4DNAA

Crystal structure of putative glutathione reductase from sinorhizobium meliloti 1021
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
461
structure length
461
Chain Sequence
AFDYDLFVIGGGSGGVRSGRLAAALGKKVAIAEEFRYGGTCVIRGCVPKKLYVYASQFAEHFEDAAGFGWTVGESRFDWAKLVAAKEQEIARLEGLYRKGLANAGAEILDTRAELAGPNTVKLLASGKTVTAERIVIAVGGHPSPHDALPGHELCITSNEAFDLPALPESILIAGGGYIAVEFANIFHGLGVKTTLIYRGKEILSRFDQDMRRGLHAAMEEKGIRILCEDIIQSVSADADGRRVATTMKHGEIVADQVMLALGRMPNTNGLGLEAAGVRTNELGAIIVDAFSRTSTPGIYALGDVTDRVQLTPVAIHEAMCFIETEYKNNPTSPDHDLIATAVFSQPEIGTVGITEEEAARKFQEIEVYRAEFRPMKATLSGRKEKTIMKLVVNAADRKVVGAHILGHDAGEMAQLLGISLRAGCTKDDFDRTMAVHPTAAEELVTMYQPSYRVRNGERVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable glutathione reductase
publication title CRYSTAL STRUCTURE OF putative glutathione reductase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
total genus 138
structure length 461
sequence length 461
chains with identical sequence B
ec nomenclature ec 1.8.1.7: Glutathione-disulfide reductase.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4dnaA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4dnaA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4dnaA02
3FIMB 2JB1A 3L1RA 4U8LA 4U8PA 1S2YA 3IF9A 3CPHG 3LZWA 2QA1A 3FPZA 2R0PA 1JNRA 2YG4A 4FX9A 2WU2A 3NN0X 5HXIA 2GR3A 2DKHA 4H4YA 1VDCA 3AE8A 1NPXA 2R0CA 2YLWA 3P9UA 3CPJG 1ONFA 1Q9IA 3P4QA 4OVIA 3GDPA 1CJCA 3NK2X 4JNQA 1GTEA 2BXRA 4C74A 4YXDA 4C77A 4USQA 3IHMA 2XLTA 1DXLA 3VRAA 5BULA 2YQUA 1QO8A 4OPLA 1ZKQA 4OCGA 5EBKA 1L0VA 4K7ZA 4EM3A 2X3NA 3F8RA 4RSLA 3KLJA 4YT0A 2XLSA 4BK3A 1GESA 1D4DA 2YM1A 2BCPA 4BK1A 3AE6A 1GALA 3OZ2A 1KDGA 2BXSA 4BJYA 1QLBA 1B5QA 4FK1C 1NHQA 4K2XA 2A8XA 4H4TA 1RP0A 1EL9A 1FCDA 2YR4A 3G5SA 1S3EA 4DNAA 2WBAA 2EQ7A 2WDVA 1LPFA 4DGKA 2F5ZA 1IUXA 3BNUA 3FMWA 1O94A 3UP4A 5U63A 4A99A 1KNPA 4A65A 3SGLA 1IUTA 3ALMA 1E1MA 4I58A 4C3XA 1TDEA 2ARDA 4Y4NA 4Y4LA 3LZXA 4CCRA 1NEKA 4P9SA 3NNEA 3K7QX 4REKA 1JRZA 2V5ZA 3ICTA 2OAMA 2GR2A 1PJ5A 5J60A 2R4JA 2QA2A 4O5QA 4A9WA 1IUWA 4ZN0A 2OLOA 4B1BA 3AEEA 5GRTA 2OLNA 3LJPA 3M0OA 2QCUA 2BYBA 2XLRA 4RG4A 3NK1X 3GD3A 2GV8A 2WOWA 3DJEA 4U8NA 1TYTA 5BVAA 1TYPA 2J3NA 4YSXA 3QSSA 4IV9A 1E1KA 4EM4A 2WDQA 5GSNA 1GT8A 2RGHA 1LV0A 4XXGA 4BK2A 1M6IA 2GEWA 1GV4A 3G5RA 2ACZA 2B9WA 2GMHA 2BCGG 1LQTA 1Z6LA 4OPDA 4X9NA 2WOIA 1B8SA 2GMJA 3CNJA 2YLZA 3GMCA 5LV9A 2E4GA 1XDIA 2OA1A 2Q0LA 3VRDB 4YTNA 3P1WA 1VRQB 2JK6A 1FOHA 5KOWA 2WPFA 4LU6A 1PXCA 1PHHA 2VRLA 3ZYXA 4J2WA 2GH5A 3F8DA 4C3YA 3AYJA 2JBVA 1H82A 5EB4A 1K4QA 1N4VA 3IHGA 5KXJA 1YQZA 3NK0X 1KF6A 3R9UA 4DSHA 4GF7A 3DK9A 2C64A 4AOXA 4ADWA 4FK1A 1N4WA 1E1NA 2ZZCA 2ZBWA 3DJDA 3AB1A 4OPCA 4E0VA 4EIPA 1OJTA 4EQSA 1D7YA 3AEAA 5IPYA 3CIRA 1XPQA 3ABVA 3ICSA 1GPEA 3CGEA 4YTMA 2BK5A 1KSSA 1LJ1A 3Q6JA 2WP5A 1PJ7A 2XVEA 4H2NA 2C76A 3QSEA 2VVLA 3FBSA 5U25A 1ZMDA 4J57A 1B4VA 3GD4A 3VQRA 2GVCA 3AEDA 4Z43A 2V61A 4H4QA 4K22A 3SFDA 2A89A 4UP3A 4D03A 3UOVA 1DOCA 1MO9A 2PYXA 2FJDA 2C73A 3D1CA 4M52A 3NLCA 1PBBA 2APGA 2OALA 4IA5A 1K0JA 1B37A 1D4CA 1Q1RA 5JCNA 4GCMA 4AP1A 3CNPA 3URHA 1P2HA 4NTDA 3UTGA 1M64A 4LA1A 3CTYA 4J56A 1PS9A 2BS2A 1BGNA 3KKJA 2C65A 1GETA 3VR9A 4GDPA 2GR1A 2R9ZA 1LTXR 2W0HA 3KD9A 3UKAA 2YLTA 4H2RA 4B64A 2XVFA 4H4WA 3AE5A 1E39A 3NHOX 4Z24A 1VG0A 1F3PA 4AT2A 1JOAA 1JEHA 3AECA 5CKUA 4KPRA 1BF3A 3RHAA 1GXFA 3GRSA 3GDNA 4H4ZA 4NEWA 4K5SA 1BKWA 4UDPA 3RP8A 2XVIA 1H83A 5JCIA 3ATRA 3LB8A 1NAAA 2XFNA 3AD9B 3AYIA 2XCGA 3QFAA 4U2TA 1EBDA 2GR0A 1NHRA 1GNDA 4JY2A 1PJ6A 4Y4MA 1MXTA 2WPCA 2R4EA 2XVJA 3GWDA 4J33A 2CVJA 2TMDA 2VVLG 4U8JA 1O5WA 3NRNA 4U8IA 4J31A 2YR6A 1F8SA 2Z5YA 5ER0A 3ALLA 1E6EA 2GAHB 2GF3A 2JB2A 5CQFA 1S2QA 3UKLA 4Z44A 3JSKA 1ZOVA 3CGBA 1GEUA 2B9YA 2YG5A 2YR5A 2GRTA 1PBDA 2WDRA 3AE9A 3NYEA 1LQUA 3C4NA 4NTEA 1H81A 2FBWA 4EIQA 4BURA 1PXAA 3PVCA 1GERA 2H89A 2VRMA 3UKHA 4Z2UA 1KSUA 4YKGA 2JKCA 3DJGX 4CCQA 5FS7A 3NT6A 1REOA 2RGOA 2WQYA 4JQ9A 3H4KA 2Q6UA 4OPTA 3EAOA 1YY5A 4U8OA 2BC1A 2AQJA 1K0IA 1Y56B 3ICRA 2XLPA 4H4SA 4EMJA 2FJBA 4BJZA 2X8CA 3OC4A 3K30A 3KU9A 1E1LA 1O95A 3RNMA 3UTFA 2Z5XA 3BI4A 4TM3A 1GRAA 2YVGA 2BK3A 1GRHA 1DJQA 1ZP0A 2BS3A 2C66A 4IVMB 4ZCDA 4JDRA 3D8XA 1PXBA 2VZ2A 3COXA 4O5UA 4H50A 4MJWA 1TDOA 3PO7A 3K7MX 2C3CA 4OPGA 2VQBA 2C70A 1H6VA 3NH3X 2Y6QA 3P4SA 4CY6A 2XFQA 4B63A 5C2TA 5FS6A 5TR3A 4PAAA 2ZZBA 5FMHA 3AEBA 2EQ9A 2WHDA 3ALJA 1RYIA 3M12A 1RSGA 2Q7VA 5M10A 3II4A 1NDAA 3RP7A 1DJNA 1GRTA 1TDNA 3HZLA 1XHCA 1OJCA 3I6DA 2IVDA 3REDA 2FJEA 2QAEA 1ZK7A 4J36A 3AE2A 5BUKA 1GSNA 1YKJA 3CPIG 4AP3A 1CL0A 3S5WA 1HYUA 2DKIA 3UP5A 1JNZA 3UOZA 2XFOA 2NVKX 3K7TA 3LOVA 2WESA 4H4RA 3UOXA 4YWOA 4C5OA 1NG3A 5JCKA 3CGDA 1DOEA 5JCMA 3I3LA 4WCTA 2X8HA 2BK4A 5IQ1A 5M0ZA 4EQWA 3VR8A 4Z25A 2XVHA 2H88A 3NTDA 2YAUA 3B6DA 1CC4A 1FEAA 1FEBA 4YSHA 3NIXA 5HHFA 2IVEA 3UKPA 1V59A 1NG4A 1CF3A 5HY5A 3RP6A 3NTAA 1DODA 4H4PA 1ZY8A 4EQRA 3BI2A 4K5RA 3V76A 3KPFA 3AEGA 1BGJA 1N1PA 2YLSA 4NEVA 3ISHA 4USRA 4OPIA 3UTEA 2YG7A 2X50A 2WU5A 4B65A 1COYA 4Z2RA 1PBFA 2TPRA 4X4JA 1YQ3A 5C3JA 1PBEA 3BHFA 4YTPA 1KFYA 2RABA 1X31B 2XYOA 3C96A 3UKKA 3F8PA 4ICYA 4X9MA 4CRTA 4GUVA 5KVHA 4ECHA 2GQFA 3NGCX 1BZLA 5J7XA 4JN9A 1E7PA 4HB9A 4RG3A 3BHKA 3T37A 2NPXA 3GRTA 1DOBA 2EQ6A 4A5LA 4TLXA 2VVMA 3KVEA 1F6MA 3AXBA 4U2LA 3EPTA 4A6NB 3GWFA 1N4UA 1PDHA 1KNRA 3LXDA 1GRBA 3AEFA 4PABA 5FS9A 2WOVA 2YG6A 3P4RA 1IUUA 1K0LA 2WS3A 2VQ7A 3DGHA 3FG2P 1DNCA 3DJJA 2B76A 1ZOYA 2GAGB 1CHUA 3AE1A 2B7SA 2Q0KA 3NKSA 3Q9TA 1FL2A 3EANA 4EMIA 2XDOA 3NYFA 1F8WA 1NENA 2BS4A 1GREA 2XLUA 2YLRA 4YSZA 1GOSA 1P2EA 1VQWA 1ZDLA 3CN8A 4H4VA 4GRTA 4J34A 4JY3A 1Y0PA 3LADA 3O0HA 4NTCA 5KVIA 5KOXA 2BABA 1ZX9A 3ATQA 3H8IA 4B68A 2UZZA 3EF6A 2C7GA 3ADAB 3UKFA 2C67A 2E1MA 3ZDNA 2AAQA 3BI5A 3QFBA 4H4UA 3WE0A 3AE3A 4B69A 1JRXA 3NN6X 4IA6A 1D4EA 1D7LA 5FS8A 2X99A 3ITJA 3QSMA 1H7WA 4U2SA 2XFUA 2C75A 1L9EA 1NHSA 3AE7A 1W4XA 4YKFA 3SM8A 3L8KA 2RGJA 3DK8A 1OJ9A 2CULA 4A6NA 4GDEA 3UOYA 2IIDA 4ZCCA 4UDRA 2V60A 3C4AA 5EB5A 4UDQA 4EQXA 1OJAA 2V3AA 1H84A 4CNKA 3VRBA 4A79A 3BNMA 1JU2A 2R45A 2YWLA 1MOKA 3DGZA 1AOGA 3PS9A 4B67A 4GR1A 3AD8B 1S3BA 5KWFA 4I59A 4DSGA 3QJ4A 1F8RA 3GYIA 4OPUA 2AR8A 2GQWA 2A87A 2JB3A 3CNDA 4H7UA 1IUVA 2WPEA 1L9DA 1H7XA 3AE4A 3IC9A 3GYJA 4TM1A 2C3DA 2Y6RA 3IWAA 4H2PA 1ZMCA 4NZHA 5HYMA 4AOSA 4B66A 2GB0A 1OJDA 2FJAA 5BRTA 2CFYA 1CJ3A 2YVFA 2VOUA 1CJ2A 3SQPA 2WETA 2YLXA 2V6OA 1EL7A 3B3RA 4WX1A 3NG7X 3CGCA 4K8DA 3DK4A 2YM2A 3CNSA 4AT0A 1CJ4A 1D5TA 3V3OA 1IUSA 3UCLA 5IQ4A 2CDUA 4APNA 2R0GA 1VG9A 4LIIA 5U1OA 1Y56A 3P4PA 4D04A 4TM0A 2XFPA 1XANA 3CNTA 3G5QA 2BACA 2EQ8A 3QVRA 1TDKA 2WEUA 3QVPA 3SFEA 1EL8A 3DA1A 1CC2A 1UKVG 3E1TA 3GMBA 2JAEA 3UTHA 1GRGA 1TRBA 3KA7A 5DBJA 2X8GA 1FECA 4A7AA 2ZZ0A 3M13A 2C72A 2HQMA 1PN0A 1LVLA 1IJHA 1QJDA 2BC0A 1SEZA 2E5VA 4TM4A 3S61A 1TDFA 4HA6A 1NHPA 2YVJA 3AYLA 2B9XA 4H2QA 1BWCA 3V3NA 4Z26A 2V3BA 4CNJA 3AD7B 5L46A 1Q1WA 3H8LA 4IVOB 4CY8A 1CBOA 4EMWA 3DMEA 4FDCB 4KX6A 4U8KA 1GRFA 4CBQA 4YSYA 4U8MA 1PBCA 5KRQA 3DH9A 4XWZA 5EOWA 2YG3A 4JNAA 2O9ZA 1GTHA 1CC6A 3AWIA 4H4XA 4XWRA 4BV6A 1EL5A 2PHHA 4TLZA 2WP6A 2R46A 4N9XA 3GSIA 1L9CA 2WP9A 1YQ4A 2B7RA 1ELIA 1H86A 1JRYA 3NYCA 4Z2TA 3UKQA 5JCLA 2BA9A 2I0ZA
chains in the Genus database with same CATH superfamily
3FIMB 3FPZA 3SY4A 2WU2A 2QVHA 3NO1A 2R0CA 1JPMA 4GGBA 3P9UA 2P3ZA 1CJCA 1JPDX 4JNQA 4YXDA 1QO8A 3V3WA 5EBKA 3BSMA 1GESA 1D4DA 2YM1A 3SX6A 3U9IA 1KDGA 4BJYA 3G5SA 1FCDA 1S3EA 4H19A 2EQ7A 1IUXA 3UP4A 1O94A 5U63A 3SGLA 3ALMA 4I58A 1SJAA 4C3XA 4Y4NA 4P9SA 1EC7A 3NNEA 2GR2A 1PJ5A 2PTWA 5GRTA 3M0OA 2BYBA 2DW7A 3DJEA 1TYPA 4G9KA 1E1KA 1GV4A 1N60C 4OPDA 3GMCA 2HZGA 3DG3A 2OA1A 1VRQB 1FOHA 2WPFA 2HXUA 2JBVA 5EB4A 5KXJA 4IHCA 3R9UA 5G5GB 3DK9A 3FYYA 1E1NA 3AB1A 4OPCA 1N5XA 1OJTA 3AEAA 5KMRA 3Q6JA 2WP5A 2XVEA 4E4FA 2AL1A 3Q4DA 4J57A 3GO2A 3P3BA 2OZ8A 4H4QA 2V61A 3SFDA 4UP3A 4II2A 3UOVA 2PYXA 2C73A 3D1CA 4M52A 4A6GA 1B37A 5JCNA 3THUA 3UTGA 1M64A 3CTYA 1PS9A 3KKJA 1GETA 5KNLA 3CK5A 4GDPA 2W0HA 5IDZA 3AE5A 4H4WA 3NHOX 2PTYA 2MUCA 3GDNA 3RP8A 3QLDA 2XVIA 2CHRA 3LB8A 3NZGA 2XCGA 3QFAA 1EBDA 2GR0A 4MGGA 2XVJA 4J33A 3V5CA 3NRNA 2Z5YA 1FFVC 2GAHB 2GF3A 5CQFA 1S2QA 4Z44A 1ZOVA 3CGBA 2GRTA 3C4NA 1PDYA 1PXAA 2VRMA 6ENLA 4YKGA 2JKCA 3DJGX 4CCQA 3NT6A 4OPTA 4IL2A 2BC1A 1K0IA 2FJBA 3K30A 1E1LA 4IVMB 1PXBA 2VZ2A 4O5UA 4MJWA 3B9JB 2VQBA 5TR3A 3AEBA 3P93A 1RYIA 3I6DA 1XHCA 1OJCA 1DTNA 4GYPA 1H2IA 4AP3A 3S5WA 3T6CA 2XFOA 1FHVA 4H4RA 3TW9A 5JCKA 3VR8A 2X8HA 2H88A 2GGHA 5HHFA 2IVEA 3UKPA 1KD0A 1NG4A 1DODA 3UJ2A 2XH7A 3BI2A 1N1PA 2YLSA 3ISHA 1FIQB 3NVYB 2X50A 4B65A 1COYA 4MMWA 1YQ3A 3UKKA 4X9MA 3S5SA 4ECHA 1BZLA 4JN9A 3VCNA 3T37A 1DOBA 3GRTA 3AXBA 4U2LA 1N4UA 1KNRA 5FS9A 2WOVA 3P4RA 3RR1A 3FJ4A 3Q9TA 2Q0KA 2OPJA 3NYFA 2XLUA 1GOSA 3DEQA 4NTCA 3O0HA 5KVIA 2W3SA 1P48A 4IZGA 3ATQA 3H8IA 3ADAB 3UKFA 2AAQA 3WE0A 3AE3A 1JRXA 1D7LA 5J04A 3R0KA 3ITJA 3QSMA 1NHSA 3SM8A 3DK8A 4GDEA 2IIDA 3OTRA 2V60A 1OJAA 2R45A 1MOKA 3PS9A 5KWFA 3SN0A 3QJ4A 1F8RA 2GQWA 2A87A 4H7UA 4DXKA 2PMQA 3IWAA 1ZMCA 2PU1A 2XH0A 3SQPA 2YLXA 2V6OA 3CGCA 3V3OA 3UCLA 3R25A 4APNA 4GAVA 4LIIA 2XFPA 1XANA 3CNTA 3QVRA 4F4RA 3QTPA 1EL8A 7ENLA 3SQSA 2PGWA 1TRBA 5DBJA 1SJBA 2ZZ0A 3M13A 1PN0A 1LVLA 3DFHA 2BC0A 1RVKA 1BWCA 4Z26A 2V3BA 1N63C 4KX6A 2QDEA 4H83A 4NNJA 5KRQA 4XWZA 4JNAA 2O9ZA 2PHHA 2AL2A 4G6GA 3GSIA 1L9CA 2PODA 5M10A 2VVLA 2YR6A 1S2YA 3IF9A 3CPHG 3LZWA 2R0PA 2YG4A 4FX9A 3FV9A 4ENLA 3I6TA 4Z1YA 4K1WA 4C77A 1L8PA 3VRAA 5G5HB 3TQPA 4OCGA 4EM3A 3F8RA 4RSLA 3AE6A 1ZXIC 1GALA 2BXSA 3SYIA 1QLBA 1B5QA 4K2XA 1RP0A 2YR4A 2WBAA 2PPGA 3BNUA 3ZLHA 3AMZA 1IUTA 4GIRA 5J60A 1IUWA 3AEEA 2QCUA 4KWSA 1TYTA 5BVAA 3IK4A 2WDQA 4XXGA 1LV0A 1JRPA 2OFJA 3G5RA 2B9WA 1MUCA 1SB3B 2WOIA 1B8SA 3CNJA 3GD6A 4YTNA 3P1WA 3OZYA 5KOWA 4G6HA 3RRAA 3H12A 4LU6A 1PHHA 2OQHA 5FJRA 2PA6A 3AYJA 1H82A 1N4VA 4EWJA 3IHGA 3NK0X 4FK1A 3DJDA 2OVLA 1D7YA 2GSHA 3SZWA 3ICSA 3NVWB 1GPEA 2FKPA 1X2HA 2MNRA 2P8BA 1KSSA 2C76A 5U25A 3ES7A 1B4VA 3GD4A 2GVCA 1XS2A 2A89A 4D03A 3BOXA 4J3ZA 3UJRA 2OALA 4IA5A 1K0JA 4AP1A 3URHA 2E3TA 4LA1A 4J56A 3T0KA 2GR1A 3R10A 4ZCWA 1ONEA 2YLTA 4B64A 3QKEA 1FHUA 1N5WC 1JOAA 5CKUA 4KPRA 1BF3A 4NEWA 1BKWA 3U4FA 1NAAA 2XFNA 3AD9B 4U2TA 3NS1B 3TWAA 1PJ6A 2WPCA 2R4EA 2P8CA 2VVLG 1O5WA 1RM6B 4U8IA 5ER0A 1E6EA 3JSKA 4E8GA 4DWDA 1MDLA 1GEUA 1PBDA 4NTEA 3NYEA 2FBWA 4BURA 3PVCA 2QGYA 1GERA 2H89A 3UKHA 1KSUA 2POZA 2RGOA 4JQ9A 2Q6UA 1YY5A 1FO4A 2AQJA 1Y56B 4H4SA 2X8CA 4MKSA 3HYVA 2Z5XA 4TM3A 2BK3A 1GRHA 1ZP0A 4ZCDA 3D8XA 3MUCA 3PO7A 3K7MX 4CY6A 2I5QA 5FS6A 2ZZBA 3S47A 3M12A 3II4A 3RP7A 2IVDA 1MRAA 4A35A 1ZK7A 3T8QA 3AE2A 1HYUA 3UOZA 2WESA 3DFYA 3FVDA 2XH2A 1R6WA 1NG3A 2BK4A 4HPNA 4Z25A 1CC4A 1FEAA 4YSHA 3TOYA 5HY5A 3T9PA 1ZY8A 3KPFA 1V97A 3MKCA 4IP5A 2OQYA 4OPIA 2WU5A 4YTPA 3CYJA 1X31B 3UJSA 4ICYA 4CRTA 4GUVA 2GQFA 4HB9A 4RG3A 4A5LA 3HYWA 3EPTA 1PDHA 3SZ0A 4HCLA 1EBGA 1K0LA 2GGIA 3VC6A 3DGHA 3FG2P 1DNCA 1ZOYA 2AKMA 1CHUA 2B7SA 1FL2A 3EANA 4EMIA 2BS4A 1NENA 1GREA 4TVYA 1VQWA 4J34A 4H4VA 4JY3A 1Y0PA 2BABA 3DERA 1N61C 2C67A 4HCDA 3QFBA 4H4UA 4E6MA 1D4EA 5FS8A 3DG6A 2XFUA 3AE7A 1MDRA 1NELA 3UOYA 4UDQA 4EQXA 3TCSA 3VRBA 4GAPA 1JU2A 1BKHA 4B67A 2QJJA 4GR1A 4DSGA 4OPUA 3JZUA 2JB3A 3IC9A 4TM1A 2C3DA 4H2PA 4NZHA 5HYMA 2GB0A 2FJAA 5BRTA 2YVFA 2VOUA 3MY9A 3NG7X 4K8DA 1D5TA 2DW6A 5IQ4A 2R0GA 1VG9A 3TWBA 5U1OA 2BACA 2EQ8A 3SFEA 3ZVHB 3E1TA 2P88A 3VC5A 5KMQA 3UTHA 3KA7A 2X8GA 1FECA 3SXIA 1QJDA 1N62C 1NHPA 2YVJA 3AYLA 3PWGA 3DDMA 3QN3A 4CNJA 3AD7B 1CBOA 1JDFA 3DMEA 3N4EA 3D46A 4CBQA 4U8MA 3MZNA 3DH9A 4IT1A 4H4XA 3R1ZA 4JHMA 4TLZA 2WP9A 4Z2TA 3NYCA 1KKOA 5JCLA 2I0ZA 2JB1A 3L1RA 3NN0X 5HXIA 2GR3A 1TZZA 2PTXA 1VDCA 3AE8A 3ZVHA 3CPJG 1ONFA 3CB3A 1Q9IA 4OVIA 3GDPA 3NK2X 1GTEA 4USQA 2XLTA 2QJMA 3CXOA 4OPLA 1ZKQA 3Q45A 1L0VA 2X3NA 4YT0A 2XLSA 2BCPA 4BK1A 3ETRB 3HYXA 4FK1C 4H4TA 1EL9A 4NWZA 4DNAA 4DGKA 2F5ZA 1KNPA 4A65A 1E1MA 4FP1A 1TDEA 2E5AA 3K7QX 4REKA 3ICTA 2R4JA 2QA2A 4A9WA 4B1BA 3LJPA 3NK1X 3SSZA 4U8NA 2J3NA 3QSSA 4IV9A 5GSNA 1GT8A 3T2KA 4BK2A 2GEWA 2ACZA 2GMHA 2BCGG 1LQTA 1Z6LA 4X9NA 2YLZA 2OKTA 1XDIA 2Q0LA 3VRDB 2JK6A 4G8TA 1PXCA 3MWCA 4J2WA 2GH5A 3EUB3 2BRAA 1K4QA 4H2HA 1YQZA 1KF6A 4GF7A 2PGEA 1EC9A 2C64A 4AOXA 4ADWA 1N4WA 2ZZCA 2ZBWA 2BRYA 4EQSA 3GY1A 3ABVA 3CGEA 4YTMA 1LJ1A 1PJ7A 4H2NA 3FBSA 1ZMDA 3AEDA 4IP4A 3SJNA 1DOCA 2FJDA 4IL0A 1PBBA 3UJEA 1Q1RA 4HN8A 3CNPA 3TJ4A 1P2HA 1BGNA 2C65A 2R9ZA 3KD9A 3UKAA 4AT2A 3AECA 3GRSA 3T2ZA 3HW2A 3CMMA 2PP3A 3NVVB 1H83A 3L5OA 2RDXA 3AYIA 1NHRA 1GNDA 1P43A 3HPFA 2CVJA 2TMDA 3FCPA 4U8JA 3ALLA 3CAWA 2B9YA 2YG5A 2YR5A 2WDRA 3AE9A 1LQUA 1H81A 2NQLA 3GYXA 4EIQA 2GGGA 5FS7A 1REOA 2WQYA 3EAOA 3T4WA 2XLPA 4EMJA 3OC4A 3KU9A 1O95A 1GRAA 2C66A 1DJQA 1TDOA 4OPGA 1H6VA 2Y6QA 2XFQA 4B63A 5C2TA 4DYEA 3ALJA 2OZ3A 2OG9A 4TVWA 3HZLA 2O56A 2ONEA 3REDA 1EBHA 2FJEA 4J36A 5BUKA 1GSNA 3CPIG 2DKIA 3UP5A 5FJTA 1JNZA 3ENLA 4K2SA 4YWOA 2FYMA 4C5OA 3CGDA 1DOEA 5M0ZA 3UXLA 4EQWA 1FEBA 3DESA 3N6HA 1FFUC 3SZFA 3RP6A 4H4PA 4YWSA 3V76A 4USRA 1PBFA 2TPRA 3CT2A 3K1GA 2P0IA 3BHFA 2XYOA 3F8PA 2PSNA 1JCTA 3BJSA 3OP2A 3NGCX 1E7PA 2GGEA 1F9CA 2VVMA 4HYRA 3LXDA 4G74A 1GRBA 3AEFA 4PABA 3ZLFA 4K8GA 1MNSA 4GYPC 3SN4A 2WS3A 2VQ7A 1S7MA 2GAGB 4J1OA 4JN8A 3NKSA 4YSZA 2YLRA 1P2EA 1ZDLA 3CN8A 4GRTA 5KOXA 3MSYA 1ZX9A 4B68A 1SJCA 2UZZA 3EF6A 2E1MA 5JRBA 3BI5A 3SBFA 4IA6A 1KCZA 2X99A 1H7WA 4U2SA 2C75A 2OZTA 4DHGA 3L8KA 2RGJA 1OJ9A 4UDRA 3C4AA 5EB5A 3P0WA 4CNKA 4A79A 3B97A 2XSXA 3D47A 2YWLA 2ZC8A 3DGZA 3PWIA 1AOGA 3UGVA 3AD8B 1SJDA 3JVAA 2ZADA 5FJOA 2WPEA 1KKRA 2GGJA 1H7XA 1L9DA 3GYJA 2PU0A 3N4FA 3PK7A 3JW7A 1OJDA 2CFYA 3B3RA 2YM2A 4AT0A 3ZLGA 1IUSA 3R0UA 1Y56A 1IYXA 3P4PA 4TM0A 1TDKA 2WEUA 3QVPA 3VFCA 1UKVG 1GRGA 3DG7A 2GDQA 1IJHA 1W6TA 1SEZA 4II3A 2E5VA 3S61A 1TDFA 4HA6A 4H2QA 1NU5A 3KUMA 2XGZA 3A7RA 3H8LA 4IVOB 4CY8A 3OW1A 1WUEA 4FDCB 4U8KA 4YSYA 3H7VA 5EOWA 2YG3A 2W55A 1CC6A 4XWRA 1EL5A 3NFUA 3IJLA 2R46A 2B7RA 1JRYA 4GFIA 3UKQA 2BA9A 4HNLA 4U8PA 4U8LA 4G7FA 4HNCA 2QA1A 1JNRA 4GGHA 3SZCA 2DKHA 4H4YA 3D9XA 1NPXA 2YLWA 3P4QA 2BXRA 4C74A 3IHMA 3OZMA 1DXLA 5BULA 3NXLA 2YQUA 5ENLA 4K7ZA 3KLJA 1T3QC 4BK3A 1BQGA 1STZA 3OZ2A 1NHQA 2A8XA 2WDVA 1LPFA 3FMWA 4A99A 1X2GA 2ARDA 4Y4LA 4CCRA 3LZXA 1NEKA 1JRZA 2V5ZA 2OAMA 3EEZA 4ZOHB 4O5QA 4ZN0A 2OLOA 4D04A 2OLNA 2XLRA 4RG4A 3GD3A 3OPSA 2GV8A 2WOWA 4YSXA 3SR6B 4EM4A 2RGHA 1M6IA 3QPEA 3H8AA 2GMJA 3RO6A 5BOEA 5LV9A 2E4GA 3MQTA 3CXBA 2QDDA 1JROA 3R11A 2VRLA 3ZYXA 3F8DA 4C3YA 4GMEA 3KPKA 4DSHA 2QQ6A 3V4BA 4E0VA 4EIPA 5IPYA 3CIRA 1XPQA 4E5TA 2BK5A 4KEMA 3QSEA 3VQRA 4Z43A 4K22A 4ROPA 1MO9A 3NRZB 2HXTA 3NLCA 2APGA 1D4CA 4GCMA 4E4UA 3FXGA 4NTDA 2BS2A 3T31A 3VR9A 1KN0A 3UCCA 2PP0A 1LTXR 3EKGA 1ECQA 4H2RA 2XVFA 1E39A 3UXKA 4Z24A 1VG0A 1F3PA 1JEHA 3RHAA 1GXFA 4H4ZA 4K5SA 4UDPA 5JCIA 3ATRA 4JY2A 4Y4MA 1MXTA 3GWDA 3VCCA 4J31A 1F8SA 2JB2A 3UKLA 4JN7A 1VQZA 2OX4A 1R0MA 4Z2UA 3GC2A 3PG6A 3H4KA 1YEYA 4U8OA 3ICRA 1PDZA 4BJZA 3UTFA 3RNMA 3BI4A 2YVGA 2BS3A 5BOFA 2OO6A 4JDRA 3COXA 3DGBA 4H50A 2C3CA 2C70A 3NH3X 3P4SA 1OEPA 4PAAA 3T2YA 1E9IA 5FMHA 2EQ9A 2WHDA 1RSGA 2Q7VA 1NDAA 1DJNA 1GRTA 1TDNA 2QAEA 1TKKA 1YKJA 2PS2A 1CL0A 3TTEA 3K7TA 2NVKX 3LOVA 2AL2B 3UOXA 4WCTA 4Z17A 5JCMA 3I3LA 5IQ1A 2XVHA 3NTDA 2YAUA 3B6DA 3NIXA 4GISA 3ZVIA 1V59A 1CF3A 3NTAA 4EQRA 4K5RA 3AEGA 1BGJA 4NEVA 5KMPA 3UTEA 2YG7A 4Z2RA 4X4JA 2OLAA 4ZA0A 5C3JA 1PBEA 1KFYA 2RABA 3C96A 2AKZA 5KVHA 3TJIA 5J7XA 3N6JA 3BHKA 2NPXA 2EQ6A 3ES8A 4TLXA 3KVEA 1F6MA 2QJNA 3IJQA 4A6NB 1VDVA 3GWFA 2YG6A 1IUUA 3RITA 4X2PA 3SN1A 3DJJA 2B76A 3AE1A 2XDOA 1F8WA 4FI4A 3LADA 3RGTA 3UJFA 2W3RA 2C7GA 3ZDNA 2C4CA 3A7UA 4B69A 3NN6X 4DN1A 1XPYA 2HNEA 2GL5A 4HCHA 1L9EA 3HRDC 3UCDA 1EC8A 1W4XA 4YKFA 3IJIA 2CULA 4A6NA 4ZCCA 5FJUA 2V3AA 2XH4A 1H84A 4H1ZA 3BNMA 4KT2A 3H70A 1S3BA 4I59A 2PP1A 3RCYA 3GYIA 3PFRA 2AR8A 3CNDA 3I6EA 1IUVA 3AM9A 3AE4A 3NVZB 2Y6RA 4AOSA 4B66A 1CJ3A 1CJ2A 2WETA 1EL7A 3A7AA 4WX1A 4M6UA 5FJPA 3DK4A 3CNSA 1CJ4A 5EU9A 4KPLA 3I4KA 2CDUA 4DX3A 3V5FA 3VDGA 3G5QA 2PTZA 3DA1A 4M0XA 1CC2A 3GMBA 2JAEA 3DIPA 2W54A 4A7AA 3AN1A 5KMSA 2C72A 2HQMA 4TM4A 2B9XA 3V3NA 2PCEA 1TE6A 5L46A 1Q1WA 3R07C 3T14A 3VA8A 4EMWA 1WUFA 1GRFA 1ELSA 1PBCA 1GTHA 3AWIA 3STPA 4G73A 4A3RA 4BV6A 2WP6A 4N9XA 1YQ4A 1ELIA 1H86A 1WYGA
chains in the Genus database with same CATH topology
3FIMB 2JB1A 3L1RA 4U8LA 4U8PA 1S2YA 3IF9A 3CPHG 3LZWA 2QA1A 3FPZA 2R0PA 1JNRA 2YG4A 4FX9A 3SY4A 2WU2A 3NN0X 3SZCA 5HXIA 2GR3A 2DKHA 4H4YA 1VDCA 3D9XA 3AE8A 1NPXA 2R0CA 2YLWA 3P9UA 3CPJG 1ONFA 1Q9IA 3P4QA 4OVIA 3GDPA 1CJCA 3NK2X 4JNQA 1GTEA 2BXRA 4C74A 4YXDA 4C77A 4USQA 3IHMA 2XLTA 1DXLA 3VRAA 5BULA 2YQUA 1QO8A 4OPLA 1ZKQA 4OCGA 5EBKA 1L0VA 4K7ZA 4EM3A 2X3NA 3F8RA 4RSLA 3KLJA 4YT0A 2XLSA 4BK3A 1GESA 1D4DA 2YM1A 2BCPA 4BK1A 3AE6A 3SX6A 1GALA 3OZ2A 1KDGA 2BXSA 4BJYA 3SYIA 1QLBA 3HYXA 1B5QA 4FK1C 1NHQA 4K2XA 2A8XA 4H4TA 1RP0A 1EL9A 1FCDA 2YR4A 3G5SA 1S3EA 4NWZA 4DNAA 2WBAA 2EQ7A 2WDVA 1LPFA 4DGKA 2F5ZA 1IUXA 3BNUA 3FMWA 1O94A 3UP4A 5U63A 4A99A 1KNPA 4A65A 3SGLA 1IUTA 3ALMA 1E1MA 4I58A 4C3XA 1TDEA 2ARDA 4Y4NA 4Y4LA 3LZXA 4CCRA 1NEKA 4P9SA 3NNEA 3K7QX 4REKA 1JRZA 2V5ZA 3ICTA 2OAMA 2GR2A 1PJ5A 5J60A 2R4JA 2QA2A 4O5QA 4A9WA 1IUWA 4ZN0A 2OLOA 4B1BA 3AEEA 5GRTA 2OLNA 3LJPA 3M0OA 2QCUA 2BYBA 2XLRA 4RG4A 3NK1X 3GD3A 2GV8A 2WOWA 3DJEA 4U8NA 1TYTA 5BVAA 1TYPA 2J3NA 4G9KA 3QSSA 4IV9A 4YSXA 1E1KA 4EM4A 2WDQA 5GSNA 1GT8A 2RGHA 1LV0A 4XXGA 3T2KA 4BK2A 1M6IA 2GEWA 1GV4A 3G5RA 2ACZA 2B9WA 2GMHA 2BCGG 1LQTA 1Z6LA 4OPDA 4X9NA 2WOIA 1B8SA 2GMJA 3CNJA 2YLZA 3GMCA 5LV9A 2E4GA 1XDIA 2OA1A 2Q0LA 3VRDB 4YTNA 3P1WA 1VRQB 2JK6A 1FOHA 5KOWA 2WPFA 4G6HA 4LU6A 1PXCA 1PHHA 2VRLA 3ZYXA 4J2WA 2GH5A 3F8DA 4C3YA 3AYJA 2JBVA 1H82A 2BRAA 5EB4A 1K4QA 3KPKA 1N4VA 3IHGA 5KXJA 1YQZA 3NK0X 1KF6A 3R9UA 4DSHA 4GF7A 3DK9A 2C64A 4AOXA 4ADWA 4FK1A 1N4WA 1E1NA 2ZZCA 2ZBWA 3DJDA 3AB1A 4OPCA 2BRYA 4E0VA 4EIPA 1OJTA 4EQSA 1D7YA 3AEAA 5IPYA 5KMRA 3SZWA 3CIRA 1XPQA 3ABVA 3ICSA 1GPEA 3CGEA 4YTMA 2BK5A 1KSSA 1LJ1A 3Q6JA 2WP5A 1PJ7A 2XVEA 4H2NA 2C76A 3QSEA 2VVLA 3FBSA 5U25A 1ZMDA 4J57A 1B4VA 3GD4A 3VQRA 2GVCA 3AEDA 4Z43A 2V61A 4H4QA 4K22A 3SFDA 2A89A 4UP3A 4D03A 4II2A 3UOVA 1DOCA 1MO9A 2PYXA 2FJDA 2C73A 3D1CA 4M52A 3NLCA 1PBBA 2APGA 2OALA 4IA5A 1K0JA 1B37A 1D4CA 1Q1RA 5JCNA 4GCMA 4AP1A 3CNPA 3URHA 1P2HA 4NTDA 3UTGA 1M64A 4LA1A 3CTYA 4J56A 1PS9A 2BS2A 1BGNA 3KKJA 2C65A 3T31A 1GETA 3VR9A 3T0KA 5KNLA 1KN0A 4GDPA 2GR1A 2R9ZA 1LTXR 2W0HA 3KD9A 3UKAA 2YLTA 4H2RA 4B64A 2XVFA 4H4WA 3AE5A 1E39A 3NHOX 4Z24A 1VG0A 1F3PA 4AT2A 1JOAA 1JEHA 3AECA 5CKUA 4KPRA 1BF3A 3RHAA 1GXFA 3GRSA 3T2ZA 3GDNA 4H4ZA 4NEWA 4K5SA 1BKWA 4UDPA 3RP8A 2XVIA 3CMMA 1H83A 5JCIA 3ATRA 3LB8A 3L5OA 1NAAA 2XFNA 3AD9B 3AYIA 2XCGA 3QFAA 4U2TA 1EBDA 2GR0A 1NHRA 1GNDA 4JY2A 1PJ6A 4Y4MA 1MXTA 2WPCA 2R4EA 2XVJA 3GWDA 4J33A 2CVJA 2TMDA 2VVLG 4U8JA 1O5WA 3NRNA 4U8IA 4J31A 2YR6A 1F8SA 2Z5YA 5ER0A 3ALLA 1E6EA 2GAHB 2GF3A 2JB2A 5CQFA 1S2QA 3UKLA 4Z44A 3JSKA 1ZOVA 3CGBA 1GEUA 2B9YA 2YG5A 2YR5A 2GRTA 1PBDA 2WDRA 3AE9A 3NYEA 1LQUA 3C4NA 4NTEA 1H81A 2FBWA 3GYXA 4BURA 1PXAA 3PVCA 4EIQA 1GERA 2H89A 2VRMA 3UKHA 4Z2UA 1KSUA 4YKGA 2JKCA 3DJGX 4CCQA 3PG6A 5FS7A 3NT6A 1REOA 2RGOA 2WQYA 4JQ9A 3H4KA 2Q6UA 4OPTA 3EAOA 1YY5A 4U8OA 2BC1A 2AQJA 1K0IA 1Y56B 3ICRA 2XLPA 4H4SA 4EMJA 2FJBA 4BJZA 2X8CA 3OC4A 3K30A 3KU9A 1E1LA 1O95A 3RNMA 3HYVA 2Z5XA 3UTFA 3BI4A 4TM3A 1GRAA 2YVGA 2BK3A 1GRHA 1DJQA 1ZP0A 2BS3A 2C66A 4IVMB 4ZCDA 4JDRA 3D8XA 1PXBA 2VZ2A 3COXA 4O5UA 4H50A 4MJWA 1TDOA 3PO7A 3K7MX 2C3CA 4OPGA 2VQBA 2C70A 1H6VA 3NH3X 2Y6QA 3P4SA 4CY6A 2XFQA 4B63A 5C2TA 5FS6A 5TR3A 4PAAA 2ZZBA 3T2YA 5FMHA 3AEBA 2EQ9A 2WHDA 3ALJA 1RYIA 3M12A 1RSGA 2Q7VA 5M10A 3II4A 1NDAA 3RP7A 1DJNA 1GRTA 1TDNA 3HZLA 1XHCA 1OJCA 3I6DA 2IVDA 3REDA 2FJEA 2QAEA 1ZK7A 4J36A 3AE2A 5BUKA 1GSNA 1YKJA 3CPIG 1H2IA 4AP3A 1CL0A 3S5WA 1HYUA 2DKIA 3UP5A 1JNZA 3UOZA 2XFOA 2NVKX 3K7TA 3LOVA 2WESA 4H4RA 3UOXA 4YWOA 4C5OA 1NG3A 5JCKA 3CGDA 1DOEA 5JCMA 3I3LA 4WCTA 2X8HA 2BK4A 5IQ1A 5M0ZA 4EQWA 3VR8A 4Z25A 2XVHA 2H88A 3NTDA 2YAUA 3B6DA 1CC4A 1FEAA 1FEBA 4YSHA 3NIXA 5HHFA 2IVEA 3UKPA 1V59A 1NG4A 1CF3A 3SZFA 5HY5A 3RP6A 3NTAA 1DODA 4H4PA 1ZY8A 4EQRA 3BI2A 4K5RA 3V76A 3KPFA 3AEGA 1BGJA 1N1PA 2YLSA 4NEVA 3ISHA 5KMPA 4USRA 4OPIA 3UTEA 2YG7A 2X50A 2WU5A 4B65A 1COYA 4Z2RA 1PBFA 2TPRA 4X4JA 1YQ3A 5C3JA 1PBEA 3BHFA 4YTPA 1KFYA 2RABA 1X31B 2XYOA 3C96A 3UKKA 3F8PA 4ICYA 4X9MA 4CRTA 4GUVA 5KVHA 4ECHA 2GQFA 3NGCX 1BZLA 5J7XA 4JN9A 1E7PA 4HB9A 4RG3A 3BHKA 3T37A 2NPXA 3GRTA 1DOBA 2EQ6A 4A5LA 4TLXA 2VVMA 3HYWA 3KVEA 1F6MA 3AXBA 4U2LA 3EPTA 4A6NB 3GWFA 1N4UA 1PDHA 3SZ0A 1KNRA 3LXDA 4G74A 1GRBA 3AEFA 4PABA 5FS9A 2WOVA 2YG6A 3P4RA 1IUUA 1K0LA 2WS3A 2VQ7A 3DGHA 3FG2P 1DNCA 1S7MA 3DJJA 2B76A 1ZOYA 2GAGB 1CHUA 3AE1A 2B7SA 2Q0KA 3NKSA 3Q9TA 1FL2A 3EANA 4EMIA 2XDOA 3NYFA 1F8WA 1NENA 2BS4A 1GREA 2XLUA 2YLRA 4YSZA 1GOSA 1P2EA 1VQWA 1ZDLA 3CN8A 4H4VA 4GRTA 4J34A 4JY3A 1Y0PA 3LADA 3O0HA 4NTCA 5KVIA 5KOXA 2BABA 1ZX9A 3ATQA 3H8IA 4B68A 2UZZA 3EF6A 2C7GA 3ADAB 3UKFA 2C67A 2E1MA 3ZDNA 5JRBA 2AAQA 2C4CA 3BI5A 3QFBA 4H4UA 3WE0A 3AE3A 4B69A 1JRXA 3NN6X 4IA6A 1D4EA 1D7LA 5FS8A 2X99A 3ITJA 3QSMA 1H7WA 4U2SA 2XFUA 2C75A 1L9EA 1NHSA 3AE7A 1W4XA 4YKFA 3SM8A 3L8KA 2RGJA 3DK8A 1OJ9A 2CULA 4A6NA 4GDEA 3UOYA 2IIDA 4ZCCA 4UDRA 2V60A 3C4AA 5EB5A 4UDQA 2V3AA 4EQXA 1OJAA 1H84A 4CNKA 3VRBA 4GAPA 4A79A 3BNMA 1JU2A 2R45A 2YWLA 1MOKA 3DGZA 1AOGA 3PS9A 4B67A 4GR1A 3AD8B 1S3BA 5KWFA 4I59A 4DSGA 3QJ4A 1F8RA 3GYIA 4OPUA 2AR8A 2GQWA 2A87A 2JB3A 3CNDA 4H7UA 1IUVA 2WPEA 1L9DA 1H7XA 3AE4A 3IC9A 3GYJA 4TM1A 2C3DA 2Y6RA 3IWAA 4H2PA 1ZMCA 4NZHA 5HYMA 4AOSA 4B66A 2GB0A 1OJDA 2FJAA 5BRTA 2CFYA 1CJ3A 2YVFA 2VOUA 1CJ2A 3SQPA 2WETA 2YLXA 2V6OA 1EL7A 3B3RA 4WX1A 3NG7X 3CGCA 4K8DA 3DK4A 2YM2A 3CNSA 4AT0A 1CJ4A 1D5TA 3V3OA 1IUSA 3UCLA 5IQ4A 2CDUA 4APNA 2R0GA 1VG9A 4GAVA 4LIIA 5U1OA 1Y56A 3P4PA 4D04A 4TM0A 2XFPA 1XANA 3CNTA 3G5QA 2BACA 2EQ8A 3QVRA 1TDKA 2WEUA 3QVPA 3SFEA 1EL8A 3DA1A 1CC2A 1UKVG 3E1TA 5KMQA 3GMBA 2JAEA 3UTHA 1GRGA 1TRBA 3KA7A 5DBJA 2X8GA 1FECA 4A7AA 2ZZ0A 5KMSA 3M13A 2C72A 2HQMA 3SXIA 1PN0A 1LVLA 1IJHA 1QJDA 2BC0A 1SEZA 2E5VA 4II3A 4TM4A 3S61A 1TDFA 4HA6A 1NHPA 2YVJA 3AYLA 2B9XA 4H2QA 1BWCA 3V3NA 4Z26A 2V3BA 4CNJA 3AD7B 5L46A 1Q1WA 3H8LA 4IVOB 3T14A 4CY8A 1CBOA 4EMWA 3DMEA 4FDCB 4KX6A 4U8KA 1GRFA 4CBQA 4YSYA 4NNJA 4U8MA 1PBCA 5KRQA 3DH9A 4XWZA 5EOWA 2YG3A 4JNAA 2O9ZA 1GTHA 1CC6A 3AWIA 4H4XA 4G73A 4XWRA 4BV6A 1EL5A 2PHHA 4G6GA 4TLZA 2WP6A 2R46A 4N9XA 3GSIA 1L9CA 2WP9A 1YQ4A 2B7RA 1ELIA 1H86A 1JRYA 3NYCA 4Z2TA 3UKQA 5JCLA 2BA9A 2I0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FIM B;  2JB1 A;  3L1R A;  4U8L A;  4U8P A;  1S2Y A;  3IF9 A;  3CPH G;  3LZW A;  2QA1 A;  3FPZ A;  2R0P A;  1JNR A;  2YG4 A;  4FX9 A;  2WU2 A;  3NN0 X;  5HXI A;  2GR3 A;  2DKH A;  4H4Y A;  1VDC A;  3AE8 A;  1NPX A;  2R0C A;  2YLW A;  3P9U A;  3CPJ G;  1ONF A;  1Q9I A;  3P4Q A;  4OVI A;  3GDP A;  1CJC A;  3NK2 X;  4JNQ A;  1GTE A;  2BXR A;  4C74 A;  4YXD A;  4C77 A;  4USQ A;  3IHM A;  2XLT A;  1DXL A;  3VRA A;  5BUL A;  2YQU A;  1QO8 A;  4OPL A;  1ZKQ A;  4OCG A;  5EBK A;  1L0V A;  4K7Z A;  4EM3 A;  2X3N A;  3F8R A;  4RSL A;  3KLJ A;  4YT0 A;  2XLS A;  4BK3 A;  1GES A;  1D4D A;  2YM1 A;  2BCP A;  4BK1 A;  3AE6 A;  1GAL A;  3OZ2 A;  1KDG A;  2BXS A;  4BJY A;  1QLB A;  1B5Q A;  4FK1 C;  1NHQ A;  4K2X A;  2A8X A;  4H4T A;  1RP0 A;  1EL9 A;  1FCD A;  2YR4 A;  3G5S A;  1S3E A;  4DNA A;  2WBA A;  2EQ7 A;  2WDV A;  1LPF A;  4DGK A;  2F5Z A;  1IUX A;  3BNU A;  3FMW A;  1O94 A;  3UP4 A;  5U63 A;  4A99 A;  1KNP A;  4A65 A;  3SGL A;  1IUT A;  3ALM A;  1E1M A;  4I58 A;  4C3X A;  1TDE A;  2ARD A;  4Y4N A;  4Y4L A;  3LZX A;  4CCR A;  1NEK A;  4P9S A;  3NNE A;  3K7Q X;  4REK A;  1JRZ A;  2V5Z A;  3ICT A;  2OAM A;  2GR2 A;  1PJ5 A;  5J60 A;  2R4J A;  2QA2 A;  4O5Q A;  4A9W A;  1IUW A;  4ZN0 A;  2OLO A;  4B1B A;  3AEE A;  5GRT A;  2OLN A;  3LJP A;  3M0O A;  2QCU A;  2BYB A;  2XLR A;  4RG4 A;  3NK1 X;  3GD3 A;  2GV8 A;  2WOW A;  3DJE A;  4U8N A;  1TYT A;  5BVA A;  1TYP A;  2J3N A;  4YSX A;  3QSS A;  4IV9 A;  1E1K A;  4EM4 A;  2WDQ A;  5GSN A;  1GT8 A;  2RGH A;  1LV0 A;  4XXG A;  4BK2 A;  1M6I A;  2GEW A;  1GV4 A;  3G5R A;  2ACZ A;  2B9W A;  2GMH A;  2BCG G;  1LQT A;  1Z6L A;  4OPD A;  4X9N A;  2WOI A;  1B8S A;  2GMJ A;  3CNJ A;  2YLZ A;  3GMC A;  5LV9 A;  2E4G A;  1XDI A;  2OA1 A;  2Q0L A;  3VRD B;  4YTN A;  3P1W A;  1VRQ B;  2JK6 A;  1FOH A;  5KOW A;  2WPF A;  4LU6 A;  1PXC A;  1PHH A;  2VRL A;  3ZYX A;  4J2W A;  2GH5 A;  3F8D A;  4C3Y A;  3AYJ A;  2JBV A;  1H82 A;  5EB4 A;  1K4Q A;  1N4V A;  3IHG A;  5KXJ A;  1YQZ A;  3NK0 X;  1KF6 A;  3R9U A;  4DSH A;  4GF7 A;  3DK9 A;  2C64 A;  4AOX A;  4ADW A;  4FK1 A;  1N4W A;  1E1N A;  2ZZC A;  2ZBW A;  3DJD A;  3AB1 A;  4OPC A;  4E0V A;  4EIP A;  1OJT A;  4EQS A;  1D7Y A;  3AEA A;  5IPY A;  3CIR A;  1XPQ A;  3ABV A;  3ICS A;  1GPE A;  3CGE A;  4YTM A;  2BK5 A;  1KSS A;  1LJ1 A;  3Q6J A;  2WP5 A;  1PJ7 A;  2XVE A;  4H2N A;  2C76 A;  3QSE A;  2VVL A;  3FBS A;  5U25 A;  1ZMD A;  4J57 A;  1B4V A;  3GD4 A;  3VQR A;  2GVC A;  3AED A;  4Z43 A;  2V61 A;  4H4Q A;  4K22 A;  3SFD A;  2A89 A;  4UP3 A;  4D03 A;  3UOV A;  1DOC A;  1MO9 A;  2PYX A;  2FJD A;  2C73 A;  3D1C A;  4M52 A;  3NLC A;  1PBB A;  2APG A;  2OAL A;  4IA5 A;  1K0J A;  1B37 A;  1D4C A;  1Q1R A;  5JCN A;  4GCM A;  4AP1 A;  3CNP A;  3URH A;  1P2H A;  4NTD A;  3UTG A;  1M64 A;  4LA1 A;  3CTY A;  4J56 A;  1PS9 A;  2BS2 A;  1BGN A;  3KKJ A;  2C65 A;  1GET A;  3VR9 A;  4GDP A;  2GR1 A;  2R9Z A;  1LTX R;  2W0H A;  3KD9 A;  3UKA A;  2YLT A;  4H2R A;  4B64 A;  2XVF A;  4H4W A;  3AE5 A;  1E39 A;  3NHO X;  4Z24 A;  1VG0 A;  1F3P A;  4AT2 A;  1JOA A;  1JEH A;  3AEC A;  5CKU A;  4KPR A;  1BF3 A;  3RHA A;  1GXF A;  3GRS A;  3GDN A;  4H4Z A;  4NEW A;  4K5S A;  1BKW A;  4UDP A;  3RP8 A;  2XVI A;  1H83 A;  5JCI A;  3ATR A;  3LB8 A;  1NAA A;  2XFN A;  3AD9 B;  3AYI A;  2XCG A;  3QFA A;  4U2T A;  1EBD A;  2GR0 A;  1NHR A;  1GND A;  4JY2 A;  1PJ6 A;  4Y4M A;  1MXT A;  2WPC A;  2R4E A;  2XVJ A;  3GWD A;  4J33 A;  2CVJ A;  2TMD A;  2VVL G;  4U8J A;  1O5W A;  3NRN A;  4U8I A;  4J31 A;  2YR6 A;  1F8S A;  2Z5Y A;  5ER0 A;  3ALL A;  1E6E A;  2GAH B;  2GF3 A;  2JB2 A;  5CQF A;  1S2Q A;  3UKL A;  4Z44 A;  3JSK A;  1ZOV A;  3CGB A;  1GEU A;  2B9Y A;  2YG5 A;  2YR5 A;  2GRT A;  1PBD A;  2WDR A;  3AE9 A;  3NYE A;  1LQU A;  3C4N A;  4NTE A;  1H81 A;  2FBW A;  4EIQ A;  4BUR A;  1PXA A;  3PVC A;  1GER A;  2H89 A;  2VRM A;  3UKH A;  4Z2U A;  1KSU A;  4YKG A;  2JKC A;  3DJG X;  4CCQ A;  5FS7 A;  3NT6 A;  1REO A;  2RGO A;  2WQY A;  4JQ9 A;  3H4K A;  2Q6U A;  4OPT A;  3EAO A;  1YY5 A;  4U8O A;  2BC1 A;  2AQJ A;  1K0I A;  1Y56 B;  3ICR A;  2XLP A;  4H4S A;  4EMJ A;  2FJB A;  4BJZ A;  2X8C A;  3OC4 A;  3K30 A;  3KU9 A;  1E1L A;  1O95 A;  3RNM A;  3UTF A;  2Z5X A;  3BI4 A;  4TM3 A;  1GRA A;  2YVG A;  2BK3 A;  1GRH A;  1DJQ A;  1ZP0 A;  2BS3 A;  2C66 A;  4IVM B;  4ZCD A;  4JDR A;  3D8X A;  1PXB A;  2VZ2 A;  3COX A;  4O5U A;  4H50 A;  4MJW A;  1TDO A;  3PO7 A;  3K7M X;  2C3C A;  4OPG A;  2VQB A;  2C70 A;  1H6V A;  3NH3 X;  2Y6Q A;  3P4S A;  4CY6 A;  2XFQ A;  4B63 A;  5C2T A;  5FS6 A;  5TR3 A;  4PAA A;  2ZZB A;  5FMH A;  3AEB A;  2EQ9 A;  2WHD A;  3ALJ A;  1RYI A;  3M12 A;  1RSG A;  2Q7V A;  5M10 A;  3II4 A;  1NDA A;  3RP7 A;  1DJN A;  1GRT A;  1TDN A;  3HZL A;  1XHC A;  1OJC A;  3I6D A;  2IVD A;  3RED A;  2FJE A;  2QAE A;  1ZK7 A;  4J36 A;  3AE2 A;  5BUK A;  1GSN A;  1YKJ A;  3CPI G;  4AP3 A;  1CL0 A;  3S5W A;  1HYU A;  2DKI A;  3UP5 A;  1JNZ A;  3UOZ A;  2XFO A;  2NVK X;  3K7T A;  3LOV A;  2WES A;  4H4R A;  3UOX A;  4YWO A;  4C5O A;  1NG3 A;  5JCK A;  3CGD A;  1DOE A;  5JCM A;  3I3L A;  4WCT A;  2X8H A;  2BK4 A;  5IQ1 A;  5M0Z A;  4EQW A;  3VR8 A;  4Z25 A;  2XVH A;  2H88 A;  3NTD A;  2YAU A;  3B6D A;  1CC4 A;  1FEA A;  1FEB A;  4YSH A;  3NIX A;  5HHF A;  2IVE A;  3UKP A;  1V59 A;  1NG4 A;  1CF3 A;  5HY5 A;  3RP6 A;  3NTA A;  1DOD A;  4H4P A;  1ZY8 A;  4EQR A;  3BI2 A;  4K5R A;  3V76 A;  3KPF A;  3AEG A;  1BGJ A;  1N1P A;  2YLS A;  4NEV A;  3ISH A;  4USR A;  4OPI A;  3UTE A;  2YG7 A;  2X50 A;  2WU5 A;  4B65 A;  1COY A;  4Z2R A;  1PBF A;  2TPR A;  4X4J A;  1YQ3 A;  5C3J A;  1PBE A;  3BHF A;  4YTP A;  1KFY A;  2RAB A;  1X31 B;  2XYO A;  3C96 A;  3UKK A;  3F8P A;  4ICY A;  4X9M A;  4CRT A;  4GUV A;  5KVH A;  4ECH A;  2GQF A;  3NGC X;  1BZL A;  5J7X A;  4JN9 A;  1E7P A;  4HB9 A;  4RG3 A;  3BHK A;  3T37 A;  2NPX A;  3GRT A;  1DOB A;  2EQ6 A;  4A5L A;  4TLX A;  2VVM A;  3KVE A;  1F6M A;  3AXB A;  4U2L A;  3EPT A;  4A6N B;  3GWF A;  1N4U A;  1PDH A;  1KNR A;  3LXD A;  1GRB A;  3AEF A;  4PAB A;  5FS9 A;  2WOV A;  2YG6 A;  3P4R A;  1IUU A;  1K0L A;  2WS3 A;  2VQ7 A;  3DGH A;  3FG2 P;  1DNC A;  3DJJ A;  2B76 A;  1ZOY A;  2GAG B;  1CHU A;  3AE1 A;  2B7S A;  2Q0K A;  3NKS A;  3Q9T A;  1FL2 A;  3EAN A;  4EMI A;  2XDO A;  3NYF A;  1F8W A;  1NEN A;  2BS4 A;  1GRE A;  2XLU A;  2YLR A;  4YSZ A;  1GOS A;  1P2E A;  1VQW A;  1ZDL A;  3CN8 A;  4H4V A;  4GRT A;  4J34 A;  4JY3 A;  1Y0P A;  3LAD A;  3O0H A;  4NTC A;  5KVI A;  5KOX A;  2BAB A;  1ZX9 A;  3ATQ A;  3H8I A;  4B68 A;  2UZZ A;  3EF6 A;  2C7G A;  3ADA B;  3UKF A;  2C67 A;  2E1M A;  3ZDN A;  2AAQ A;  3BI5 A;  3QFB A;  4H4U A;  3WE0 A;  3AE3 A;  4B69 A;  1JRX A;  3NN6 X;  4IA6 A;  1D4E A;  1D7L A;  5FS8 A;  2X99 A;  3ITJ A;  3QSM A;  1H7W A;  4U2S A;  2XFU A;  2C75 A;  1L9E A;  1NHS A;  3AE7 A;  1W4X A;  4YKF A;  3SM8 A;  3L8K A;  2RGJ A;  3DK8 A;  1OJ9 A;  2CUL A;  4A6N A;  4GDE A;  3UOY A;  2IID A;  4ZCC A;  4UDR A;  2V60 A;  3C4A A;  5EB5 A;  4UDQ A;  4EQX A;  1OJA A;  2V3A A;  1H84 A;  4CNK A;  3VRB A;  4A79 A;  3BNM A;  1JU2 A;  2R45 A;  2YWL A;  1MOK A;  3DGZ A;  1AOG A;  3PS9 A;  4B67 A;  4GR1 A;  3AD8 B;  1S3B A;  5KWF A;  4I59 A;  4DSG A;  3QJ4 A;  1F8R A;  3GYI A;  4OPU A;  2AR8 A;  2GQW A;  2A87 A;  2JB3 A;  3CND A;  4H7U A;  1IUV A;  2WPE A;  1L9D A;  1H7X A;  3AE4 A;  3IC9 A;  3GYJ A;  4TM1 A;  2C3D A;  2Y6R A;  3IWA A;  4H2P A;  1ZMC A;  4NZH A;  5HYM A;  4AOS A;  4B66 A;  2GB0 A;  1OJD A;  2FJA A;  5BRT A;  2CFY A;  1CJ3 A;  2YVF A;  2VOU A;  1CJ2 A;  3SQP A;  2WET A;  2YLX A;  2V6O A;  1EL7 A;  3B3R A;  4WX1 A;  3NG7 X;  3CGC A;  4K8D A;  3DK4 A;  2YM2 A;  3CNS A;  4AT0 A;  1CJ4 A;  1D5T A;  3V3O A;  1IUS A;  3UCL A;  5IQ4 A;  2CDU A;  4APN A;  2R0G A;  1VG9 A;  4LII A;  5U1O A;  1Y56 A;  3P4P A;  4D04 A;  4TM0 A;  2XFP A;  1XAN A;  3CNT A;  3G5Q A;  2BAC A;  2EQ8 A;  3QVR A;  1TDK A;  2WEU A;  3QVP A;  3SFE A;  1EL8 A;  3DA1 A;  1CC2 A;  1UKV G;  3E1T A;  3GMB A;  2JAE A;  3UTH A;  1GRG A;  1TRB A;  3KA7 A;  5DBJ A;  2X8G A;  1FEC A;  4A7A A;  2ZZ0 A;  3M13 A;  2C72 A;  2HQM A;  1PN0 A;  1LVL A;  1IJH A;  1QJD A;  2BC0 A;  1SEZ A;  2E5V A;  4TM4 A;  3S61 A;  1TDF A;  4HA6 A;  1NHP A;  2YVJ A;  3AYL A;  2B9X A;  4H2Q A;  1BWC A;  3V3N A;  4Z26 A;  2V3B A;  4CNJ A;  3AD7 B;  5L46 A;  1Q1W A;  3H8L A;  4IVO B;  4CY8 A;  1CBO A;  4EMW A;  3DME A;  4FDC B;  4KX6 A;  4U8K A;  1GRF A;  4CBQ A;  4YSY A;  4U8M A;  1PBC A;  5KRQ A;  3DH9 A;  4XWZ A;  5EOW A;  2YG3 A;  4JNA A;  2O9Z A;  1GTH A;  1CC6 A;  3AWI A;  4H4X A;  4XWR A;  4BV6 A;  1EL5 A;  2PHH A;  4TLZ A;  2WP6 A;  2R46 A;  4N9X A;  3GSI A;  1L9C A;  2WP9 A;  1YQ4 A;  2B7R A;  1ELI A;  1H86 A;  1JRY A;  3NYC A;  4Z2T A;  3UKQ A;  5JCL A;  2BA9 A;  2I0Z A; 
#chains in the Genus database with same CATH topology
 3FIM B;  3FPZ A;  3SY4 A;  2WU2 A;  2QVH A;  3NO1 A;  2R0C A;  1JPM A;  4GGB A;  3P9U A;  2P3Z A;  1CJC A;  1JPD X;  4JNQ A;  4YXD A;  1QO8 A;  3V3W A;  5EBK A;  3BSM A;  1GES A;  1D4D A;  2YM1 A;  3SX6 A;  3U9I A;  1KDG A;  4BJY A;  3G5S A;  1FCD A;  1S3E A;  4H19 A;  2EQ7 A;  1IUX A;  3UP4 A;  1O94 A;  5U63 A;  3SGL A;  3ALM A;  4I58 A;  1SJA A;  4C3X A;  4Y4N A;  4P9S A;  1EC7 A;  3NNE A;  2GR2 A;  1PJ5 A;  2PTW A;  5GRT A;  3M0O A;  2BYB A;  2DW7 A;  3DJE A;  1TYP A;  4G9K A;  1E1K A;  1GV4 A;  1N60 C;  4OPD A;  3GMC A;  2HZG A;  3DG3 A;  2OA1 A;  1VRQ B;  1FOH A;  2WPF A;  2HXU A;  2JBV A;  5EB4 A;  5KXJ A;  4IHC A;  3R9U A;  5G5G B;  3DK9 A;  3FYY A;  1E1N A;  3AB1 A;  4OPC A;  1N5X A;  1OJT A;  3AEA A;  5KMR A;  3Q6J A;  2WP5 A;  2XVE A;  4E4F A;  2AL1 A;  3Q4D A;  4J57 A;  3GO2 A;  3P3B A;  2OZ8 A;  4H4Q A;  2V61 A;  3SFD A;  4UP3 A;  4II2 A;  3UOV A;  2PYX A;  2C73 A;  3D1C A;  4M52 A;  4A6G A;  1B37 A;  5JCN A;  3THU A;  3UTG A;  1M64 A;  3CTY A;  1PS9 A;  3KKJ A;  1GET A;  5KNL A;  3CK5 A;  4GDP A;  2W0H A;  5IDZ A;  3AE5 A;  4H4W A;  3NHO X;  2PTY A;  2MUC A;  3GDN A;  3RP8 A;  3QLD A;  2XVI A;  2CHR A;  3LB8 A;  3NZG A;  2XCG A;  3QFA A;  1EBD A;  2GR0 A;  4MGG A;  2XVJ A;  4J33 A;  3V5C A;  3NRN A;  2Z5Y A;  1FFV C;  2GAH B;  2GF3 A;  5CQF A;  1S2Q A;  4Z44 A;  1ZOV A;  3CGB A;  2GRT A;  3C4N A;  1PDY A;  1PXA A;  2VRM A;  6ENL A;  4YKG A;  2JKC A;  3DJG X;  4CCQ A;  3NT6 A;  4OPT A;  4IL2 A;  2BC1 A;  1K0I A;  2FJB A;  3K30 A;  1E1L A;  4IVM B;  1PXB A;  2VZ2 A;  4O5U A;  4MJW A;  3B9J B;  2VQB A;  5TR3 A;  3AEB A;  3P93 A;  1RYI A;  3I6D A;  1XHC A;  1OJC A;  1DTN A;  4GYP A;  1H2I A;  4AP3 A;  3S5W A;  3T6C A;  2XFO A;  1FHV A;  4H4R A;  3TW9 A;  5JCK A;  3VR8 A;  2X8H A;  2H88 A;  2GGH A;  5HHF A;  2IVE A;  3UKP A;  1KD0 A;  1NG4 A;  1DOD A;  3UJ2 A;  2XH7 A;  3BI2 A;  1N1P A;  2YLS A;  3ISH A;  1FIQ B;  3NVY B;  2X50 A;  4B65 A;  1COY A;  4MMW A;  1YQ3 A;  3UKK A;  4X9M A;  3S5S A;  4ECH A;  1BZL A;  4JN9 A;  3VCN A;  3T37 A;  1DOB A;  3GRT A;  3AXB A;  4U2L A;  1N4U A;  1KNR A;  5FS9 A;  2WOV A;  3P4R A;  3RR1 A;  3FJ4 A;  3Q9T A;  2Q0K A;  2OPJ A;  3NYF A;  2XLU A;  1GOS A;  3DEQ A;  4NTC A;  3O0H A;  5KVI A;  2W3S A;  1P48 A;  4IZG A;  3ATQ A;  3H8I A;  3ADA B;  3UKF A;  2AAQ A;  3WE0 A;  3AE3 A;  1JRX A;  1D7L A;  5J04 A;  3R0K A;  3ITJ A;  3QSM A;  1NHS A;  3SM8 A;  3DK8 A;  4GDE A;  2IID A;  3OTR A;  2V60 A;  1OJA A;  2R45 A;  1MOK A;  3PS9 A;  5KWF A;  3SN0 A;  3QJ4 A;  1F8R A;  2GQW A;  2A87 A;  4H7U A;  4DXK A;  2PMQ A;  3IWA A;  1ZMC A;  2PU1 A;  2XH0 A;  3SQP A;  2YLX A;  2V6O A;  3CGC A;  3V3O A;  3UCL A;  3R25 A;  4APN A;  4GAV A;  4LII A;  2XFP A;  1XAN A;  3CNT A;  3QVR A;  4F4R A;  3QTP A;  1EL8 A;  7ENL A;  3SQS A;  2PGW A;  1TRB A;  5DBJ A;  1SJB A;  2ZZ0 A;  3M13 A;  1PN0 A;  1LVL A;  3DFH A;  2BC0 A;  1RVK A;  1BWC A;  4Z26 A;  2V3B A;  1N63 C;  4KX6 A;  2QDE A;  4H83 A;  4NNJ A;  5KRQ A;  4XWZ A;  4JNA A;  2O9Z A;  2PHH A;  2AL2 A;  4G6G A;  3GSI A;  1L9C A;  2POD A;  5M10 A;  2VVL A;  2YR6 A;  1S2Y A;  3IF9 A;  3CPH G;  3LZW A;  2R0P A;  2YG4 A;  4FX9 A;  3FV9 A;  4ENL A;  3I6T A;  4Z1Y A;  4K1W A;  4C77 A;  1L8P A;  3VRA A;  5G5H B;  3TQP A;  4OCG A;  4EM3 A;  3F8R A;  4RSL A;  3AE6 A;  1ZXI C;  1GAL A;  2BXS A;  3SYI A;  1QLB A;  1B5Q A;  4K2X A;  1RP0 A;  2YR4 A;  2WBA A;  2PPG A;  3BNU A;  3ZLH A;  3AMZ A;  1IUT A;  4GIR A;  5J60 A;  1IUW A;  3AEE A;  2QCU A;  4KWS A;  1TYT A;  5BVA A;  3IK4 A;  2WDQ A;  4XXG A;  1LV0 A;  1JRP A;  2OFJ A;  3G5R A;  2B9W A;  1MUC A;  1SB3 B;  2WOI A;  1B8S A;  3CNJ A;  3GD6 A;  4YTN A;  3P1W A;  3OZY A;  5KOW A;  4G6H A;  3RRA A;  3H12 A;  4LU6 A;  1PHH A;  2OQH A;  5FJR A;  2PA6 A;  3AYJ A;  1H82 A;  1N4V A;  4EWJ A;  3IHG A;  3NK0 X;  4FK1 A;  3DJD A;  2OVL A;  1D7Y A;  2GSH A;  3SZW A;  3ICS A;  3NVW B;  1GPE A;  2FKP A;  1X2H A;  2MNR A;  2P8B A;  1KSS A;  2C76 A;  5U25 A;  3ES7 A;  1B4V A;  3GD4 A;  2GVC A;  1XS2 A;  2A89 A;  4D03 A;  3BOX A;  4J3Z A;  3UJR A;  2OAL A;  4IA5 A;  1K0J A;  4AP1 A;  3URH A;  2E3T A;  4LA1 A;  4J56 A;  3T0K A;  2GR1 A;  3R10 A;  4ZCW A;  1ONE A;  2YLT A;  4B64 A;  3QKE A;  1FHU A;  1N5W C;  1JOA A;  5CKU A;  4KPR A;  1BF3 A;  4NEW A;  1BKW A;  3U4F A;  1NAA A;  2XFN A;  3AD9 B;  4U2T A;  3NS1 B;  3TWA A;  1PJ6 A;  2WPC A;  2R4E A;  2P8C A;  2VVL G;  1O5W A;  1RM6 B;  4U8I A;  5ER0 A;  1E6E A;  3JSK A;  4E8G A;  4DWD A;  1MDL A;  1GEU A;  1PBD A;  4NTE A;  3NYE A;  2FBW A;  4BUR A;  3PVC A;  2QGY A;  1GER A;  2H89 A;  3UKH A;  1KSU A;  2POZ A;  2RGO A;  4JQ9 A;  2Q6U A;  1YY5 A;  1FO4 A;  2AQJ A;  1Y56 B;  4H4S A;  2X8C A;  4MKS A;  3HYV A;  2Z5X A;  4TM3 A;  2BK3 A;  1GRH A;  1ZP0 A;  4ZCD A;  3D8X A;  3MUC A;  3PO7 A;  3K7M X;  4CY6 A;  2I5Q A;  5FS6 A;  2ZZB A;  3S47 A;  3M12 A;  3II4 A;  3RP7 A;  2IVD A;  1MRA A;  4A35 A;  1ZK7 A;  3T8Q A;  3AE2 A;  1HYU A;  3UOZ A;  2WES A;  3DFY A;  3FVD A;  2XH2 A;  1R6W A;  1NG3 A;  2BK4 A;  4HPN A;  4Z25 A;  1CC4 A;  1FEA A;  4YSH A;  3TOY A;  5HY5 A;  3T9P A;  1ZY8 A;  3KPF A;  1V97 A;  3MKC A;  4IP5 A;  2OQY A;  4OPI A;  2WU5 A;  4YTP A;  3CYJ A;  1X31 B;  3UJS A;  4ICY A;  4CRT A;  4GUV A;  2GQF A;  4HB9 A;  4RG3 A;  4A5L A;  3HYW A;  3EPT A;  1PDH A;  3SZ0 A;  4HCL A;  1EBG A;  1K0L A;  2GGI A;  3VC6 A;  3DGH A;  3FG2 P;  1DNC A;  1ZOY A;  2AKM A;  1CHU A;  2B7S A;  1FL2 A;  3EAN A;  4EMI A;  2BS4 A;  1NEN A;  1GRE A;  4TVY A;  1VQW A;  4J34 A;  4H4V A;  4JY3 A;  1Y0P A;  2BAB A;  3DER A;  1N61 C;  2C67 A;  4HCD A;  3QFB A;  4H4U A;  4E6M A;  1D4E A;  5FS8 A;  3DG6 A;  2XFU A;  3AE7 A;  1MDR A;  1NEL A;  3UOY A;  4UDQ A;  4EQX A;  3TCS A;  3VRB A;  4GAP A;  1JU2 A;  1BKH A;  4B67 A;  2QJJ A;  4GR1 A;  4DSG A;  4OPU A;  3JZU A;  2JB3 A;  3IC9 A;  4TM1 A;  2C3D A;  4H2P A;  4NZH A;  5HYM A;  2GB0 A;  2FJA A;  5BRT A;  2YVF A;  2VOU A;  3MY9 A;  3NG7 X;  4K8D A;  1D5T A;  2DW6 A;  5IQ4 A;  2R0G A;  1VG9 A;  3TWB A;  5U1O A;  2BAC A;  2EQ8 A;  3SFE A;  3ZVH B;  3E1T A;  2P88 A;  3VC5 A;  5KMQ A;  3UTH A;  3KA7 A;  2X8G A;  1FEC A;  3SXI A;  1QJD A;  1N62 C;  1NHP A;  2YVJ A;  3AYL A;  3PWG A;  3DDM A;  3QN3 A;  4CNJ A;  3AD7 B;  1CBO A;  1JDF A;  3DME A;  3N4E A;  3D46 A;  4CBQ A;  4U8M A;  3MZN A;  3DH9 A;  4IT1 A;  4H4X A;  3R1Z A;  4JHM A;  4TLZ A;  2WP9 A;  4Z2T A;  3NYC A;  1KKO A;  5JCL A;  2I0Z A;  2JB1 A;  3L1R A;  3NN0 X;  5HXI A;  2GR3 A;  1TZZ A;  2PTX A;  1VDC A;  3AE8 A;  3ZVH A;  3CPJ G;  1ONF A;  3CB3 A;  1Q9I A;  4OVI A;  3GDP A;  3NK2 X;  1GTE A;  4USQ A;  2XLT A;  2QJM A;  3CXO A;  4OPL A;  1ZKQ A;  3Q45 A;  1L0V A;  2X3N A;  4YT0 A;  2XLS A;  2BCP A;  4BK1 A;  3ETR B;  3HYX A;  4FK1 C;  4H4T A;  1EL9 A;  4NWZ A;  4DNA A;  4DGK A;  2F5Z A;  1KNP A;  4A65 A;  1E1M A;  4FP1 A;  1TDE A;  2E5A A;  3K7Q X;  4REK A;  3ICT A;  2R4J A;  2QA2 A;  4A9W A;  4B1B A;  3LJP A;  3NK1 X;  3SSZ A;  4U8N A;  2J3N A;  3QSS A;  4IV9 A;  5GSN A;  1GT8 A;  3T2K A;  4BK2 A;  2GEW A;  2ACZ A;  2GMH A;  2BCG G;  1LQT A;  1Z6L A;  4X9N A;  2YLZ A;  2OKT A;  1XDI A;  2Q0L A;  3VRD B;  2JK6 A;  4G8T A;  1PXC A;  3MWC A;  4J2W A;  2GH5 A;  3EUB 3;  2BRA A;  1K4Q A;  4H2H A;  1YQZ A;  1KF6 A;  4GF7 A;  2PGE A;  1EC9 A;  2C64 A;  4AOX A;  4ADW A;  1N4W A;  2ZZC A;  2ZBW A;  2BRY A;  4EQS A;  3GY1 A;  3ABV A;  3CGE A;  4YTM A;  1LJ1 A;  1PJ7 A;  4H2N A;  3FBS A;  1ZMD A;  3AED A;  4IP4 A;  3SJN A;  1DOC A;  2FJD A;  4IL0 A;  1PBB A;  3UJE A;  1Q1R A;  4HN8 A;  3CNP A;  3TJ4 A;  1P2H A;  1BGN A;  2C65 A;  2R9Z A;  3KD9 A;  3UKA A;  4AT2 A;  3AEC A;  3GRS A;  3T2Z A;  3HW2 A;  3CMM A;  2PP3 A;  3NVV B;  1H83 A;  3L5O A;  2RDX A;  3AYI A;  1NHR A;  1GND A;  1P43 A;  3HPF A;  2CVJ A;  2TMD A;  3FCP A;  4U8J A;  3ALL A;  3CAW A;  2B9Y A;  2YG5 A;  2YR5 A;  2WDR A;  3AE9 A;  1LQU A;  1H81 A;  2NQL A;  3GYX A;  4EIQ A;  2GGG A;  5FS7 A;  1REO A;  2WQY A;  3EAO A;  3T4W A;  2XLP A;  4EMJ A;  3OC4 A;  3KU9 A;  1O95 A;  1GRA A;  2C66 A;  1DJQ A;  1TDO A;  4OPG A;  1H6V A;  2Y6Q A;  2XFQ A;  4B63 A;  5C2T A;  4DYE A;  3ALJ A;  2OZ3 A;  2OG9 A;  4TVW A;  3HZL A;  2O56 A;  2ONE A;  3RED A;  1EBH A;  2FJE A;  4J36 A;  5BUK A;  1GSN A;  3CPI G;  2DKI A;  3UP5 A;  5FJT A;  1JNZ A;  3ENL A;  4K2S A;  4YWO A;  2FYM A;  4C5O A;  3CGD A;  1DOE A;  5M0Z A;  3UXL A;  4EQW A;  1FEB A;  3DES A;  3N6H A;  1FFU C;  3SZF A;  3RP6 A;  4H4P A;  4YWS A;  3V76 A;  4USR A;  1PBF A;  2TPR A;  3CT2 A;  3K1G A;  2P0I A;  3BHF A;  2XYO A;  3F8P A;  2PSN A;  1JCT A;  3BJS A;  3OP2 A;  3NGC X;  1E7P A;  2GGE A;  1F9C A;  2VVM A;  4HYR A;  3LXD A;  4G74 A;  1GRB A;  3AEF A;  4PAB A;  3ZLF A;  4K8G A;  1MNS A;  4GYP C;  3SN4 A;  2WS3 A;  2VQ7 A;  1S7M A;  2GAG B;  4J1O A;  4JN8 A;  3NKS A;  4YSZ A;  2YLR A;  1P2E A;  1ZDL A;  3CN8 A;  4GRT A;  5KOX A;  3MSY A;  1ZX9 A;  4B68 A;  1SJC A;  2UZZ A;  3EF6 A;  2E1M A;  5JRB A;  3BI5 A;  3SBF A;  4IA6 A;  1KCZ A;  2X99 A;  1H7W A;  4U2S A;  2C75 A;  2OZT A;  4DHG A;  3L8K A;  2RGJ A;  1OJ9 A;  4UDR A;  3C4A A;  5EB5 A;  3P0W A;  4CNK A;  4A79 A;  3B97 A;  2XSX A;  3D47 A;  2YWL A;  2ZC8 A;  3DGZ A;  3PWI A;  1AOG A;  3UGV A;  3AD8 B;  1SJD A;  3JVA A;  2ZAD A;  5FJO A;  2WPE A;  1KKR A;  2GGJ A;  1H7X A;  1L9D A;  3GYJ A;  2PU0 A;  3N4F A;  3PK7 A;  3JW7 A;  1OJD A;  2CFY A;  3B3R A;  2YM2 A;  4AT0 A;  3ZLG A;  1IUS A;  3R0U A;  1Y56 A;  1IYX A;  3P4P A;  4TM0 A;  1TDK A;  2WEU A;  3QVP A;  3VFC A;  1UKV G;  1GRG A;  3DG7 A;  2GDQ A;  1IJH A;  1W6T A;  1SEZ A;  4II3 A;  2E5V A;  3S61 A;  1TDF A;  4HA6 A;  4H2Q A;  1NU5 A;  3KUM A;  2XGZ A;  3A7R A;  3H8L A;  4IVO B;  4CY8 A;  3OW1 A;  1WUE A;  4FDC B;  4U8K A;  4YSY A;  3H7V A;  5EOW A;  2YG3 A;  2W55 A;  1CC6 A;  4XWR A;  1EL5 A;  3NFU A;  3IJL A;  2R46 A;  2B7R A;  1JRY A;  4GFI A;  3UKQ A;  2BA9 A;  4HNL A;  4U8P A;  4U8L A;  4G7F A;  4HNC A;  2QA1 A;  1JNR A;  4GGH A;  3SZC A;  2DKH A;  4H4Y A;  3D9X A;  1NPX A;  2YLW A;  3P4Q A;  2BXR A;  4C74 A;  3IHM A;  3OZM A;  1DXL A;  5BUL A;  3NXL A;  2YQU A;  5ENL A;  4K7Z A;  3KLJ A;  1T3Q C;  4BK3 A;  1BQG A;  1STZ A;  3OZ2 A;  1NHQ A;  2A8X A;  2WDV A;  1LPF A;  3FMW A;  4A99 A;  1X2G A;  2ARD A;  4Y4L A;  4CCR A;  3LZX A;  1NEK A;  1JRZ A;  2V5Z A;  2OAM A;  3EEZ A;  4ZOH B;  4O5Q A;  4ZN0 A;  2OLO A;  4D04 A;  2OLN A;  2XLR A;  4RG4 A;  3GD3 A;  3OPS A;  2GV8 A;  2WOW A;  4YSX A;  3SR6 B;  4EM4 A;  2RGH A;  1M6I A;  3QPE A;  3H8A A;  2GMJ A;  3RO6 A;  5BOE A;  5LV9 A;  2E4G A;  3MQT A;  3CXB A;  2QDD A;  1JRO A;  3R11 A;  2VRL A;  3ZYX A;  3F8D A;  4C3Y A;  4GME A;  3KPK A;  4DSH A;  2QQ6 A;  3V4B A;  4E0V A;  4EIP A;  5IPY A;  3CIR A;  1XPQ A;  4E5T A;  2BK5 A;  4KEM A;  3QSE A;  3VQR A;  4Z43 A;  4K22 A;  4ROP A;  1MO9 A;  3NRZ B;  2HXT A;  3NLC A;  2APG A;  1D4C A;  4GCM A;  4E4U A;  3FXG A;  4NTD A;  2BS2 A;  3T31 A;  3VR9 A;  1KN0 A;  3UCC A;  2PP0 A;  1LTX R;  3EKG A;  1ECQ A;  4H2R A;  2XVF A;  1E39 A;  3UXK A;  4Z24 A;  1VG0 A;  1F3P A;  1JEH A;  3RHA A;  1GXF A;  4H4Z A;  4K5S A;  4UDP A;  5JCI A;  3ATR A;  4JY2 A;  4Y4M A;  1MXT A;  3GWD A;  3VCC A;  4J31 A;  1F8S A;  2JB2 A;  3UKL A;  4JN7 A;  1VQZ A;  2OX4 A;  1R0M A;  4Z2U A;  3GC2 A;  3PG6 A;  3H4K A;  1YEY A;  4U8O A;  3ICR A;  1PDZ A;  4BJZ A;  3UTF A;  3RNM A;  3BI4 A;  2YVG A;  2BS3 A;  5BOF A;  2OO6 A;  4JDR A;  3COX A;  3DGB A;  4H50 A;  2C3C A;  2C70 A;  3NH3 X;  3P4S A;  1OEP A;  4PAA A;  3T2Y A;  1E9I A;  5FMH A;  2EQ9 A;  2WHD A;  1RSG A;  2Q7V A;  1NDA A;  1DJN A;  1GRT A;  1TDN A;  2QAE A;  1TKK A;  1YKJ A;  2PS2 A;  1CL0 A;  3TTE A;  3K7T A;  2NVK X;  3LOV A;  2AL2 B;  3UOX A;  4WCT A;  4Z17 A;  5JCM A;  3I3L A;  5IQ1 A;  2XVH A;  3NTD A;  2YAU A;  3B6D A;  3NIX A;  4GIS A;  3ZVI A;  1V59 A;  1CF3 A;  3NTA A;  4EQR A;  4K5R A;  3AEG A;  1BGJ A;  4NEV A;  5KMP A;  3UTE A;  2YG7 A;  4Z2R A;  4X4J A;  2OLA A;  4ZA0 A;  5C3J A;  1PBE A;  1KFY A;  2RAB A;  3C96 A;  2AKZ A;  5KVH A;  3TJI A;  5J7X A;  3N6J A;  3BHK A;  2NPX A;  2EQ6 A;  3ES8 A;  4TLX A;  3KVE A;  1F6M A;  2QJN A;  3IJQ A;  4A6N B;  1VDV A;  3GWF A;  2YG6 A;  1IUU A;  3RIT A;  4X2P A;  3SN1 A;  3DJJ A;  2B76 A;  3AE1 A;  2XDO A;  1F8W A;  4FI4 A;  3LAD A;  3RGT A;  3UJF A;  2W3R A;  2C7G A;  3ZDN A;  2C4C A;  3A7U A;  4B69 A;  3NN6 X;  4DN1 A;  1XPY A;  2HNE A;  2GL5 A;  4HCH A;  1L9E A;  3HRD C;  3UCD A;  1EC8 A;  1W4X A;  4YKF A;  3IJI A;  2CUL A;  4A6N A;  4ZCC A;  5FJU A;  2V3A A;  2XH4 A;  1H84 A;  4H1Z A;  3BNM A;  4KT2 A;  3H70 A;  1S3B A;  4I59 A;  2PP1 A;  3RCY A;  3GYI A;  3PFR A;  2AR8 A;  3CND A;  3I6E A;  1IUV A;  3AM9 A;  3AE4 A;  3NVZ B;  2Y6R A;  4AOS A;  4B66 A;  1CJ3 A;  1CJ2 A;  2WET A;  1EL7 A;  3A7A A;  4WX1 A;  4M6U A;  5FJP A;  3DK4 A;  3CNS A;  1CJ4 A;  5EU9 A;  4KPL A;  3I4K A;  2CDU A;  4DX3 A;  3V5F A;  3VDG A;  3G5Q A;  2PTZ A;  3DA1 A;  4M0X A;  1CC2 A;  3GMB A;  2JAE A;  3DIP A;  2W54 A;  4A7A A;  3AN1 A;  5KMS A;  2C72 A;  2HQM A;  4TM4 A;  2B9X A;  3V3N A;  2PCE A;  1TE6 A;  5L46 A;  1Q1W A;  3R07 C;  3T14 A;  3VA8 A;  4EMW A;  1WUF A;  1GRF A;  1ELS A;  1PBC A;  1GTH A;  3AWI A;  3STP A;  4G73 A;  4A3R A;  4BV6 A;  2WP6 A;  4N9X A;  1YQ4 A;  1ELI A;  1H86 A;  1WYG A; 
#chains in the Genus database with same CATH homology
 3FIM B;  2JB1 A;  3L1R A;  4U8L A;  4U8P A;  1S2Y A;  3IF9 A;  3CPH G;  3LZW A;  2QA1 A;  3FPZ A;  2R0P A;  1JNR A;  2YG4 A;  4FX9 A;  3SY4 A;  2WU2 A;  3NN0 X;  3SZC A;  5HXI A;  2GR3 A;  2DKH A;  4H4Y A;  1VDC A;  3D9X A;  3AE8 A;  1NPX A;  2R0C A;  2YLW A;  3P9U A;  3CPJ G;  1ONF A;  1Q9I A;  3P4Q A;  4OVI A;  3GDP A;  1CJC A;  3NK2 X;  4JNQ A;  1GTE A;  2BXR A;  4C74 A;  4YXD A;  4C77 A;  4USQ A;  3IHM A;  2XLT A;  1DXL A;  3VRA A;  5BUL A;  2YQU A;  1QO8 A;  4OPL A;  1ZKQ A;  4OCG A;  5EBK A;  1L0V A;  4K7Z A;  4EM3 A;  2X3N A;  3F8R A;  4RSL A;  3KLJ A;  4YT0 A;  2XLS A;  4BK3 A;  1GES A;  1D4D A;  2YM1 A;  2BCP A;  4BK1 A;  3AE6 A;  3SX6 A;  1GAL A;  3OZ2 A;  1KDG A;  2BXS A;  4BJY A;  3SYI A;  1QLB A;  3HYX A;  1B5Q A;  4FK1 C;  1NHQ A;  4K2X A;  2A8X A;  4H4T A;  1RP0 A;  1EL9 A;  1FCD A;  2YR4 A;  3G5S A;  1S3E A;  4NWZ A;  4DNA A;  2WBA A;  2EQ7 A;  2WDV A;  1LPF A;  4DGK A;  2F5Z A;  1IUX A;  3BNU A;  3FMW A;  1O94 A;  3UP4 A;  5U63 A;  4A99 A;  1KNP A;  4A65 A;  3SGL A;  1IUT A;  3ALM A;  1E1M A;  4I58 A;  4C3X A;  1TDE A;  2ARD A;  4Y4N A;  4Y4L A;  3LZX A;  4CCR A;  1NEK A;  4P9S A;  3NNE A;  3K7Q X;  4REK A;  1JRZ A;  2V5Z A;  3ICT A;  2OAM A;  2GR2 A;  1PJ5 A;  5J60 A;  2R4J A;  2QA2 A;  4O5Q A;  4A9W A;  1IUW A;  4ZN0 A;  2OLO A;  4B1B A;  3AEE A;  5GRT A;  2OLN A;  3LJP A;  3M0O A;  2QCU A;  2BYB A;  2XLR A;  4RG4 A;  3NK1 X;  3GD3 A;  2GV8 A;  2WOW A;  3DJE A;  4U8N A;  1TYT A;  5BVA A;  1TYP A;  2J3N A;  4G9K A;  3QSS A;  4IV9 A;  4YSX A;  1E1K A;  4EM4 A;  2WDQ A;  5GSN A;  1GT8 A;  2RGH A;  1LV0 A;  4XXG A;  3T2K A;  4BK2 A;  1M6I A;  2GEW A;  1GV4 A;  3G5R A;  2ACZ A;  2B9W A;  2GMH A;  2BCG G;  1LQT A;  1Z6L A;  4OPD A;  4X9N A;  2WOI A;  1B8S A;  2GMJ A;  3CNJ A;  2YLZ A;  3GMC A;  5LV9 A;  2E4G A;  1XDI A;  2OA1 A;  2Q0L A;  3VRD B;  4YTN A;  3P1W A;  1VRQ B;  2JK6 A;  1FOH A;  5KOW A;  2WPF A;  4G6H A;  4LU6 A;  1PXC A;  1PHH A;  2VRL A;  3ZYX A;  4J2W A;  2GH5 A;  3F8D A;  4C3Y A;  3AYJ A;  2JBV A;  1H82 A;  2BRA A;  5EB4 A;  1K4Q A;  3KPK A;  1N4V A;  3IHG A;  5KXJ A;  1YQZ A;  3NK0 X;  1KF6 A;  3R9U A;  4DSH A;  4GF7 A;  3DK9 A;  2C64 A;  4AOX A;  4ADW A;  4FK1 A;  1N4W A;  1E1N A;  2ZZC A;  2ZBW A;  3DJD A;  3AB1 A;  4OPC A;  2BRY A;  4E0V A;  4EIP A;  1OJT A;  4EQS A;  1D7Y A;  3AEA A;  5IPY A;  5KMR A;  3SZW A;  3CIR A;  1XPQ A;  3ABV A;  3ICS A;  1GPE A;  3CGE A;  4YTM A;  2BK5 A;  1KSS A;  1LJ1 A;  3Q6J A;  2WP5 A;  1PJ7 A;  2XVE A;  4H2N A;  2C76 A;  3QSE A;  2VVL A;  3FBS A;  5U25 A;  1ZMD A;  4J57 A;  1B4V A;  3GD4 A;  3VQR A;  2GVC A;  3AED A;  4Z43 A;  2V61 A;  4H4Q A;  4K22 A;  3SFD A;  2A89 A;  4UP3 A;  4D03 A;  4II2 A;  3UOV A;  1DOC A;  1MO9 A;  2PYX A;  2FJD A;  2C73 A;  3D1C A;  4M52 A;  3NLC A;  1PBB A;  2APG A;  2OAL A;  4IA5 A;  1K0J A;  1B37 A;  1D4C A;  1Q1R A;  5JCN A;  4GCM A;  4AP1 A;  3CNP A;  3URH A;  1P2H A;  4NTD A;  3UTG A;  1M64 A;  4LA1 A;  3CTY A;  4J56 A;  1PS9 A;  2BS2 A;  1BGN A;  3KKJ A;  2C65 A;  3T31 A;  1GET A;  3VR9 A;  3T0K A;  5KNL A;  1KN0 A;  4GDP A;  2GR1 A;  2R9Z A;  1LTX R;  2W0H A;  3KD9 A;  3UKA A;  2YLT A;  4H2R A;  4B64 A;  2XVF A;  4H4W A;  3AE5 A;  1E39 A;  3NHO X;  4Z24 A;  1VG0 A;  1F3P A;  4AT2 A;  1JOA A;  1JEH A;  3AEC A;  5CKU A;  4KPR A;  1BF3 A;  3RHA A;  1GXF A;  3GRS A;  3T2Z A;  3GDN A;  4H4Z A;  4NEW A;  4K5S A;  1BKW A;  4UDP A;  3RP8 A;  2XVI A;  3CMM A;  1H83 A;  5JCI A;  3ATR A;  3LB8 A;  3L5O A;  1NAA A;  2XFN A;  3AD9 B;  3AYI A;  2XCG A;  3QFA A;  4U2T A;  1EBD A;  2GR0 A;  1NHR A;  1GND A;  4JY2 A;  1PJ6 A;  4Y4M A;  1MXT A;  2WPC A;  2R4E A;  2XVJ A;  3GWD A;  4J33 A;  2CVJ A;  2TMD A;  2VVL G;  4U8J A;  1O5W A;  3NRN A;  4U8I A;  4J31 A;  2YR6 A;  1F8S A;  2Z5Y A;  5ER0 A;  3ALL A;  1E6E A;  2GAH B;  2GF3 A;  2JB2 A;  5CQF A;  1S2Q A;  3UKL A;  4Z44 A;  3JSK A;  1ZOV A;  3CGB A;  1GEU A;  2B9Y A;  2YG5 A;  2YR5 A;  2GRT A;  1PBD A;  2WDR A;  3AE9 A;  3NYE A;  1LQU A;  3C4N A;  4NTE A;  1H81 A;  2FBW A;  3GYX A;  4BUR A;  1PXA A;  3PVC A;  4EIQ A;  1GER A;  2H89 A;  2VRM A;  3UKH A;  4Z2U A;  1KSU A;  4YKG A;  2JKC A;  3DJG X;  4CCQ A;  3PG6 A;  5FS7 A;  3NT6 A;  1REO A;  2RGO A;  2WQY A;  4JQ9 A;  3H4K A;  2Q6U A;  4OPT A;  3EAO A;  1YY5 A;  4U8O A;  2BC1 A;  2AQJ A;  1K0I A;  1Y56 B;  3ICR A;  2XLP A;  4H4S A;  4EMJ A;  2FJB A;  4BJZ A;  2X8C A;  3OC4 A;  3K30 A;  3KU9 A;  1E1L A;  1O95 A;  3RNM A;  3HYV A;  2Z5X A;  3UTF A;  3BI4 A;  4TM3 A;  1GRA A;  2YVG A;  2BK3 A;  1GRH A;  1DJQ A;  1ZP0 A;  2BS3 A;  2C66 A;  4IVM B;  4ZCD A;  4JDR A;  3D8X A;  1PXB A;  2VZ2 A;  3COX A;  4O5U A;  4H50 A;  4MJW A;  1TDO A;  3PO7 A;  3K7M X;  2C3C A;  4OPG A;  2VQB A;  2C70 A;  1H6V A;  3NH3 X;  2Y6Q A;  3P4S A;  4CY6 A;  2XFQ A;  4B63 A;  5C2T A;  5FS6 A;  5TR3 A;  4PAA A;  2ZZB A;  3T2Y A;  5FMH A;  3AEB A;  2EQ9 A;  2WHD A;  3ALJ A;  1RYI A;  3M12 A;  1RSG A;  2Q7V A;  5M10 A;  3II4 A;  1NDA A;  3RP7 A;  1DJN A;  1GRT A;  1TDN A;  3HZL A;  1XHC A;  1OJC A;  3I6D A;  2IVD A;  3RED A;  2FJE A;  2QAE A;  1ZK7 A;  4J36 A;  3AE2 A;  5BUK A;  1GSN A;  1YKJ A;  3CPI G;  1H2I A;  4AP3 A;  1CL0 A;  3S5W A;  1HYU A;  2DKI A;  3UP5 A;  1JNZ A;  3UOZ A;  2XFO A;  2NVK X;  3K7T A;  3LOV A;  2WES A;  4H4R A;  3UOX A;  4YWO A;  4C5O A;  1NG3 A;  5JCK A;  3CGD A;  1DOE A;  5JCM A;  3I3L A;  4WCT A;  2X8H A;  2BK4 A;  5IQ1 A;  5M0Z A;  4EQW A;  3VR8 A;  4Z25 A;  2XVH A;  2H88 A;  3NTD A;  2YAU A;  3B6D A;  1CC4 A;  1FEA A;  1FEB A;  4YSH A;  3NIX A;  5HHF A;  2IVE A;  3UKP A;  1V59 A;  1NG4 A;  1CF3 A;  3SZF A;  5HY5 A;  3RP6 A;  3NTA A;  1DOD A;  4H4P A;  1ZY8 A;  4EQR A;  3BI2 A;  4K5R A;  3V76 A;  3KPF A;  3AEG A;  1BGJ A;  1N1P A;  2YLS A;  4NEV A;  3ISH A;  5KMP A;  4USR A;  4OPI A;  3UTE A;  2YG7 A;  2X50 A;  2WU5 A;  4B65 A;  1COY A;  4Z2R A;  1PBF A;  2TPR A;  4X4J A;  1YQ3 A;  5C3J A;  1PBE A;  3BHF A;  4YTP A;  1KFY A;  2RAB A;  1X31 B;  2XYO A;  3C96 A;  3UKK A;  3F8P A;  4ICY A;  4X9M A;  4CRT A;  4GUV A;  5KVH A;  4ECH A;  2GQF A;  3NGC X;  1BZL A;  5J7X A;  4JN9 A;  1E7P A;  4HB9 A;  4RG3 A;  3BHK A;  3T37 A;  2NPX A;  3GRT A;  1DOB A;  2EQ6 A;  4A5L A;  4TLX A;  2VVM A;  3HYW A;  3KVE A;  1F6M A;  3AXB A;  4U2L A;  3EPT A;  4A6N B;  3GWF A;  1N4U A;  1PDH A;  3SZ0 A;  1KNR A;  3LXD A;  4G74 A;  1GRB A;  3AEF A;  4PAB A;  5FS9 A;  2WOV A;  2YG6 A;  3P4R A;  1IUU A;  1K0L A;  2WS3 A;  2VQ7 A;  3DGH A;  3FG2 P;  1DNC A;  1S7M A;  3DJJ A;  2B76 A;  1ZOY A;  2GAG B;  1CHU A;  3AE1 A;  2B7S A;  2Q0K A;  3NKS A;  3Q9T A;  1FL2 A;  3EAN A;  4EMI A;  2XDO A;  3NYF A;  1F8W A;  1NEN A;  2BS4 A;  1GRE A;  2XLU A;  2YLR A;  4YSZ A;  1GOS A;  1P2E A;  1VQW A;  1ZDL A;  3CN8 A;  4H4V A;  4GRT A;  4J34 A;  4JY3 A;  1Y0P A;  3LAD A;  3O0H A;  4NTC A;  5KVI A;  5KOX A;  2BAB A;  1ZX9 A;  3ATQ A;  3H8I A;  4B68 A;  2UZZ A;  3EF6 A;  2C7G A;  3ADA B;  3UKF A;  2C67 A;  2E1M A;  3ZDN A;  5JRB A;  2AAQ A;  2C4C A;  3BI5 A;  3QFB A;  4H4U A;  3WE0 A;  3AE3 A;  4B69 A;  1JRX A;  3NN6 X;  4IA6 A;  1D4E A;  1D7L A;  5FS8 A;  2X99 A;  3ITJ A;  3QSM A;  1H7W A;  4U2S A;  2XFU A;  2C75 A;  1L9E A;  1NHS A;  3AE7 A;  1W4X A;  4YKF A;  3SM8 A;  3L8K A;  2RGJ A;  3DK8 A;  1OJ9 A;  2CUL A;  4A6N A;  4GDE A;  3UOY A;  2IID A;  4ZCC A;  4UDR A;  2V60 A;  3C4A A;  5EB5 A;  4UDQ A;  2V3A A;  4EQX A;  1OJA A;  1H84 A;  4CNK A;  3VRB A;  4GAP A;  4A79 A;  3BNM A;  1JU2 A;  2R45 A;  2YWL A;  1MOK A;  3DGZ A;  1AOG A;  3PS9 A;  4B67 A;  4GR1 A;  3AD8 B;  1S3B A;  5KWF A;  4I59 A;  4DSG A;  3QJ4 A;  1F8R A;  3GYI A;  4OPU A;  2AR8 A;  2GQW A;  2A87 A;  2JB3 A;  3CND A;  4H7U A;  1IUV A;  2WPE A;  1L9D A;  1H7X A;  3AE4 A;  3IC9 A;  3GYJ A;  4TM1 A;  2C3D A;  2Y6R A;  3IWA A;  4H2P A;  1ZMC A;  4NZH A;  5HYM A;  4AOS A;  4B66 A;  2GB0 A;  1OJD A;  2FJA A;  5BRT A;  2CFY A;  1CJ3 A;  2YVF A;  2VOU A;  1CJ2 A;  3SQP A;  2WET A;  2YLX A;  2V6O A;  1EL7 A;  3B3R A;  4WX1 A;  3NG7 X;  3CGC A;  4K8D A;  3DK4 A;  2YM2 A;  3CNS A;  4AT0 A;  1CJ4 A;  1D5T A;  3V3O A;  1IUS A;  3UCL A;  5IQ4 A;  2CDU A;  4APN A;  2R0G A;  1VG9 A;  4GAV A;  4LII A;  5U1O A;  1Y56 A;  3P4P A;  4D04 A;  4TM0 A;  2XFP A;  1XAN A;  3CNT A;  3G5Q A;  2BAC A;  2EQ8 A;  3QVR A;  1TDK A;  2WEU A;  3QVP A;  3SFE A;  1EL8 A;  3DA1 A;  1CC2 A;  1UKV G;  3E1T A;  5KMQ A;  3GMB A;  2JAE A;  3UTH A;  1GRG A;  1TRB A;  3KA7 A;  5DBJ A;  2X8G A;  1FEC A;  4A7A A;  2ZZ0 A;  5KMS A;  3M13 A;  2C72 A;  2HQM A;  3SXI A;  1PN0 A;  1LVL A;  1IJH A;  1QJD A;  2BC0 A;  1SEZ A;  2E5V A;  4II3 A;  4TM4 A;  3S61 A;  1TDF A;  4HA6 A;  1NHP A;  2YVJ A;  3AYL A;  2B9X A;  4H2Q A;  1BWC A;  3V3N A;  4Z26 A;  2V3B A;  4CNJ A;  3AD7 B;  5L46 A;  1Q1W A;  3H8L A;  4IVO B;  3T14 A;  4CY8 A;  1CBO A;  4EMW A;  3DME A;  4FDC B;  4KX6 A;  4U8K A;  1GRF A;  4CBQ A;  4YSY A;  4NNJ A;  4U8M A;  1PBC A;  5KRQ A;  3DH9 A;  4XWZ A;  5EOW A;  2YG3 A;  4JNA A;  2O9Z A;  1GTH A;  1CC6 A;  3AWI A;  4H4X A;  4G73 A;  4XWR A;  4BV6 A;  1EL5 A;  2PHH A;  4G6G A;  4TLZ A;  2WP6 A;  2R46 A;  4N9X A;  3GSI A;  1L9C A;  2WP9 A;  1YQ4 A;  2B7R A;  1ELI A;  1H86 A;  1JRY A;  3NYC A;  4Z2T A;  3UKQ A;  5JCL A;  2BA9 A;  2I0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...