4LIIA

Crystal structure of an apoptosis-inducing factor, mitochondrion-associated, 1 (aifm1) from homo sapiens at 1.88 a resolution
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
Knots found
sequence length
487
structure length
474
Chain Sequence
QDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase, apoptosis
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Crystal structure of an apoptosis-inducing factor, mitochondrion-associated, 1 (AIFM1) from Homo sapiens at 1.88 A resolution
rcsb
source organism Homo sapiens
total genus 147
structure length 474
sequence length 487
other databases KnotProt 2.0: S -31
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4liiA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4liiA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4liiA01
3GRSA 4Z24A 4BJYA 3P4QA 2WOVA 4H2RA 4I59A 4OPIA 4TLXA 2YM1A 3S61A 4JY2A 1S3EA 3AEEA 1NENA 1GSNA 5U25A 3ICRA 4B1BA 5JCKA 5KVHA 3UTFA 1E1NA 1K4QA 1EL8A 1GPEA 1KSUA 2FJEA 3LJPA 4USRA 1GREA 3CN8A 2B7RA 1ZOYA 4C77A 4X9NA 3EPTA 5EB5A 4BJZA 4J33A 4U2LA 2WPEA 2BCGG 3AE5A 2C64A 4Y4NA 2EQ6A 2QA1A 2YLSA 3CTYA 3LXDA 1DNCA 3NRNA 2B9WA 3NYCA 5IPYA 4JY3A 5HXIA 2R0GA 2R45A 4HA6A 3VRBA 3KD9A 1HYUA 4AOSA 1DODA 2XFOA 2FJDA 2V6OA 2XVIA 1GRGA 1H82A 3OZ2A 1L9CA 4TM4A 2ZZ0A 3QVRA 3AEGA 1EL5A 5KOXA 3L8KA 3AYLA 2WPFA 4YTPA 4OPDA 3D8XA 1IUTA 3BNMA 5KRQA 3LOVA 4OPGA 2PYXA 3COXA 3L1RA 3SGLA 3M13A 1FECA 2EQ8A 2YG7A 3GD3A 3M0OA 2C70A 1H81A 1DOEA 5TR3A 4H4WA 1BGJA 3B6DA 3CPHG 2BA9A 2V5ZA 2VVLG 1BF3A 1JRYA 2VVLA 5CQFA 1YY5A 4YXDA 1FCDA 3SFDA 1GRBA 2APGA 4REKA 1H6VA 1PJ5A 1KNPA 2C72A 2XCGA 4EIQA 4Z2TA 4A5LA 1B4VA 5FS9A 1D4CA 1PHHA 2YG6A 2IVDA 4U8NA 3GYIA 3DJDA 1NPXA 1CC4A 4OPTA 4YKFA 4ZCCA 3UP5A 4YKGA 4NTDA 2WOIA 3FPZA 2Z5YA 2AR8A 2JB1A 2C75A 3UCLA 1H7WA 4BK1A 4H4XA 2XLSA 4C3XA 3DGZA 4A99A 3EF6A 2XLPA 2YLTA 1GERA 1NHSA 2WU2A 1YQZA 2YLZA 4UDQA 2OALA 3LADA 3ATQA 1TYPA 2TPRA 3UKLA 3QSMA 2IIDA 4A6NB 1NDAA 3K7QX 2YVFA 1GT8A 5U1OA 3KPFA 3NKSA 2OLOA 4JN9A 4U8PA 3AYIA 3AWIA 3P4PA 3LZWA 4GCMA 3DK8A 1E1KA 3IHGA 3AB1A 4PAAA 3CPIG 4EM4A 4A7AA 3V3NA 3AE6A 4H4QA 1PN0A 2ACZA 3ISHA 5LV9A 2CULA 1JNRA 1E1MA 4KX6A 4EMIA 4JDRA 3AE9A 5U63A 4JQ9A 4Z2RA 5HY5A 2XLRA 2BYBA 3F8PA 3REDA 3AEDA 1N1PA 2X99A 4H2NA 5J60A 3NN6X 1FEAA 2WOWA 5FS8A 4H4SA 1CHUA 1LVLA 1PXCA 3V3OA 3NYEA 2GH5A 4M52A 1EBDA 2X3NA 4AP1A 3CGEA 4YSZA 1PBCA 2WDRA 5BVAA 3AE8A 4B65A 1FEBA 2C65A 3AECA 4EQSA 3P9UA 3Q9TA 2DKHA 1NAAA 4AOXA 1GNDA 4U8IA 2Y6QA 1B5QA 4B67A 1F8RA 3UTGA 3AE1A 3K7TA 3SQPA 5BUKA 3OC4A 4O5UA 2A87A 1GRFA 3AD9B 2UZZA 1D4EA 4PABA 5C3JA 2X8GA 1E7PA 2BXRA 1FOHA 4ADWA 2RGOA 3F8DA 2Q0LA 1F8WA 2Q6UA 1LQTA 1IJHA 2GB0A 4H2PA 4XXGA 2C7GA 2GQWA 2YR4A 1L9EA 2VOUA 4JNAA 2WETA 3BNUA 3F8RA 4NTEA 4C5OA 3BHFA 1CJ3A 4H50A 4XWRA 2XVEA 3UKFA 4EIPA 1FL2A 3I3LA 1ZP0A 1PBFA 5EBKA 4FK1A 2XVJA 1JRXA 1LTXR 2BS3A 3D1CA 3BI2A 1IUSA 3BHKA 2C3CA 1GTEA 4GDPA 3V76A 1ZX9A 1GEUA 1MOKA 1RSGA 1F3PA 1DJQA 1GRAA 1H86A 2R0CA 3NLCA 1VQWA 1Z6LA 4K5SA 2WHDA 3VRDB 4A9WA 4NTCA 2WS3A 2BACA 3ALJA 1LV0A 5C2TA 2JAEA 1IUXA 4J34A 1QO8A 1GRHA 2RGHA 1O95A 4Y4MA 3IC9A 1P2EA 1IUWA 3UTHA 2WQYA 4H4ZA 5IQ1A 3ATRA 3UOYA 2HQMA 2YM2A 1D5TA 2BK5A 2TMDA 4GF7A 3UKPA 4YSYA 4YTNA 1D7YA 4K8DA 3CNJA 4K2XA 2IVEA 2AAQA 3GMBA 1ONFA 4TM0A 3DK9A 2GAHB 3ICSA 4WCTA 2CFYA 2V3AA 1S2YA 3AD7B 5HYMA 5M0ZA 3ALLA 5DBJA 4BURA 3QSSA 4TM3A 4A65A 2Z5XA 1YQ4A 1D4DA 2R4JA 2VZ2A 1GRTA 1ELIA 1K0LA 3ABVA 2BC0A 2GR3A 3UP4A 2R0PA 1ZDLA 4U8JA 1TDOA 1E6EA 4D04A 3AE2A 5BRTA 1ZMCA 1PXAA 3KU9A 4Z25A 1S3BA 2EQ7A 1LPFA 2BS2A 3B3RA 2GV8A 4H4PA 2AQJA 2JKCA 1CJCA 4WX1A 3NNEA 1KSSA 3K30A 1LJ1A 2OLNA 1YKJA 4YSHA 2EQ9A 1M6IA 3HZLA 3T37A 1IUVA 4B64A 3NH3X 1QLBA 3IWAA 4CNJA 1TDNA 4J56A 2YLWA 3AXBA 3DA1A 3IF9A 2H88A 3CNTA 4Z44A 4LIIA 1JU2A 2C73A 1PJ6A 1EL9A 4CY6A 3NGCX 3NK2X 2C67A 4X9MA 1RYIA 4LA1A 3LZXA 2BCPA 1CJ4A 2V61A 3QJ4A 3UOXA 2XFQA 3AE3A 3P1WA 4B69A 4DSHA 4J31A 4AP3A 3I6DA 3S5WA 2BC1A 4TM1A 3UOVA 4CY8A 2WBAA 2WP5A 2YQUA 2ZZCA 1YQ3A 5ER0A 1M64A 4J36A 1REOA 1CJ2A 2BK4A 3GDPA 1LQUA 1VDCA 3GRTA 2YG4A 4CCQA 2YVGA 4J2WA 2OA1A 3RP7A 4E0VA 3Q6JA 4USQA 1ZKQA 1S2QA 1CC2A 4OPLA 4U8OA 1PXBA 4H2QA 2YAUA 1QJDA 3G5RA 1CF3A 1GOSA 5EOWA 4B68A 4RG4A 1ZOVA 3RP6A 3M12A 4HB9A 1ZK7A 1KF6A 1E1LA 2CDUA 1K0IA 3H8LA 3GWDA 3DK4A 1F6MA 4H4YA 3R9UA 2WDQA 2ZZBA 4UDRA 2YG3A 3ZYXA 1DOCA 1NEKA 2XLUA 1DOBA 3RP8A 2H89A 4OVIA 1EL7A 4U8MA 1Q1WA 5JCIA 3H8IA 4GRTA 4RSLA 3P4RA 2CVJA 3NG7X 1BWCA 1TDEA 3ITJA 3BI5A 2JBVA 2WESA 3PVCA 4YSXA 4H4VA 3NHOX 3KKJA 1ZMDA 3NTDA 4NEVA 4Y4LA 3AD8B 4AT2A 4CRTA 2GEWA 4GR1A 1B8SA 1L9DA 2Q0KA 4U2TA 1E39A 2NPXA 4Z26A 3JSKA 4IA5A 3IHMA 3O0HA 3CNPA 4IVOB 5GRTA 4RG3A 4CBQA 3VR8A 2GR2A 2JK6A 3C4AA 1OJAA 3UKKA 4FK1C 5IQ4A 1TYTA 2WPCA 1OJDA 4K5RA 4FDCB 4O5QA 1UKVG 1Q1RA 2B76A 5FS7A 3GWFA 1JRZA 5KXJA 1GTHA 3ALMA 4NZHA 2QA2A 4H4TA 4AT0A 1GETA 3UKAA 3BI4A 2GVCA 1ZY8A 3DJJA 1W4XA 3CPJG 2ARDA 4BK3A 2YLXA 2B9YA 3C96A 3QVPA 3UOZA 5BULA 2WP6A 1KNRA 4MJWA 2XFUA 1N4UA 3ICTA 4H4UA 2E5VA 1PBDA 3CGBA 3NYFA 4BV6A 3NK0X 2PHHA 1COYA 1MO9A 1Q9IA 2JB2A 2C3DA 3DJEA 2GR1A 2XLTA 2RABA 3KVEA 2R9ZA 3H4KA 4J57A 3E1TA 3GYJA 2X8HA 1BKWA 1PBBA 2J3NA 3EAOA 3P4SA 4Z43A 2XYOA 1H7XA 2XFNA 3CNSA 1IUUA 2JB3A 2XDOA 3UKQA 1GV4A 4EQXA 3FIMB 1VG0A 2BS4A 1MXTA 4BK2A 5M10A 2VRMA 1PBEA 2GMJA 1OJTA 5J7XA 1JNZA 1AOGA 1GESA 3KA7A 2GQFA 5CKUA 4YTMA 4JNQA 2OAMA 4U2SA 3QFAA 1NHPA 4FX9A 4APNA 1NG4A 3PO7A 4N9XA 4GDEA 4ZCDA 3WE0A 3VRAA 1PS9A 2GAGB 2X8CA 5FMHA 4IA6A 2W0HA 1O5WA 3AE7A 1Y56A 3K7MX 4EQWA 3NIXA 1NHQA 2V3BA 3C4NA 3G5SA 2R4EA 3PS9A 4DNAA 1V59A 1Y56B 4EM3A 3UKHA 4I58A 3SFEA 2FJAA 4ECHA 4H4RA 3AE4A 2GRTA 3FBSA 1D7LA 4B63A 1K0JA 3CGDA 1KFYA 1VG9A 4XWZA 2YR6A 5GSNA 2F5ZA 2R46A 2GR0A 3DGHA 4KPRA 3GMCA 3QSEA 2C76A 2DKIA 2A8XA 4B66A 5KOWA 3DJGX 4IVMB 1XANA 1L0VA 3KLJA 1H83A 4U8KA 1N4WA 4C74A 2VQBA 1SEZA 2XVFA 5L46A 1BZLA 1GALA 2YR5A 2A89A 1CBOA 1KDGA 4OCGA 4U8LA 4EQRA 2O9ZA 1NHRA 5KWFA 2WP9A 2QCUA 2QAEA 2VRLA 4YWOA 3SM8A 1O94A 3RNMA 4H7UA 4X4JA 2V60A 2GMHA 3VR9A 4DSGA 5JCMA 2NVKX 1CL0A 5HHFA 2YG5A 2GF3A 2BXSA 3G5QA 3QFBA 4A6NA 1JOAA 1P2HA 1PJ7A 3ZDNA 4CCRA 3GD4A 5FS6A 1TDKA 1XHCA 1DXLA 1OJCA 2E1MA 2E4GA 4YT0A 4D03A 3DH9A 4EMWA 4OPCA 4P9SA 1XDIA 2C66A 2ZBWA 1PDHA 2Y6RA 1GXFA 5EB4A 4ZN0A 1N4VA 1X31B 3NN0X 3CGCA 2XFPA 3VQRA 2BK3A 3CNDA 4C3YA 2FJBA 5JCLA 1VRQB 3AEBA 3GDNA 4NEWA 3FG2P 3ADAB 2X50A 3AEFA 4OPUA 1TDFA 3AYJA 1OJ9A 3NTAA 2B9XA 2WEUA 4K7ZA 2VQ7A 4LU6A 4ICYA 4EMJA 3EANA 4CNKA 1F8SA 1RP0A 3DMEA 3NK1X 4UP3A 1XPQA 4IV9A 3LB8A 3AEAA 1DJNA 3II4A 5KVIA 1H84A 2YLRA 4GUVA 4K22A 2Q7VA 1NG3A 4A79A 2FBWA 3NT6A 4Z2UA 4TLZA 4DGKA 5JCNA 3URHA 3GSIA 3UTEA 1BGNA 2YVJA 2WDVA 1JEHA 2BABA 2I0ZA 3RHAA 1Y0PA 2VVMA 1B37A 1CC6A 2B7SA 2YWLA 4UDPA 1TRBA 2RGJA 2WU5A 2XVHA 3FMWA 3CIRA
chains in the Genus database with same CATH superfamily
4Z24A 3P4QA 4I59A 2YM1A 3S61A 2HZGA 1PDZA 3UTFA 1E1NA 1N61C 1FO4A 2QJNA 3T0KA 1ZOYA 4C77A 4X9NA 5EB5A 4U2LA 2BCGG 3AE5A 4Y4NA 2EQ6A 3SR6B 3LXDA 3RCYA 2R0GA 4E4FA 2R45A 3KD9A 3QPEA 2XFOA 1H82A 1L9CA 1FHUA 5ENLA 3L8KA 4YTPA 3LOVA 3COXA 2YG7A 4TVYA 3MSYA 4H4WA 2BA9A 1FHVA 1R0MA 3JVAA 2C72A 3K1GA 2PCEA 5FS9A 1D4CA 1PHHA 1SJCA 3EEZA 4IP4A 1RVKA 1ZXIC 2IVDA 3DDMA 4YKFA 2AR8A 3DG7A 3GO2A 2YLTA 1GERA 1EBHA 3GY1A 3UKLA 4A6NB 2I5QA 5FJPA 3NKSA 4JN9A 3AWIA 3SN0A 3AB1A 3V5FA 4PAAA 3T31A 3CPIG 4A7AA 3ISHA 3UJ2A 3GYXA 5U63A 2XLRA 2BYBA 3REDA 1DTNA 4H19A 2WOWA 5FS8A 1LVLA 1PXCA 3V3OA 4HNLA 2GH5A 5BVAA 1VDVA 1PBCA 2WDRA 3AE8A 2C65A 3T6CA 3P9UA 3Q9TA 1NAAA 4U8IA 1B5QA 4GYPC 3UCDA 2MUCA 3AE1A 3SQPA 3NVZB 2QDEA 4PABA 2X8GA 3FVDA 5KMSA 1F8WA 1IJHA 2GB0A 4H50A 4EIPA 1PBFA 4JN7A 1GTEA 4GDPA 1ZX9A 1GEUA 1H86A 3NLCA 4K5SA 3MZNA 4NTCA 2BACA 3OTRA 1IUXA 2RGHA 1O95A 3PWIA 3PK7A 2WQYA 4H4ZA 1D5TA 2QDDA 4Z17A 3A7UA 3CNJA 2AAQA 3DK9A 4WCTA 2V3AA 1S2YA 3ALLA 2E3TA 3IJQA 4TM3A 1YQ4A 2R4JA 1ELIA 3D9XA 1ZDLA 1E6EA 1ZMCA 2AL2A 3T2YA 2BS2A 2GV8A 2JKCA 3NNEA 2AL2B 3NVYB 1M6IA 3T37A 2OQYA 3CT2A 4CNJA 5KMPA 3DA1A 3TQPA 4LIIA 1JU2A 2QQ6A 2V61A 1H2IA 3AE3A 3S5WA 4CY8A 4YSXA 3UOVA 2WP5A 1REOA 2YVGA 4J2WA 2OA1A 3RP7A 1ZKQA 1PXBA 5EOWA 3NVWB 4H4YA 4NWZA 2OX4A 1X2GA 1NEKA 3RP8A 1EL7A 3P4RA 3NG7X 5KMQA 4E6MA 3KKJA 4AT2A 2GEWA 1E39A 2NPXA 4Z26A 3JSKA 4GFIA 3O0HA 5GRTA 3VR8A 3C4AA 4HYRA 5IQ4A 4K5RA 4K2SA 3ALMA 3T2ZA 3BI4A 3DJJA 3CPJG 4BK3A 2YLXA 2PTZA 1KNRA 4GAVA 2ONEA 2PHHA 2JB2A 2PGEA 2GR1A 3H4KA 3E1TA 1BKWA 3EAOA 1H7XA 4FP1A 3VCNA 2BS4A 2OZ3A 3OW1A 5CKUA 3QFAA 5BOEA 4GDEA 1PS9A 2GAGB 2W0HA 3AE7A 3NIXA 2R4EA 3PS9A 1MNSA 4DNAA 2OVLA 4EM3A 4GGBA 3FBSA 1D7LA 4B63A 2ZADA 2GR0A 3GMCA 3QSEA 2C76A 3KLJA 4U8KA 1S7MA 1BZLA 2A89A 1CBOA 1KDGA 2QAEA 4YWOA 3NO1A 4X4JA 2V60A 2GMHA 1CL0A 2PPGA 1P2HA 3ZDNA 4ROPA 3CXOA 1JRPA 4D03A 3DH9A 4OPCA 1XDIA 1R6WA 1GXFA 1N60C 3NN0X 3CGCA 2BK3A 3JW7A 1VRQB 3AEBA 2X50A 2WEUA 4IL2A 4LU6A 4EMJA 4HNCA 2P0IA 1RP0A 3DMEA 3NK1X 3LB8A 4II3A 5KVIA 1WUFA 2PU0A 4Z2UA 4TLZA 4DGKA 3URHA 3GSIA 1BGNA 2OO6A 2BABA 3RHAA 1B37A 4UDPA 4DYEA 3FYYA 2WU5A 2XVHA 3UXLA 4H2RA 3NXLA 1XPYA 4B1BA 1TE6A 5JCKA 1K4QA 1EL8A 4H1ZA 3CN8A 4II2A 3DG3A 2YLSA 3CTYA 3NYCA 4AOSA 2V6OA 2XVIA 4MGGA 4ZCWA 4TM4A 3SZFA 3D8XA 2PYXA 3GD3A 3M0OA 3CPHG 3B6DA 2CHRA 3CK5A 2V5ZA 1L8PA 2P3ZA 1JRYA 2VVLA 1FCDA 3DIPA 2QJJA 2XCGA 4EIQA 4Z2TA 4K1WA 4F4RA 1B4VA 3DFHA 1ECQA 3DJDA 1NPXA 1CC4A 3UP5A 1TZZA 4A6GA 2Z5YA 2JB1A 4BK1A 4A99A 3EF6A 2XLPA 1YQZA 2YLZA 3RR1A 3RRAA 3H70A 3K7QX 1GT8A 2PP3A 5U1OA 3N6JA 3AYIA 4GCMA 1E1KA 3IHGA 2BRYA 4EM4A 3DERA 4H4QA 1PN0A 2ACZA 3DFYA 1E1MA 3AE9A 4Z2RA 4JQ9A 5HY5A 3ETRB 3F8PA 2X99A 5J60A 1FEAA 1CHUA 4AP1A 1EBDA 3CGEA 3FXGA 4B65A 3PFRA 4EQSA 3ENLA 2DKHA 5G5GB 4EWJA 4G6GA 3I6EA 2UZZA 2OQHA 1SJBA 1FOHA 2RGOA 1FFUC 2Q0LA 2Q6UA 3PG6A 2YR4A 4C5OA 4JNAA 1EC9A 3PWGA 3OPSA 3P0WA 2XVEA 3UKFA 1FL2A 4FK1A 2XVJA 5IDZA 3V76A 1VQWA 1F9CA 3VRDB 3ALJA 1GRHA 3IC9A 3ATRA 3UOYA 4YTNA 2BK5A 2TMDA 4GF7A 4YSYA 1EC8A 3GMBA 4GIRA 1ONFA 2GAHB 3ICSA 3AD7B 4A65A 3BSMA 1KD0A 5G5HB 3UP4A 4D04A 1PXAA 4Z25A 1JPDX 1CJCA 3K30A 1LJ1A 2OLNA 3KPKA 1IUVA 3NH3X 1QLBA 2ZC8A 2YLWA 3AXBA 4K8GA 2H88A 3CNTA 1MDRA 3CMMA 1EL9A 4CY6A 2XSXA 1JPMA 2C67A 2GGJA 3QJ4A 4AP3A 3TW9A 4TM1A 2YQUA 1N62C 1M64A 1YQ3A 3GDPA 1LQUA 4E5TA 3R0KA 4E0VA 4OPLA 1QJDA 1GOSA 4RG4A 3V3WA 1ZOVA 3M12A 4HB9A 1ZK7A 3AM9A 1E1LA 2CDUA 4IL0A 2AL1A 3R9UA 2OLAA 2ZZBA 2YG3A 3IK4A 3QKEA 1IYXA 1Q1WA 5JCIA 4GRTA 4RSLA 1BWCA 1TDEA 3ITJA 3NHOX 3NTDA 1ZMDA 4Y4LA 4CRTA 3FCPA 4GR1A 1L9DA 4U2TA 4IA5A 4RG3A 4CBQA 3UKKA 1OJDA 2WPCA 3R1ZA 1UKVG 2B76A 2GL5A 4GYPA 2QA2A 4AT0A 4IT1A 1ZY8A 2HNEA 3C96A 5BULA 4MJWA 2XFUA 3ICTA 4H4UA 2E5VA 2XH0A 3CGBA 3N6HA 1MRAA 2E5AA 3I4KA 4G7FA 1COYA 2C3DA 3DJEA 2XLTA 3EKGA 2R9ZA 3UJRA 3GYJA 2J3NA 3IJLA 3CNSA 4J3ZA 3FIMB 2OPJA 1MXTA 2GMJA 5J7XA 3STPA 4JNQA 2OAMA 4APNA 5KMRA 1NG4A 4N9XA 2P88A 3T2KA 3VRAA 3L5OA 4IA6A 3D46A 4EQWA 1NHQA 1V59A 3UKHA 4I58A 2FJAA 4H4RA 3AE4A 4DN1A 1K0JA 1KFYA 1VG9A 3GC2A 4MMWA 4B66A 3NFUA 1N5XA 1L0VA 2PP0A 4C74A 2VQBA 3R25A 1SEZA 2XVFA 2YR5A 3VC5A 4U8LA 5KWFA 2O9ZA 2WP9A 2QCUA 1E9IA 1O94A 3U4FA 3VR9A 4DSGA 2YG5A 2BXSA 3G5QA 3QFBA 1JOAA 5J04A 3OZMA 2DW7A 3HRDC 2Y6RA 5EB4A 3NVVB 4KPLA 1X31B 3SSZA 3GDNA 2W54A 4OPUA 3AYJA 2VQ7A 4ICYA 3EANA 1F8SA 1XPQA 2YLRA 3II4A 2FBWA 1JEHA 1Y0PA 2VVMA 1TRBA 2RGJA 3GRSA 1EBGA 2WOVA 4OPIA 3AEEA 1STZA 3ICRA 5U25A 1JCTA 2FKPA 1GPEA 3LJPA 3CXBA 4J33A 3HYXA 2C64A 4A3RA 3NRNA 5IPYA 4HA6A 3VRBA 3BOXA 3MKCA 4HCHA 1SJDA 1GRGA 3QVRA 3AEGA 5KOXA 3SBFA 4DXKA 2WPFA 1IUTA 5KRQA 4HPNA 3B97A 3L1RA 3M13A 2EQ8A 1KN0A 1BGJA 1BF3A 1BKHA 3ZLFA 1MDLA 3SFDA 1PJ5A 1KNPA 4A5LA 2YG6A 3GYIA 2WOIA 2BRAA 4G8TA 3UCLA 1H7WA 1ELSA 2XLSA 3DGZA 4KT2A 2OKTA 3ATQA 2GGGA 2YVFA 3BJSA 4M6UA 2OLOA 4U8PA 3P4PA 3LZWA 3DK8A 5EU9A 1JNRA 4JDRA 3AEDA 2GSHA 3RO6A 1N1PA 3ZVHA 3NYEA 4M52A 1FEBA 3AECA 3SZCA 3ZVHB 3VCCA 4AOXA 2Y6QA 3K7TA 5BUKA 3AD9B 3FV9A 4G9KA 5C3JA 1E7PA 4ADWA 2PS2A 1LQTA 4H2PA 2C7GA 3F8RA 3BNUA 3SZWA 3BHFA 1CJ3A 5JRBA 4XWRA 4JN8A 1ZP0A 3SX6A 3BHKA 2C3CA 1P48A 2NQLA 2R0CA 1Z6LA 4IP5A 4A9WA 1JDFA 2WS3A 1LV0A 3TOYA 5C2TA 4DHGA 2JAEA 4G6HA 1P2EA 3UTHA 3HYWA 2PU1A 2P8CA 5IQ1A 2YM2A 1D7YA 3KUMA 2IVEA 1RM6B 1WUEA 3R0UA 5M0ZA 3ZVIA 2C4CA 3QSSA 2VZ2A 1GRTA 3ABVA 2BC0A 2R0PA 1TDOA 3AE2A 5BRTA 1S3BA 2EQ7A 3B3RA 2AQJA 1KSSA 1YKJA 3HZLA 3UGVA 4B64A 4ZA0A 3GD6A 1TDNA 3IF9A 1N63C 4Z44A 4X9MA 1RYIA 2BCPA 3UOXA 3P1WA 4DSHA 4J31A 2BC1A 2WBAA 2ZZCA 5ER0A 3V4BA 4USQA 4H2QA 4Z1YA 3A7RA 1CF3A 3G5RA 4B68A 4E8GA 3RP6A 3HW2A 1KF6A 3H8LA 3GWDA 3DK4A 1F6MA 2WDQA 4UDRA 3JZUA 3UCCA 1PDYA 2H89A 4OVIA 4U8MA 2CVJA 3DESA 3R11A 3BI5A 4NNJA 3IHMA 2JK6A 4FK1C 1TYTA 4O5QA 1Q1RA 5FS7A 3GWFA 1JRZA 1GTHA 4NZHA 4HCDA 1GETA 3UKAA 2GVCA 2ARDA 2B9YA 3UOZA 2WP6A 3OZYA 2PTYA 1PBDA 3NYFA 4BV6A 1MO9A 4MKSA 2RABA 3SJNA 4J57A 2W3RA 5BOFA 2JB3A 3UKQA 1GV4A 1KKRA 3DEQA 3CYJA 5M10A 2OFJA 1OEPA 3KA7A 2HXTA 4YTMA 4U2SA 1NHPA 2P8BA 4ZCDA 2X8CA 5FMHA 3K7MX 1Y56A 3C4NA 1Y56B 3ZLGA 3SFEA 3ES8A 4H2HA 2GRTA 2PSNA 3CGDA 2AKMA 1SB3B 3SZ0A 2F5ZA 4E4UA 2GGHA 7ENLA 2DKIA 4GISA 3P3BA 3R07C 1T3QC 4IVMB 1N4WA 5L46A 4IHCA 4EQRA 1NHRA 2VRLA 3VA8A 4TVWA 3THUA 3SY4A 2NVKX 5HHFA 4A6NA 1PJ7A 4CCRA 3GD4A 2OZ8A 2RDXA 1TDKA 3QTPA 1DXLA 1OJCA 3UJFA 2E1MA 3H8AA 4YT0A 4EMWA 4P9SA 1MUCA 2ZBWA 1PDHA 2XFPA 3CNDA 3UJEA 3AEFA 1OJ9A 4X2PA 2B9XA 4DX3A 2FYMA 3UXKA 1DJNA 1H84A 3ES7A 2W55A 1NG3A 1KCZA 1TKKA 1NU5A 3NT6A 2QJMA 3SQSA 5JCNA 2YVJA 2I0ZA 1V97A 1CC6A 2B7SA 2YWLA 3VFCA 3TCSA 3TTEA 3FMWA 3CIRA 4BJYA 4TLXA 5FJOA 2POZA 2PA6A 4JY2A 1S3EA 1KKOA 1GSNA 1NENA 5KVHA 3V5CA 1KSUA 2FJEA 2MNRA 4USRA 1GREA 2B7RA 3EPTA 4BJZA 2WPEA 4KWSA 4A35A 2GGEA 2QA1A 1DNCA 4FI4A 2B9WA 4JY3A 5HXIA 1JROA 1HYUA 1DODA 2FJDA 4GAPA 3OZ2A 1XS2A 2ZZ0A 1EL5A 3AYLA 4GMEA 3TWAA 4OPDA 1ONEA 3BNMA 4OPGA 3SGLA 1FECA 2C70A 1H81A 1DOEA 5TR3A 2VVLG 3CAWA 5CQFA 1YY5A 4YXDA 1GRBA 2APGA 4REKA 1H6VA 3RGTA 3ZLHA 3AN1A 4U8NA 1EC7A 4ZCCA 4OPTA 2OZTA 4YKGA 4NTDA 3FPZA 2C75A 4H4XA 4C3XA 2WU2A 1NHSA 4UDQA 2OALA 3LADA 1TYPA 2TPRA 3QSMA 2IIDA 1NDAA 3KPFA 2XH4A 3NZGA 3V3NA 2PMQA 3AE6A 5LV9A 2CULA 4KX6A 4EMIA 4H2NA 2PGWA 3NN6X 3Q4DA 4H4SA 3VC6A 2X3NA 4YSZA 3T9PA 2XH7A 1GNDA 4B67A 4G73A 1F8RA 3MWCA 3UTGA 3OC4A 4O5UA 2A87A 1GRFA 1D4EA 2PODA 2BXRA 3F8DA 2PP1A 4XXGA 2GQWA 3OP2A 1L9EA 2VOUA 2WETA 4NTEA 3SN1A 4HN8A 3I3LA 3QLDA 5EBKA 3T14A 1JRXA 1LTXR 2BS3A 3D1CA 3BI2A 1IUSA 1MOKA 4YWSA 1RSGA 1F3PA 1DJQA 1GRAA 3T4WA 3NS1B 2WHDA 4J34A 1QO8A 3QN3A 4Y4MA 1IUWA 3S47A 1FFVC 2HQMA 3UKPA 3N4EA 3P93A 4K8DA 4K2XA 3SYIA 4TM0A 1WYGA 4J1OA 2CFYA 3B9JB 3A7AA 5HYMA 5DBJA 4BURA 5KNLA 2Z5XA 1D4DA 1K0LA 2GR3A 4U8JA 3CB3A 3KU9A 1LPFA 1N5WC 4H4PA 3MY9A 4WX1A 4H83A 4YSHA 2EQ9A 3TJ4A 4DWDA 3U9IA 3IWAA 4J56A 1W6TA 2QVHA 2C73A 1PJ6A 3NGCX 3NK2X 4LA1A 3LZXA 1CJ4A 2XFQA 4B69A 3I6DA 4ZOHB 5FJUA 4J36A 1FIQB 3I6TA 1CJ2A 2BK4A 1VDCA 3GRTA 2YG4A 4CCQA 3Q6JA 1S2QA 1CC2A 4U8OA 2YAUA 4M0XA 2O56A 3D47A 2DW6A 1K0IA 3SXIA 2HXUA 3ZYXA 1DOCA 3NRZB 2XLUA 1DOBA 5FJTA 3H8IA 2JBVA 2WESA 3PVCA 4H4VA 4NEVA 3AD8B 2PTXA 1B8SA 2Q0KA 3CNPA 4IVOB 3H12A 2GR2A 1OJAA 4FDCB 5KXJA 4H4TA 2XH2A 1W4XA 4GGHA 3QVPA 4HCLA 1N4UA 1X2HA 2W3SA 3NK0X 1Q9IA 3KVEA 4JHMA 2X8HA 1PBBA 4Z43A 3P4SA 2XYOA 2XFNA 1IUUA 2QGYA 4ENLA 2XDOA 4EQXA 1VG0A 4BK2A 3Q45A 2VRMA 1PBEA 3TJIA 1OJTA 1JNZA 1AOGA 1GESA 2GQFA 3RITA 4FX9A 3PO7A 3H7VA 4KEMA 3SN4A 3WE0A 1O5WA 2PTWA 3S5SA 2V3BA 3G5SA 3FJ4A 3N4FA 4ECHA 2XGZA 4G74A 5GSNA 4XWZA 2YR6A 2R46A 3DGHA 4KPRA 2A8XA 3TWBA 5KOWA 1NELA 3UJSA 2OG9A 3DJGX 1XANA 1H83A 1GALA 4OCGA 3IJIA 3SM8A 3RNMA 4H7UA 1BQGA 1YEYA 5JCMA 2GF3A 2GDQA 3EUB3 3AMZA 5FS6A 3HYVA 1XHCA 1VQZA 4IZGA 2E4GA 3MQTA 2C66A 3DG6A 4ZN0A 1N4VA 3T8QA 3VQRA 4C3YA 3MUCA 2FJBA 5JCLA 1SJAA 2AKZA 4NEWA 3FG2P 3ADAB 6ENLA 1TDFA 3NTAA 4K7ZA 3R10A 1P43A 2GGIA 4CNKA 4UP3A 4IV9A 3AEAA 4GUVA 4K22A 2Q7VA 4A79A 3HPFA 3DGBA 3UTEA 2WDVA 3VDGA 5FJRA
chains in the Genus database with same CATH topology
3GRSA 4Z24A 4BJYA 3P4QA 2WOVA 4H2RA 4I59A 4OPIA 4TLXA 2YM1A 3S61A 4JY2A 1S3EA 3AEEA 1NENA 1GSNA 5U25A 3ICRA 4B1BA 5JCKA 5KVHA 3UTFA 1E1NA 1K4QA 1EL8A 1GPEA 1KSUA 2FJEA 3LJPA 4USRA 1GREA 3CN8A 4II2A 2B7RA 3T0KA 1ZOYA 4C77A 4X9NA 3EPTA 5EB5A 4BJZA 4J33A 4U2LA 3HYXA 2WPEA 2BCGG 3AE5A 2C64A 4Y4NA 2EQ6A 2QA1A 2YLSA 3CTYA 3LXDA 1DNCA 3NRNA 2B9WA 3NYCA 5IPYA 4JY3A 5HXIA 2R0GA 2R45A 4HA6A 3VRBA 3KD9A 1HYUA 4AOSA 1DODA 2XFOA 2FJDA 2V6OA 2XVIA 4GAPA 1GRGA 1H82A 3OZ2A 1L9CA 4TM4A 2ZZ0A 3QVRA 3AEGA 1EL5A 5KOXA 3L8KA 3AYLA 2WPFA 4YTPA 4OPDA 3SZFA 3D8XA 1IUTA 3BNMA 5KRQA 3LOVA 4OPGA 2PYXA 3COXA 3L1RA 3SGLA 3M13A 1FECA 2EQ8A 2YG7A 3GD3A 3M0OA 2C70A 1KN0A 1DOEA 1H81A 5TR3A 4H4WA 1BGJA 3B6DA 3CPHG 2BA9A 2V5ZA 2VVLG 1BF3A 1JRYA 2VVLA 5CQFA 1YY5A 4YXDA 1FCDA 3SFDA 1GRBA 2APGA 4REKA 1H6VA 1PJ5A 1KNPA 2C72A 2XCGA 4EIQA 4Z2TA 4A5LA 1B4VA 5FS9A 1D4CA 1PHHA 2YG6A 2IVDA 4U8NA 3GYIA 3DJDA 1NPXA 1CC4A 4OPTA 4YKFA 4ZCCA 3UP5A 4YKGA 4NTDA 2WOIA 3FPZA 2BRAA 2AR8A 2Z5YA 2JB1A 2C75A 3UCLA 1H7WA 4BK1A 4H4XA 2XLSA 4C3XA 3DGZA 4A99A 3EF6A 2XLPA 2YLTA 1GERA 1NHSA 2WU2A 1YQZA 2YLZA 4UDQA 2OALA 3LADA 3ATQA 1TYPA 2TPRA 3UKLA 3QSMA 2IIDA 4A6NB 1NDAA 3K7QX 2YVFA 1GT8A 5U1OA 3KPFA 3NKSA 2OLOA 4JN9A 4U8PA 3AYIA 3AWIA 3P4PA 3LZWA 4GCMA 3DK8A 1E1KA 3IHGA 2BRYA 3AB1A 4PAAA 3T31A 3CPIG 4EM4A 4A7AA 3V3NA 3AE6A 4H4QA 1PN0A 2ACZA 3ISHA 5LV9A 2CULA 3GYXA 1JNRA 1E1MA 4KX6A 4EMIA 4JDRA 3AE9A 5U63A 4JQ9A 4Z2RA 5HY5A 2XLRA 2BYBA 3F8PA 3REDA 3AEDA 1N1PA 2X99A 4H2NA 5J60A 3NN6X 1FEAA 2WOWA 5FS8A 4H4SA 1CHUA 1LVLA 1PXCA 3V3OA 3NYEA 2GH5A 4M52A 1EBDA 2X3NA 4AP1A 3CGEA 4YSZA 1PBCA 2WDRA 5BVAA 3AE8A 4B65A 1FEBA 2C65A 3AECA 3SZCA 4EQSA 3P9UA 3Q9TA 2DKHA 1NAAA 4AOXA 1GNDA 4U8IA 2Y6QA 1B5QA 4B67A 4G73A 1F8RA 3UTGA 3AE1A 3K7TA 3SQPA 5BUKA 3OC4A 4G6GA 4O5UA 2A87A 1GRFA 3AD9B 2UZZA 1D4EA 4PABA 4G9KA 5C3JA 2X8GA 1E7PA 2BXRA 1FOHA 4ADWA 5KMSA 2RGOA 3F8DA 2Q0LA 1F8WA 2Q6UA 1LQTA 1IJHA 3PG6A 2GB0A 4H2PA 4XXGA 2C7GA 2GQWA 2YR4A 1L9EA 2VOUA 4JNAA 2WETA 3BNUA 3F8RA 4NTEA 3SZWA 4C5OA 3BHFA 1CJ3A 4H50A 5JRBA 4XWRA 2XVEA 3UKFA 4EIPA 1FL2A 3I3LA 1ZP0A 1PBFA 5EBKA 3T14A 4FK1A 2XVJA 1JRXA 1LTXR 2BS3A 3D1CA 3SX6A 3BI2A 1IUSA 3BHKA 2C3CA 1GTEA 4GDPA 3V76A 1ZX9A 1GEUA 1MOKA 1RSGA 1F3PA 1DJQA 1GRAA 1H86A 2R0CA 3NLCA 1VQWA 1Z6LA 4K5SA 2WHDA 3VRDB 4A9WA 4NTCA 2WS3A 2BACA 3ALJA 1LV0A 5C2TA 2JAEA 1IUXA 4G6HA 1QO8A 4J34A 1GRHA 2RGHA 1O95A 4Y4MA 3IC9A 1P2EA 1IUWA 3UTHA 3HYWA 2WQYA 4H4ZA 5IQ1A 3ATRA 3UOYA 2HQMA 2YM2A 1D5TA 2BK5A 2TMDA 4GF7A 3UKPA 4YSYA 4YTNA 1D7YA 4K8DA 3CNJA 4K2XA 2IVEA 2AAQA 3GMBA 3SYIA 1ONFA 4TM0A 3DK9A 2GAHB 3ICSA 4WCTA 2CFYA 2V3AA 1S2YA 3AD7B 5HYMA 5M0ZA 3ALLA 5DBJA 4BURA 2C4CA 3QSSA 5KNLA 4TM3A 4A65A 2Z5XA 1YQ4A 1D4DA 2R4JA 2VZ2A 1GRTA 1ELIA 1K0LA 3ABVA 2BC0A 2GR3A 3D9XA 2R0PA 1ZDLA 4U8JA 3UP4A 1TDOA 1E6EA 4D04A 3AE2A 5BRTA 1ZMCA 1PXAA 3KU9A 4Z25A 3T2YA 1S3BA 2EQ7A 1LPFA 2BS2A 3B3RA 2GV8A 4H4PA 2AQJA 2JKCA 1CJCA 4WX1A 3NNEA 1KSSA 3K30A 1LJ1A 2OLNA 3KPKA 1YKJA 4YSHA 2EQ9A 1M6IA 3HZLA 3T37A 1IUVA 4B64A 3NH3X 1QLBA 3IWAA 4CNJA 5KMPA 1TDNA 4J56A 2YLWA 3AXBA 3DA1A 3IF9A 2H88A 3CNTA 3CMMA 4Z44A 4LIIA 1JU2A 2C73A 1PJ6A 1EL9A 4CY6A 3NGCX 3NK2X 2C67A 4X9MA 1RYIA 4LA1A 3LZXA 2BCPA 1CJ4A 2V61A 3QJ4A 3UOXA 2XFQA 1H2IA 3AE3A 3P1WA 4B69A 4DSHA 4J31A 4AP3A 3I6DA 3S5WA 2BC1A 4TM1A 3UOVA 4CY8A 2WBAA 2WP5A 2YQUA 2ZZCA 1YQ3A 5ER0A 1M64A 4J36A 1REOA 1CJ2A 2BK4A 3GDPA 1LQUA 1VDCA 3GRTA 2YG4A 4CCQA 2YVGA 4J2WA 2OA1A 3RP7A 4E0VA 3Q6JA 4USQA 1ZKQA 1S2QA 1CC2A 4OPLA 4U8OA 1PXBA 4H2QA 2YAUA 1QJDA 3G5RA 1CF3A 1GOSA 5EOWA 4B68A 4RG4A 1ZOVA 3RP6A 3M12A 4HB9A 1ZK7A 1KF6A 1E1LA 2CDUA 1K0IA 3H8LA 3GWDA 3DK4A 1F6MA 4H4YA 3SXIA 3R9UA 4NWZA 2WDQA 2ZZBA 4UDRA 2YG3A 3ZYXA 1DOCA 1NEKA 2XLUA 1DOBA 3RP8A 2H89A 4OVIA 1EL7A 4U8MA 1Q1WA 5JCIA 3H8IA 4GRTA 4RSLA 3P4RA 2CVJA 3NG7X 1BWCA 1TDEA 3ITJA 3BI5A 2JBVA 5KMQA 2WESA 3PVCA 4YSXA 4H4VA 4NNJA 3NHOX 3KKJA 1ZMDA 3NTDA 4NEVA 4Y4LA 3AD8B 4AT2A 4CRTA 2GEWA 4GR1A 1B8SA 1L9DA 2Q0KA 4U2TA 1E39A 2NPXA 4Z26A 3JSKA 4IA5A 3IHMA 3O0HA 3CNPA 4IVOB 5GRTA 4RG3A 4CBQA 3VR8A 2GR2A 2JK6A 3C4AA 1OJAA 3UKKA 4FK1C 5IQ4A 1TYTA 2WPCA 1OJDA 4K5RA 4FDCB 4O5QA 1UKVG 1Q1RA 2B76A 5FS7A 3GWFA 1JRZA 5KXJA 1GTHA 3ALMA 4NZHA 3T2ZA 2QA2A 4H4TA 4AT0A 1GETA 3UKAA 3BI4A 2GVCA 1ZY8A 3DJJA 1W4XA 3CPJG 2ARDA 4BK3A 2YLXA 2B9YA 3C96A 3QVPA 3UOZA 5BULA 2WP6A 1KNRA 4MJWA 2XFUA 1N4UA 3ICTA 4H4UA 2E5VA 1PBDA 3CGBA 3NYFA 4BV6A 4GAVA 3NK0X 2PHHA 1COYA 1MO9A 1Q9IA 2JB2A 2C3DA 3DJEA 2GR1A 2XLTA 2RABA 3KVEA 2R9ZA 3H4KA 4J57A 3E1TA 3GYJA 2X8HA 1BKWA 1PBBA 2J3NA 3EAOA 3P4SA 4Z43A 2XYOA 1H7XA 2XFNA 3CNSA 1IUUA 2JB3A 2XDOA 3UKQA 1GV4A 4EQXA 3FIMB 1VG0A 2BS4A 1MXTA 4BK2A 5M10A 2VRMA 1PBEA 2GMJA 1OJTA 5J7XA 1JNZA 1AOGA 1GESA 3KA7A 2GQFA 5CKUA 4YTMA 4JNQA 2OAMA 4U2SA 3QFAA 1NHPA 4FX9A 4APNA 1NG4A 3PO7A 4N9XA 5KMRA 4GDEA 4ZCDA 3T2KA 3WE0A 3VRAA 1PS9A 2GAGB 2X8CA 3L5OA 5FMHA 2W0HA 1O5WA 4IA6A 3AE7A 1Y56A 3K7MX 4EQWA 3NIXA 1NHQA 2V3BA 3C4NA 3G5SA 2R4EA 3PS9A 4DNAA 1V59A 1Y56B 4EM3A 3UKHA 4I58A 3SFEA 2FJAA 4ECHA 4H4RA 3AE4A 2GRTA 3FBSA 1D7LA 4G74A 4B63A 1K0JA 3CGDA 1KFYA 1VG9A 4XWZA 2YR6A 5GSNA 3SZ0A 2F5ZA 2R46A 2GR0A 3DGHA 4KPRA 3GMCA 3QSEA 2C76A 2DKIA 2A8XA 4B66A 5KOWA 3DJGX 4IVMB 1XANA 1L0VA 3KLJA 1H83A 4U8KA 1N4WA 4C74A 2VQBA 1SEZA 2XVFA 5L46A 1S7MA 1BZLA 1GALA 2YR5A 2A89A 1CBOA 1KDGA 4OCGA 4U8LA 4EQRA 2O9ZA 1NHRA 5KWFA 2WP9A 2QCUA 2QAEA 2VRLA 4YWOA 3SM8A 1O94A 3RNMA 4H7UA 4X4JA 2V60A 2GMHA 3VR9A 3SY4A 4DSGA 5JCMA 2NVKX 1CL0A 5HHFA 2YG5A 2GF3A 2BXSA 3G5QA 3QFBA 4A6NA 1JOAA 1P2HA 1PJ7A 3ZDNA 4CCRA 3GD4A 5FS6A 1TDKA 3HYVA 1XHCA 1DXLA 1OJCA 2E1MA 2E4GA 4YT0A 4D03A 3DH9A 4EMWA 4OPCA 4P9SA 1XDIA 2C66A 2ZBWA 1PDHA 2Y6RA 1GXFA 5EB4A 4ZN0A 1N4VA 1X31B 3NN0X 3CGCA 2XFPA 3VQRA 2BK3A 3CNDA 4C3YA 2FJBA 5JCLA 1VRQB 3AEBA 3GDNA 4NEWA 3FG2P 3ADAB 2X50A 3AEFA 4OPUA 1TDFA 3AYJA 1OJ9A 3NTAA 2B9XA 2WEUA 4K7ZA 2VQ7A 4LU6A 4ICYA 4EMJA 3EANA 4CNKA 1F8SA 1RP0A 3DMEA 3NK1X 4UP3A 1XPQA 4IV9A 3LB8A 3AEAA 1DJNA 3II4A 5KVIA 1H84A 2YLRA 4II3A 4GUVA 4K22A 2Q7VA 1NG3A 4A79A 2FBWA 3NT6A 4Z2UA 4TLZA 4DGKA 5JCNA 3URHA 3GSIA 3UTEA 1BGNA 2YVJA 2WDVA 1JEHA 2BABA 2I0ZA 3RHAA 1Y0PA 2VVMA 1B37A 1CC6A 2B7SA 2YWLA 4UDPA 1TRBA 2RGJA 2WU5A 2XVHA 3FMWA 3CIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GRS A;  4Z24 A;  4BJY A;  3P4Q A;  2WOV A;  4H2R A;  4I59 A;  4OPI A;  4TLX A;  2YM1 A;  3S61 A;  4JY2 A;  1S3E A;  3AEE A;  1NEN A;  1GSN A;  5U25 A;  3ICR A;  4B1B A;  5JCK A;  5KVH A;  3UTF A;  1E1N A;  1K4Q A;  1EL8 A;  1GPE A;  1KSU A;  2FJE A;  3LJP A;  4USR A;  1GRE A;  3CN8 A;  2B7R A;  1ZOY A;  4C77 A;  4X9N A;  3EPT A;  5EB5 A;  4BJZ A;  4J33 A;  4U2L A;  2WPE A;  2BCG G;  3AE5 A;  2C64 A;  4Y4N A;  2EQ6 A;  2QA1 A;  2YLS A;  3CTY A;  3LXD A;  1DNC A;  3NRN A;  2B9W A;  3NYC A;  5IPY A;  4JY3 A;  5HXI A;  2R0G A;  2R45 A;  4HA6 A;  3VRB A;  3KD9 A;  1HYU A;  4AOS A;  1DOD A;  2XFO A;  2FJD A;  2V6O A;  2XVI A;  1GRG A;  1H82 A;  3OZ2 A;  1L9C A;  4TM4 A;  2ZZ0 A;  3QVR A;  3AEG A;  1EL5 A;  5KOX A;  3L8K A;  3AYL A;  2WPF A;  4YTP A;  4OPD A;  3D8X A;  1IUT A;  3BNM A;  5KRQ A;  3LOV A;  4OPG A;  2PYX A;  3COX A;  3L1R A;  3SGL A;  3M13 A;  1FEC A;  2EQ8 A;  2YG7 A;  3GD3 A;  3M0O A;  2C70 A;  1H81 A;  1DOE A;  5TR3 A;  4H4W A;  1BGJ A;  3B6D A;  3CPH G;  2BA9 A;  2V5Z A;  2VVL G;  1BF3 A;  1JRY A;  2VVL A;  5CQF A;  1YY5 A;  4YXD A;  1FCD A;  3SFD A;  1GRB A;  2APG A;  4REK A;  1H6V A;  1PJ5 A;  1KNP A;  2C72 A;  2XCG A;  4EIQ A;  4Z2T A;  4A5L A;  1B4V A;  5FS9 A;  1D4C A;  1PHH A;  2YG6 A;  2IVD A;  4U8N A;  3GYI A;  3DJD A;  1NPX A;  1CC4 A;  4OPT A;  4YKF A;  4ZCC A;  3UP5 A;  4YKG A;  4NTD A;  2WOI A;  3FPZ A;  2Z5Y A;  2AR8 A;  2JB1 A;  2C75 A;  3UCL A;  1H7W A;  4BK1 A;  4H4X A;  2XLS A;  4C3X A;  3DGZ A;  4A99 A;  3EF6 A;  2XLP A;  2YLT A;  1GER A;  1NHS A;  2WU2 A;  1YQZ A;  2YLZ A;  4UDQ A;  2OAL A;  3LAD A;  3ATQ A;  1TYP A;  2TPR A;  3UKL A;  3QSM A;  2IID A;  4A6N B;  1NDA A;  3K7Q X;  2YVF A;  1GT8 A;  5U1O A;  3KPF A;  3NKS A;  2OLO A;  4JN9 A;  4U8P A;  3AYI A;  3AWI A;  3P4P A;  3LZW A;  4GCM A;  3DK8 A;  1E1K A;  3IHG A;  3AB1 A;  4PAA A;  3CPI G;  4EM4 A;  4A7A A;  3V3N A;  3AE6 A;  4H4Q A;  1PN0 A;  2ACZ A;  3ISH A;  5LV9 A;  2CUL A;  1JNR A;  1E1M A;  4KX6 A;  4EMI A;  4JDR A;  3AE9 A;  5U63 A;  4JQ9 A;  4Z2R A;  5HY5 A;  2XLR A;  2BYB A;  3F8P A;  3RED A;  3AED A;  1N1P A;  2X99 A;  4H2N A;  5J60 A;  3NN6 X;  1FEA A;  2WOW A;  5FS8 A;  4H4S A;  1CHU A;  1LVL A;  1PXC A;  3V3O A;  3NYE A;  2GH5 A;  4M52 A;  1EBD A;  2X3N A;  4AP1 A;  3CGE A;  4YSZ A;  1PBC A;  2WDR A;  5BVA A;  3AE8 A;  4B65 A;  1FEB A;  2C65 A;  3AEC A;  4EQS A;  3P9U A;  3Q9T A;  2DKH A;  1NAA A;  4AOX A;  1GND A;  4U8I A;  2Y6Q A;  1B5Q A;  4B67 A;  1F8R A;  3UTG A;  3AE1 A;  3K7T A;  3SQP A;  5BUK A;  3OC4 A;  4O5U A;  2A87 A;  1GRF A;  3AD9 B;  2UZZ A;  1D4E A;  4PAB A;  5C3J A;  2X8G A;  1E7P A;  2BXR A;  1FOH A;  4ADW A;  2RGO A;  3F8D A;  2Q0L A;  1F8W A;  2Q6U A;  1LQT A;  1IJH A;  2GB0 A;  4H2P A;  4XXG A;  2C7G A;  2GQW A;  2YR4 A;  1L9E A;  2VOU A;  4JNA A;  2WET A;  3BNU A;  3F8R A;  4NTE A;  4C5O A;  3BHF A;  1CJ3 A;  4H50 A;  4XWR A;  2XVE A;  3UKF A;  4EIP A;  1FL2 A;  3I3L A;  1ZP0 A;  1PBF A;  5EBK A;  4FK1 A;  2XVJ A;  1JRX A;  1LTX R;  2BS3 A;  3D1C A;  3BI2 A;  1IUS A;  3BHK A;  2C3C A;  1GTE A;  4GDP A;  3V76 A;  1ZX9 A;  1GEU A;  1MOK A;  1RSG A;  1F3P A;  1DJQ A;  1GRA A;  1H86 A;  2R0C A;  3NLC A;  1VQW A;  1Z6L A;  4K5S A;  2WHD A;  3VRD B;  4A9W A;  4NTC A;  2WS3 A;  2BAC A;  3ALJ A;  1LV0 A;  5C2T A;  2JAE A;  1IUX A;  4J34 A;  1QO8 A;  1GRH A;  2RGH A;  1O95 A;  4Y4M A;  3IC9 A;  1P2E A;  1IUW A;  3UTH A;  2WQY A;  4H4Z A;  5IQ1 A;  3ATR A;  3UOY A;  2HQM A;  2YM2 A;  1D5T A;  2BK5 A;  2TMD A;  4GF7 A;  3UKP A;  4YSY A;  4YTN A;  1D7Y A;  4K8D A;  3CNJ A;  4K2X A;  2IVE A;  2AAQ A;  3GMB A;  1ONF A;  4TM0 A;  3DK9 A;  2GAH B;  3ICS A;  4WCT A;  2CFY A;  2V3A A;  1S2Y A;  3AD7 B;  5HYM A;  5M0Z A;  3ALL A;  5DBJ A;  4BUR A;  3QSS A;  4TM3 A;  4A65 A;  2Z5X A;  1YQ4 A;  1D4D A;  2R4J A;  2VZ2 A;  1GRT A;  1ELI A;  1K0L A;  3ABV A;  2BC0 A;  2GR3 A;  3UP4 A;  2R0P A;  1ZDL A;  4U8J A;  1TDO A;  1E6E A;  4D04 A;  3AE2 A;  5BRT A;  1ZMC A;  1PXA A;  3KU9 A;  4Z25 A;  1S3B A;  2EQ7 A;  1LPF A;  2BS2 A;  3B3R A;  2GV8 A;  4H4P A;  2AQJ A;  2JKC A;  1CJC A;  4WX1 A;  3NNE A;  1KSS A;  3K30 A;  1LJ1 A;  2OLN A;  1YKJ A;  4YSH A;  2EQ9 A;  1M6I A;  3HZL A;  3T37 A;  1IUV A;  4B64 A;  3NH3 X;  1QLB A;  3IWA A;  4CNJ A;  1TDN A;  4J56 A;  2YLW A;  3AXB A;  3DA1 A;  3IF9 A;  2H88 A;  3CNT A;  4Z44 A;  4LII A;  1JU2 A;  2C73 A;  1PJ6 A;  1EL9 A;  4CY6 A;  3NGC X;  3NK2 X;  2C67 A;  4X9M A;  1RYI A;  4LA1 A;  3LZX A;  2BCP A;  1CJ4 A;  2V61 A;  3QJ4 A;  3UOX A;  2XFQ A;  3AE3 A;  3P1W A;  4B69 A;  4DSH A;  4J31 A;  4AP3 A;  3I6D A;  3S5W A;  2BC1 A;  4TM1 A;  3UOV A;  4CY8 A;  2WBA A;  2WP5 A;  2YQU A;  2ZZC A;  1YQ3 A;  5ER0 A;  1M64 A;  4J36 A;  1REO A;  1CJ2 A;  2BK4 A;  3GDP A;  1LQU A;  1VDC A;  3GRT A;  2YG4 A;  4CCQ A;  2YVG A;  4J2W A;  2OA1 A;  3RP7 A;  4E0V A;  3Q6J A;  4USQ A;  1ZKQ A;  1S2Q A;  1CC2 A;  4OPL A;  4U8O A;  1PXB A;  4H2Q A;  2YAU A;  1QJD A;  3G5R A;  1CF3 A;  1GOS A;  5EOW A;  4B68 A;  4RG4 A;  1ZOV A;  3RP6 A;  3M12 A;  4HB9 A;  1ZK7 A;  1KF6 A;  1E1L A;  2CDU A;  1K0I A;  3H8L A;  3GWD A;  3DK4 A;  1F6M A;  4H4Y A;  3R9U A;  2WDQ A;  2ZZB A;  4UDR A;  2YG3 A;  3ZYX A;  1DOC A;  1NEK A;  2XLU A;  1DOB A;  3RP8 A;  2H89 A;  4OVI A;  1EL7 A;  4U8M A;  1Q1W A;  5JCI A;  3H8I A;  4GRT A;  4RSL A;  3P4R A;  2CVJ A;  3NG7 X;  1BWC A;  1TDE A;  3ITJ A;  3BI5 A;  2JBV A;  2WES A;  3PVC A;  4YSX A;  4H4V A;  3NHO X;  3KKJ A;  1ZMD A;  3NTD A;  4NEV A;  4Y4L A;  3AD8 B;  4AT2 A;  4CRT A;  2GEW A;  4GR1 A;  1B8S A;  1L9D A;  2Q0K A;  4U2T A;  1E39 A;  2NPX A;  4Z26 A;  3JSK A;  4IA5 A;  3IHM A;  3O0H A;  3CNP A;  4IVO B;  5GRT A;  4RG3 A;  4CBQ A;  3VR8 A;  2GR2 A;  2JK6 A;  3C4A A;  1OJA A;  3UKK A;  4FK1 C;  5IQ4 A;  1TYT A;  2WPC A;  1OJD A;  4K5R A;  4FDC B;  4O5Q A;  1UKV G;  1Q1R A;  2B76 A;  5FS7 A;  3GWF A;  1JRZ A;  5KXJ A;  1GTH A;  3ALM A;  4NZH A;  2QA2 A;  4H4T A;  4AT0 A;  1GET A;  3UKA A;  3BI4 A;  2GVC A;  1ZY8 A;  3DJJ A;  1W4X A;  3CPJ G;  2ARD A;  4BK3 A;  2YLX A;  2B9Y A;  3C96 A;  3QVP A;  3UOZ A;  5BUL A;  2WP6 A;  1KNR A;  4MJW A;  2XFU A;  1N4U A;  3ICT A;  4H4U A;  2E5V A;  1PBD A;  3CGB A;  3NYF A;  4BV6 A;  3NK0 X;  2PHH A;  1COY A;  1MO9 A;  1Q9I A;  2JB2 A;  2C3D A;  3DJE A;  2GR1 A;  2XLT A;  2RAB A;  3KVE A;  2R9Z A;  3H4K A;  4J57 A;  3E1T A;  3GYJ A;  2X8H A;  1BKW A;  1PBB A;  2J3N A;  3EAO A;  3P4S A;  4Z43 A;  2XYO A;  1H7X A;  2XFN A;  3CNS A;  1IUU A;  2JB3 A;  2XDO A;  3UKQ A;  1GV4 A;  4EQX A;  3FIM B;  1VG0 A;  2BS4 A;  1MXT A;  4BK2 A;  5M10 A;  2VRM A;  1PBE A;  2GMJ A;  1OJT A;  5J7X A;  1JNZ A;  1AOG A;  1GES A;  3KA7 A;  2GQF A;  5CKU A;  4YTM A;  4JNQ A;  2OAM A;  4U2S A;  3QFA A;  1NHP A;  4FX9 A;  4APN A;  1NG4 A;  3PO7 A;  4N9X A;  4GDE A;  4ZCD A;  3WE0 A;  3VRA A;  1PS9 A;  2GAG B;  2X8C A;  5FMH A;  4IA6 A;  2W0H A;  1O5W A;  3AE7 A;  1Y56 A;  3K7M X;  4EQW A;  3NIX A;  1NHQ A;  2V3B A;  3C4N A;  3G5S A;  2R4E A;  3PS9 A;  4DNA A;  1V59 A;  1Y56 B;  4EM3 A;  3UKH A;  4I58 A;  3SFE A;  2FJA A;  4ECH A;  4H4R A;  3AE4 A;  2GRT A;  3FBS A;  1D7L A;  4B63 A;  1K0J A;  3CGD A;  1KFY A;  1VG9 A;  4XWZ A;  2YR6 A;  5GSN A;  2F5Z A;  2R46 A;  2GR0 A;  3DGH A;  4KPR A;  3GMC A;  3QSE A;  2C76 A;  2DKI A;  2A8X A;  4B66 A;  5KOW A;  3DJG X;  4IVM B;  1XAN A;  1L0V A;  3KLJ A;  1H83 A;  4U8K A;  1N4W A;  4C74 A;  2VQB A;  1SEZ A;  2XVF A;  5L46 A;  1BZL A;  1GAL A;  2YR5 A;  2A89 A;  1CBO A;  1KDG A;  4OCG A;  4U8L A;  4EQR A;  2O9Z A;  1NHR A;  5KWF A;  2WP9 A;  2QCU A;  2QAE A;  2VRL A;  4YWO A;  3SM8 A;  1O94 A;  3RNM A;  4H7U A;  4X4J A;  2V60 A;  2GMH A;  3VR9 A;  4DSG A;  5JCM A;  2NVK X;  1CL0 A;  5HHF A;  2YG5 A;  2GF3 A;  2BXS A;  3G5Q A;  3QFB A;  4A6N A;  1JOA A;  1P2H A;  1PJ7 A;  3ZDN A;  4CCR A;  3GD4 A;  5FS6 A;  1TDK A;  1XHC A;  1DXL A;  1OJC A;  2E1M A;  2E4G A;  4YT0 A;  4D03 A;  3DH9 A;  4EMW A;  4OPC A;  4P9S A;  1XDI A;  2C66 A;  2ZBW A;  1PDH A;  2Y6R A;  1GXF A;  5EB4 A;  4ZN0 A;  1N4V A;  1X31 B;  3NN0 X;  3CGC A;  2XFP A;  3VQR A;  2BK3 A;  3CND A;  4C3Y A;  2FJB A;  5JCL A;  1VRQ B;  3AEB A;  3GDN A;  4NEW A;  3FG2 P;  3ADA B;  2X50 A;  3AEF A;  4OPU A;  1TDF A;  3AYJ A;  1OJ9 A;  3NTA A;  2B9X A;  2WEU A;  4K7Z A;  2VQ7 A;  4LU6 A;  4ICY A;  4EMJ A;  3EAN A;  4CNK A;  1F8S A;  1RP0 A;  3DME A;  3NK1 X;  4UP3 A;  1XPQ A;  4IV9 A;  3LB8 A;  3AEA A;  1DJN A;  3II4 A;  5KVI A;  1H84 A;  2YLR A;  4GUV A;  4K22 A;  2Q7V A;  1NG3 A;  4A79 A;  2FBW A;  3NT6 A;  4Z2U A;  4TLZ A;  4DGK A;  5JCN A;  3URH A;  3GSI A;  3UTE A;  1BGN A;  2YVJ A;  2WDV A;  1JEH A;  2BAB A;  2I0Z A;  3RHA A;  1Y0P A;  2VVM A;  1B37 A;  1CC6 A;  2B7S A;  2YWL A;  4UDP A;  1TRB A;  2RGJ A;  2WU5 A;  2XVH A;  3FMW A;  3CIR A; 
#chains in the Genus database with same CATH topology
 4Z24 A;  3P4Q A;  4I59 A;  2YM1 A;  3S61 A;  2HZG A;  1PDZ A;  3UTF A;  1E1N A;  1N61 C;  1FO4 A;  2QJN A;  3T0K A;  1ZOY A;  4C77 A;  4X9N A;  5EB5 A;  4U2L A;  2BCG G;  3AE5 A;  4Y4N A;  2EQ6 A;  3SR6 B;  3LXD A;  3RCY A;  2R0G A;  4E4F A;  2R45 A;  3KD9 A;  3QPE A;  2XFO A;  1H82 A;  1L9C A;  1FHU A;  5ENL A;  3L8K A;  4YTP A;  3LOV A;  3COX A;  2YG7 A;  4TVY A;  3MSY A;  4H4W A;  2BA9 A;  1FHV A;  1R0M A;  3JVA A;  2C72 A;  3K1G A;  2PCE A;  5FS9 A;  1D4C A;  1PHH A;  1SJC A;  3EEZ A;  4IP4 A;  1RVK A;  1ZXI C;  2IVD A;  3DDM A;  4YKF A;  2AR8 A;  3DG7 A;  3GO2 A;  2YLT A;  1GER A;  1EBH A;  3GY1 A;  3UKL A;  4A6N B;  2I5Q A;  5FJP A;  3NKS A;  4JN9 A;  3AWI A;  3SN0 A;  3AB1 A;  3V5F A;  4PAA A;  3T31 A;  3CPI G;  4A7A A;  3ISH A;  3UJ2 A;  3GYX A;  5U63 A;  2XLR A;  2BYB A;  3RED A;  1DTN A;  4H19 A;  2WOW A;  5FS8 A;  1LVL A;  1PXC A;  3V3O A;  4HNL A;  2GH5 A;  5BVA A;  1VDV A;  1PBC A;  2WDR A;  3AE8 A;  2C65 A;  3T6C A;  3P9U A;  3Q9T A;  1NAA A;  4U8I A;  1B5Q A;  4GYP C;  3UCD A;  2MUC A;  3AE1 A;  3SQP A;  3NVZ B;  2QDE A;  4PAB A;  2X8G A;  3FVD A;  5KMS A;  1F8W A;  1IJH A;  2GB0 A;  4H50 A;  4EIP A;  1PBF A;  4JN7 A;  1GTE A;  4GDP A;  1ZX9 A;  1GEU A;  1H86 A;  3NLC A;  4K5S A;  3MZN A;  4NTC A;  2BAC A;  3OTR A;  1IUX A;  2RGH A;  1O95 A;  3PWI A;  3PK7 A;  2WQY A;  4H4Z A;  1D5T A;  2QDD A;  4Z17 A;  3A7U A;  3CNJ A;  2AAQ A;  3DK9 A;  4WCT A;  2V3A A;  1S2Y A;  3ALL A;  2E3T A;  3IJQ A;  4TM3 A;  1YQ4 A;  2R4J A;  1ELI A;  3D9X A;  1ZDL A;  1E6E A;  1ZMC A;  2AL2 A;  3T2Y A;  2BS2 A;  2GV8 A;  2JKC A;  3NNE A;  2AL2 B;  3NVY B;  1M6I A;  3T37 A;  2OQY A;  3CT2 A;  4CNJ A;  5KMP A;  3DA1 A;  3TQP A;  4LII A;  1JU2 A;  2QQ6 A;  2V61 A;  1H2I A;  3AE3 A;  3S5W A;  4CY8 A;  4YSX A;  3UOV A;  2WP5 A;  1REO A;  2YVG A;  4J2W A;  2OA1 A;  3RP7 A;  1ZKQ A;  1PXB A;  5EOW A;  3NVW B;  4H4Y A;  4NWZ A;  2OX4 A;  1X2G A;  1NEK A;  3RP8 A;  1EL7 A;  3P4R A;  3NG7 X;  5KMQ A;  4E6M A;  3KKJ A;  4AT2 A;  2GEW A;  1E39 A;  2NPX A;  4Z26 A;  3JSK A;  4GFI A;  3O0H A;  5GRT A;  3VR8 A;  3C4A A;  4HYR A;  5IQ4 A;  4K5R A;  4K2S A;  3ALM A;  3T2Z A;  3BI4 A;  3DJJ A;  3CPJ G;  4BK3 A;  2YLX A;  2PTZ A;  1KNR A;  4GAV A;  2ONE A;  2PHH A;  2JB2 A;  2PGE A;  2GR1 A;  3H4K A;  3E1T A;  1BKW A;  3EAO A;  1H7X A;  4FP1 A;  3VCN A;  2BS4 A;  2OZ3 A;  3OW1 A;  5CKU A;  3QFA A;  5BOE A;  4GDE A;  1PS9 A;  2GAG B;  2W0H A;  3AE7 A;  3NIX A;  2R4E A;  3PS9 A;  1MNS A;  4DNA A;  2OVL A;  4EM3 A;  4GGB A;  3FBS A;  1D7L A;  4B63 A;  2ZAD A;  2GR0 A;  3GMC A;  3QSE A;  2C76 A;  3KLJ A;  4U8K A;  1S7M A;  1BZL A;  2A89 A;  1CBO A;  1KDG A;  2QAE A;  4YWO A;  3NO1 A;  4X4J A;  2V60 A;  2GMH A;  1CL0 A;  2PPG A;  1P2H A;  3ZDN A;  4ROP A;  3CXO A;  1JRP A;  4D03 A;  3DH9 A;  4OPC A;  1XDI A;  1R6W A;  1GXF A;  1N60 C;  3NN0 X;  3CGC A;  2BK3 A;  3JW7 A;  1VRQ B;  3AEB A;  2X50 A;  2WEU A;  4IL2 A;  4LU6 A;  4EMJ A;  4HNC A;  2P0I A;  1RP0 A;  3DME A;  3NK1 X;  3LB8 A;  4II3 A;  5KVI A;  1WUF A;  2PU0 A;  4Z2U A;  4TLZ A;  4DGK A;  3URH A;  3GSI A;  1BGN A;  2OO6 A;  2BAB A;  3RHA A;  1B37 A;  4UDP A;  4DYE A;  3FYY A;  2WU5 A;  2XVH A;  3UXL A;  4H2R A;  3NXL A;  1XPY A;  4B1B A;  1TE6 A;  5JCK A;  1K4Q A;  1EL8 A;  4H1Z A;  3CN8 A;  4II2 A;  3DG3 A;  2YLS A;  3CTY A;  3NYC A;  4AOS A;  2V6O A;  2XVI A;  4MGG A;  4ZCW A;  4TM4 A;  3SZF A;  3D8X A;  2PYX A;  3GD3 A;  3M0O A;  3CPH G;  3B6D A;  2CHR A;  3CK5 A;  2V5Z A;  1L8P A;  2P3Z A;  1JRY A;  2VVL A;  1FCD A;  3DIP A;  2QJJ A;  2XCG A;  4EIQ A;  4Z2T A;  4K1W A;  4F4R A;  1B4V A;  3DFH A;  1ECQ A;  3DJD A;  1NPX A;  1CC4 A;  3UP5 A;  1TZZ A;  4A6G A;  2Z5Y A;  2JB1 A;  4BK1 A;  4A99 A;  3EF6 A;  2XLP A;  1YQZ A;  2YLZ A;  3RR1 A;  3RRA A;  3H70 A;  3K7Q X;  1GT8 A;  2PP3 A;  5U1O A;  3N6J A;  3AYI A;  4GCM A;  1E1K A;  3IHG A;  2BRY A;  4EM4 A;  3DER A;  4H4Q A;  1PN0 A;  2ACZ A;  3DFY A;  1E1M A;  3AE9 A;  4Z2R A;  4JQ9 A;  5HY5 A;  3ETR B;  3F8P A;  2X99 A;  5J60 A;  1FEA A;  1CHU A;  4AP1 A;  1EBD A;  3CGE A;  3FXG A;  4B65 A;  3PFR A;  4EQS A;  3ENL A;  2DKH A;  5G5G B;  4EWJ A;  4G6G A;  3I6E A;  2UZZ A;  2OQH A;  1SJB A;  1FOH A;  2RGO A;  1FFU C;  2Q0L A;  2Q6U A;  3PG6 A;  2YR4 A;  4C5O A;  4JNA A;  1EC9 A;  3PWG A;  3OPS A;  3P0W A;  2XVE A;  3UKF A;  1FL2 A;  4FK1 A;  2XVJ A;  5IDZ A;  3V76 A;  1VQW A;  1F9C A;  3VRD B;  3ALJ A;  1GRH A;  3IC9 A;  3ATR A;  3UOY A;  4YTN A;  2BK5 A;  2TMD A;  4GF7 A;  4YSY A;  1EC8 A;  3GMB A;  4GIR A;  1ONF A;  2GAH B;  3ICS A;  3AD7 B;  4A65 A;  3BSM A;  1KD0 A;  5G5H B;  3UP4 A;  4D04 A;  1PXA A;  4Z25 A;  1JPD X;  1CJC A;  3K30 A;  1LJ1 A;  2OLN A;  3KPK A;  1IUV A;  3NH3 X;  1QLB A;  2ZC8 A;  2YLW A;  3AXB A;  4K8G A;  2H88 A;  3CNT A;  1MDR A;  3CMM A;  1EL9 A;  4CY6 A;  2XSX A;  1JPM A;  2C67 A;  2GGJ A;  3QJ4 A;  4AP3 A;  3TW9 A;  4TM1 A;  2YQU A;  1N62 C;  1M64 A;  1YQ3 A;  3GDP A;  1LQU A;  4E5T A;  3R0K A;  4E0V A;  4OPL A;  1QJD A;  1GOS A;  4RG4 A;  3V3W A;  1ZOV A;  3M12 A;  4HB9 A;  1ZK7 A;  3AM9 A;  1E1L A;  2CDU A;  4IL0 A;  2AL1 A;  3R9U A;  2OLA A;  2ZZB A;  2YG3 A;  3IK4 A;  3QKE A;  1IYX A;  1Q1W A;  5JCI A;  4GRT A;  4RSL A;  1BWC A;  1TDE A;  3ITJ A;  3NHO X;  3NTD A;  1ZMD A;  4Y4L A;  4CRT A;  3FCP A;  4GR1 A;  1L9D A;  4U2T A;  4IA5 A;  4RG3 A;  4CBQ A;  3UKK A;  1OJD A;  2WPC A;  3R1Z A;  1UKV G;  2B76 A;  2GL5 A;  4GYP A;  2QA2 A;  4AT0 A;  4IT1 A;  1ZY8 A;  2HNE A;  3C96 A;  5BUL A;  4MJW A;  2XFU A;  3ICT A;  4H4U A;  2E5V A;  2XH0 A;  3CGB A;  3N6H A;  1MRA A;  2E5A A;  3I4K A;  4G7F A;  1COY A;  2C3D A;  3DJE A;  2XLT A;  3EKG A;  2R9Z A;  3UJR A;  3GYJ A;  2J3N A;  3IJL A;  3CNS A;  4J3Z A;  3FIM B;  2OPJ A;  1MXT A;  2GMJ A;  5J7X A;  3STP A;  4JNQ A;  2OAM A;  4APN A;  5KMR A;  1NG4 A;  4N9X A;  2P88 A;  3T2K A;  3VRA A;  3L5O A;  4IA6 A;  3D46 A;  4EQW A;  1NHQ A;  1V59 A;  3UKH A;  4I58 A;  2FJA A;  4H4R A;  3AE4 A;  4DN1 A;  1K0J A;  1KFY A;  1VG9 A;  3GC2 A;  4MMW A;  4B66 A;  3NFU A;  1N5X A;  1L0V A;  2PP0 A;  4C74 A;  2VQB A;  3R25 A;  1SEZ A;  2XVF A;  2YR5 A;  3VC5 A;  4U8L A;  5KWF A;  2O9Z A;  2WP9 A;  2QCU A;  1E9I A;  1O94 A;  3U4F A;  3VR9 A;  4DSG A;  2YG5 A;  2BXS A;  3G5Q A;  3QFB A;  1JOA A;  5J04 A;  3OZM A;  2DW7 A;  3HRD C;  2Y6R A;  5EB4 A;  3NVV B;  4KPL A;  1X31 B;  3SSZ A;  3GDN A;  2W54 A;  4OPU A;  3AYJ A;  2VQ7 A;  4ICY A;  3EAN A;  1F8S A;  1XPQ A;  2YLR A;  3II4 A;  2FBW A;  1JEH A;  1Y0P A;  2VVM A;  1TRB A;  2RGJ A;  3GRS A;  1EBG A;  2WOV A;  4OPI A;  3AEE A;  1STZ A;  3ICR A;  5U25 A;  1JCT A;  2FKP A;  1GPE A;  3LJP A;  3CXB A;  4J33 A;  3HYX A;  2C64 A;  4A3R A;  3NRN A;  5IPY A;  4HA6 A;  3VRB A;  3BOX A;  3MKC A;  4HCH A;  1SJD A;  1GRG A;  3QVR A;  3AEG A;  5KOX A;  3SBF A;  4DXK A;  2WPF A;  1IUT A;  5KRQ A;  4HPN A;  3B97 A;  3L1R A;  3M13 A;  2EQ8 A;  1KN0 A;  1BGJ A;  1BF3 A;  1BKH A;  3ZLF A;  1MDL A;  3SFD A;  1PJ5 A;  1KNP A;  4A5L A;  2YG6 A;  3GYI A;  2WOI A;  2BRA A;  4G8T A;  3UCL A;  1H7W A;  1ELS A;  2XLS A;  3DGZ A;  4KT2 A;  2OKT A;  3ATQ A;  2GGG A;  2YVF A;  3BJS A;  4M6U A;  2OLO A;  4U8P A;  3P4P A;  3LZW A;  3DK8 A;  5EU9 A;  1JNR A;  4JDR A;  3AED A;  2GSH A;  3RO6 A;  1N1P A;  3ZVH A;  3NYE A;  4M52 A;  1FEB A;  3AEC A;  3SZC A;  3ZVH B;  3VCC A;  4AOX A;  2Y6Q A;  3K7T A;  5BUK A;  3AD9 B;  3FV9 A;  4G9K A;  5C3J A;  1E7P A;  4ADW A;  2PS2 A;  1LQT A;  4H2P A;  2C7G A;  3F8R A;  3BNU A;  3SZW A;  3BHF A;  1CJ3 A;  5JRB A;  4XWR A;  4JN8 A;  1ZP0 A;  3SX6 A;  3BHK A;  2C3C A;  1P48 A;  2NQL A;  2R0C A;  1Z6L A;  4IP5 A;  4A9W A;  1JDF A;  2WS3 A;  1LV0 A;  3TOY A;  5C2T A;  4DHG A;  2JAE A;  4G6H A;  1P2E A;  3UTH A;  3HYW A;  2PU1 A;  2P8C A;  5IQ1 A;  2YM2 A;  1D7Y A;  3KUM A;  2IVE A;  1RM6 B;  1WUE A;  3R0U A;  5M0Z A;  3ZVI A;  2C4C A;  3QSS A;  2VZ2 A;  1GRT A;  3ABV A;  2BC0 A;  2R0P A;  1TDO A;  3AE2 A;  5BRT A;  1S3B A;  2EQ7 A;  3B3R A;  2AQJ A;  1KSS A;  1YKJ A;  3HZL A;  3UGV A;  4B64 A;  4ZA0 A;  3GD6 A;  1TDN A;  3IF9 A;  1N63 C;  4Z44 A;  4X9M A;  1RYI A;  2BCP A;  3UOX A;  3P1W A;  4DSH A;  4J31 A;  2BC1 A;  2WBA A;  2ZZC A;  5ER0 A;  3V4B A;  4USQ A;  4H2Q A;  4Z1Y A;  3A7R A;  1CF3 A;  3G5R A;  4B68 A;  4E8G A;  3RP6 A;  3HW2 A;  1KF6 A;  3H8L A;  3GWD A;  3DK4 A;  1F6M A;  2WDQ A;  4UDR A;  3JZU A;  3UCC A;  1PDY A;  2H89 A;  4OVI A;  4U8M A;  2CVJ A;  3DES A;  3R11 A;  3BI5 A;  4NNJ A;  3IHM A;  2JK6 A;  4FK1 C;  1TYT A;  4O5Q A;  1Q1R A;  5FS7 A;  3GWF A;  1JRZ A;  1GTH A;  4NZH A;  4HCD A;  1GET A;  3UKA A;  2GVC A;  2ARD A;  2B9Y A;  3UOZ A;  2WP6 A;  3OZY A;  2PTY A;  1PBD A;  3NYF A;  4BV6 A;  1MO9 A;  4MKS A;  2RAB A;  3SJN A;  4J57 A;  2W3R A;  5BOF A;  2JB3 A;  3UKQ A;  1GV4 A;  1KKR A;  3DEQ A;  3CYJ A;  5M10 A;  2OFJ A;  1OEP A;  3KA7 A;  2HXT A;  4YTM A;  4U2S A;  1NHP A;  2P8B A;  4ZCD A;  2X8C A;  5FMH A;  3K7M X;  1Y56 A;  3C4N A;  1Y56 B;  3ZLG A;  3SFE A;  3ES8 A;  4H2H A;  2GRT A;  2PSN A;  3CGD A;  2AKM A;  1SB3 B;  3SZ0 A;  2F5Z A;  4E4U A;  2GGH A;  7ENL A;  2DKI A;  4GIS A;  3P3B A;  3R07 C;  1T3Q C;  4IVM B;  1N4W A;  5L46 A;  4IHC A;  4EQR A;  1NHR A;  2VRL A;  3VA8 A;  4TVW A;  3THU A;  3SY4 A;  2NVK X;  5HHF A;  4A6N A;  1PJ7 A;  4CCR A;  3GD4 A;  2OZ8 A;  2RDX A;  1TDK A;  3QTP A;  1DXL A;  1OJC A;  3UJF A;  2E1M A;  3H8A A;  4YT0 A;  4EMW A;  4P9S A;  1MUC A;  2ZBW A;  1PDH A;  2XFP A;  3CND A;  3UJE A;  3AEF A;  1OJ9 A;  4X2P A;  2B9X A;  4DX3 A;  2FYM A;  3UXK A;  1DJN A;  1H84 A;  3ES7 A;  2W55 A;  1NG3 A;  1KCZ A;  1TKK A;  1NU5 A;  3NT6 A;  2QJM A;  3SQS A;  5JCN A;  2YVJ A;  2I0Z A;  1V97 A;  1CC6 A;  2B7S A;  2YWL A;  3VFC A;  3TCS A;  3TTE A;  3FMW A;  3CIR A;  4BJY A;  4TLX A;  5FJO A;  2POZ A;  2PA6 A;  4JY2 A;  1S3E A;  1KKO A;  1GSN A;  1NEN A;  5KVH A;  3V5C A;  1KSU A;  2FJE A;  2MNR A;  4USR A;  1GRE A;  2B7R A;  3EPT A;  4BJZ A;  2WPE A;  4KWS A;  4A35 A;  2GGE A;  2QA1 A;  1DNC A;  4FI4 A;  2B9W A;  4JY3 A;  5HXI A;  1JRO A;  1HYU A;  1DOD A;  2FJD A;  4GAP A;  3OZ2 A;  1XS2 A;  2ZZ0 A;  1EL5 A;  3AYL A;  4GME A;  3TWA A;  4OPD A;  1ONE A;  3BNM A;  4OPG A;  3SGL A;  1FEC A;  2C70 A;  1H81 A;  1DOE A;  5TR3 A;  2VVL G;  3CAW A;  5CQF A;  1YY5 A;  4YXD A;  1GRB A;  2APG A;  4REK A;  1H6V A;  3RGT A;  3ZLH A;  3AN1 A;  4U8N A;  1EC7 A;  4ZCC A;  4OPT A;  2OZT A;  4YKG A;  4NTD A;  3FPZ A;  2C75 A;  4H4X A;  4C3X A;  2WU2 A;  1NHS A;  4UDQ A;  2OAL A;  3LAD A;  1TYP A;  2TPR A;  3QSM A;  2IID A;  1NDA A;  3KPF A;  2XH4 A;  3NZG A;  3V3N A;  2PMQ A;  3AE6 A;  5LV9 A;  2CUL A;  4KX6 A;  4EMI A;  4H2N A;  2PGW A;  3NN6 X;  3Q4D A;  4H4S A;  3VC6 A;  2X3N A;  4YSZ A;  3T9P A;  2XH7 A;  1GND A;  4B67 A;  4G73 A;  1F8R A;  3MWC A;  3UTG A;  3OC4 A;  4O5U A;  2A87 A;  1GRF A;  1D4E A;  2POD A;  2BXR A;  3F8D A;  2PP1 A;  4XXG A;  2GQW A;  3OP2 A;  1L9E A;  2VOU A;  2WET A;  4NTE A;  3SN1 A;  4HN8 A;  3I3L A;  3QLD A;  5EBK A;  3T14 A;  1JRX A;  1LTX R;  2BS3 A;  3D1C A;  3BI2 A;  1IUS A;  1MOK A;  4YWS A;  1RSG A;  1F3P A;  1DJQ A;  1GRA A;  3T4W A;  3NS1 B;  2WHD A;  4J34 A;  1QO8 A;  3QN3 A;  4Y4M A;  1IUW A;  3S47 A;  1FFV C;  2HQM A;  3UKP A;  3N4E A;  3P93 A;  4K8D A;  4K2X A;  3SYI A;  4TM0 A;  1WYG A;  4J1O A;  2CFY A;  3B9J B;  3A7A A;  5HYM A;  5DBJ A;  4BUR A;  5KNL A;  2Z5X A;  1D4D A;  1K0L A;  2GR3 A;  4U8J A;  3CB3 A;  3KU9 A;  1LPF A;  1N5W C;  4H4P A;  3MY9 A;  4WX1 A;  4H83 A;  4YSH A;  2EQ9 A;  3TJ4 A;  4DWD A;  3U9I A;  3IWA A;  4J56 A;  1W6T A;  2QVH A;  2C73 A;  1PJ6 A;  3NGC X;  3NK2 X;  4LA1 A;  3LZX A;  1CJ4 A;  2XFQ A;  4B69 A;  3I6D A;  4ZOH B;  5FJU A;  4J36 A;  1FIQ B;  3I6T A;  1CJ2 A;  2BK4 A;  1VDC A;  3GRT A;  2YG4 A;  4CCQ A;  3Q6J A;  1S2Q A;  1CC2 A;  4U8O A;  2YAU A;  4M0X A;  2O56 A;  3D47 A;  2DW6 A;  1K0I A;  3SXI A;  2HXU A;  3ZYX A;  1DOC A;  3NRZ B;  2XLU A;  1DOB A;  5FJT A;  3H8I A;  2JBV A;  2WES A;  3PVC A;  4H4V A;  4NEV A;  3AD8 B;  2PTX A;  1B8S A;  2Q0K A;  3CNP A;  4IVO B;  3H12 A;  2GR2 A;  1OJA A;  4FDC B;  5KXJ A;  4H4T A;  2XH2 A;  1W4X A;  4GGH A;  3QVP A;  4HCL A;  1N4U A;  1X2H A;  2W3S A;  3NK0 X;  1Q9I A;  3KVE A;  4JHM A;  2X8H A;  1PBB A;  4Z43 A;  3P4S A;  2XYO A;  2XFN A;  1IUU A;  2QGY A;  4ENL A;  2XDO A;  4EQX A;  1VG0 A;  4BK2 A;  3Q45 A;  2VRM A;  1PBE A;  3TJI A;  1OJT A;  1JNZ A;  1AOG A;  1GES A;  2GQF A;  3RIT A;  4FX9 A;  3PO7 A;  3H7V A;  4KEM A;  3SN4 A;  3WE0 A;  1O5W A;  2PTW A;  3S5S A;  2V3B A;  3G5S A;  3FJ4 A;  3N4F A;  4ECH A;  2XGZ A;  4G74 A;  5GSN A;  4XWZ A;  2YR6 A;  2R46 A;  3DGH A;  4KPR A;  2A8X A;  3TWB A;  5KOW A;  1NEL A;  3UJS A;  2OG9 A;  3DJG X;  1XAN A;  1H83 A;  1GAL A;  4OCG A;  3IJI A;  3SM8 A;  3RNM A;  4H7U A;  1BQG A;  1YEY A;  5JCM A;  2GF3 A;  2GDQ A;  3EUB 3;  3AMZ A;  5FS6 A;  3HYV A;  1XHC A;  1VQZ A;  4IZG A;  2E4G A;  3MQT A;  2C66 A;  3DG6 A;  4ZN0 A;  1N4V A;  3T8Q A;  3VQR A;  4C3Y A;  3MUC A;  2FJB A;  5JCL A;  1SJA A;  2AKZ A;  4NEW A;  3FG2 P;  3ADA B;  6ENL A;  1TDF A;  3NTA A;  4K7Z A;  3R10 A;  1P43 A;  2GGI A;  4CNK A;  4UP3 A;  4IV9 A;  3AEA A;  4GUV A;  4K22 A;  2Q7V A;  4A79 A;  3HPF A;  3DGB A;  3UTE A;  2WDV A;  3VDG A;  5FJR A; 
#chains in the Genus database with same CATH homology
 3GRS A;  4Z24 A;  4BJY A;  3P4Q A;  2WOV A;  4H2R A;  4I59 A;  4OPI A;  4TLX A;  2YM1 A;  3S61 A;  4JY2 A;  1S3E A;  3AEE A;  1NEN A;  1GSN A;  5U25 A;  3ICR A;  4B1B A;  5JCK A;  5KVH A;  3UTF A;  1E1N A;  1K4Q A;  1EL8 A;  1GPE A;  1KSU A;  2FJE A;  3LJP A;  4USR A;  1GRE A;  3CN8 A;  4II2 A;  2B7R A;  3T0K A;  1ZOY A;  4C77 A;  4X9N A;  3EPT A;  5EB5 A;  4BJZ A;  4J33 A;  4U2L A;  3HYX A;  2WPE A;  2BCG G;  3AE5 A;  2C64 A;  4Y4N A;  2EQ6 A;  2QA1 A;  2YLS A;  3CTY A;  3LXD A;  1DNC A;  3NRN A;  2B9W A;  3NYC A;  5IPY A;  4JY3 A;  5HXI A;  2R0G A;  2R45 A;  4HA6 A;  3VRB A;  3KD9 A;  1HYU A;  4AOS A;  1DOD A;  2XFO A;  2FJD A;  2V6O A;  2XVI A;  4GAP A;  1GRG A;  1H82 A;  3OZ2 A;  1L9C A;  4TM4 A;  2ZZ0 A;  3QVR A;  3AEG A;  1EL5 A;  5KOX A;  3L8K A;  3AYL A;  2WPF A;  4YTP A;  4OPD A;  3SZF A;  3D8X A;  1IUT A;  3BNM A;  5KRQ A;  3LOV A;  4OPG A;  2PYX A;  3COX A;  3L1R A;  3SGL A;  3M13 A;  1FEC A;  2EQ8 A;  2YG7 A;  3GD3 A;  3M0O A;  2C70 A;  1KN0 A;  1DOE A;  1H81 A;  5TR3 A;  4H4W A;  1BGJ A;  3B6D A;  3CPH G;  2BA9 A;  2V5Z A;  2VVL G;  1BF3 A;  1JRY A;  2VVL A;  5CQF A;  1YY5 A;  4YXD A;  1FCD A;  3SFD A;  1GRB A;  2APG A;  4REK A;  1H6V A;  1PJ5 A;  1KNP A;  2C72 A;  2XCG A;  4EIQ A;  4Z2T A;  4A5L A;  1B4V A;  5FS9 A;  1D4C A;  1PHH A;  2YG6 A;  2IVD A;  4U8N A;  3GYI A;  3DJD A;  1NPX A;  1CC4 A;  4OPT A;  4YKF A;  4ZCC A;  3UP5 A;  4YKG A;  4NTD A;  2WOI A;  3FPZ A;  2BRA A;  2AR8 A;  2Z5Y A;  2JB1 A;  2C75 A;  3UCL A;  1H7W A;  4BK1 A;  4H4X A;  2XLS A;  4C3X A;  3DGZ A;  4A99 A;  3EF6 A;  2XLP A;  2YLT A;  1GER A;  1NHS A;  2WU2 A;  1YQZ A;  2YLZ A;  4UDQ A;  2OAL A;  3LAD A;  3ATQ A;  1TYP A;  2TPR A;  3UKL A;  3QSM A;  2IID A;  4A6N B;  1NDA A;  3K7Q X;  2YVF A;  1GT8 A;  5U1O A;  3KPF A;  3NKS A;  2OLO A;  4JN9 A;  4U8P A;  3AYI A;  3AWI A;  3P4P A;  3LZW A;  4GCM A;  3DK8 A;  1E1K A;  3IHG A;  2BRY A;  3AB1 A;  4PAA A;  3T31 A;  3CPI G;  4EM4 A;  4A7A A;  3V3N A;  3AE6 A;  4H4Q A;  1PN0 A;  2ACZ A;  3ISH A;  5LV9 A;  2CUL A;  3GYX A;  1JNR A;  1E1M A;  4KX6 A;  4EMI A;  4JDR A;  3AE9 A;  5U63 A;  4JQ9 A;  4Z2R A;  5HY5 A;  2XLR A;  2BYB A;  3F8P A;  3RED A;  3AED A;  1N1P A;  2X99 A;  4H2N A;  5J60 A;  3NN6 X;  1FEA A;  2WOW A;  5FS8 A;  4H4S A;  1CHU A;  1LVL A;  1PXC A;  3V3O A;  3NYE A;  2GH5 A;  4M52 A;  1EBD A;  2X3N A;  4AP1 A;  3CGE A;  4YSZ A;  1PBC A;  2WDR A;  5BVA A;  3AE8 A;  4B65 A;  1FEB A;  2C65 A;  3AEC A;  3SZC A;  4EQS A;  3P9U A;  3Q9T A;  2DKH A;  1NAA A;  4AOX A;  1GND A;  4U8I A;  2Y6Q A;  1B5Q A;  4B67 A;  4G73 A;  1F8R A;  3UTG A;  3AE1 A;  3K7T A;  3SQP A;  5BUK A;  3OC4 A;  4G6G A;  4O5U A;  2A87 A;  1GRF A;  3AD9 B;  2UZZ A;  1D4E A;  4PAB A;  4G9K A;  5C3J A;  2X8G A;  1E7P A;  2BXR A;  1FOH A;  4ADW A;  5KMS A;  2RGO A;  3F8D A;  2Q0L A;  1F8W A;  2Q6U A;  1LQT A;  1IJH A;  3PG6 A;  2GB0 A;  4H2P A;  4XXG A;  2C7G A;  2GQW A;  2YR4 A;  1L9E A;  2VOU A;  4JNA A;  2WET A;  3BNU A;  3F8R A;  4NTE A;  3SZW A;  4C5O A;  3BHF A;  1CJ3 A;  4H50 A;  5JRB A;  4XWR A;  2XVE A;  3UKF A;  4EIP A;  1FL2 A;  3I3L A;  1ZP0 A;  1PBF A;  5EBK A;  3T14 A;  4FK1 A;  2XVJ A;  1JRX A;  1LTX R;  2BS3 A;  3D1C A;  3SX6 A;  3BI2 A;  1IUS A;  3BHK A;  2C3C A;  1GTE A;  4GDP A;  3V76 A;  1ZX9 A;  1GEU A;  1MOK A;  1RSG A;  1F3P A;  1DJQ A;  1GRA A;  1H86 A;  2R0C A;  3NLC A;  1VQW A;  1Z6L A;  4K5S A;  2WHD A;  3VRD B;  4A9W A;  4NTC A;  2WS3 A;  2BAC A;  3ALJ A;  1LV0 A;  5C2T A;  2JAE A;  1IUX A;  4G6H A;  1QO8 A;  4J34 A;  1GRH A;  2RGH A;  1O95 A;  4Y4M A;  3IC9 A;  1P2E A;  1IUW A;  3UTH A;  3HYW A;  2WQY A;  4H4Z A;  5IQ1 A;  3ATR A;  3UOY A;  2HQM A;  2YM2 A;  1D5T A;  2BK5 A;  2TMD A;  4GF7 A;  3UKP A;  4YSY A;  4YTN A;  1D7Y A;  4K8D A;  3CNJ A;  4K2X A;  2IVE A;  2AAQ A;  3GMB A;  3SYI A;  1ONF A;  4TM0 A;  3DK9 A;  2GAH B;  3ICS A;  4WCT A;  2CFY A;  2V3A A;  1S2Y A;  3AD7 B;  5HYM A;  5M0Z A;  3ALL A;  5DBJ A;  4BUR A;  2C4C A;  3QSS A;  5KNL A;  4TM3 A;  4A65 A;  2Z5X A;  1YQ4 A;  1D4D A;  2R4J A;  2VZ2 A;  1GRT A;  1ELI A;  1K0L A;  3ABV A;  2BC0 A;  2GR3 A;  3D9X A;  2R0P A;  1ZDL A;  4U8J A;  3UP4 A;  1TDO A;  1E6E A;  4D04 A;  3AE2 A;  5BRT A;  1ZMC A;  1PXA A;  3KU9 A;  4Z25 A;  3T2Y A;  1S3B A;  2EQ7 A;  1LPF A;  2BS2 A;  3B3R A;  2GV8 A;  4H4P A;  2AQJ A;  2JKC A;  1CJC A;  4WX1 A;  3NNE A;  1KSS A;  3K30 A;  1LJ1 A;  2OLN A;  3KPK A;  1YKJ A;  4YSH A;  2EQ9 A;  1M6I A;  3HZL A;  3T37 A;  1IUV A;  4B64 A;  3NH3 X;  1QLB A;  3IWA A;  4CNJ A;  5KMP A;  1TDN A;  4J56 A;  2YLW A;  3AXB A;  3DA1 A;  3IF9 A;  2H88 A;  3CNT A;  3CMM A;  4Z44 A;  4LII A;  1JU2 A;  2C73 A;  1PJ6 A;  1EL9 A;  4CY6 A;  3NGC X;  3NK2 X;  2C67 A;  4X9M A;  1RYI A;  4LA1 A;  3LZX A;  2BCP A;  1CJ4 A;  2V61 A;  3QJ4 A;  3UOX A;  2XFQ A;  1H2I A;  3AE3 A;  3P1W A;  4B69 A;  4DSH A;  4J31 A;  4AP3 A;  3I6D A;  3S5W A;  2BC1 A;  4TM1 A;  3UOV A;  4CY8 A;  2WBA A;  2WP5 A;  2YQU A;  2ZZC A;  1YQ3 A;  5ER0 A;  1M64 A;  4J36 A;  1REO A;  1CJ2 A;  2BK4 A;  3GDP A;  1LQU A;  1VDC A;  3GRT A;  2YG4 A;  4CCQ A;  2YVG A;  4J2W A;  2OA1 A;  3RP7 A;  4E0V A;  3Q6J A;  4USQ A;  1ZKQ A;  1S2Q A;  1CC2 A;  4OPL A;  4U8O A;  1PXB A;  4H2Q A;  2YAU A;  1QJD A;  3G5R A;  1CF3 A;  1GOS A;  5EOW A;  4B68 A;  4RG4 A;  1ZOV A;  3RP6 A;  3M12 A;  4HB9 A;  1ZK7 A;  1KF6 A;  1E1L A;  2CDU A;  1K0I A;  3H8L A;  3GWD A;  3DK4 A;  1F6M A;  4H4Y A;  3SXI A;  3R9U A;  4NWZ A;  2WDQ A;  2ZZB A;  4UDR A;  2YG3 A;  3ZYX A;  1DOC A;  1NEK A;  2XLU A;  1DOB A;  3RP8 A;  2H89 A;  4OVI A;  1EL7 A;  4U8M A;  1Q1W A;  5JCI A;  3H8I A;  4GRT A;  4RSL A;  3P4R A;  2CVJ A;  3NG7 X;  1BWC A;  1TDE A;  3ITJ A;  3BI5 A;  2JBV A;  5KMQ A;  2WES A;  3PVC A;  4YSX A;  4H4V A;  4NNJ A;  3NHO X;  3KKJ A;  1ZMD A;  3NTD A;  4NEV A;  4Y4L A;  3AD8 B;  4AT2 A;  4CRT A;  2GEW A;  4GR1 A;  1B8S A;  1L9D A;  2Q0K A;  4U2T A;  1E39 A;  2NPX A;  4Z26 A;  3JSK A;  4IA5 A;  3IHM A;  3O0H A;  3CNP A;  4IVO B;  5GRT A;  4RG3 A;  4CBQ A;  3VR8 A;  2GR2 A;  2JK6 A;  3C4A A;  1OJA A;  3UKK A;  4FK1 C;  5IQ4 A;  1TYT A;  2WPC A;  1OJD A;  4K5R A;  4FDC B;  4O5Q A;  1UKV G;  1Q1R A;  2B76 A;  5FS7 A;  3GWF A;  1JRZ A;  5KXJ A;  1GTH A;  3ALM A;  4NZH A;  3T2Z A;  2QA2 A;  4H4T A;  4AT0 A;  1GET A;  3UKA A;  3BI4 A;  2GVC A;  1ZY8 A;  3DJJ A;  1W4X A;  3CPJ G;  2ARD A;  4BK3 A;  2YLX A;  2B9Y A;  3C96 A;  3QVP A;  3UOZ A;  5BUL A;  2WP6 A;  1KNR A;  4MJW A;  2XFU A;  1N4U A;  3ICT A;  4H4U A;  2E5V A;  1PBD A;  3CGB A;  3NYF A;  4BV6 A;  4GAV A;  3NK0 X;  2PHH A;  1COY A;  1MO9 A;  1Q9I A;  2JB2 A;  2C3D A;  3DJE A;  2GR1 A;  2XLT A;  2RAB A;  3KVE A;  2R9Z A;  3H4K A;  4J57 A;  3E1T A;  3GYJ A;  2X8H A;  1BKW A;  1PBB A;  2J3N A;  3EAO A;  3P4S A;  4Z43 A;  2XYO A;  1H7X A;  2XFN A;  3CNS A;  1IUU A;  2JB3 A;  2XDO A;  3UKQ A;  1GV4 A;  4EQX A;  3FIM B;  1VG0 A;  2BS4 A;  1MXT A;  4BK2 A;  5M10 A;  2VRM A;  1PBE A;  2GMJ A;  1OJT A;  5J7X A;  1JNZ A;  1AOG A;  1GES A;  3KA7 A;  2GQF A;  5CKU A;  4YTM A;  4JNQ A;  2OAM A;  4U2S A;  3QFA A;  1NHP A;  4FX9 A;  4APN A;  1NG4 A;  3PO7 A;  4N9X A;  5KMR A;  4GDE A;  4ZCD A;  3T2K A;  3WE0 A;  3VRA A;  1PS9 A;  2GAG B;  2X8C A;  3L5O A;  5FMH A;  2W0H A;  1O5W A;  4IA6 A;  3AE7 A;  1Y56 A;  3K7M X;  4EQW A;  3NIX A;  1NHQ A;  2V3B A;  3C4N A;  3G5S A;  2R4E A;  3PS9 A;  4DNA A;  1V59 A;  1Y56 B;  4EM3 A;  3UKH A;  4I58 A;  3SFE A;  2FJA A;  4ECH A;  4H4R A;  3AE4 A;  2GRT A;  3FBS A;  1D7L A;  4G74 A;  4B63 A;  1K0J A;  3CGD A;  1KFY A;  1VG9 A;  4XWZ A;  2YR6 A;  5GSN A;  3SZ0 A;  2F5Z A;  2R46 A;  2GR0 A;  3DGH A;  4KPR A;  3GMC A;  3QSE A;  2C76 A;  2DKI A;  2A8X A;  4B66 A;  5KOW A;  3DJG X;  4IVM B;  1XAN A;  1L0V A;  3KLJ A;  1H83 A;  4U8K A;  1N4W A;  4C74 A;  2VQB A;  1SEZ A;  2XVF A;  5L46 A;  1S7M A;  1BZL A;  1GAL A;  2YR5 A;  2A89 A;  1CBO A;  1KDG A;  4OCG A;  4U8L A;  4EQR A;  2O9Z A;  1NHR A;  5KWF A;  2WP9 A;  2QCU A;  2QAE A;  2VRL A;  4YWO A;  3SM8 A;  1O94 A;  3RNM A;  4H7U A;  4X4J A;  2V60 A;  2GMH A;  3VR9 A;  3SY4 A;  4DSG A;  5JCM A;  2NVK X;  1CL0 A;  5HHF A;  2YG5 A;  2GF3 A;  2BXS A;  3G5Q A;  3QFB A;  4A6N A;  1JOA A;  1P2H A;  1PJ7 A;  3ZDN A;  4CCR A;  3GD4 A;  5FS6 A;  1TDK A;  3HYV A;  1XHC A;  1DXL A;  1OJC A;  2E1M A;  2E4G A;  4YT0 A;  4D03 A;  3DH9 A;  4EMW A;  4OPC A;  4P9S A;  1XDI A;  2C66 A;  2ZBW A;  1PDH A;  2Y6R A;  1GXF A;  5EB4 A;  4ZN0 A;  1N4V A;  1X31 B;  3NN0 X;  3CGC A;  2XFP A;  3VQR A;  2BK3 A;  3CND A;  4C3Y A;  2FJB A;  5JCL A;  1VRQ B;  3AEB A;  3GDN A;  4NEW A;  3FG2 P;  3ADA B;  2X50 A;  3AEF A;  4OPU A;  1TDF A;  3AYJ A;  1OJ9 A;  3NTA A;  2B9X A;  2WEU A;  4K7Z A;  2VQ7 A;  4LU6 A;  4ICY A;  4EMJ A;  3EAN A;  4CNK A;  1F8S A;  1RP0 A;  3DME A;  3NK1 X;  4UP3 A;  1XPQ A;  4IV9 A;  3LB8 A;  3AEA A;  1DJN A;  3II4 A;  5KVI A;  1H84 A;  2YLR A;  4II3 A;  4GUV A;  4K22 A;  2Q7V A;  1NG3 A;  4A79 A;  2FBW A;  3NT6 A;  4Z2U A;  4TLZ A;  4DGK A;  5JCN A;  3URH A;  3GSI A;  3UTE A;  1BGN A;  2YVJ A;  2WDV A;  1JEH A;  2BAB A;  2I0Z A;  3RHA A;  1Y0P A;  2VVM A;  1B37 A;  1CC6 A;  2B7S A;  2YWL A;  4UDP A;  1TRB A;  2RGJ A;  2WU5 A;  2XVH A;  3FMW A;  3CIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...