4LCKA

Co-crystal structure of a t-box riboswitch stem i domain in complex with its cognate trna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
b'SYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSVVSLAEDQGISVSMVESMKKLGKACGIEVGAAAVAIIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein YbxF
publication title Co-crystal structure of a T-box riboswitch stem I domain in complex with its cognate tRNA.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Ribosomal protein/rna
total genus 16
structure length 81
sequence length 81
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 4lckA00
1XBIA 3CCLF 3CCJF 5G4UC 3N4YA 1QVGF 1W2BF 3CCRF 3G6EF 2KTUA 1E7KA 5GINC 3CC4F 3LWRC 3CC7F 3OBWA 1VQPF 1YITF 1YJWF 2WALA 1RA4A 3HAXD 3V7EA 4X3MA 5EO3A 3J81M 4NUTA 1YHQF 1DT9A 4BW0B 2KG4A 5GANK 2VGMA 3RA5A 1VQ4F 1KQSF 1X52A 2I6DA 3AGKA 1K9MH 2FC3A 1IPAA 3FFMA 3CMAF 4LCKA 4C4WC 1VQ8F 3CCVF 1W42A 3NK6A 1RLGA 1S72F 1X7OA 1M90H 1NJIH 2LBWA 1SDSA 2OHWA 1QVFF 1H7MA 1PXWA 1GO0A 1W40A 2KTVA 3PLAC 1CN7A 3N4ZA 1VQ9F 1JJ2F 1W41A 2JNBA 3LFOA 1T0KB 3CPQA 3IR9A 3E1YA 3GYQA 1K8AH 3CG6A 3LWVC 5G4VC 3LWQC 3JAMM 3HJWC 2BO1A 3NVIB 5DCVA 1NMUB 3E20B 3LWPC 1KD1H 1VQ5F 1ZWZA 5EWRA 3CXCF 1M1KH 3CPWF 1VQMF 1VQOF 2OZBA 5GIOC 1KC8H 3OW2F 3WXMB 3CCSF 1Q7YH 1Q86H 1N8RH 1YI2F 1VQLF 1Q81H 2HVYD 3NMUC 3MCAB 4BY9D 3CD6F 3SIVA 3NK7A 3I56F 3V7QA 1YJNF 2LBXA 3CCUF 1VQ7F 2OTJF 3LWOC 2VGNA 1K73H 2AIFA 3J80M 3PAFA 5IT9M 1W3EX 1GO1A 2QEXF 1X7PA 1YJ9F 3CCQF 4X3LA 3NVKE 3G71F 1YIJF 1Q82H 5A2QM 2OTLF 5FLXM 2CZWA 1VQNF 3O85A 1VQ6F 3CCMF 2QA4F 3ON1A 3VI6A 3VMFB 3CMEF 1VQKF 3SIUA 3RA6A 3OBYA 3I55F 1GZ0A 3JCMM 2QI2A 1CK2A 4TZZA 5GIPC 2ALEA 3G4SF 3CC2F 5FJ4C 3CCEF 3J7AR 5GAPK
chains in the Genus database with same CATH superfamily
3RYHA 4G4XA 1U3LA 5G4UC 2CWJA 3G6EF 3CCRF 3LYBA 5JCOA 3Q8HA 5BMVA 1FNKA 3FBAA 3LWRC 3S0HA 3VYUC 2Z01A 3UT5A 5JCOC 3K2XA 1VQPF 3P10A 2WALA 1RA4A 4E6EA 3I3FA 3IKEA 3LDTA 3M1XA 5C8YA 4NUTA 4I50B 5EYPB 4BW0B 2KG4A 1OAPA 2VAWA 2GLZA 3C9TA 3HWUA 2I6DA 4PWTA 1IPAA 3N2KA 3FFMA 4LCKA 3CCVF 4BT4A 1RLGA 1U40A 3TD5A 2OHWA 3ZP4A 5IJ0B 2KTVA 4O2BA 3MBMA 1CN7A 3N4ZA 4LNUB 4FFBA 4RQOA 3IR9A 4X1IB 1W55A 1COMA 3CG6A 3GHZA 3HKDA 4HNAB 3N2GB 4C82A 5JVDA 1Z5VA 4X1KB 3LWPC 1VQ5F 3F0GA 1J7HA 1VQMF 4X1YA 5KMGB 3GTZA 5HY2A 4O4HB 3F6MA 2IQQA 2Z1UA 4I4TB 1VHAA 1W5BA 1Q86H 1N8RH 3KJKA 2HVYD 4RHAA 5AVMA 3MCAB 4BVRA 1W57A 5LP6C 2AMTA 5GONB 5FNVB 4I50A 1UFYA 5EYPA 2LBXA 5LYJA 2UZHA 3R0PA 2LCAA 5MN4A 5EIBC 2Z1EA 1QD9A 3K14A 1X7PA 4EI7A 2EWCA 2CSLA 2RHJA 3C8LA 4X3LA 3RYHB 5IJ0A 5LOVA 3NVKE 5FLXM 4TV8B 3EORA 4LNUA 5CB4A 3ON1A 3D01A 4B62A 3SIUA 3RA6A 4X1IA 2DT4A 4HNAA 3N2GA 3QHDA 3UT5B 4C8EA 2ALEA 3RYIA 4C81A 1QAHA 3MCQA 4B5CA 5FJ4C 5KMGA 2N48A 3V4DA 5GAPK 4O4HA 1XBIA 5HXZA 3IEQA 4I4TA 4BT2A 3CCJF 1W2BF 3N2KB 2KTUA 3HKEA 3MQWA 1W5EA 1IV3A 2ZVZA 3CC7F 5FNVA 4ZK7A 3BYQA 1YJWF 2G9IA 3HAXD 1PF5A 2UYKA 1SA0B 3IEWA 1DT9A 1RLUA 5GANK 1VQ4F 3L7QA 1X52A 3FD5A 5HY1A 2ZODA 3WJPA 3CMAF 4M8IA 3M84A 1FNJA 4TV8A 4X1YB 2HS0A 1NJIH 2LBWA 2UYJA 1SDSA 1PXWA 1TUBA 5HP7A 5IJ9B 3VIUA 5MN6A 1IV2A 2RHOA 1W59A 2HS4A 5CA0B 5LP6B 1JJ2F 2IG8A 4IIJA 4XCQA 2F9ZC 3LFOA 3JAWB 3VTIC 1K8AH 3LWVC 5G4VC 2BO1A 1XRGA 2HP0A 5HXUA 3VOBA 2HQSC 5LYJB 3WJRA 2BTOA 1ZWZA 5EWRA 1M1KH 1JN1A 3HKCB 3RE3A 3CPWF 3C9SA 2MQEA 4G4ZA 3WGLA 3WXMB 2W8BC 3E22B 1Q7YH 1YI2F 4BVQA 1IV1A 4NQ3A 5LOVB 3CD6F 1SA0A 3ERNA 3NK7A 3QUWA 1QU9A 2H8CA 1YJNF 5CB4B 3T80A 2VXYA 3JATB 4WBNB 3JARA 2OTJF 3LWOC 1DBFA 5KX5B 4O2AB 3RYIB 2Q1XA 2CW4A 2IAFA 4G4YA 4YJ3A 3ZP7A 2QEXF 2I6RA 1H48A 3WPWA 5JH7A 3U0OA 2FGYA 1Q82H 5IJ9A 3FPIA 3K12A 3VYSC 3F0FA 2OTLF 5CA0A 5LP6A 3HKEB 3VMFB 5HP8A 3CMEF 3JAWA 3WJQA 5HY0A 3HKBB 3OBYA 3D00A 5GIPC 3G4SF 3OONA 4B45A 3HKCA 4IHJB 4DRXA 3CCEF 4O4LB 3TD4A 3P4EA 3CCLF 2UYNB 3E22A 3TD3A 2GZLA 3N4YA 3S06A 3ELCA 3D54A 3OBWA 4BT5A 1TUBB 2ZVYA 3JATA 4WBNA 1W5FA 4DXDA 4X20A 2H6LA 3RYFB 3V7EA 3WGNA 4C8IA 3WPXA 1OFUA 5EB1B 4IIJB 3CYQA 3J81M 5KX5A 4O2AA 1YHQF 1JD1A 2HRYA 4R40B 2CHSA 5EIBD 5J2TB 1KQSF 2HP0B 2FC3A 3DC2A 4C4WC 1VQ8F 3NK6A 1YGYA 1S72F 2HRUA 4I55B 1TVKB 2ZF8A 1QVFF 3VO8A 1ONIA 3KE1A 1U3PA 5MN5A 1W40A 3HKBA 3PLAC 2QTPA 4ZOLB 1VQ9F 3VCZA 5HWEA 3CB2A 1T0KB 3E1YA 3GYQA 4IHJA 3LWQC 3JAMM 3WGMA 3HJWC 3NVIB 5DCVA 5IYZB 4O4LA 3WGJA 2Z1FA 1NMUB 3E20B 1KD1H 3JARB 3C9RA 4BT3A 2UYNA 2BTQB 2VAMA 1VQOF 5GIOC 2Z1TA 4YJ3B 3OW2F 3B6NA 3CCSF 1VQVA 4ZHWA 5EB0A 1Q81H 3JASA 5JH7B 3NMUC 2GVIA 1Z5WA 3RYFA 5EZYA 3I56F 2PHNA 4ZHQB 2AIZP 4KWEA 4G4VA 4C8GA 3CYPB 3CCUF 1W5AA 4G88A 5J2TA 1CLIA 2PMPA 3PAFA 4U3JA 5IT9M 1W3EX 2ZOVA 4DRXB 4I55A 4ZI7B 1TVKA 1H47A 3VOAA 5B8FA 1X25A 3CCQF 3G71F 4O4IB 2BTUA 3IMPA 5JQGB 3JAKB 1YIJF 5A2QM 2CZWA 4ZOLA 1RQ7A 3O85A 1VQ6F 4YJ2B 2B33A 4O4JB 5HY4A 3I55F 1CK2A 5IYZA 2CVLA 1UI9A 1NQ3A 3CC2F 4X20B 5LA6B 4ERHA 5CA1A 2Q1YA 3F0EA 4EI9A 1GX1A 1KNJA 1FFXB 3C9UA 1YQNA 3DDNA 3IKFA 1QVGF 1E7KA 5GINC 2V9YA 3CC4F 2R751 3P0ZA 4ZHQA 1YITF 4EI8A 3VYTC 4BT7A 4X3MA 5EO3A 4B46A 2RHLA 2VGMA 3RA5A 4BT6A 2NMUA 3AGKA 4ZI7A 3RYCB 1K9MH 4TUYB 3FD6A 4F6RB 3F0DA 3WGKA 1W42A 2P6YA 4O4IA 5JQGA 3JAKA 5J2UB 1X7OA 1M90H 2R6R1 3KHNA 4EB6B 1FSZA 1H7MA 2RHHA 4BVTA 1IV4A 2RB9A 4YJ2A 1GO0A 4O4JA 1VH8A 3JALB 4NWOB 1W41A 2JNBA 3JASB 5LXTB 1T0AA 5ITZB 1RQ2A 3CPQA 5LA6A 5EZYB 3S02A 1JFFB 2DYYA 2L26A 1KNKA 3K0TA 1U43A 2YYEA 1FFXA 4TV9B 2CHTA 2HS3A 1XHOA 3V3TA 3ESJA 2OZBA 1KC8H 4U3JB 3HTNA 3LMEA 2YXZA 1VQLF 2VAPA 4U39A 2LBTA 5EAZA 5BMVB 4BY9D 1SZQA 3S0YA 3SIVA 3ZO8A 4G4WA 3V7QA 3JVHA 4X1KA 1R1MA 1VQ7F 4ZHYB 2VGNA 3ZOPA 4ZHVA 1K73H 2AIFA 3S03A 5C8YB 1VK3A 3RYCA 4TUYA 1JY8A 4F6RA 3J80M 4BVSA 2K1SA 5J2UA 1GO1A 5CA1B 2HX0A 1Q8RA 3KJJA 1XV2A 4EB6A 1YJ9F 2ZAUA 3QTYA 3S0WA 3JALA 2H8EA 1VQNF 5GONA 5LXTA 2HP3A 3KIZA 3CCMF 1ODEA 2QA4F 3VI6A 5ITZA 1VQKF 1W581 4O2BB 3I7TA 1GZ0A 3JCMM 1JFFA 2QI2A 4TZZA 3M4SA 3MDOA 2OTMA 4FFBB 2UYPA 4TV9A 3HKDB 2KGWA 5JVDB 3J7AR 3CXCF
chains in the Genus database with same CATH topology
1XBIA 3CCLF 3CCJF 5G4UC 3N4YA 1QVGF 1W2BF 3CCRF 3G6EF 2KTUA 1E7KA 5GINC 3CC4F 3LWRC 3CC7F 3OBWA 1VQPF 1YITF 1YJWF 4EI8A 2WALA 1RA4A 3HAXD 3V7EA 4X3MA 5EO3A 3J81M 4NUTA 1YHQF 1DT9A 4BW0B 2KG4A 5GANK 2VGMA 2GLZA 3RA5A 1VQ4F 1KQSF 1X52A 2I6DA 5HY1A 3AGKA 1K9MH 2FC3A 1IPAA 3FFMA 3CMAF 4LCKA 4C4WC 1VQ8F 3CCVF 1W42A 3NK6A 1RLGA 1S72F 1X7OA 1M90H 1NJIH 2LBWA 1SDSA 2OHWA 4BVTA 1H7MA 1QVFF 1PXWA 1GO0A 1W40A 2KTVA 3PLAC 1CN7A 3N4ZA 1VQ9F 1JJ2F 1W41A 2JNBA 5HWEA 4XCQA 2F9ZC 3LFOA 1T0KB 3CPQA 3IR9A 3E1YA 3GYQA 1K8AH 3CG6A 3LWVC 5G4VC 3LWQC 3JAMM 3HJWC 2BO1A 3NVIB 5DCVA 5HXUA 1NMUB 3E20B 3LWPC 1KD1H 1VQ5F 1ZWZA 5EWRA 3CXCF 1M1KH 3CPWF 1VQMF 3V3TA 1VQOF 2OZBA 5GIOC 5HY2A 1KC8H 3OW2F 3WXMB 3CCSF 1Q7YH 1Q86H 1N8RH 1YI2F 1VQLF 1Q81H 4BVQA 2HVYD 3NMUC 4NQ3A 4BVRA 3MCAB 4BY9D 3CD6F 3SIVA 3NK7A 3I56F 3V7QA 1YJNF 2LBXA 3CCUF 1VQ7F 2OTJF 3LWOC 2VGNA 1K73H 2AIFA 3J80M 4BVSA 3PAFA 5IT9M 1W3EX 1GO1A 2QEXF 1X7PA 1YJ9F 4EI7A 3CCQF 4X3LA 3NVKE 3G71F 2FGYA 1YIJF 1Q82H 5A2QM 2OTLF 5FLXM 2CZWA 1VQNF 3O85A 1VQ6F 3CCMF 2QA4F 3ON1A 3VI6A 3VMFB 3CMEF 1VQKF 3SIUA 3RA6A 5HY0A 3OBYA 5HY4A 3I55F 1GZ0A 3JCMM 2QI2A 1CK2A 4TZZA 3D00A 5GIPC 2ALEA 3G4SF 3CC2F 5FJ4C 4EI9A 3CCEF 3J7AR 5GAPK 5HXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XBI A;  3CCL F;  3CCJ F;  5G4U C;  3N4Y A;  1QVG F;  1W2B F;  3CCR F;  3G6E F;  2KTU A;  1E7K A;  5GIN C;  3CC4 F;  3LWR C;  3CC7 F;  3OBW A;  1VQP F;  1YIT F;  1YJW F;  2WAL A;  1RA4 A;  3HAX D;  3V7E A;  4X3M A;  5EO3 A;  3J81 M;  4NUT A;  1YHQ F;  1DT9 A;  4BW0 B;  2KG4 A;  5GAN K;  2VGM A;  3RA5 A;  1VQ4 F;  1KQS F;  1X52 A;  2I6D A;  3AGK A;  1K9M H;  2FC3 A;  1IPA A;  3FFM A;  3CMA F;  4LCK A;  4C4W C;  1VQ8 F;  3CCV F;  1W42 A;  3NK6 A;  1RLG A;  1S72 F;  1X7O A;  1M90 H;  1NJI H;  2LBW A;  1SDS A;  2OHW A;  1QVF F;  1H7M A;  1PXW A;  1GO0 A;  1W40 A;  2KTV A;  3PLA C;  1CN7 A;  3N4Z A;  1VQ9 F;  1JJ2 F;  1W41 A;  2JNB A;  3LFO A;  1T0K B;  3CPQ A;  3IR9 A;  3E1Y A;  3GYQ A;  1K8A H;  3CG6 A;  3LWV C;  5G4V C;  3LWQ C;  3JAM M;  3HJW C;  2BO1 A;  3NVI B;  5DCV A;  1NMU B;  3E20 B;  3LWP C;  1KD1 H;  1VQ5 F;  1ZWZ A;  5EWR A;  3CXC F;  1M1K H;  3CPW F;  1VQM F;  1VQO F;  2OZB A;  5GIO C;  1KC8 H;  3OW2 F;  3WXM B;  3CCS F;  1Q7Y H;  1Q86 H;  1N8R H;  1YI2 F;  1VQL F;  1Q81 H;  2HVY D;  3NMU C;  3MCA B;  4BY9 D;  3CD6 F;  3SIV A;  3NK7 A;  3I56 F;  3V7Q A;  1YJN F;  2LBX A;  3CCU F;  1VQ7 F;  2OTJ F;  3LWO C;  2VGN A;  1K73 H;  2AIF A;  3J80 M;  3PAF A;  5IT9 M;  1W3E X;  1GO1 A;  2QEX F;  1X7P A;  1YJ9 F;  3CCQ F;  4X3L A;  3NVK E;  3G71 F;  1YIJ F;  1Q82 H;  5A2Q M;  2OTL F;  5FLX M;  2CZW A;  1VQN F;  3O85 A;  1VQ6 F;  3CCM F;  2QA4 F;  3ON1 A;  3VI6 A;  3VMF B;  3CME F;  1VQK F;  3SIU A;  3RA6 A;  3OBY A;  3I55 F;  1GZ0 A;  3JCM M;  2QI2 A;  1CK2 A;  4TZZ A;  5GIP C;  2ALE A;  3G4S F;  3CC2 F;  5FJ4 C;  3CCE F;  3J7A R;  5GAP K; 
#chains in the Genus database with same CATH topology
 3RYH A;  4G4X A;  1U3L A;  5G4U C;  2CWJ A;  3G6E F;  3CCR F;  3LYB A;  5JCO A;  3Q8H A;  5BMV A;  1FNK A;  3FBA A;  3LWR C;  3S0H A;  3VYU C;  2Z01 A;  3UT5 A;  5JCO C;  3K2X A;  1VQP F;  3P10 A;  2WAL A;  1RA4 A;  4E6E A;  3I3F A;  3IKE A;  3LDT A;  3M1X A;  5C8Y A;  4NUT A;  4I50 B;  5EYP B;  4BW0 B;  2KG4 A;  1OAP A;  2VAW A;  2GLZ A;  3C9T A;  3HWU A;  2I6D A;  4PWT A;  1IPA A;  3N2K A;  3FFM A;  4LCK A;  3CCV F;  4BT4 A;  1RLG A;  1U40 A;  3TD5 A;  2OHW A;  3ZP4 A;  5IJ0 B;  2KTV A;  4O2B A;  3MBM A;  1CN7 A;  3N4Z A;  4LNU B;  4FFB A;  4RQO A;  3IR9 A;  4X1I B;  1W55 A;  1COM A;  3CG6 A;  3GHZ A;  3HKD A;  4HNA B;  3N2G B;  4C82 A;  5JVD A;  1Z5V A;  4X1K B;  3LWP C;  1VQ5 F;  3F0G A;  1J7H A;  1VQM F;  4X1Y A;  5KMG B;  3GTZ A;  5HY2 A;  4O4H B;  3F6M A;  2IQQ A;  2Z1U A;  4I4T B;  1VHA A;  1W5B A;  1Q86 H;  1N8R H;  3KJK A;  2HVY D;  4RHA A;  5AVM A;  3MCA B;  4BVR A;  1W57 A;  5LP6 C;  2AMT A;  5GON B;  5FNV B;  4I50 A;  1UFY A;  5EYP A;  2LBX A;  5LYJ A;  2UZH A;  3R0P A;  2LCA A;  5MN4 A;  5EIB C;  2Z1E A;  1QD9 A;  3K14 A;  1X7P A;  4EI7 A;  2EWC A;  2CSL A;  2RHJ A;  3C8L A;  4X3L A;  3RYH B;  5IJ0 A;  5LOV A;  3NVK E;  5FLX M;  4TV8 B;  3EOR A;  4LNU A;  5CB4 A;  3ON1 A;  3D01 A;  4B62 A;  3SIU A;  3RA6 A;  4X1I A;  2DT4 A;  4HNA A;  3N2G A;  3QHD A;  3UT5 B;  4C8E A;  2ALE A;  3RYI A;  4C81 A;  1QAH A;  3MCQ A;  4B5C A;  5FJ4 C;  5KMG A;  2N48 A;  3V4D A;  5GAP K;  4O4H A;  1XBI A;  5HXZ A;  3IEQ A;  4I4T A;  4BT2 A;  3CCJ F;  1W2B F;  3N2K B;  2KTU A;  3HKE A;  3MQW A;  1W5E A;  1IV3 A;  2ZVZ A;  3CC7 F;  5FNV A;  4ZK7 A;  3BYQ A;  1YJW F;  2G9I A;  3HAX D;  1PF5 A;  2UYK A;  1SA0 B;  3IEW A;  1DT9 A;  1RLU A;  5GAN K;  1VQ4 F;  3L7Q A;  1X52 A;  3FD5 A;  5HY1 A;  2ZOD A;  3WJP A;  3CMA F;  4M8I A;  3M84 A;  1FNJ A;  4TV8 A;  4X1Y B;  2HS0 A;  1NJI H;  2LBW A;  2UYJ A;  1SDS A;  1PXW A;  1TUB A;  5HP7 A;  5IJ9 B;  3VIU A;  5MN6 A;  1IV2 A;  2RHO A;  1W59 A;  2HS4 A;  5CA0 B;  5LP6 B;  1JJ2 F;  2IG8 A;  4IIJ A;  4XCQ A;  2F9Z C;  3LFO A;  3JAW B;  3VTI C;  1K8A H;  3LWV C;  5G4V C;  2BO1 A;  1XRG A;  2HP0 A;  5HXU A;  3VOB A;  2HQS C;  5LYJ B;  3WJR A;  2BTO A;  1ZWZ A;  5EWR A;  1M1K H;  1JN1 A;  3HKC B;  3RE3 A;  3CPW F;  3C9S A;  2MQE A;  4G4Z A;  3WGL A;  3WXM B;  2W8B C;  3E22 B;  1Q7Y H;  1YI2 F;  4BVQ A;  1IV1 A;  4NQ3 A;  5LOV B;  3CD6 F;  1SA0 A;  3ERN A;  3NK7 A;  3QUW A;  1QU9 A;  2H8C A;  1YJN F;  5CB4 B;  3T80 A;  2VXY A;  3JAT B;  4WBN B;  3JAR A;  2OTJ F;  3LWO C;  1DBF A;  5KX5 B;  4O2A B;  3RYI B;  2Q1X A;  2CW4 A;  2IAF A;  4G4Y A;  4YJ3 A;  3ZP7 A;  2QEX F;  2I6R A;  1H48 A;  3WPW A;  5JH7 A;  3U0O A;  2FGY A;  1Q82 H;  5IJ9 A;  3FPI A;  3K12 A;  3VYS C;  3F0F A;  2OTL F;  5CA0 A;  5LP6 A;  3HKE B;  3VMF B;  5HP8 A;  3CME F;  3JAW A;  3WJQ A;  5HY0 A;  3HKB B;  3OBY A;  3D00 A;  5GIP C;  3G4S F;  3OON A;  4B45 A;  3HKC A;  4IHJ B;  4DRX A;  3CCE F;  4O4L B;  3TD4 A;  3P4E A;  3CCL F;  2UYN B;  3E22 A;  3TD3 A;  2GZL A;  3N4Y A;  3S06 A;  3ELC A;  3D54 A;  3OBW A;  4BT5 A;  1TUB B;  2ZVY A;  3JAT A;  4WBN A;  1W5F A;  4DXD A;  4X20 A;  2H6L A;  3RYF B;  3V7E A;  3WGN A;  4C8I A;  3WPX A;  1OFU A;  5EB1 B;  4IIJ B;  3CYQ A;  3J81 M;  5KX5 A;  4O2A A;  1YHQ F;  1JD1 A;  2HRY A;  4R40 B;  2CHS A;  5EIB D;  5J2T B;  1KQS F;  2HP0 B;  2FC3 A;  3DC2 A;  4C4W C;  1VQ8 F;  3NK6 A;  1YGY A;  1S72 F;  2HRU A;  4I55 B;  1TVK B;  2ZF8 A;  1QVF F;  3VO8 A;  1ONI A;  3KE1 A;  1U3P A;  5MN5 A;  1W40 A;  3HKB A;  3PLA C;  2QTP A;  4ZOL B;  1VQ9 F;  3VCZ A;  5HWE A;  3CB2 A;  1T0K B;  3E1Y A;  3GYQ A;  4IHJ A;  3LWQ C;  3JAM M;  3WGM A;  3HJW C;  3NVI B;  5DCV A;  5IYZ B;  4O4L A;  3WGJ A;  2Z1F A;  1NMU B;  3E20 B;  1KD1 H;  3JAR B;  3C9R A;  4BT3 A;  2UYN A;  2BTQ B;  2VAM A;  1VQO F;  5GIO C;  2Z1T A;  4YJ3 B;  3OW2 F;  3B6N A;  3CCS F;  1VQV A;  4ZHW A;  5EB0 A;  1Q81 H;  3JAS A;  5JH7 B;  3NMU C;  2GVI A;  1Z5W A;  3RYF A;  5EZY A;  3I56 F;  2PHN A;  4ZHQ B;  2AIZ P;  4KWE A;  4G4V A;  4C8G A;  3CYP B;  3CCU F;  1W5A A;  4G88 A;  5J2T A;  1CLI A;  2PMP A;  3PAF A;  4U3J A;  5IT9 M;  1W3E X;  2ZOV A;  4DRX B;  4I55 A;  4ZI7 B;  1TVK A;  1H47 A;  3VOA A;  5B8F A;  1X25 A;  3CCQ F;  3G71 F;  4O4I B;  2BTU A;  3IMP A;  5JQG B;  3JAK B;  1YIJ F;  5A2Q M;  2CZW A;  4ZOL A;  1RQ7 A;  3O85 A;  1VQ6 F;  4YJ2 B;  2B33 A;  4O4J B;  5HY4 A;  3I55 F;  1CK2 A;  5IYZ A;  2CVL A;  1UI9 A;  1NQ3 A;  3CC2 F;  4X20 B;  5LA6 B;  4ERH A;  5CA1 A;  2Q1Y A;  3F0E A;  4EI9 A;  1GX1 A;  1KNJ A;  1FFX B;  3C9U A;  1YQN A;  3DDN A;  3IKF A;  1QVG F;  1E7K A;  5GIN C;  2V9Y A;  3CC4 F;  2R75 1;  3P0Z A;  4ZHQ A;  1YIT F;  4EI8 A;  3VYT C;  4BT7 A;  4X3M A;  5EO3 A;  4B46 A;  2RHL A;  2VGM A;  3RA5 A;  4BT6 A;  2NMU A;  3AGK A;  4ZI7 A;  3RYC B;  1K9M H;  4TUY B;  3FD6 A;  4F6R B;  3F0D A;  3WGK A;  1W42 A;  2P6Y A;  4O4I A;  5JQG A;  3JAK A;  5J2U B;  1X7O A;  1M90 H;  2R6R 1;  3KHN A;  4EB6 B;  1FSZ A;  1H7M A;  2RHH A;  4BVT A;  1IV4 A;  2RB9 A;  4YJ2 A;  1GO0 A;  4O4J A;  1VH8 A;  3JAL B;  4NWO B;  1W41 A;  2JNB A;  3JAS B;  5LXT B;  1T0A A;  5ITZ B;  1RQ2 A;  3CPQ A;  5LA6 A;  5EZY B;  3S02 A;  1JFF B;  2DYY A;  2L26 A;  1KNK A;  3K0T A;  1U43 A;  2YYE A;  1FFX A;  4TV9 B;  2CHT A;  2HS3 A;  1XHO A;  3V3T A;  3ESJ A;  2OZB A;  1KC8 H;  4U3J B;  3HTN A;  3LME A;  2YXZ A;  1VQL F;  2VAP A;  4U39 A;  2LBT A;  5EAZ A;  5BMV B;  4BY9 D;  1SZQ A;  3S0Y A;  3SIV A;  3ZO8 A;  4G4W A;  3V7Q A;  3JVH A;  4X1K A;  1R1M A;  1VQ7 F;  4ZHY B;  2VGN A;  3ZOP A;  4ZHV A;  1K73 H;  2AIF A;  3S03 A;  5C8Y B;  1VK3 A;  3RYC A;  4TUY A;  1JY8 A;  4F6R A;  3J80 M;  4BVS A;  2K1S A;  5J2U A;  1GO1 A;  5CA1 B;  2HX0 A;  1Q8R A;  3KJJ A;  1XV2 A;  4EB6 A;  1YJ9 F;  2ZAU A;  3QTY A;  3S0W A;  3JAL A;  2H8E A;  1VQN F;  5GON A;  5LXT A;  2HP3 A;  3KIZ A;  3CCM F;  1ODE A;  2QA4 F;  3VI6 A;  5ITZ A;  1VQK F;  1W58 1;  4O2B B;  3I7T A;  1GZ0 A;  3JCM M;  1JFF A;  2QI2 A;  4TZZ A;  3M4S A;  3MDO A;  2OTM A;  4FFB B;  2UYP A;  4TV9 A;  3HKD B;  2KGW A;  5JVD B;  3J7A R;  3CXC F; 
#chains in the Genus database with same CATH homology
 1XBI A;  3CCL F;  3CCJ F;  5G4U C;  3N4Y A;  1QVG F;  1W2B F;  3CCR F;  3G6E F;  2KTU A;  1E7K A;  5GIN C;  3CC4 F;  3LWR C;  3CC7 F;  3OBW A;  1VQP F;  1YIT F;  1YJW F;  4EI8 A;  2WAL A;  1RA4 A;  3HAX D;  3V7E A;  4X3M A;  5EO3 A;  3J81 M;  4NUT A;  1YHQ F;  1DT9 A;  4BW0 B;  2KG4 A;  5GAN K;  2VGM A;  2GLZ A;  3RA5 A;  1VQ4 F;  1KQS F;  1X52 A;  2I6D A;  5HY1 A;  3AGK A;  1K9M H;  2FC3 A;  1IPA A;  3FFM A;  3CMA F;  4LCK A;  4C4W C;  1VQ8 F;  3CCV F;  1W42 A;  3NK6 A;  1RLG A;  1S72 F;  1X7O A;  1M90 H;  1NJI H;  2LBW A;  1SDS A;  2OHW A;  4BVT A;  1H7M A;  1QVF F;  1PXW A;  1GO0 A;  1W40 A;  2KTV A;  3PLA C;  1CN7 A;  3N4Z A;  1VQ9 F;  1JJ2 F;  1W41 A;  2JNB A;  5HWE A;  4XCQ A;  2F9Z C;  3LFO A;  1T0K B;  3CPQ A;  3IR9 A;  3E1Y A;  3GYQ A;  1K8A H;  3CG6 A;  3LWV C;  5G4V C;  3LWQ C;  3JAM M;  3HJW C;  2BO1 A;  3NVI B;  5DCV A;  5HXU A;  1NMU B;  3E20 B;  3LWP C;  1KD1 H;  1VQ5 F;  1ZWZ A;  5EWR A;  3CXC F;  1M1K H;  3CPW F;  1VQM F;  3V3T A;  1VQO F;  2OZB A;  5GIO C;  5HY2 A;  1KC8 H;  3OW2 F;  3WXM B;  3CCS F;  1Q7Y H;  1Q86 H;  1N8R H;  1YI2 F;  1VQL F;  1Q81 H;  4BVQ A;  2HVY D;  3NMU C;  4NQ3 A;  4BVR A;  3MCA B;  4BY9 D;  3CD6 F;  3SIV A;  3NK7 A;  3I56 F;  3V7Q A;  1YJN F;  2LBX A;  3CCU F;  1VQ7 F;  2OTJ F;  3LWO C;  2VGN A;  1K73 H;  2AIF A;  3J80 M;  4BVS A;  3PAF A;  5IT9 M;  1W3E X;  1GO1 A;  2QEX F;  1X7P A;  1YJ9 F;  4EI7 A;  3CCQ F;  4X3L A;  3NVK E;  3G71 F;  2FGY A;  1YIJ F;  1Q82 H;  5A2Q M;  2OTL F;  5FLX M;  2CZW A;  1VQN F;  3O85 A;  1VQ6 F;  3CCM F;  2QA4 F;  3ON1 A;  3VI6 A;  3VMF B;  3CME F;  1VQK F;  3SIU A;  3RA6 A;  5HY0 A;  3OBY A;  5HY4 A;  3I55 F;  1GZ0 A;  3JCM M;  2QI2 A;  1CK2 A;  4TZZ A;  3D00 A;  5GIP C;  2ALE A;  3G4S F;  3CC2 F;  5FJ4 C;  4EI9 A;  3CCE F;  3J7A R;  5GAP K;  5HXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...