A;  5CQF A;  1R0M A;  3ES7 A;  2ACZ A;  1O95 A;  3ZLG A;  2VRL A;  2JB2 A;  4AP1 A;  3NS1 B;  3BI4 A;  4BK2 A;  3UCL A;  1PXA A;  3SFD A;  2CVJ A;  2FJE A;  1JNR A;  4II2 A;  3AE8 A;  1PBD A;  2C72 A;  1YY5 A;  3OZ2 A;  4NNJ A;  4YTN A;  2C3D A;  5JRB A;  4U8I A;  2GGG A;  4GDE A;  3B6D A;  3HPF A;  2HNE A;  1FEA A;  3AXB A;  3BI5 A;  1YKJ A;  3OW1 A;  2QCU A;  3NLC A;  3FVD A;  2XH4 A;  2POD A;  4YSY A;  5KVI A;  4H2P A;  1TYT A;  3E1T A;  2RGJ A;  3ITJ A;  1H81 A;  2BCG G;  2R4E A;  1GRG A;  1JCT A;  5KXJ A;  3RP6 A;  1SJB A;  4I58 A;  2PU1 A;  1ZXI C;  3R1Z A;  3ZLF A;  1TDN A;  4FK1 C;  2V60 A;  1NHQ A;  2W54 A;  3GDP A;  5BUK A;  3DER A;  3L1R A;  3SZC A;  4O5Q A;  2JBV A;  1NDA A;  2YLW A;  2QQ6 A;  2GAH B;  3DJE A;  2V6O A;  3HW2 A;  1YQ4 A;  1B4V A;  3AD8 B;  4IP5 A;  1DXL A;  3SBF A;  3SZ0 A;  3NNE A;  1DJN A;  3N6J A;  2PCE A;  2JAE A;  2H89 A;  5KWF A;  3V76 A;  4H19 A;  1COY A;  1F8R A;  1GT8 A;  3G5Q A;  2GEW A;  3IJL A;  2ZZC A;  3T14 A;  3CYJ A;  3ZVI A;  3CNP A;  4B68 A;  1CHU A;  4HCH A;  2P8C A;  2YAU A;  2BXR A;  1JPM A;  3GSI A;  2ONE A;  1CC4 A;  2YR4 A;  1ONF A;  4RSL A;  4B65 A;  4H2R A;  4E4U A;  3UKK A;  1IUW A;  2EQ7 A;  2DW6 A;  2C67 A;  3SN4 A;  2YR5 A;  4H4R A;  1DOD A;  2XDO A;  4B66 A;  1CJ3 A;  3ALL A;  3PVC A;  1MDL A;  4EQX A;  1KKO A;  4GYP A;  3AE5 A;  2MUC A;  4IA5 A;  2YLX A;  1MOK A;  2GDQ A;  1ZK7 A;  3T9P A;  3SN0 A;  2ARD A;  1MUC A;  3FMW A;  1ZOY A;  1JRX A;  3DES A;  2OZ8 A;  5JCM A;  1FHV A;  1N62 C;  1NG4 A;  2QVH A;  2YLR A;  4U2T A;  4X9M A;  2YVJ A;  3Q6J A;  2OLA A;  1IYX A;  1VQW A;  1RM6 B;  1H7W A;  3C4A A;  1X2G A;  1L9D A;  4LU6 A;  2RDX A;  4TLZ A;  3CNS A;  1CL0 A;  1E1N A;  4Y4N A;  4HA6 A;  1PBB A;  1TZZ A;  3AEE A;  2OA1 A;  3SGL A;  1BGN A;  4II3 A;  2B7S A;  3ZLH A;  5BOE A;  3ICT A;  3UTH A;  5C2T A;  3DG3 A;  3VFC A;  3GWF A;  4KX6 A;  4J1O A;  3PFR A;  4CY6 A;  1OJ9 A;  3NTD A;  2O9Z A;  4JN9 A;  3G5R A;  4GDP A;  3CK5 A;  4HPN A;  5EU9 A;  1LQU A;  2BRA A;  4NTC A;  3DJJ A;  3NYF A;  2PTW A;  3S5S A;  3OZY A;  1BF3 A;  3KD9 A;  4FK1 A;  1DOC A;  1QLB A;  3UKQ A;  4IV9 A;  1SJC A;  2GMH A;  4GUV A;  4BK1 A;  4GRT A;  3EUB 3;  4NTD A;  3DFY A;  4JQ9 A;  1JRZ A;  3AEC A;  3T37 A;  4GIS A;  3H70 A;  3SX6 A;  4CNJ A;  3H12 A;  1TDK A;  1EL7 A;  2P8B A;  2XVJ A;  4JNA A;  2BS4 A;  1SJD A;  2R46 A;  3KU9 A;  1BKH A;  2WHD A;  4A99 A;  1H86 A;  2QDD A;  3Q4D A;  1F9C A;  2HQM A;  1XPY A;  4Y4L A;  3NRN A;  2I5Q A;  2GR2 A;  4LII A;  3NK1 X;  1W6T A;  4OPD A;  3SSZ A;  4K5R A;  1KN0 A;  3IJQ A;  3OPS A;  2XFO A;  3ZYX A;  3NVW B;  1GTE A;  2ZZB A;  3QFA A;  3HYX A;  3PWI A;  3GC2 A;  3KLJ A;  3R10 A;  1PDZ A;  3JSK A;  4CCQ A;  3B3R A;  4U8P A;  1BGJ A;  2RAB A;  1DNC A;  3UOX A;  1PJ6 A;  3QKE A;  2YQU A;  3WE0 A;  4J3Z A;  2OLN A;  3UTG A;  1K0L A;  1ZMC A;  1CF3 A;  1KSS A;  3OTR A;  3SQP A;  2X8C A;  3DME A;  3NTA A;  4U8M A;  2YLT A;  2BYB A;  4YKF A;  4AT2 A;  4AOX A;  1VG0 A;  3M0O A;  5G5H B;  2WOI A;  2Q0L A;  1GTH A;  3RGT A;  1ECQ A;  1O5W A;  4IP4 A;  2AL1 A;  2XH0 A;  4K22 A;  5FJU A;  3H4K A;  3ZDN A;  3NIX A;  3AD7 B;  4A9W A;  4G73 A;  4O5U A;  3AE2 A;  3P4P A;  3NYC A;  2B76 A;  4JN7 A;  3D8X A;  3CGD A;  2HXU A;  3L5O A;  2ZAD A;  2V5Z A;  3GMC A;  4K8D A;  2PPG A;  2YM2 A;  3TTE A;  5L46 A;  2E3T A;  2IID A;  4JDR A;  1ELS A;  4RG3 A;  3AED A;  4CNK A;  3EAO A;  2PU0 A;  4HB9 A;  4E0V A;  4D04 A;  1H83 A;  1ZX9 A;  2WOV A;  1MDR A;  4OCG A;  2P0I A;  1F3P A;  3AE7 A;  4IHC A;  1IUU A;  2JKC A;  4A5L A;  4YTP A;  5J60 A;  1FEC A;  2WPE A;  3BI2 A;  3NHO X;  2WET A;  1FO4 A;  2CUL A;  4B1B A;  3SY4 A;  4H4S A;  3HYV A;  2WDQ A;  3FBS A;  4XXG A;  2W3S A;  3DG6 A;  2Y6R A;  5C3J A;  3AE4 A;  3AM9 A;  3DG7 A;  1Y56 A;  1GES A;  2FJD A;  3NGC X;  1DTN A;  1PBC A;  2BXS A;  3Q45 A;  4DXK A;  3TW9 A;  3V4B A;  2VQB A;  4GYP C;  3QN3 A;  3ZVH A;  4K5S A;  3P0W A;  4J57 A;  1YQ3 A;  4J56 A;  3P3B A;  3MKC A;  3PS9 A;  1EC7 A;  3FV9 A;  2R4J A;  3AMZ A;  3UJE A;  1F8S A;  3OP2 A;  3P4R A;  3TWB A;  3DIP A;  2C73 A;  4C3Y A;  2AQJ A;  1NAA A;  3M12 A;  4ZOH B;  4FI4 A;  2R0P A;  3R07 C;  3DH9 A;  3I3L A;  5GRT A;  1GRA A;  4H4Q A;  1ZY8 A;  4EQW A;  3NVY B;  4GCM A;  1GOS A;  4E8G A;  4P9S A;  3CXB A;  1SEZ A;  5J04 A;  1D4C A;  3UGV A;  2XLT A;  1CJ2 A;  2PP1 A;  2X8H A;  3UKA A;  5BVA A;  3TCS A;  3R11 A;  1ONE A;  4MKS A;  3PG6 A;  1N61 C;  3AB1 A;  2JB1 A;  2GV8 A;  4K2S A;  1PDY A;  3V3N A;  2FKP A;  3ATR A;  3H7V A;  1OJC A;  2W55 A;  5IDZ A;  3GD3 A;  3UXK A;  3DJD A;  4BV6 A;  2YG4 A;  1UKV G;  1FOH A;  3NT6 A;  1GAL A;  1ZOV A;  4MJW A;  3H8I A;  1P2H A;  4DSH A;  2XLS A;  1H6V A;  1PN0 A;  2QA1 A;  1VDC A;  4A7A A;  1B8S A;  1RP0 A;  2WOW A;  2W0H A;  3HYW A;  1PJ5 A;  1SJA A;  3UTF A;  4X9N A;  2C3C A;  3V5F A;  3SR6 B;  5U1O A;  4Z44 A;  1N4U A;  2WDV A;  4C74 A;  4U8L A;  4U8J A;  1NHP A;  1E39 A;  3SZF A;  5TR3 A;  3SYI A;  4B69 A;  1S3E A;  3DGZ A;  5FJP A;  4IL0 A;  5JCN A;  1TDF A;  3IJI A;  4J31 A;  3CB3 A;  1NEL A;  3SJN A;  2YR6 A;  2XFU A;  4DSG A;  1KDG A;  3QJ4 A;  5EB5 A;  4H50 A;  4GF7 A;  2GQF A;  1MRA A;  1OJA A;  4K2X A;  1LPF A;  1EL8 A;  4Z43 A;  5KMQ A;  1S2Q A;  1GER A;  2OZ3 A;  2V3B A;  3KA7 A;  3NH3 X;  2BS2 A;  1V97 A;  5KOX A;  3NK2 X;  4D03 A;  1RVK A;  3ALM A;  3UJF A;  1EL5 A;  5GSN A;  2CDU A;  3DK4 A;  1PXC A;  4EMJ A;  3RP7 A;  1DJQ A;  4OPI A;  2YM1 A;  5EOW A;  2YLZ A;  1KCZ A;  4OPG A;  3R25 A;  3GD6 A;  1PXB A;  2XVE A;  3BSM A;  1OJD A;  1E1K A;  4UDP A;  2VVM A;  1KNR A;  4NZH A;  3IHG A;  3T4W A;  3FYY A;  3I6T A;  3GRS A;  4ROP A;  1GRH A;  3UOZ A;  1LVL A;  5EB4 A;  3DA1 A;  4Z2T A;  4USR A;  3BNM A;  3A7U A;  3ETR B;  4TM4 A;  2AAQ A;  3IHM A;  2XGZ A;  4ENL A;  2OAL A;  1KF6 A;  5JCI A;  2XLR A;  1D7L A;  3K7M X;  4H83 A;  5FS8 A;  3GO2 A;  3UOV A;  2PA6 A;  1D4E A;  3NG7 X;  1N4V A;  2OKT A;  2J3N A;  2PS2 A;  3CMM A;  3RNM A;  2I0Z A;  5ER0 A;  3OZM A;  4Z26 A;  3RR1 A;  4A35 A;  3JW7 A;  3CPI G;  1BKW A;  1L9E A;  3S61 A;  3DJG X;  3VRA A;  2XH7 A;  2CHR A;  3BJS A;  3LOV A;  2C70 A;  3T2Y A;  4FX9 A;  3RIT A;  1SB3 B;  1ZDL A;  2XLP A;  2DW7 A;  4K1W A;  3D9X A;  3LXD A;  2F5Z A;  3MSY A;  3AEA A;  2QJM A;  1YEY A;  4EIQ A;  2AL2 A;  1Y56 B;  4TLX A;  1IJH A;  1FFU C;  2HXT A;  1O94 A;  2ZC8 A;  2YG3 A;  3ZVH B;  2XYO A;  1OEP A;  3MUC A;  2GGE A;  4DN1 A;  2C66 A;  3UJ2 A;  3CT2 A;  4H4U A;  3AWI A;  3CIR A;  3RP8 A;  2WP9 A;  3URH A;  3GY1 A;  3NVZ B;  3VRD B;  3ABV A;  2WEU A;  1QJD A;  1CC6 A;  5KMR A;  4ECH A;  5IPY A;  1TDO A;  2TMD A;  3DK8 A;  2AR8 A;  3SXI A;  5FJT A;  1IUV A;  2VQ7 A;  3N4E A;  3HRD C;  4EWJ A;  3P4Q A;  1WUE A;  1S2Y A;  1PJ7 A;  2XFN A;  3IF9 A;  2JB3 A;  3QFB A;  3DEQ A;  4G8T A;  5FS7 A;  3F8R A;  2OZT A;  5U25 A;  3EEZ A;  2XVF A;  4X4J A;  3UTE A;  2IVD A;  3NRZ B;  1PBF A;  4XWR A;  4EQR A;  4EMW A;  2YVG A;  2Z5Y A;  2FJA A;  1GXF A;  3PWG A;  2WS3 A;  4H4W A;  4CBQ A;  2PP3 A;  1EC8 A;  4H2Q A;  1VDV A;  3RRA A;  5U63 A;  3T2Z A;  4C3X A;  1XAN A;  2POZ A;  1VG9 A;  3VCC A;  1PBE A;  1X31 B;  2MNR A;  1NEN A;  1EC9 A;  2R0G A;  3KPK A;  2BK5 A;  2QGY A;  4DYE A;  3KVE A;  2XFQ A;  1GEU A;  5BUL A;  4J33 A;  3GMB A;  3LZX A;  2W3R A;  4HYR A;  3RED A;  3AN1 A;  1ZKQ A;  2P3Z A;  2B9W A;  3CNJ A;  2QA2 A;  2OG9 A;  4KEM A;  1LV0 A;  2WPC A;  4JHM A;  4IZG A;  4IA6 A;  4AP3 A;  4X2P A;  3QSS A;  4TM0 A;  4KPL A;  2Q0K A;  3UP4 A;  3P93 A;  1TE6 A;  4GFI A;  1FL2 A;  1VRQ B;  4WCT A;  2ZZ0 A;  3DK9 A;  3G5S A;  2R0C A;  3COX A;  2PTX A;  3THU A;  4IL2 A;  5M0Z A;  1EBH A;  4E4F A;  4OPL A;  1Q9I A;  3R0U A;  4EQS A;  5KNL A;  1GND A;  2B9Y A;  2FJB A;  1AOG A;  1MO9 A;  3TJI A;  4WX1 A;  1EL9 A;  1S3B A;  4G6H A;  3NO1 A;  4IT1 A;  4C77 A;  1F8W A;  1IUX A;  3GYJ A;  3UJR A;  1E9I A;  4A6G A;  3OC4 A;  3C4N A;  4Z2R A;  1STZ A;  2YG5 A;  3I4K A;  4F4R A;  2BK4 A;  3T8Q A;  4Y4M A;  3AEF A;  2YVF A;  1L9C A;  5FJO A;  2BA9 A;  4HNL A;  1TDE A;  3AYL A;  4U2S A;  3RHA A;  4IVM B;  4U8N A;  3D1C A;  5DBJ A;  3DDM A;  1LTX R;  3QVR A;  2A89 A;  3A7R A;  1DOB A;  1GET A;  3KPF A;  5KVH A;  2YG6 A;  4H1Z A;  1JNZ A;  4JN8 A;  2WP6 A;  3K30 A;  4PAB A;  4B63 A;  1KKR A;  4GAV A;  2WQY A;  3CGE A;  3UJS A;  4E5T A;  4GME A;  2Q6U A;  2YG7 A;  3EAN A;  2V3A A;  5FS6 A;  1W4X A;  3GDN A;  3PO7 A;  3UP5 A;  4EM4 A;  5JCK A;  1FIQ B;  1NPX A;  2XLU A;  4H4Y A;  4OVI A;  3AEB A;  4BJZ A;  3ALJ A;  3P9U A;  4G74 A;  2PGW A;  2GQW A;  4YT0 A;  3MZN A;  4GGB A;  2AL2 B;  5JCL A;  2OQY A;  1X2H A;  2BC0 A;  2WBA A;  4BUR A;  1FFV C;  3ENL A;  3GYI A;  3SZW A;  3CGC A;  3NKS A;  1E6E A;  1L8P A;  2XVH A;  1WUF A;  4TM1 A;  3QSE A;  4JNQ A;  3RCY A;  1YQZ A;  4ICY A;  1B5Q A;  4HNC A;  1TKK A;  3DFH A;  2UZZ A;  2GF3 A;  3P4S A;  1BZL A;  3RO6 A;  2XVI A;  3ISH A;  4NEV A;  3GD4 A;  4LA1 A;  5BOF A;  4I59 A;  4E6M A;  1FCD A;  2BAB A;  3VQR A;  2A87 A;  3VR8 A;  1IUS A;  3BNU A;  1GRF A;  4GAP A;  1HYU A;  2H88 A;  4RG4 A;  4KT2 A;  1JOA A;  1K4Q A;  3FCP A;  2PP0 A;  1JEH A;  1JDF A;  2PTY A;  1PDH A;  3GRT A;  3VC5 A;  3EF6 A;  4UP3 A;  2QJJ A;  2WU5 A;  5HY5 A;  4H7U A;  4ZN0 A;  3UKH A;  1D7Y A;  3ICR A;  3M13 A;  3UCD A;  1M6I A;  1GRT A;  2OPJ A;  3T31 A;  3U9I A;  3UKL A;  4UDQ A;  3I6E A;  4G6G A;  4NWZ A;  1CBO A;  1NHS A;  2Y6Q A;  2XSX A;  2C64 A;  4TVW A;  7ENL A;  2R9Z A;  4YXD A;  1XS2 A;  3MQT A;  3SN1 A;  3C96 A;  2QAE A;  2DKI A;  2BRY A;  3NN0 X;  1GRE A;  4KPR A;  4FDC B;  3BOX A;  4HCL A;  2JK6 A;  3QTP A;  3FXG A;  2BS3 A;  4NEW A;  1Q1W A;  4YKG A;  4A6N A;  3VR9 A;  1PS9 A;  2E4G A;  5BRT A;  2OVL A;  3AE3 A;  3NK0 X;  2C7G A;  1FHU A;  1E1L A;  3UXL A;  4U8O A;  2GH5 A;  1NG3 A;  3B9J B;  2GR3 A;  3BHK A;  2BCP A;  4ZA0 A;  3TOY A;  2WPF A;  2GGJ A;  2XFP A;  3FJ4 A;  2B7R A;  2GVC A;  2WES A;  3BHF A;  3EKG A;  2GGH A;  3L8K A;  2R45 A;  1EBD A;  3V3O A;  1Y0P A;  3D46 A;  4H4P A;  3AEG A;  3S47 A; 
#chains in the Genus database with same CATH homology
 2WDR A;  1TYP A;  1RSG A;  1O5W A;  3VRD B;  5HYM A;  4J2W A;  3ABV A;  2WEU A;  4A65 A;  1F6M A;  3ADA B;  1QJD A;  4EIP A;  5LV9 A;  3QVP A;  1GV4 A;  5CQF A;  4K22 A;  3ZDN A;  3H4K A;  3LZW A;  3NIX A;  1CC6 A;  5KMR A;  4B67 A;  4ECH A;  3AD7 B;  4A9W A;  1TDO A;  5IPY A;  2ACZ A;  2TMD A;  4G73 A;  4O5U A;  1O95 A;  3DK8 A;  2AR8 A;  3SXI A;  2VRL A;  3AE2 A;  3ATQ A;  2JB2 A;  1IUV A;  2VQ7 A;  4AP1 A;  2FBW A;  3P4Q A;  3BI4 A;  4BK2 A;  3UCL A;  1PXA A;  3SFD A;  2CVJ A;  3P4P A;  1H2I A;  2FJE A;  4USQ A;  3NYC A;  2B76 A;  3D8X A;  3CGD A;  4CCR A;  3L5O A;  1XDI A;  5HXI A;  2V5Z A;  1CJC A;  1S2Y A;  1PJ7 A;  1LQT A;  2XFN A;  3GMC A;  3IF9 A;  4K8D A;  2JB3 A;  3QFB A;  1JNR A;  3LB8 A;  2YWL A;  5FS7 A;  2YM2 A;  3F8R A;  5U25 A;  4M52 A;  2GR1 A;  5FS9 A;  4H4Z A;  2XVF A;  4X4J A;  3UTE A;  3CPJ G;  4II2 A;  3AE8 A;  2IVD A;  3SM8 A;  5L46 A;  1PBF A;  1PBD A;  3CPH G;  2C72 A;  4XWR A;  2IID A;  1YY5 A;  4JDR A;  4EQR A;  4EMW A;  3OZ2 A;  2YVG A;  2Z5Y A;  3Q9T A;  4NNJ A;  2CFY A;  4YTN A;  2FJA A;  2C3D A;  1GXF A;  5JRB A;  4RG3 A;  3AED A;  4U8I A;  1B37 A;  4GDE A;  4CNK A;  3B6D A;  2VZ2 A;  4OPT A;  2WS3 A;  5IQ4 A;  3EAO A;  4H4W A;  4NTE A;  4CBQ A;  1FEA A;  4HB9 A;  4E0V A;  3AXB A;  3BI5 A;  4H2Q A;  4D04 A;  1YKJ A;  1H83 A;  1GPE A;  1ZX9 A;  2QCU A;  2WOV A;  1K0I A;  5U63 A;  4OCG A;  3T2Z A;  4C3X A;  1XAN A;  1VG9 A;  3NN6 X;  5CKU A;  3NLC A;  1F3P A;  3AE7 A;  1LJ1 A;  1PBE A;  1X31 B;  1M64 A;  2OAM A;  1NEN A;  4YSY A;  1Q1R A;  5KVI A;  1IUU A;  4H2P A;  2JKC A;  2R0G A;  1OJT A;  3KPK A;  2BK5 A;  4A5L A;  4YTP A;  5J60 A;  1TYT A;  3E1T A;  1FEC A;  2WPE A;  3BI2 A;  3KVE A;  2RGJ A;  4GR1 A;  1D4D A;  3ITJ A;  3NHO X;  4G9K A;  3EPT A;  2XFQ A;  1GEU A;  3FG2 P;  1H81 A;  2BCG G;  2R4E A;  2WET A;  1GRG A;  5BUL A;  4J33 A;  3DGH A;  3GMB A;  4ZCC A;  2CUL A;  3LZX A;  4ZCD A;  4B1B A;  5KXJ A;  3RP6 A;  3SY4 A;  4H4S A;  3HYV A;  2XCG A;  1IUT A;  2WDQ A;  3CND A;  3UOY A;  3FBS A;  1BWC A;  3KKJ A;  4I58 A;  4XXG A;  3RED A;  2Y6R A;  5C3J A;  1ZKQ A;  2B9W A;  3AE4 A;  3AYJ A;  3CNJ A;  1TDN A;  2QA2 A;  2TPR A;  3LJP A;  1Y56 A;  1GES A;  2FJD A;  4FK1 C;  5KRQ A;  2V60 A;  3NGC X;  1PBC A;  1NHQ A;  2BXS A;  2GMJ A;  1LV0 A;  3GDP A;  2WPC A;  2APG A;  3QSM A;  4IA6 A;  4YSZ A;  4AP3 A;  4TM0 A;  3QSS A;  5BUK A;  3L1R A;  2Q0K A;  2B9X A;  2VQB A;  3UP4 A;  3SZC A;  4O5Q A;  2JBV A;  1NDA A;  2YLW A;  1E1M A;  2GAH B;  4K5S A;  4J57 A;  3DJE A;  2V6O A;  1FL2 A;  4J56 A;  1VRQ B;  1YQ4 A;  1B4V A;  2ZZ0 A;  1YQ3 A;  3H8L A;  1H84 A;  4WCT A;  3AD8 B;  3T2K A;  3DK9 A;  4TM3 A;  1DXL A;  3PS9 A;  3SZ0 A;  3NNE A;  2R4J A;  3G5S A;  2R0C A;  3S5W A;  1PHH A;  1DJN A;  3COX A;  1F8S A;  3P4R A;  3CTY A;  2JAE A;  2VRM A;  2C73 A;  2H89 A;  4C3Y A;  2AQJ A;  5KWF A;  3V76 A;  1NAA A;  3M12 A;  5M0Z A;  4OPL A;  1Q9I A;  4EQS A;  1COY A;  1F8R A;  5KNL A;  2R0P A;  1GT8 A;  3G5Q A;  1GND A;  2B9Y A;  2GEW A;  2FJB A;  3DH9 A;  2ZZC A;  3T14 A;  1AOG A;  1MO9 A;  4WX1 A;  4B68 A;  3CNP A;  2GRT A;  3I3L A;  4APN A;  1ELI A;  5GRT A;  1GRA A;  1EL9 A;  4Z2U A;  1CHU A;  4H4Q A;  1D5T A;  1S3B A;  4G6H A;  4C77 A;  1DOE A;  1ZY8 A;  1H7X A;  1F8W A;  2X99 A;  1IUX A;  3GYJ A;  1GSN A;  2YAU A;  5KMS A;  1KSU A;  2E1M A;  2BXR A;  4PAA A;  4EQW A;  4GCM A;  1GOS A;  3GSI A;  4P9S A;  3OC4 A;  1CC4 A;  1SEZ A;  2YR4 A;  3C4N A;  1ONF A;  4Z25 A;  2NVK X;  1D4C A;  4Z2R A;  4RSL A;  2YG5 A;  4B65 A;  2XLT A;  1CJ2 A;  1L0V A;  4OPU A;  2X8H A;  1CJ4 A;  2BK4 A;  4H2R A;  3UKA A;  3UKK A;  1K0J A;  1V59 A;  5BVA A;  5KOW A;  1IUW A;  2EQ7 A;  2C67 A;  3PG6 A;  3FPZ A;  4Y4M A;  4C5O A;  2Z5X A;  3AEF A;  2YVF A;  5J7X A;  2YR5 A;  1L9C A;  3AB1 A;  2X8G A;  4H4R A;  1DOD A;  1N1P A;  2XDO A;  2BA9 A;  4B66 A;  2JB1 A;  1CJ3 A;  2GV8 A;  3I6D A;  3ALL A;  4H4T A;  1TDE A;  2GR0 A;  3IC9 A;  3ATR A;  3AYL A;  3AE1 A;  3PVC A;  3K7Q X;  4U2S A;  3V3N A;  1OJC A;  2VOU A;  3RHA A;  4IVM B;  4U8N A;  3R9U A;  3VRB A;  3D1C A;  3GD3 A;  5DBJ A;  1JRY A;  2C65 A;  2Q7V A;  1LTX R;  3DJD A;  4BV6 A;  3QVR A;  4EQX A;  2A89 A;  2YG4 A;  1UKV G;  3NYE A;  3SFE A;  1FOH A;  3NT6 A;  4N9X A;  3AE5 A;  1DOB A;  1GET A;  1GAL A;  1ZOV A;  4MJW A;  4YWO A;  3H8I A;  4IA5 A;  2GB0 A;  3KPF A;  5KOX A;  5KVH A;  2YLX A;  2YG6 A;  1P2H A;  1MOK A;  4DSH A;  1JNZ A;  4J36 A;  2XLS A;  2WP6 A;  1ZK7 A;  1H6V A;  3K30 A;  4PAB A;  1PN0 A;  4B63 A;  4K7Z A;  4GAV A;  2WQY A;  2ARD A;  2QA1 A;  1VDC A;  1ZMD A;  3CGE A;  4ADW A;  4EM3 A;  4A7A A;  4H2N A;  1B8S A;  1RP0 A;  2X3N A;  3FMW A;  2WOW A;  2W0H A;  3HYW A;  1PJ5 A;  1ZOY A;  2Q6U A;  3EAN A;  2YG7 A;  4H4X A;  1JRX A;  2V3A A;  3UTF A;  5FS6 A;  1W4X A;  5JCM A;  3GDN A;  1NG4 A;  4X9N A;  3PO7 A;  3UP5 A;  4EM4 A;  5JCK A;  2YLR A;  2V61 A;  2C3C A;  4U2T A;  1NPX A;  4X9M A;  3AE6 A;  2XLU A;  2YVJ A;  3Q6J A;  5U1O A;  2A8X A;  4H4Y A;  3GYX A;  4Z44 A;  4OVI A;  3AEB A;  4REK A;  1N4U A;  3P1W A;  4BJZ A;  2WDV A;  1VQW A;  3ALJ A;  3P9U A;  4C74 A;  4U8L A;  4U8J A;  4CY8 A;  1NHP A;  2X50 A;  4G74 A;  1GRB A;  1E39 A;  3SZF A;  3UKP A;  4A6N B;  5TR3 A;  1H7W A;  1JU2 A;  3FIM B;  3SYI A;  4B69 A;  2NPX A;  1S3E A;  2WP9 A;  3C4A A;  3DGZ A;  2GQW A;  5JCN A;  1TDF A;  4YT0 A;  1L9D A;  4LU6 A;  3CGB A;  3AYI A;  1FEB A;  4TLZ A;  4J31 A;  2C75 A;  1E1N A;  5JCL A;  1CL0 A;  2YR6 A;  3CNS A;  4Y4N A;  4HA6 A;  2XFU A;  4DSG A;  1KDG A;  2BC0 A;  1KNP A;  1PBB A;  2IVE A;  3LAD A;  2WBA A;  3AEE A;  4BUR A;  2EQ8 A;  3QJ4 A;  2PHH A;  2OA1 A;  3GYI A;  4IVO B;  5EB5 A;  4H50 A;  3SGL A;  3SZW A;  3CGC A;  4GF7 A;  2VVL A;  2GQF A;  1BGN A;  3NKS A;  1E6E A;  2WU2 A;  1XPQ A;  1OJA A;  4II3 A;  2XVH A;  4K2X A;  1LPF A;  4TM1 A;  1EL8 A;  2DKH A;  2B7S A;  3F8D A;  3QSE A;  4JNQ A;  1YQZ A;  1RYI A;  1B5Q A;  2RGO A;  4ICY A;  1QO8 A;  3ICT A;  2UZZ A;  3UTH A;  2GF3 A;  3P4S A;  1S2Q A;  5KMQ A;  4Z43 A;  1BZL A;  5C2T A;  1REO A;  4A79 A;  1GER A;  2V3B A;  3GWF A;  4KX6 A;  1E7P A;  3KA7 A;  2BS2 A;  3NH3 X;  4JY2 A;  2XVI A;  3CN8 A;  1ZP0 A;  3ISH A;  3NK2 X;  4CY6 A;  3ALM A;  1OJ9 A;  2YLS A;  3NTD A;  4D03 A;  4NEV A;  5M10 A;  5FMH A;  1EL5 A;  2O9Z A;  5GSN A;  4JN9 A;  2CDU A;  3DK4 A;  3GD4 A;  4LA1 A;  1PXC A;  3G5R A;  2VVL G;  4GDP A;  4I59 A;  5IQ1 A;  4EMJ A;  1FCD A;  2BAB A;  3VQR A;  1KFY A;  2A87 A;  3RP7 A;  1NHR A;  1DJQ A;  1TRB A;  1LQU A;  3IWA A;  2BRA A;  1IUS A;  3CNT A;  3BNU A;  4NTC A;  3VR8 A;  4OPI A;  1GRF A;  2YM1 A;  4GAP A;  1HYU A;  3DJJ A;  1Z6L A;  2H88 A;  4RG4 A;  3NYF A;  2PYX A;  1JOA A;  5EOW A;  1K4Q A;  3T0K A;  2EQ9 A;  2YLZ A;  4OPG A;  1JEH A;  1PXB A;  2XVE A;  2BK3 A;  1OJD A;  1E1K A;  4UDP A;  2VVM A;  1BF3 A;  1NEK A;  1KNR A;  3F8P A;  4NZH A;  3IHG A;  1PDH A;  3KD9 A;  4FK1 A;  1DOC A;  1QLB A;  3GRS A;  3GRT A;  3ICS A;  2E5V A;  1GRH A;  3UKQ A;  3UOZ A;  1LVL A;  3EF6 A;  4IV9 A;  4UP3 A;  4BJY A;  2GMH A;  5EB4 A;  4GUV A;  3DA1 A;  4BK1 A;  4GRT A;  2WU5 A;  4Z2T A;  4NTD A;  4H7U A;  2C76 A;  4XWZ A;  5HY5 A;  4ZN0 A;  4JQ9 A;  1JRZ A;  3AEC A;  4USR A;  1XHC A;  3T37 A;  3UKH A;  1D7Y A;  3BNM A;  3ICR A;  2OLO A;  3M13 A;  4U8K A;  3SX6 A;  4CNJ A;  5HHF A;  1M6I A;  4TM4 A;  2AAQ A;  4DGK A;  1TDK A;  3IHM A;  1EL7 A;  1GRT A;  3T31 A;  2OAL A;  1KF6 A;  2XVJ A;  3UKL A;  4JNA A;  2BS4 A;  2R46 A;  4UDQ A;  4G6G A;  5JCI A;  2XLR A;  1CBO A;  4NWZ A;  4EMI A;  1NHS A;  1D7L A;  3K7M X;  5FS8 A;  3KU9 A;  2Y6Q A;  2WHD A;  4Z24 A;  4A99 A;  1H86 A;  3UOV A;  1D4E A;  3NG7 X;  2C64 A;  2HQM A;  4JY3 A;  1N4V A;  4J34 A;  4Y4L A;  3UKF A;  2R9Z A;  3NRN A;  4YXD A;  2J3N A;  3CMM A;  2GR2 A;  4LII A;  3RNM A;  3NK1 X;  2I0Z A;  3O0H A;  5ER0 A;  4OPD A;  3C96 A;  4Z26 A;  4K5R A;  2QAE A;  2RGH A;  3K7T A;  2DKI A;  2BRY A;  1KN0 A;  2XFO A;  3ZYX A;  3CPI G;  1BKW A;  1GRE A;  4KPR A;  3NN0 X;  1L9E A;  4AT0 A;  3S61 A;  1GTE A;  3DJG X;  3VRA A;  4FDC B;  2ZZB A;  2JK6 A;  4H4V A;  3QFA A;  3HYX A;  3LOV A;  2C70 A;  4DNA A;  3T2Y A;  4FX9 A;  3KLJ A;  2BS3 A;  4NEW A;  1Q1W A;  1N4W A;  1ZDL A;  1P2E A;  4YKG A;  4A6N A;  3II4 A;  2XLP A;  4YSH A;  3VR9 A;  1PS9 A;  2E4G A;  3D9X A;  3JSK A;  5BRT A;  3LXD A;  2F5Z A;  4CCQ A;  3AEA A;  4AOS A;  3B3R A;  3AE3 A;  4YTM A;  4U8P A;  1BGJ A;  2RAB A;  3AE9 A;  3GWD A;  1DNC A;  3NK0 X;  4EIQ A;  3UOX A;  1Y56 B;  4TLX A;  4BK3 A;  1IJH A;  1E1L A;  1PJ6 A;  2C7G A;  4U2L A;  5KMP A;  4U8O A;  2YQU A;  3HZL A;  1S7M A;  3WE0 A;  2GH5 A;  2GAG B;  2OLN A;  1NG3 A;  3UTG A;  2GR3 A;  3BHK A;  2BCP A;  2C4C A;  1O94 A;  2BAC A;  1CC2 A;  1K0L A;  1ZMC A;  1CF3 A;  2WPF A;  1KSS A;  2YG3 A;  3SQP A;  2X8C A;  2XFP A;  2XYO A;  3DME A;  3NTA A;  4YSX A;  4U8M A;  2YLT A;  1MXT A;  5EBK A;  2B7R A;  2GVC A;  1H82 A;  2BYB A;  4UDR A;  4YKF A;  2WES A;  4CRT A;  2WP5 A;  4AT2 A;  4AOX A;  2C66 A;  3BHF A;  1VG0 A;  3AD9 B;  2EQ6 A;  3L8K A;  4H4U A;  3AWI A;  2R45 A;  3CIR A;  4OPC A;  1EBD A;  3M0O A;  3RP8 A;  3V3O A;  4B64 A;  2WOI A;  2Q0L A;  1Y0P A;  2ZBW A;  4H4P A;  1GTH A;  3URH A;  3AEG A;  2BC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...