4LIIA

Crystal structure of an apoptosis-inducing factor, mitochondrion-associated, 1 (aifm1) from homo sapiens at 1.88 a resolution
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
Knots found
sequence length
487
structure length
474
Chain Sequence
QDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an apoptosis-inducing factor, mitochondrion-associated, 1 (AIFM1) from Homo sapiens at 1.88 A resolution
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase, apoptosis
molecule keywords Apoptosis-inducing factor 1, mitochondrial
total genus 147
structure length 474
sequence length 487
other databases KnotProt 2.0: S -31
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4liiA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4liiA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4liiA01
2Z5XA 2X8CA 3LOVA 5EB5A 4DSGA 3ATRA 5C3JA 1OJDA 2WOIA 4K5RA 4M52A 3SQPA 1ZDLA 2IVEA 1PBBA 2QCUA 3AYLA 2ZZ0A 4NTDA 3UCLA 2GVCA 4YWOA 3VRAA 1B8SA 3G5SA 3O0HA 3I3LA 2CVJA 2WETA 5BVAA 3QSSA 1S2QA 3AEFA 1ZY8A 3AE4A 4J34A 4H4QA 2R4JA 2XVIA 1LPFA 4IV9A 2DKHA 4BK3A 4FK1A 2C3CA 3CGDA 5EB4A 3LB8A 4BURA 3WE0A 3VRBA 4YKGA 1P2HA 2GAGB 3BI5A 3DJEA 3ITJA 4A5LA 4YTNA 3DJJA 2BC1A 2Q7VA 2YLTA 3NN0X 1UKVG 3P4QA 4XXGA 2E4GA 2R46A 2YWLA 5FS6A 2GF3A 1SEZA 1CHUA 2C7GA 2B7SA 4K8DA 3B6DA 1PXAA 4TM1A 3AE2A 2C65A 2H89A 5FS9A 4Y4NA 1RYIA 1BKWA 3ALJA 1XPQA 2WESA 3DJDA 3CPHG 1GEUA 3M0OA 4A99A 4YTPA 3LXDA 1PBEA 2GMJA 3KVEA 4YSZA 2YG7A 3GD4A 2JAEA 3LZXA 1TRBA 4EMWA 1PS9A 2YM1A 3ATQA 3NK0X 2C70A 2PHHA 4UP3A 3DMEA 2QA1A 3GYIA 2FJEA 1K0JA 1QJDA 5J60A 3IC9A 1CJCA 4ZN0A 1Y56A 1HYUA 3DK4A 2V61A 4B69A 4FDCB 2EQ7A 1LTXR 2AR8A 3NK2X 4Z2RA 2V60A 1NENA 4I58A 1F3PA 1M64A 1BF3A 4DGKA 1VRQB 1ZOVA 3F8DA 3NT6A 4H2PA 2R0GA 4Z25A 3AECA 1XDIA 1XHCA 2YLXA 1O5WA 1D7YA 3AE3A 2EQ6A 3CPJG 3CNTA 5TR3A 2YG4A 4J56A 4UDQA 3KLJA 1QLBA 1EBDA 3S5WA 1M6IA 3GWFA 3FBSA 4KX6A 4OPLA 2C67A 3RP6A 3VRDB 2R0CA 1H86A 3NYCA 4JNAA 1GETA 2YG6A 2A8XA 3CIRA 3K30A 4B1BA 2XLTA 5BRTA 2BK3A 1ZOYA 4H2QA 4ADWA 2A87A 4NZHA 4UDPA 2XLUA 4EQWA 1KSSA 4LA1A 1B4VA 4GCMA 1YQ3A 3UTHA 1H7XA 1LQTA 4GUVA 4ECHA 3BNUA 4TLZA 2YAUA 4FX9A 2V5ZA 4JQ9A 2UZZA 1CJ4A 1TDNA 1N4VA 3UKPA 2BC0A 4N9XA 3NH3X 4YKFA 2PYXA 3QSEA 1IUSA 4X9MA 3GRSA 3AEDA 3GMBA 1Q9IA 5GSNA 1E1KA 3CNJA 3UKQA 1GNDA 1RSGA 1PBCA 3BI2A 5KOXA 2O9ZA 1YKJA 4TM4A 3CGBA 5U25A 2GEWA 4YT0A 2BA9A 5U63A 2VVLA 2WP6A 3QVRA 2R0PA 4H4ZA 2VZ2A 2GR2A 3E1TA 2FJDA 1YY5A 2XLPA 2XCGA 3G5RA 4U8NA 1ZMDA 2OLNA 4JY3A 5IPYA 4A6NB 1KFYA 3VR9A 2FJBA 3P1WA 4CBQA 3EF6A 3CNSA 4WX1A 1MO9A 1K0LA 1NHSA 3ALMA 4A6NA 4GF7A 4RG4A 3QSMA 1E1MA 2OAMA 2YR6A 3AWIA 4H4TA 4OPGA 2WHDA 1E1LA 3NTAA 1GRBA 2E5VA 2QA2A 2OALA 4OPCA 3C4NA 4U8PA 1L9DA 3OC4A 1PJ5A 3RHAA 1XANA 2CFYA 3URHA 3AXBA 4DNAA 1E7PA 1KNRA 2VQBA 3K7QX 1AOGA 1GREA 1E6EA 5BUKA 2GH5A 2XFOA 4BK2A 1O95A 4H4PA 4K2XA 2Q0LA 4EM4A 3AE1A 2AQJA 2YVJA 1DOCA 1OJAA 2BK5A 3EAOA 4C77A 1DODA 2X99A 4D03A 1IUVA 3ALLA 2XVEA 1K4QA 4FK1C 5M0ZA 4B68A 2GRTA 5JCMA 5IQ1A 1CL0A 5KWFA 1PJ6A 4U8KA 3DK9A 3KPFA 4EM3A 3AEGA 2WS3A 4XWRA 2XVJA 3NIXA 4U2TA 4ZCCA 3AE7A 3IWAA 4ICYA 2HQMA 3P4SA 1NEKA 2XFUA 3ZYXA 4NTEA 1W4XA 4OVIA 3UP5A 1X31B 4RSLA 1GRGA 4JDRA 2XFPA 2X50A 2BYBA 2YG3A 4B67A 3NLCA 4A79A 3DGHA 1F6MA 3UKHA 4B65A 4DSHA 1TDEA 4OPUA 2C3DA 1F8SA 3VR8A 2IIDA 4IVOB 3K7TA 3CNPA 1GTEA 2V3AA 5KRQA 2ZZCA 1FCDA 1GALA 2C73A 2BCPA 3GYJA 1S3BA 3DA1A 4EIQA 2RABA 2GQWA 5KVHA 1B5QA 2GR1A 2XDOA 1L9EA 3GDPA 4H4YA 3IF9A 5FS7A 3NRNA 4EQSA 4Z44A 2B9WA 1GESA 1N4WA 3BI4A 3NG7X 4YSXA 3QFBA 3CNDA 4PAAA 2BS4A 5J7XA 2VRLA 1H83A 1ONFA 4H4WA 2J3NA 4BV6A 1KSUA 1IJHA 2BK4A 2GAHB 3QJ4A 2C66A 2WDVA 1GOSA 5KOWA 1H7WA 4XWZA 3UKAA 3BHFA 2WEUA 5L46A 2YLWA 2BXRA 4H4XA 1DJQA 1GERA 1LJ1A 2R45A 2H88A 4IA6A 1MOKA 2C75A 1ZX9A 3P9UA 2JB1A 4ZCDA 4H4RA 3DH9A 2JKCA 3UOXA 3R9UA 4A65A 5JCKA 4AOSA 1QO8A 2WBAA 1K0IA 4H2NA 2WPFA 1L0VA 2B9XA 4EMJA 3ABVA 4JY2A 4OCGA 3NKSA 3AE5A 3Q9TA 1EL5A 3F8RA 4OPTA 1B37A 1IUXA 4J57A 3AE6A 4J36A 1JRXA 4CNKA 2OA1A 1JRZA 1RP0A 4AP1A 5GRTA 1Y0PA 2B7RA 1V59A 2XFQA 4H4VA 3C4AA 5ER0A 1EL8A 2R9ZA 1EL9A 1P2EA 3DK8A 5HXIA 5JCIA 4CNJA 1H6VA 1DNCA 4H4SA 3REDA 1FEAA 2R4EA 1FL2A 2YLSA 3C96A 4H4UA 1GPEA 3NK1X 3LJPA 1F8WA 2WOWA 1KF6A 1ZKQA 1Y56B 4EMIA 3F8PA 3DGZA 4LU6A 3L8KA 3PO7A 1NG3A 2YM2A 4TLXA 1H84A 2XFNA 3D1CA 3UTEA 3NYEA 3V76A 4EQXA 4O5QA 2VVLG 1D4CA 2EQ8A 1VG0A 4Z24A 2Q0KA 2YLZA 3T37A 1NG4A 3PS9A 2VOUA 2NPXA 1NHRA 5M10A 1FEBA 4C3XA 5U1OA 4TM3A 1D5TA 3CN8A 2GR0A 1PBFA 2VQ7A 3CTYA 4A7AA 3GRTA 1DXLA 2Z5YA 1TYTA 5DBJA 2DKIA 1JRYA 2OLOA 2JK6A 1IUTA 3Q6JA 4Z43A 1Q1WA 4K7ZA 1VG9A 4JN9A 2RGOA 5LV9A 3SM8A 3ZDNA 4K5SA 4JNQA 1NDAA 2YVGA 3G5QA 3FG2P 4I59A 4CCRA 1D4EA 2WDRA 3UTGA 3H8LA 3HZLA 1IUUA 2GV8A 1YQ4A 2JB3A 2CULA 2V3BA 3RP7A 3AEEA 3VQRA 3UKFA 5HYMA 5FS8A 3B3RA 4U8LA 4E0VA 1TYPA 2RGJA 5JCLA 3IHMA 1L9CA 5KVIA 2C64A 4NTCA 1GRAA 4OPIA 1FECA 2AAQA 3CGEA 3NTDA 4H50A 1OJCA 1D4DA 1F8RA 4REKA 1GV4A 2YR5A 1CBOA 4AT2A 1S2YA 1CF3A 4GRTA 2A89A 1LQUA 1S3EA 4YTMA 2WPEA 3UOZA 3AEAA 4USQA 1DJNA 2X3NA 1DOEA 1DOBA 3D8XA 2CDUA 2WP5A 4Y4MA 4APNA 4UDRA 4GDEA 4OPDA 1JOAA 5JCNA 4H2RA 4AOXA 4KPRA 3AD9B 4X9NA 4WCTA 1CC6A 5IQ4A 4HA6A 4GDPA 4U2SA 2BS3A 3AD8B 1ZK7A 1OJTA 1GRTA 1E1NA 3V3NA 2B76A 2Y6RA 4C3YA 3NN6X 1PXBA 1LVLA 2ARDA 2BCGG 2XVHA 2XVFA 3AB1A 3KU9A 3RP8A 2YLRA 2WP9A 1VQWA 3NYFA 3P4RA 4U8IA 3DJGX 1BWCA 4A9WA 2WU2A 2APGA 4B66A 3H4KA 1YQZA 2IVDA 2XYOA 2WOVA 1BGJA 1IUWA 3UP4A 2E1MA 1EL7A 1VDCA 3LZWA 1FOHA 3CPIG 2VVMA 4Y4LA 4NEWA 1ZP0A 3KA7A 4Z26A 1JEHA 5CQFA 4LIIA 4YSYA 3KKJA 2YR4A 3AYJA 3ISHA 2VRMA 2NVKX 1REOA 1NPXA 1LV0A 1GTHA 3BNMA 2X8HA 3UOYA 4YSHA 2ZZBA 3QFAA 2FBWA 1CJ3A 2FJAA 2GB0A 4MJWA 2TMDA 4H7UA 4U2LA 4CCQA 5C2TA 2YVFA 4CY8A 2B9YA 4O5UA 3I6DA 3BHKA 2YQUA 3EPTA 1TDOA 4C5OA 4EQRA 1Z6LA 3QVPA 2XLRA 1N4UA 1OJ9A 3FPZA 4J2WA 3ICRA 1BZLA 3II4A 1NAAA 2ACZA 3CGCA 3FIMB 1GSNA 4HB9A 1CJ2A 2X8GA 2F5ZA 1E39A 2XLSA 3H8IA 2JBVA 1CC4A 1KNPA 1PBDA 1PDHA 3AE8A 4U8MA 1CC2A 1H82A 5BULA 1GRHA 5FMHA 1PJ7A 1PN0A 3UKLA 4BJZA 2C72A 4Z2UA 3SFEA 4BJYA 3M13A 3UOVA 4CY6A 2GQFA 3ICTA 2Q6UA 4AT0A 3COXA 2BS2A 3GSIA 2EQ9A 4D04A 3NGCX 3NNEA 3L1RA 1NHQA 4GR1A 2QAEA 1TDKA 3AEBA 2W0HA 3OZ2A 1ZMCA 4J31A 5HY5A 1D7LA 4IA5A 4K22A 1BGNA 2V6OA 4U8OA 3GD3A 2TPRA 3S61A 1COYA 3EANA 1TDFA 3UTFA 3K7MX 3PVCA 3AD7B 3ICSA 4P9SA 4B63A 4RG3A 4BK1A 5CKUA 5EOWA 2Y6QA 3IHGA 1PHHA 4J33A 3RNMA 3ADAB 3GMCA 3KD9A 1GT8A 1JU2A 4Z2TA 2ZBWA 3JSKA 2WDQA 5HHFA 3LADA 1JNZA 1H81A 1N1PA 2BACA 5EBKA 2YG5A 4U8JA 4USRA 2GR3A 1PXCA 4X4JA 4CRTA 2WPCA 1ELIA 4YXDA 2WQYA 2RGHA 2JB2A 2I0ZA 3UKKA 3M12A 4PABA 1Q1RA 4TM0A 1GRFA 4B64A 4NEVA 1KDGA 3GWDA 1GXFA 4EIPA 4AP3A 1JNRA 2GMHA 1MXTA 3AYIA 3FMWA 3GDNA 4IVMB 3SFDA 2C76A 2BABA 4C74A 3AE9A 1O94A 2WU5A 3NHOX 3SGLA 1NHPA 3P4PA 3V3OA 5KXJA 2BXSA
chains in the Genus database with same CATH superfamily
4DSGA 4HNCA 3SQPA 2QCUA 4DX3A 4G9KA 4X4JA 1F9CA 3DJEA 5FJUA 3DJJA 2Q7VA 3CMMA 1UKVG 2E4GA 2R46A 3NXLA 1SEZA 1EBHA 2C7GA 4DN1A 3ENLA 2C65A 2E5AA 4JN8A 3V4BA 3AN1A 1XPQA 4E5TA 3MY9A 3Q45A 3TOYA 4YTPA 1PBEA 3PG6A 3UJFA 1SB3B 3LZXA 2YM1A 2NQLA 1FHUA 2PHHA 1K0JA 1QJDA 4H2HA 5J60A 3IC9A 1HYUA 3DK4A 3IK4A 2V61A 5KMSA 1LTXR 4Z2RA 1F3PA 1BF3A 4DGKA 1VRQB 1ZOVA 4E8GA 1D7YA 5TR3A 4UDQA 3KLJA 1EBDA 3VFCA 3GWFA 4GGBA 3VRDB 4JNAA 2YG6A 1ZOYA 3CXOA 3OZYA 3R11A 4K8GA 1KD0A 3QKEA 4NZHA 3UJEA 3NO1A 3BNUA 2HXTA 3UKPA 2BC0A 2POZA 1IUSA 3GRSA 3AEDA 3GMBA 3CNJA 1PBCA 3BI2A 5KOXA 1YKJA 3CGBA 2GEWA 4YT0A 5U63A 5J04A 2FJDA 2OLNA 2CHRA 3NVYB 3P1WA 3HPFA 3KUMA 3CNSA 4WX1A 2E3TA 1K0LA 4A6NA 1FIQB 2OQHA 4GF7A 4RG4A 1E1MA 4HNLA 4F4RA 2QA2A 4OPCA 3C4NA 1L9DA 3RHAA 3AXBA 4DNAA 3K7QX 1AOGA 2XFOA 4K2XA 2AQJA 1OJAA 3EAOA 1K4QA 1EC9A 1CL0A 1PJ6A 3DK9A 3KPFA 2WS3A 1FHVA 2QJNA 3AE7A 1SJCA 3Q4DA 2XFUA 1N63C 2GGHA 4OVIA 4RSLA 4B67A 4A79A 3UKHA 4OPUA 3VR8A 4DWDA 3K7TA 1GALA 2BCPA 3GYJA 2PU0A 2XDOA 4EQSA 4Z44A 2PSNA 3SZFA 3CNDA 5G5GB 3ES7A 2W3RA 2ZADA 2P8BA 1ECQA 2WEUA 2BXRA 1LJ1A 2H88A 4IA6A 1MOKA 4IL0A 2JKCA 3UOXA 3R9UA 4A65A 2P0IA 1QO8A 2PGWA 3AE5A 4E4UA 3FXGA 4G7FA 1JRXA 4YWSA 1JRZA 2P3ZA 1RP0A 2B7RA 2R9ZA 1EL9A 1P2EA 1VDVA 1FL2A 4H4UA 1F8WA 4Z17A 1ZKQA 3F8PA 4ZA0A 3SZ0A 3UTEA 3T2KA 2VVLG 2PMQA 1VG0A 2Q0KA 4H1ZA 5M10A 4HYRA 1JCTA 4C3XA 2PPGA 2GR0A 4HN8A 2DKIA 4Z43A 4K7ZA 3B97A 2GGGA 2YVGA 4I59A 2P8CA 2PU1A 2OLAA 5FS8A 4U8LA 4J1OA 4IHCA 3OW1A 5BOEA 1OJCA 1D4DA 1F8RA 4REKA 4GRTA 4IT1A 1LQUA 3UOZA 2WPEA 1DOEA 1DOBA 4M6UA 3R0KA 4Y4MA 3N6HA 1JOAA 4GDPA 2BS3A 3AD8B 1LVLA 3AB1A 2WP9A 1VQWA 3NYFA 2APGA 3NVVB 3BSMA 1YQZA 2XYOA 2WOVA 1IUWA 3UP4A 1EL7A 3CPIG 2VVMA 4NEWA 5CQFA 3PWGA 1BQGA 1REOA 1JRPA 3QFAA 4MJWA 2TMDA 4H7UA 5C2TA 2YVFA 1KCZA 4O5UA 3I6DA 3EPTA 3QVPA 2AL1A 1N4UA 2PA6A 2PGEA 3CGCA 3UCDA 1V97A 2F5ZA 1X2GA 2I5QA 3AE8A 1GRHA 5FMHA 2XH7A 4GYPC 3R1ZA 4Z2UA 3GSIA 3NGCX 3L1RA 2PODA 5HY5A 3EUB3 1ZMCA 1D7LA 1COYA 4B63A 4RG3A 4FI4A 5CKUA 5EOWA 4J33A 3KD9A 4H19A 4H83A 3JSKA 3K1GA 1EC7A 4U8JA 1XS2A 1PXCA 4YXDA 1ELIA 2JB2A 4HCLA 3UKKA 4PABA 4NEVA 1SJBA 1KDGA 1N60C 2PP1A 3AE9A 2WU5A 3P4PA 3V3OA 3LOVA 1E9IA 2WOIA 4M52A 2IVEA 4NTDA 3G5SA 3O0HA 2WETA 3SZWA 4TVYA 3AEFA 2AKMA 4FK1A 2C3CA 3CGDA 2PP0A 4IP4A 1P2HA 2GAGB 3BI5A 3ITJA 2YLTA 5FS6A 4TM1A 4Y4NA 2H89A 5FS9A 1BKWA 3ALJA 3DJDA 1P48A 4X2PA 3RR1A 4A99A 3LXDA 3NS1B 3IJQA 2GMJA 1H2IA 4YSZA 2YG7A 2JAEA 1EBGA 2C70A 3GYIA 1CJCA 1Y56A 2EQ7A 1M64A 4H2PA 2R0GA 3AECA 5FJTA 2EQ6A 3CPJG 4GAVA 5KMQA 1QLBA 3PK7A 4KX6A 2C67A 2R0CA 1GETA 2QDDA 2XLUA 4EQWA 1B4VA 4GCMA 3UTHA 1LQTA 4GFIA 2YAUA 4IP5A 4JQ9A 1N4VA 3NH3X 3DG7A 3GO2A 3H8AA 3TQPA 3UJSA 2ZC8A 1FO4A 2OZ3A 3QVRA 2WP6A 2R0PA 2GGEA 2VZ2A 3E1TA 3G5RA 1YY5A 2XGZA 4JY3A 5IPYA 1WYGA 1KFYA 4ZCWA 3FJ4A 4CBQA 3EF6A 1MO9A 3OP2A 4G8TA 2OAMA 3EEZA 2PTYA 1PDYA 4U8PA 1PJ5A 1XANA 3URHA 3ZLGA 3TJIA 4ZOHB 1GREA 4Z1YA 5KMPA 4KPLA 1O95A 5ENLA 3AE1A 1W6TA 2BK5A 4D03A 2X99A 1IUVA 4FK1C 2XVEA 4B68A 3P3BA 5JCMA 5IQ1A 3AEGA 4XWRA 3FCPA 4ZCCA 3IWAA 4ICYA 3P4SA 3ZYXA 1W4XA 3UP5A 2MUCA 2X50A 4DSHA 5KRQA 1S3BA 2RABA 3CAWA 4K2SA 5KVHA 5FS7A 3NRNA 1N61C 1GESA 2XH0A 3NG7X 2BS4A 5J7XA 2VRLA 1ONFA 1KSUA 3QJ4A 1JPDX 2C66A 3SXIA 2WDVA 3VC6A 3ZLFA 5KOWA 4H4XA 1DJQA 1GERA 4A6GA 2R45A 1ZX9A 3P9UA 2JB1A 3SX6A 3BOXA 2B9XA 3Q9TA 1EL5A 3F8RA 1IUXA 1JROA 5KMRA 3VA8A 4J36A 4CNKA 2OA1A 1Y0PA 3UCLA 5ER0A 4MMWA 1FEAA 3TWBA 1GPEA 3NK1X 1KF6A 3CK5A 4EMIA 3DGZA 3PO7A 4TLXA 2XFNA 2OQYA 2YLZA 1NG4A 2NPXA 1RM6B 5U1OA 1D5TA 3EKGA 3QPEA 2VQ7A 3CTYA 1TYTA 5DBJA 1IUTA 3Q6JA 4JN9A 3A7RA 4K5SA 4JNQA 1NDAA 2WDRA 3T0KA 3KPKA 3H8LA 3HZLA 2GV8A 1YQ4A 1SJDA 5HYMA 3B3RA 1TYPA 3IHMA 5KVIA 3VCNA 4NTCA 4E6MA 3NRZB 1CBOA 2PS2A 2PCEA 1DJNA 2CDUA 2WP5A 2AL2A 4UDRA 3HW2A 5JCNA 4H2RA 3GC2A 3H70A 4AOXA 3AD9B 4WCTA 2W54A 4U2SA 4G73A 5FJRA 1E1NA 2B76A 2Y6RA 2ARDA 2XVHA 2BRAA 2PTZA 4U8IA 4A9WA 4B66A 3UXLA 1T3QC 2OZTA 2OX4A 4GGHA 2E1MA 3V5CA 3LZWA 3SY4A 1FOHA 4A35A 1ZP0A 4Z26A 3SR6B 3AYJA 1NU5A 1NPXA 1LV0A 3TJ4A 2FJAA 4U2LA 4CY8A 1MNSA 1Z6LA 1OJ9A 3FPZA 4J2WA 1BZLA 2ACZA 1NELA 1CJ2A 1E39A 2JBVA 1KNPA 4U8MA 1CC2A 5BULA 2DW7A 2C72A 3M13A 3IJLA 4CY6A 2GQFA 3ICTA 2Q6UA 2OG9A 3COXA 1TZZA 2BS2A 2W3SA 2OPJA 2QJJA 2PTXA 3AEBA 3OZ2A 4II2A 4IA5A 1BGNA 1TDFA 3ICSA 3IHGA 1PHHA 4Z2TA 5G5HB 2YG5A 2WPCA 1ELSA 2I0ZA 3A7AA 1Q1RA 4TM0A 2OKTA 2HZGA 4IVMB 3SFDA 3CYJA 2BABA 3SGLA 1NHPA 5KXJA 2BXSA 3NZGA 2Z5XA 3GYXA 5C3JA 3ATRA 1OJDA 4K5RA 1ZDLA 1PBBA 2GGJA 3I4KA 3VRAA 3A7UA 4YWOA 2GVCA 3NVZB 3I3LA 2CVJA 1N5WC 1ZY8A 3AE4A 1LPFA 2DKHA 3AMZA 3SYIA 4BURA 3VRBA 4YKGA 4A5LA 3NN0X 4KEMA 4XXGA 3ES8A 2GF3A 1CHUA 3B6DA 4K8DA 3AM9A 3SN0A 2WESA 3CPHG 3JVAA 3QTPA 3GD6A 1TRBA 1PS9A 3ATQA 3QLDA 3DMEA 4ZN0A 4I58A 3F8DA 3SQSA 4Z25A 1XDIA 1XHCA 2YLXA 3CNTA 3S5WA 3FBSA 4OPLA 3RP6A 3NYCA 2A8XA 4B1BA 5BRTA 4ADWA 3UCCA 4UDPA 1KSSA 2OO6A 3SSZA 1H7XA 4ECHA 4TLZA 4FX9A 2V5ZA 3OZMA 4DHGA 1CJ4A 1TDNA 4N9XA 1STZA 2PYXA 4E4FA 3QSEA 2DW6A 3UKQA 1E1KA 3R25A 4TM4A 2BA9A 2VVLA 3V3WA 2GR2A 2XLPA 3IJIA 2XCGA 4GYPA 4A6NB 4GAPA 3VR9A 3ALMA 1NHSA 2OFJA 3QSMA 4OPGA 4H4TA 2WHDA 1E1LA 3CXBA 1GRBA 5FJOA 1MUCA 4M0XA 2CFYA 3QN3A 1E7PA 2VQBA 5BUKA 2GH5A 3MKCA 4BK2A 4H4PA 2Q0LA 4EM4A 4C77A 1DODA 5M0ZA 2GRTA 4HCDA 4U8KA 3VC5A 4EM3A 2XVJA 1KKOA 3NLCA 1F6MA 1TDEA 2C3DA 3DG6A 3D47A 3CNPA 2ZZCA 1FCDA 2C73A 3DA1A 2PTWA 2GQWA 1B5QA 2GR1A 3IF9A 2QJMA 2B9WA 3DGBA 2XSXA 1H83A 4H4WA 2J3NA 4BV6A 3RO6A 1GOSA 3BHFA 2YLWA 3VDGA 2C75A 3FV9A 4ZCDA 3DERA 4H4RA 3U9IA 3T8QA 2WBAA 1K0IA 4H2NA 2WPFA 1IYXA 4EMJA 3ABVA 4JY2A 4OCGA 3NKSA 4OPTA 4J57A 3AE6A 4AP1A 5GRTA 2XFQA 1V59A 3C4AA 4H4VA 5HXIA 3DFHA 1EL8A 4A3RA 3DK8A 3UGVA 1H6VA 4CNJA 1DNCA 3C96A 4ROPA 2WOWA 3STPA 1Y56B 3L8KA 2YM2A 1H84A 3D1CA 3V76A 3NYEA 4EQXA 2AL2B 2EQ8A 3T37A 3PS9A 1ZXIC 3R07C 3UXKA 2VOUA 1FEBA 2OVLA 3TWAA 1MDRA 4MGGA 3GRTA 1DXLA 2Z5YA 1JRYA 2OLOA 4II3A 4HPNA 2RGOA 3ZDNA 3CT2A 3SBFA 3P0WA 3UTGA 2JB3A 2V3BA 3RP7A 2CULA 1JDFA 3AEEA 3VQRA 5JCLA 1L9CA 3HRDC 2C64A 4OPIA 1FECA 2AAQA 3CGEA 3T14A 3NTDA 3DEQA 2YR5A 1CF3A 3D8XA 3PWIA 4GDEA 4OPDA 2FKPA 5IQ4A 2HXUA 4JHMA 1OJTA 1GRTA 1SJAA 1X2HA 2BCGG 2XVFA 3T2ZA 2YLRA 4JN7A 3P4RA 3DJGX 1BWCA 2IVDA 3H7VA 4HCHA 3R10A 4Y4LA 4KT2A 4LIIA 4YSYA 2NVKX 2X8HA 3UOYA 4YSHA 2ZZBA 2FBWA 4CCQA 1CJ3A 2GSHA 2B9YA 2YQUA 3T2YA 3ICRA 1NAAA 3HYVA 3FIMB 4HB9A 2XLSA 3NFUA 1CC4A 2PP3A 4BJZA 3SFEA 1WUFA 3MZNA 2EQ9A 2HNEA 3T9PA 4J31A 2W0HA 1EC8A 4K22A 3S61A 4FP1A 3UTFA 3AD7B 4BK1A 3D46A 3ADAB 3GMCA 1P43A 3BJSA 1GT8A 1JU2A 2ZBWA 3ZLHA 7ENLA 3N4EA 5HHFA 3LADA 1JNZA 1H81A 1N1PA 5EBKA 4USRA 2GR3A 4J3ZA 2RGHA 3TCSA 4B64A 3DDMA 3GWDA 4EIPA 1JNRA 3ZVHA 3AYIA 3FMWA 2C76A 1BKHA 2X8CA 5EB5A 1MDLA 3T6CA 3DESA 3AYLA 2ZZ0A 1B8SA 1ONEA 3MUCA 5BVAA 4MKSA 3QSSA 1S2QA 4J34A 4IV9A 4H4QA 2R4JA 2XVIA 4BK3A 5EB4A 3LB8A 3WE0A 2P88A 4YTNA 2BC1A 3P4QA 2YWLA 2AKZA 3VCCA 2B7SA 1PXAA 3AE2A 1RYIA 2O56A 3NVWB 1GEUA 3OPSA 3M0OA 3UJRA 3N4FA 3KVEA 3GD4A 3P93A 4EMWA 3NK0X 3SN4A 4UP3A 3RGTA 1FFVC 2QA1A 4ENLA 2FJEA 1R6WA 1N5XA 4B69A 4FDCB 2AR8A 3NK2X 2V60A 3ZVIA 1NENA 3NT6A 3AE3A 1O5WA 2YG4A 4J56A 1M6IA 3ETRB 1H86A 3CIRA 3K30A 2XLTA 2BK3A 4H2QA 3L5OA 2GL5A 2A87A 1RVKA 3RITA 3SZCA 4LA1A 1YQ3A 4GUVA 5JRBA 3DFYA 2UZZA 3H12A 4YKFA 4X9MA 1Q9IA 5GSNA 1R0MA 5IDZA 1GNDA 1RSGA 2O9ZA 5U25A 3MWCA 4H4ZA 3HYXA 1JPMA 4U8NA 3I6EA 1ZMDA 2FJBA 3MSYA 3UJ2A 4IL2A 5BOFA 3AWIA 2YR6A 3NTAA 2E5VA 2OALA 3OC4A 3TTEA 3D9XA 1KNRA 3JW7A 2GGIA 1E6EA 2YVJA 1DOCA 3ALLA 5KWFA 1FFUC 2ONEA 3NIXA 4NNJA 4U2TA 2HQMA 2GDQA 1NEKA 4NTEA 1X31B 1GRGA 4JDRA 2XFPA 2YG3A 2BYBA 3SN1A 3DGHA 4B65A 1F8SA 2IIDA 4IVOB 1GTEA 2V3AA 4EIQA 1VQZA 4TVWA 1L9EA 3GDPA 4H4YA 3GY1A 1N4WA 3BI4A 2C4CA 4YSXA 3QFBA 3TW9A 4PAAA 4G74A 3HYWA 1IJHA 2BK4A 2GAHB 3MQTA 2RDXA 4DYEA 1H7WA 3V5FA 4G6GA 4XWZA 3UKAA 5L46A 5KNLA 3I6TA 2QQ6A 3DH9A 4AOSA 5JCKA 5EU9A 1L0VA 1L8PA 1B37A 4NWZA 1MRAA 3U4FA 5JCIA 4H4SA 3REDA 1OEPA 2R4EA 2YLSA 1TE6A 3LJPA 4LU6A 1NG3A 4O5QA 2QDEA 1N62C 1D4CA 3N6JA 4Z24A 1YEYA 1NHRA 4K1WA 3THUA 3DG3A 5FJPA 4TM3A 3CN8A 3FVDA 3S47A 1PBFA 4A7AA 2JK6A 1Q1WA 1VG9A 5LV9A 3SM8A 1DTNA 3G5QA 3FG2P 4CCRA 1D4EA 1IUUA 3UKFA 2BRYA 4E0VA 2RGJA 1GRAA 3S5SA 3ZVHB 4H50A 1GV4A 4GISA 4AT2A 1S2YA 2A89A 1S3EA 4YTMA 3AEAA 4USQA 2X3NA 2QVHA 4APNA 4KPRA 4X9NA 1CC6A 4HA6A 1ZK7A 3V3NA 4C3YA 3NN6X 1PXBA 3RP8A 3KU9A 6ENLA 3RCYA 2WU2A 3DIPA 3H4KA 1BGJA 1VDCA 2XH4A 4GIRA 3B9JB 3KA7A 1JEHA 2MNRA 3KKJA 2YR4A 3ISHA 1S7MA 3JZUA 2VRMA 3SJNA 1TKKA 2QGYA 1GTHA 3BNMA 3T31A 3R0UA 2GB0A 3FYYA 1WUEA 3BHKA 1TDOA 1KKRA 4C5OA 4EQRA 2XLRA 2XH2A 3II4A 3CB3A 2W55A 1GSNA 2X8GA 3H8IA 1XPYA 1PBDA 1PDHA 1H82A 1PJ7A 3RRAA 1PN0A 3UKLA 4BJYA 3UOVA 1PDZA 2FYMA 4AT0A 4IZGA 3NNEA 4D04A 1NHQA 4GR1A 2QAEA 4GMEA 1TDKA 3OTRA 4EWJA 3PFRA 2V6OA 4U8OA 3GD3A 2TPRA 4KWSA 3EANA 3K7MX 3PVCA 4P9SA 2Y6QA 3RNMA 2WDQA 1KN0A 2BACA 4CRTA 2WQYA 4DXKA 3M12A 4G6HA 1GRFA 3T4WA 1GXFA 2OZ8A 4AP3A 2GMHA 1MXTA 3GDNA 4C74A 1O94A 3NHOX
chains in the Genus database with same CATH topology
2Z5XA 2X8CA 3GYXA 3LOVA 5EB5A 3ATRA 4DSGA 5C3JA 1OJDA 2WOIA 4K5RA 4M52A 3SQPA 1ZDLA 2IVEA 1PBBA 2QCUA 3AYLA 2ZZ0A 4NTDA 3UCLA 2GVCA 4YWOA 3VRAA 1B8SA 3G5SA 3O0HA 3I3LA 2CVJA 2WETA 3SZWA 5BVAA 4G9KA 3QSSA 1S2QA 3AEFA 1ZY8A 3AE4A 4J34A 4H4QA 2R4JA 2XVIA 1LPFA 4IV9A 2DKHA 4BK3A 4FK1A 2C3CA 3SYIA 3CGDA 5EB4A 3LB8A 4BURA 3WE0A 3VRBA 4YKGA 1P2HA 2GAGB 3BI5A 3DJEA 3ITJA 4A5LA 4YTNA 3DJJA 2BC1A 2Q7VA 2YLTA 3CMMA 3NN0X 1UKVG 3P4QA 4XXGA 2E4GA 2R46A 2YWLA 5FS6A 2GF3A 1SEZA 1CHUA 2C7GA 2B7SA 4K8DA 3B6DA 1PXAA 4TM1A 3AE2A 2C65A 2H89A 5FS9A 4Y4NA 1RYIA 1BKWA 3ALJA 1XPQA 2WESA 3DJDA 3CPHG 1GEUA 3M0OA 4A99A 4YTPA 3LXDA 1PBEA 2GMJA 3PG6A 3KVEA 1H2IA 4YSZA 2YG7A 3GD4A 2JAEA 3LZXA 1TRBA 4EMWA 1PS9A 2YM1A 3ATQA 3NK0X 2C70A 2PHHA 4UP3A 3DMEA 2QA1A 3GYIA 2FJEA 1K0JA 1QJDA 5J60A 3IC9A 1CJCA 4ZN0A 1Y56A 1HYUA 3DK4A 2V61A 4B69A 5KMSA 4FDCB 2EQ7A 1LTXR 2AR8A 3NK2X 4Z2RA 2V60A 1NENA 4I58A 1F3PA 1M64A 1BF3A 4DGKA 1VRQB 1ZOVA 3F8DA 3NT6A 4H2PA 2R0GA 4Z25A 3AECA 1XDIA 1XHCA 2YLXA 1O5WA 1D7YA 3AE3A 2EQ6A 3CPJG 3CNTA 5TR3A 2YG4A 4J56A 4UDQA 3KLJA 4GAVA 5KMQA 1QLBA 1EBDA 3S5WA 1M6IA 3GWFA 3FBSA 4KX6A 4OPLA 2C67A 3RP6A 3VRDB 2R0CA 1H86A 3NYCA 4JNAA 1GETA 2YG6A 2A8XA 3CIRA 3K30A 4B1BA 2XLTA 5BRTA 2BK3A 1ZOYA 3L5OA 4H2QA 4ADWA 2A87A 4NZHA 3SZCA 4UDPA 2XLUA 4EQWA 1KSSA 4LA1A 1B4VA 4GCMA 1YQ3A 3UTHA 1H7XA 1LQTA 4GUVA 4ECHA 3BNUA 5JRBA 4TLZA 2YAUA 4FX9A 2V5ZA 4JQ9A 2UZZA 1CJ4A 1TDNA 1N4VA 3UKPA 2BC0A 4N9XA 3NH3X 4YKFA 2PYXA 3QSEA 1IUSA 4X9MA 3GRSA 3AEDA 3GMBA 1Q9IA 5GSNA 1E1KA 3CNJA 3UKQA 1GNDA 1RSGA 1PBCA 3BI2A 5KOXA 2O9ZA 1YKJA 4TM4A 3CGBA 5U25A 2GEWA 4YT0A 2BA9A 5U63A 2VVLA 2WP6A 3QVRA 2R0PA 4H4ZA 3HYXA 2VZ2A 2GR2A 3E1TA 2FJDA 1YY5A 2XLPA 2XCGA 3G5RA 4U8NA 1ZMDA 2OLNA 4JY3A 5IPYA 4A6NB 1KFYA 4GAPA 2FJBA 3VR9A 3P1WA 4CBQA 3EF6A 3CNSA 4WX1A 1MO9A 1K0LA 1NHSA 3ALMA 4A6NA 4GF7A 4RG4A 3QSMA 1E1MA 2OAMA 2YR6A 3AWIA 4H4TA 4OPGA 2WHDA 1E1LA 3NTAA 1GRBA 2E5VA 2QA2A 2OALA 4OPCA 3C4NA 4U8PA 1L9DA 3OC4A 1PJ5A 3RHAA 1XANA 2CFYA 3URHA 3AXBA 3D9XA 4DNAA 1E7PA 1KNRA 2VQBA 3K7QX 1AOGA 1GREA 1E6EA 5BUKA 5KMPA 2GH5A 2XFOA 4BK2A 1O95A 4H4PA 4K2XA 2Q0LA 4EM4A 3AE1A 2AQJA 2YVJA 1DOCA 1OJAA 2BK5A 3EAOA 4C77A 1DODA 2X99A 4D03A 1IUVA 3ALLA 2XVEA 1K4QA 4FK1C 5M0ZA 4B68A 2GRTA 5JCMA 5IQ1A 1CL0A 5KWFA 1PJ6A 4U8KA 3DK9A 3KPFA 4EM3A 3AEGA 2WS3A 4XWRA 2XVJA 3NIXA 4NNJA 4U2TA 4ZCCA 3AE7A 3IWAA 4ICYA 2HQMA 3P4SA 1NEKA 2XFUA 3ZYXA 4NTEA 1W4XA 4OVIA 3UP5A 1X31B 4RSLA 1GRGA 4JDRA 2XFPA 2X50A 2BYBA 2YG3A 4B67A 3NLCA 4A79A 3DGHA 1F6MA 3UKHA 4B65A 4DSHA 1TDEA 4OPUA 2C3DA 1F8SA 3VR8A 2IIDA 4IVOB 3K7TA 3CNPA 1GTEA 2V3AA 5KRQA 2ZZCA 1FCDA 1GALA 2C73A 2BCPA 3GYJA 1S3BA 3DA1A 4EIQA 2RABA 2GQWA 5KVHA 1B5QA 2GR1A 2XDOA 1L9EA 3GDPA 4H4YA 3IF9A 5FS7A 3NRNA 4EQSA 4Z44A 2B9WA 1GESA 1N4WA 3BI4A 2C4CA 3NG7X 3SZFA 4YSXA 3QFBA 3CNDA 4PAAA 2BS4A 5J7XA 2VRLA 1H83A 4G74A 1ONFA 4H4WA 3HYWA 2J3NA 4BV6A 1KSUA 1IJHA 2BK4A 2GAHB 3QJ4A 2C66A 3SXIA 2WDVA 1GOSA 5KOWA 1H7WA 4G6GA 4XWZA 3BHFA 2WEUA 3UKAA 2YLWA 5L46A 2BXRA 4H4XA 1DJQA 1GERA 1LJ1A 2R45A 2H88A 4IA6A 1MOKA 5KNLA 2C75A 1ZX9A 3P9UA 2JB1A 3SX6A 4ZCDA 4H4RA 3DH9A 2JKCA 3UOXA 3R9UA 4A65A 5JCKA 4AOSA 1QO8A 2WBAA 1K0IA 4H2NA 2WPFA 1L0VA 2B9XA 4EMJA 3ABVA 4JY2A 4OCGA 3NKSA 3AE5A 3Q9TA 1EL5A 3F8RA 4OPTA 4NWZA 1B37A 1IUXA 4J57A 3AE6A 5KMRA 4J36A 1JRXA 4CNKA 2OA1A 1JRZA 1RP0A 4AP1A 5GRTA 1Y0PA 2B7RA 1V59A 2XFQA 4H4VA 3C4AA 5ER0A 1EL8A 2R9ZA 1EL9A 1P2EA 3DK8A 5HXIA 5JCIA 4CNJA 1H6VA 1DNCA 4H4SA 3REDA 1FEAA 2R4EA 1FL2A 2YLSA 3C96A 4H4UA 1GPEA 3NK1X 3LJPA 1F8WA 2WOWA 1KF6A 1ZKQA 1Y56B 4EMIA 3F8PA 3DGZA 4LU6A 3L8KA 3PO7A 1NG3A 2YM2A 4TLXA 1H84A 2XFNA 3D1CA 3SZ0A 3NYEA 3UTEA 3V76A 3T2KA 4EQXA 4O5QA 2VVLG 1D4CA 2EQ8A 1VG0A 4Z24A 2Q0KA 2YLZA 3T37A 1NG4A 3PS9A 2VOUA 2NPXA 1NHRA 5M10A 1FEBA 4C3XA 5U1OA 4TM3A 1D5TA 3CN8A 2GR0A 1PBFA 2VQ7A 3CTYA 4A7AA 3GRTA 1DXLA 2Z5YA 1TYTA 5DBJA 2DKIA 1JRYA 2OLOA 2JK6A 4II3A 1IUTA 3Q6JA 4Z43A 1Q1WA 4K7ZA 1VG9A 4JN9A 2RGOA 5LV9A 3SM8A 3ZDNA 4K5SA 4JNQA 1NDAA 2YVGA 3G5QA 3FG2P 4I59A 4CCRA 1D4EA 2WDRA 3T0KA 3KPKA 3H8LA 3UTGA 3HZLA 1IUUA 2GV8A 2V3BA 1YQ4A 2CULA 2JB3A 3RP7A 3AEEA 3VQRA 3UKFA 5HYMA 5FS8A 2BRYA 3B3RA 4U8LA 1TYPA 2RGJA 4E0VA 5JCLA 3IHMA 1L9CA 5KVIA 2C64A 4NTCA 1GRAA 4OPIA 1FECA 2AAQA 3CGEA 3NTDA 3T14A 4H50A 1OJCA 1D4DA 1F8RA 4REKA 1GV4A 2YR5A 1CBOA 4AT2A 1S2YA 1CF3A 4GRTA 2A89A 1LQUA 1S3EA 4YTMA 2WPEA 3UOZA 3AEAA 4USQA 1DJNA 2X3NA 1DOEA 1DOBA 3D8XA 2CDUA 2WP5A 4Y4MA 4APNA 4UDRA 4GDEA 4OPDA 1JOAA 5JCNA 4H2RA 4AOXA 4KPRA 3AD9B 4X9NA 4WCTA 1CC6A 5IQ4A 4HA6A 4GDPA 4U2SA 2BS3A 3AD8B 4G73A 1ZK7A 1OJTA 1GRTA 1E1NA 3V3NA 2B76A 2Y6RA 4C3YA 3NN6X 1PXBA 1LVLA 2ARDA 2BCGG 2XVHA 2XVFA 3AB1A 3KU9A 3RP8A 2YLRA 2WP9A 1VQWA 2BRAA 3NYFA 3P4RA 4U8IA 3DJGX 1BWCA 4A9WA 2WU2A 2APGA 4B66A 3H4KA 1YQZA 2IVDA 2XYOA 2WOVA 1BGJA 1IUWA 3UP4A 2E1MA 1EL7A 1VDCA 3LZWA 3SY4A 1FOHA 3CPIG 2VVMA 4Y4LA 4NEWA 1ZP0A 3KA7A 4Z26A 1JEHA 5CQFA 4LIIA 4YSYA 3KKJA 2YR4A 3AYJA 3ISHA 1S7MA 2VRMA 2NVKX 1REOA 1NPXA 1LV0A 1GTHA 3BNMA 2X8HA 3T31A 3UOYA 4YSHA 2ZZBA 3QFAA 2FBWA 1CJ3A 2FJAA 2GB0A 4MJWA 2TMDA 4H7UA 4U2LA 4CCQA 5C2TA 2YVFA 4CY8A 2B9YA 4O5UA 3I6DA 3BHKA 2YQUA 3EPTA 1TDOA 3T2YA 4C5OA 4EQRA 1Z6LA 3QVPA 2XLRA 1N4UA 1OJ9A 3FPZA 4J2WA 3ICRA 1BZLA 3II4A 1NAAA 2ACZA 3HYVA 3CGCA 3FIMB 1GSNA 4HB9A 1CJ2A 2X8GA 2F5ZA 1E39A 2XLSA 3H8IA 2JBVA 1CC4A 1KNPA 1PBDA 1PDHA 3AE8A 4U8MA 1CC2A 1H82A 5BULA 1GRHA 5FMHA 1PJ7A 1PN0A 3UKLA 4BJZA 2C72A 4Z2UA 3SFEA 4BJYA 3M13A 3UOVA 4CY6A 2GQFA 3ICTA 2Q6UA 4AT0A 3COXA 2BS2A 3GSIA 2EQ9A 4D04A 3NGCX 3NNEA 3L1RA 1NHQA 4GR1A 2QAEA 1TDKA 3AEBA 2W0HA 3OZ2A 1ZMCA 4J31A 4II2A 1D7LA 5HY5A 4IA5A 4K22A 1BGNA 2V6OA 4U8OA 3GD3A 2TPRA 3S61A 1COYA 3EANA 1TDFA 3UTFA 3K7MX 3PVCA 3AD7B 3ICSA 4P9SA 3T2ZA 4B63A 4RG3A 4BK1A 5CKUA 5EOWA 2Y6QA 3IHGA 1PHHA 4J33A 3RNMA 3ADAB 3GMCA 3KD9A 1GT8A 1JU2A 4Z2TA 2ZBWA 3JSKA 2WDQA 5HHFA 3LADA 1KN0A 1JNZA 1H81A 1N1PA 2BACA 5EBKA 2YG5A 4U8JA 4USRA 2GR3A 1PXCA 4X4JA 4CRTA 2WPCA 1ELIA 4YXDA 2WQYA 2RGHA 2JB2A 2I0ZA 3UKKA 3M12A 4G6HA 4PABA 1Q1RA 4TM0A 1GRFA 4B64A 4NEVA 1KDGA 3GWDA 1GXFA 4EIPA 4AP3A 1JNRA 2GMHA 1MXTA 3AYIA 3FMWA 3GDNA 4IVMB 3SFDA 2C76A 2BABA 4C74A 3AE9A 1O94A 2WU5A 3NHOX 3SGLA 1NHPA 3P4PA 3V3OA 5KXJA 2BXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5X A;  2X8C A;  3LOV A;  5EB5 A;  4DSG A;  3ATR A;  5C3J A;  1OJD A;  2WOI A;  4K5R A;  4M52 A;  3SQP A;  1ZDL A;  2IVE A;  1PBB A;  2QCU A;  3AYL A;  2ZZ0 A;  4NTD A;  3UCL A;  2GVC A;  4YWO A;  3VRA A;  1B8S A;  3G5S A;  3O0H A;  3I3L A;  2CVJ A;  2WET A;  5BVA A;  3QSS A;  1S2Q A;  3AEF A;  1ZY8 A;  3AE4 A;  4J34 A;  4H4Q A;  2R4J A;  2XVI A;  1LPF A;  4IV9 A;  2DKH A;  4BK3 A;  4FK1 A;  2C3C A;  3CGD A;  5EB4 A;  3LB8 A;  4BUR A;  3WE0 A;  3VRB A;  4YKG A;  1P2H A;  2GAG B;  3BI5 A;  3DJE A;  3ITJ A;  4A5L A;  4YTN A;  3DJJ A;  2BC1 A;  2Q7V A;  2YLT A;  3NN0 X;  1UKV G;  3P4Q A;  4XXG A;  2E4G A;  2R46 A;  2YWL A;  5FS6 A;  2GF3 A;  1SEZ A;  1CHU A;  2C7G A;  2B7S A;  4K8D A;  3B6D A;  1PXA A;  4TM1 A;  3AE2 A;  2C65 A;  2H89 A;  5FS9 A;  4Y4N A;  1RYI A;  1BKW A;  3ALJ A;  1XPQ A;  2WES A;  3DJD A;  3CPH G;  1GEU A;  3M0O A;  4A99 A;  4YTP A;  3LXD A;  1PBE A;  2GMJ A;  3KVE A;  4YSZ A;  2YG7 A;  3GD4 A;  2JAE A;  3LZX A;  1TRB A;  4EMW A;  1PS9 A;  2YM1 A;  3ATQ A;  3NK0 X;  2C70 A;  2PHH A;  4UP3 A;  3DME A;  2QA1 A;  3GYI A;  2FJE A;  1K0J A;  1QJD A;  5J60 A;  3IC9 A;  1CJC A;  4ZN0 A;  1Y56 A;  1HYU A;  3DK4 A;  2V61 A;  4B69 A;  4FDC B;  2EQ7 A;  1LTX R;  2AR8 A;  3NK2 X;  4Z2R A;  2V60 A;  1NEN A;  4I58 A;  1F3P A;  1M64 A;  1BF3 A;  4DGK A;  1VRQ B;  1ZOV A;  3F8D A;  3NT6 A;  4H2P A;  2R0G A;  4Z25 A;  3AEC A;  1XDI A;  1XHC A;  2YLX A;  1O5W A;  1D7Y A;  3AE3 A;  2EQ6 A;  3CPJ G;  3CNT A;  5TR3 A;  2YG4 A;  4J56 A;  4UDQ A;  3KLJ A;  1QLB A;  1EBD A;  3S5W A;  1M6I A;  3GWF A;  3FBS A;  4KX6 A;  4OPL A;  2C67 A;  3RP6 A;  3VRD B;  2R0C A;  1H86 A;  3NYC A;  4JNA A;  1GET A;  2YG6 A;  2A8X A;  3CIR A;  3K30 A;  4B1B A;  2XLT A;  5BRT A;  2BK3 A;  1ZOY A;  4H2Q A;  4ADW A;  2A87 A;  4NZH A;  4UDP A;  2XLU A;  4EQW A;  1KSS A;  4LA1 A;  1B4V A;  4GCM A;  1YQ3 A;  3UTH A;  1H7X A;  1LQT A;  4GUV A;  4ECH A;  3BNU A;  4TLZ A;  2YAU A;  4FX9 A;  2V5Z A;  4JQ9 A;  2UZZ A;  1CJ4 A;  1TDN A;  1N4V A;  3UKP A;  2BC0 A;  4N9X A;  3NH3 X;  4YKF A;  2PYX A;  3QSE A;  1IUS A;  4X9M A;  3GRS A;  3AED A;  3GMB A;  1Q9I A;  5GSN A;  1E1K A;  3CNJ A;  3UKQ A;  1GND A;  1RSG A;  1PBC A;  3BI2 A;  5KOX A;  2O9Z A;  1YKJ A;  4TM4 A;  3CGB A;  5U25 A;  2GEW A;  4YT0 A;  2BA9 A;  5U63 A;  2VVL A;  2WP6 A;  3QVR A;  2R0P A;  4H4Z A;  2VZ2 A;  2GR2 A;  3E1T A;  2FJD A;  1YY5 A;  2XLP A;  2XCG A;  3G5R A;  4U8N A;  1ZMD A;  2OLN A;  4JY3 A;  5IPY A;  4A6N B;  1KFY A;  3VR9 A;  2FJB A;  3P1W A;  4CBQ A;  3EF6 A;  3CNS A;  4WX1 A;  1MO9 A;  1K0L A;  1NHS A;  3ALM A;  4A6N A;  4GF7 A;  4RG4 A;  3QSM A;  1E1M A;  2OAM A;  2YR6 A;  3AWI A;  4H4T A;  4OPG A;  2WHD A;  1E1L A;  3NTA A;  1GRB A;  2E5V A;  2QA2 A;  2OAL A;  4OPC A;  3C4N A;  4U8P A;  1L9D A;  3OC4 A;  1PJ5 A;  3RHA A;  1XAN A;  2CFY A;  3URH A;  3AXB A;  4DNA A;  1E7P A;  1KNR A;  2VQB A;  3K7Q X;  1AOG A;  1GRE A;  1E6E A;  5BUK A;  2GH5 A;  2XFO A;  4BK2 A;  1O95 A;  4H4P A;  4K2X A;  2Q0L A;  4EM4 A;  3AE1 A;  2AQJ A;  2YVJ A;  1DOC A;  1OJA A;  2BK5 A;  3EAO A;  4C77 A;  1DOD A;  2X99 A;  4D03 A;  1IUV A;  3ALL A;  2XVE A;  1K4Q A;  4FK1 C;  5M0Z A;  4B68 A;  2GRT A;  5JCM A;  5IQ1 A;  1CL0 A;  5KWF A;  1PJ6 A;  4U8K A;  3DK9 A;  3KPF A;  4EM3 A;  3AEG A;  2WS3 A;  4XWR A;  2XVJ A;  3NIX A;  4U2T A;  4ZCC A;  3AE7 A;  3IWA A;  4ICY A;  2HQM A;  3P4S A;  1NEK A;  2XFU A;  3ZYX A;  4NTE A;  1W4X A;  4OVI A;  3UP5 A;  1X31 B;  4RSL A;  1GRG A;  4JDR A;  2XFP A;  2X50 A;  2BYB A;  2YG3 A;  4B67 A;  3NLC A;  4A79 A;  3DGH A;  1F6M A;  3UKH A;  4B65 A;  4DSH A;  1TDE A;  4OPU A;  2C3D A;  1F8S A;  3VR8 A;  2IID A;  4IVO B;  3K7T A;  3CNP A;  1GTE A;  2V3A A;  5KRQ A;  2ZZC A;  1FCD A;  1GAL A;  2C73 A;  2BCP A;  3GYJ A;  1S3B A;  3DA1 A;  4EIQ A;  2RAB A;  2GQW A;  5KVH A;  1B5Q A;  2GR1 A;  2XDO A;  1L9E A;  3GDP A;  4H4Y A;  3IF9 A;  5FS7 A;  3NRN A;  4EQS A;  4Z44 A;  2B9W A;  1GES A;  1N4W A;  3BI4 A;  3NG7 X;  4YSX A;  3QFB A;  3CND A;  4PAA A;  2BS4 A;  5J7X A;  2VRL A;  1H83 A;  1ONF A;  4H4W A;  2J3N A;  4BV6 A;  1KSU A;  1IJH A;  2BK4 A;  2GAH B;  3QJ4 A;  2C66 A;  2WDV A;  1GOS A;  5KOW A;  1H7W A;  4XWZ A;  3UKA A;  3BHF A;  2WEU A;  5L46 A;  2YLW A;  2BXR A;  4H4X A;  1DJQ A;  1GER A;  1LJ1 A;  2R45 A;  2H88 A;  4IA6 A;  1MOK A;  2C75 A;  1ZX9 A;  3P9U A;  2JB1 A;  4ZCD A;  4H4R A;  3DH9 A;  2JKC A;  3UOX A;  3R9U A;  4A65 A;  5JCK A;  4AOS A;  1QO8 A;  2WBA A;  1K0I A;  4H2N A;  2WPF A;  1L0V A;  2B9X A;  4EMJ A;  3ABV A;  4JY2 A;  4OCG A;  3NKS A;  3AE5 A;  3Q9T A;  1EL5 A;  3F8R A;  4OPT A;  1B37 A;  1IUX A;  4J57 A;  3AE6 A;  4J36 A;  1JRX A;  4CNK A;  2OA1 A;  1JRZ A;  1RP0 A;  4AP1 A;  5GRT A;  1Y0P A;  2B7R A;  1V59 A;  2XFQ A;  4H4V A;  3C4A A;  5ER0 A;  1EL8 A;  2R9Z A;  1EL9 A;  1P2E A;  3DK8 A;  5HXI A;  5JCI A;  4CNJ A;  1H6V A;  1DNC A;  4H4S A;  3RED A;  1FEA A;  2R4E A;  1FL2 A;  2YLS A;  3C96 A;  4H4U A;  1GPE A;  3NK1 X;  3LJP A;  1F8W A;  2WOW A;  1KF6 A;  1ZKQ A;  1Y56 B;  4EMI A;  3F8P A;  3DGZ A;  4LU6 A;  3L8K A;  3PO7 A;  1NG3 A;  2YM2 A;  4TLX A;  1H84 A;  2XFN A;  3D1C A;  3UTE A;  3NYE A;  3V76 A;  4EQX A;  4O5Q A;  2VVL G;  1D4C A;  2EQ8 A;  1VG0 A;  4Z24 A;  2Q0K A;  2YLZ A;  3T37 A;  1NG4 A;  3PS9 A;  2VOU A;  2NPX A;  1NHR A;  5M10 A;  1FEB A;  4C3X A;  5U1O A;  4TM3 A;  1D5T A;  3CN8 A;  2GR0 A;  1PBF A;  2VQ7 A;  3CTY A;  4A7A A;  3GRT A;  1DXL A;  2Z5Y A;  1TYT A;  5DBJ A;  2DKI A;  1JRY A;  2OLO A;  2JK6 A;  1IUT A;  3Q6J A;  4Z43 A;  1Q1W A;  4K7Z A;  1VG9 A;  4JN9 A;  2RGO A;  5LV9 A;  3SM8 A;  3ZDN A;  4K5S A;  4JNQ A;  1NDA A;  2YVG A;  3G5Q A;  3FG2 P;  4I59 A;  4CCR A;  1D4E A;  2WDR A;  3UTG A;  3H8L A;  3HZL A;  1IUU A;  2GV8 A;  1YQ4 A;  2JB3 A;  2CUL A;  2V3B A;  3RP7 A;  3AEE A;  3VQR A;  3UKF A;  5HYM A;  5FS8 A;  3B3R A;  4U8L A;  4E0V A;  1TYP A;  2RGJ A;  5JCL A;  3IHM A;  1L9C A;  5KVI A;  2C64 A;  4NTC A;  1GRA A;  4OPI A;  1FEC A;  2AAQ A;  3CGE A;  3NTD A;  4H50 A;  1OJC A;  1D4D A;  1F8R A;  4REK A;  1GV4 A;  2YR5 A;  1CBO A;  4AT2 A;  1S2Y A;  1CF3 A;  4GRT A;  2A89 A;  1LQU A;  1S3E A;  4YTM A;  2WPE A;  3UOZ A;  3AEA A;  4USQ A;  1DJN A;  2X3N A;  1DOE A;  1DOB A;  3D8X A;  2CDU A;  2WP5 A;  4Y4M A;  4APN A;  4UDR A;  4GDE A;  4OPD A;  1JOA A;  5JCN A;  4H2R A;  4AOX A;  4KPR A;  3AD9 B;  4X9N A;  4WCT A;  1CC6 A;  5IQ4 A;  4HA6 A;  4GDP A;  4U2S A;  2BS3 A;  3AD8 B;  1ZK7 A;  1OJT A;  1GRT A;  1E1N A;  3V3N A;  2B76 A;  2Y6R A;  4C3Y A;  3NN6 X;  1PXB A;  1LVL A;  2ARD A;  2BCG G;  2XVH A;  2XVF A;  3AB1 A;  3KU9 A;  3RP8 A;  2YLR A;  2WP9 A;  1VQW A;  3NYF A;  3P4R A;  4U8I A;  3DJG X;  1BWC A;  4A9W A;  2WU2 A;  2APG A;  4B66 A;  3H4K A;  1YQZ A;  2IVD A;  2XYO A;  2WOV A;  1BGJ A;  1IUW A;  3UP4 A;  2E1M A;  1EL7 A;  1VDC A;  3LZW A;  1FOH A;  3CPI G;  2VVM A;  4Y4L A;  4NEW A;  1ZP0 A;  3KA7 A;  4Z26 A;  1JEH A;  5CQF A;  4LII A;  4YSY A;  3KKJ A;  2YR4 A;  3AYJ A;  3ISH A;  2VRM A;  2NVK X;  1REO A;  1NPX A;  1LV0 A;  1GTH A;  3BNM A;  2X8H A;  3UOY A;  4YSH A;  2ZZB A;  3QFA A;  2FBW A;  1CJ3 A;  2FJA A;  2GB0 A;  4MJW A;  2TMD A;  4H7U A;  4U2L A;  4CCQ A;  5C2T A;  2YVF A;  4CY8 A;  2B9Y A;  4O5U A;  3I6D A;  3BHK A;  2YQU A;  3EPT A;  1TDO A;  4C5O A;  4EQR A;  1Z6L A;  3QVP A;  2XLR A;  1N4U A;  1OJ9 A;  3FPZ A;  4J2W A;  3ICR A;  1BZL A;  3II4 A;  1NAA A;  2ACZ A;  3CGC A;  3FIM B;  1GSN A;  4HB9 A;  1CJ2 A;  2X8G A;  2F5Z A;  1E39 A;  2XLS A;  3H8I A;  2JBV A;  1CC4 A;  1KNP A;  1PBD A;  1PDH A;  3AE8 A;  4U8M A;  1CC2 A;  1H82 A;  5BUL A;  1GRH A;  5FMH A;  1PJ7 A;  1PN0 A;  3UKL A;  4BJZ A;  2C72 A;  4Z2U A;  3SFE A;  4BJY A;  3M13 A;  3UOV A;  4CY6 A;  2GQF A;  3ICT A;  2Q6U A;  4AT0 A;  3COX A;  2BS2 A;  3GSI A;  2EQ9 A;  4D04 A;  3NGC X;  3NNE A;  3L1R A;  1NHQ A;  4GR1 A;  2QAE A;  1TDK A;  3AEB A;  2W0H A;  3OZ2 A;  1ZMC A;  4J31 A;  5HY5 A;  1D7L A;  4IA5 A;  4K22 A;  1BGN A;  2V6O A;  4U8O A;  3GD3 A;  2TPR A;  3S61 A;  1COY A;  3EAN A;  1TDF A;  3UTF A;  3K7M X;  3PVC A;  3AD7 B;  3ICS A;  4P9S A;  4B63 A;  4RG3 A;  4BK1 A;  5CKU A;  5EOW A;  2Y6Q A;  3IHG A;  1PHH A;  4J33 A;  3RNM A;  3ADA B;  3GMC A;  3KD9 A;  1GT8 A;  1JU2 A;  4Z2T A;  2ZBW A;  3JSK A;  2WDQ A;  5HHF A;  3LAD A;  1JNZ A;  1H81 A;  1N1P A;  2BAC A;  5EBK A;  2YG5 A;  4U8J A;  4USR A;  2GR3 A;  1PXC A;  4X4J A;  4CRT A;  2WPC A;  1ELI A;  4YXD A;  2WQY A;  2RGH A;  2JB2 A;  2I0Z A;  3UKK A;  3M12 A;  4PAB A;  1Q1R A;  4TM0 A;  1GRF A;  4B64 A;  4NEV A;  1KDG A;  3GWD A;  1GXF A;  4EIP A;  4AP3 A;  1JNR A;  2GMH A;  1MXT A;  3AYI A;  3FMW A;  3GDN A;  4IVM B;  3SFD A;  2C76 A;  2BAB A;  4C74 A;  3AE9 A;  1O94 A;  2WU5 A;  3NHO X;  3SGL A;  1NHP A;  3P4P A;  3V3O A;  5KXJ A;  2BXS A; 
#chains in the Genus database with same CATH topology
 4DSG A;  4HNC A;  3SQP A;  2QCU A;  4DX3 A;  4G9K A;  4X4J A;  1F9C A;  3DJE A;  5FJU A;  3DJJ A;  2Q7V A;  3CMM A;  1UKV G;  2E4G A;  2R46 A;  3NXL A;  1SEZ A;  1EBH A;  2C7G A;  4DN1 A;  3ENL A;  2C65 A;  2E5A A;  4JN8 A;  3V4B A;  3AN1 A;  1XPQ A;  4E5T A;  3MY9 A;  3Q45 A;  3TOY A;  4YTP A;  1PBE A;  3PG6 A;  3UJF A;  1SB3 B;  3LZX A;  2YM1 A;  2NQL A;  1FHU A;  2PHH A;  1K0J A;  1QJD A;  4H2H A;  5J60 A;  3IC9 A;  1HYU A;  3DK4 A;  3IK4 A;  2V61 A;  5KMS A;  1LTX R;  4Z2R A;  1F3P A;  1BF3 A;  4DGK A;  1VRQ B;  1ZOV A;  4E8G A;  1D7Y A;  5TR3 A;  4UDQ A;  3KLJ A;  1EBD A;  3VFC A;  3GWF A;  4GGB A;  3VRD B;  4JNA A;  2YG6 A;  1ZOY A;  3CXO A;  3OZY A;  3R11 A;  4K8G A;  1KD0 A;  3QKE A;  4NZH A;  3UJE A;  3NO1 A;  3BNU A;  2HXT A;  3UKP A;  2BC0 A;  2POZ A;  1IUS A;  3GRS A;  3AED A;  3GMB A;  3CNJ A;  1PBC A;  3BI2 A;  5KOX A;  1YKJ A;  3CGB A;  2GEW A;  4YT0 A;  5U63 A;  5J04 A;  2FJD A;  2OLN A;  2CHR A;  3NVY B;  3P1W A;  3HPF A;  3KUM A;  3CNS A;  4WX1 A;  2E3T A;  1K0L A;  4A6N A;  1FIQ B;  2OQH A;  4GF7 A;  4RG4 A;  1E1M A;  4HNL A;  4F4R A;  2QA2 A;  4OPC A;  3C4N A;  1L9D A;  3RHA A;  3AXB A;  4DNA A;  3K7Q X;  1AOG A;  2XFO A;  4K2X A;  2AQJ A;  1OJA A;  3EAO A;  1K4Q A;  1EC9 A;  1CL0 A;  1PJ6 A;  3DK9 A;  3KPF A;  2WS3 A;  1FHV A;  2QJN A;  3AE7 A;  1SJC A;  3Q4D A;  2XFU A;  1N63 C;  2GGH A;  4OVI A;  4RSL A;  4B67 A;  4A79 A;  3UKH A;  4OPU A;  3VR8 A;  4DWD A;  3K7T A;  1GAL A;  2BCP A;  3GYJ A;  2PU0 A;  2XDO A;  4EQS A;  4Z44 A;  2PSN A;  3SZF A;  3CND A;  5G5G B;  3ES7 A;  2W3R A;  2ZAD A;  2P8B A;  1ECQ A;  2WEU A;  2BXR A;  1LJ1 A;  2H88 A;  4IA6 A;  1MOK A;  4IL0 A;  2JKC A;  3UOX A;  3R9U A;  4A65 A;  2P0I A;  1QO8 A;  2PGW A;  3AE5 A;  4E4U A;  3FXG A;  4G7F A;  1JRX A;  4YWS A;  1JRZ A;  2P3Z A;  1RP0 A;  2B7R A;  2R9Z A;  1EL9 A;  1P2E A;  1VDV A;  1FL2 A;  4H4U A;  1F8W A;  4Z17 A;  1ZKQ A;  3F8P A;  4ZA0 A;  3SZ0 A;  3UTE A;  3T2K A;  2VVL G;  2PMQ A;  1VG0 A;  2Q0K A;  4H1Z A;  5M10 A;  4HYR A;  1JCT A;  4C3X A;  2PPG A;  2GR0 A;  4HN8 A;  2DKI A;  4Z43 A;  4K7Z A;  3B97 A;  2GGG A;  2YVG A;  4I59 A;  2P8C A;  2PU1 A;  2OLA A;  5FS8 A;  4U8L A;  4J1O A;  4IHC A;  3OW1 A;  5BOE A;  1OJC A;  1D4D A;  1F8R A;  4REK A;  4GRT A;  4IT1 A;  1LQU A;  3UOZ A;  2WPE A;  1DOE A;  1DOB A;  4M6U A;  3R0K A;  4Y4M A;  3N6H A;  1JOA A;  4GDP A;  2BS3 A;  3AD8 B;  1LVL A;  3AB1 A;  2WP9 A;  1VQW A;  3NYF A;  2APG A;  3NVV B;  3BSM A;  1YQZ A;  2XYO A;  2WOV A;  1IUW A;  3UP4 A;  1EL7 A;  3CPI G;  2VVM A;  4NEW A;  5CQF A;  3PWG A;  1BQG A;  1REO A;  1JRP A;  3QFA A;  4MJW A;  2TMD A;  4H7U A;  5C2T A;  2YVF A;  1KCZ A;  4O5U A;  3I6D A;  3EPT A;  3QVP A;  2AL1 A;  1N4U A;  2PA6 A;  2PGE A;  3CGC A;  3UCD A;  1V97 A;  2F5Z A;  1X2G A;  2I5Q A;  3AE8 A;  1GRH A;  5FMH A;  2XH7 A;  4GYP C;  3R1Z A;  4Z2U A;  3GSI A;  3NGC X;  3L1R A;  2POD A;  5HY5 A;  3EUB 3;  1ZMC A;  1D7L A;  1COY A;  4B63 A;  4RG3 A;  4FI4 A;  5CKU A;  5EOW A;  4J33 A;  3KD9 A;  4H19 A;  4H83 A;  3JSK A;  3K1G A;  1EC7 A;  4U8J A;  1XS2 A;  1PXC A;  4YXD A;  1ELI A;  2JB2 A;  4HCL A;  3UKK A;  4PAB A;  4NEV A;  1SJB A;  1KDG A;  1N60 C;  2PP1 A;  3AE9 A;  2WU5 A;  3P4P A;  3V3O A;  3LOV A;  1E9I A;  2WOI A;  4M52 A;  2IVE A;  4NTD A;  3G5S A;  3O0H A;  2WET A;  3SZW A;  4TVY A;  3AEF A;  2AKM A;  4FK1 A;  2C3C A;  3CGD A;  2PP0 A;  4IP4 A;  1P2H A;  2GAG B;  3BI5 A;  3ITJ A;  2YLT A;  5FS6 A;  4TM1 A;  4Y4N A;  2H89 A;  5FS9 A;  1BKW A;  3ALJ A;  3DJD A;  1P48 A;  4X2P A;  3RR1 A;  4A99 A;  3LXD A;  3NS1 B;  3IJQ A;  2GMJ A;  1H2I A;  4YSZ A;  2YG7 A;  2JAE A;  1EBG A;  2C70 A;  3GYI A;  1CJC A;  1Y56 A;  2EQ7 A;  1M64 A;  4H2P A;  2R0G A;  3AEC A;  5FJT A;  2EQ6 A;  3CPJ G;  4GAV A;  5KMQ A;  1QLB A;  3PK7 A;  4KX6 A;  2C67 A;  2R0C A;  1GET A;  2QDD A;  2XLU A;  4EQW A;  1B4V A;  4GCM A;  3UTH A;  1LQT A;  4GFI A;  2YAU A;  4IP5 A;  4JQ9 A;  1N4V A;  3NH3 X;  3DG7 A;  3GO2 A;  3H8A A;  3TQP A;  3UJS A;  2ZC8 A;  1FO4 A;  2OZ3 A;  3QVR A;  2WP6 A;  2R0P A;  2GGE A;  2VZ2 A;  3E1T A;  3G5R A;  1YY5 A;  2XGZ A;  4JY3 A;  5IPY A;  1WYG A;  1KFY A;  4ZCW A;  3FJ4 A;  4CBQ A;  3EF6 A;  1MO9 A;  3OP2 A;  4G8T A;  2OAM A;  3EEZ A;  2PTY A;  1PDY A;  4U8P A;  1PJ5 A;  1XAN A;  3URH A;  3ZLG A;  3TJI A;  4ZOH B;  1GRE A;  4Z1Y A;  5KMP A;  4KPL A;  1O95 A;  5ENL A;  3AE1 A;  1W6T A;  2BK5 A;  4D03 A;  2X99 A;  1IUV A;  4FK1 C;  2XVE A;  4B68 A;  3P3B A;  5JCM A;  5IQ1 A;  3AEG A;  4XWR A;  3FCP A;  4ZCC A;  3IWA A;  4ICY A;  3P4S A;  3ZYX A;  1W4X A;  3UP5 A;  2MUC A;  2X50 A;  4DSH A;  5KRQ A;  1S3B A;  2RAB A;  3CAW A;  4K2S A;  5KVH A;  5FS7 A;  3NRN A;  1N61 C;  1GES A;  2XH0 A;  3NG7 X;  2BS4 A;  5J7X A;  2VRL A;  1ONF A;  1KSU A;  3QJ4 A;  1JPD X;  2C66 A;  3SXI A;  2WDV A;  3VC6 A;  3ZLF A;  5KOW A;  4H4X A;  1DJQ A;  1GER A;  4A6G A;  2R45 A;  1ZX9 A;  3P9U A;  2JB1 A;  3SX6 A;  3BOX A;  2B9X A;  3Q9T A;  1EL5 A;  3F8R A;  1IUX A;  1JRO A;  5KMR A;  3VA8 A;  4J36 A;  4CNK A;  2OA1 A;  1Y0P A;  3UCL A;  5ER0 A;  4MMW A;  1FEA A;  3TWB A;  1GPE A;  3NK1 X;  1KF6 A;  3CK5 A;  4EMI A;  3DGZ A;  3PO7 A;  4TLX A;  2XFN A;  2OQY A;  2YLZ A;  1NG4 A;  2NPX A;  1RM6 B;  5U1O A;  1D5T A;  3EKG A;  3QPE A;  2VQ7 A;  3CTY A;  1TYT A;  5DBJ A;  1IUT A;  3Q6J A;  4JN9 A;  3A7R A;  4K5S A;  4JNQ A;  1NDA A;  2WDR A;  3T0K A;  3KPK A;  3H8L A;  3HZL A;  2GV8 A;  1YQ4 A;  1SJD A;  5HYM A;  3B3R A;  1TYP A;  3IHM A;  5KVI A;  3VCN A;  4NTC A;  4E6M A;  3NRZ B;  1CBO A;  2PS2 A;  2PCE A;  1DJN A;  2CDU A;  2WP5 A;  2AL2 A;  4UDR A;  3HW2 A;  5JCN A;  4H2R A;  3GC2 A;  3H70 A;  4AOX A;  3AD9 B;  4WCT A;  2W54 A;  4U2S A;  4G73 A;  5FJR A;  1E1N A;  2B76 A;  2Y6R A;  2ARD A;  2XVH A;  2BRA A;  2PTZ A;  4U8I A;  4A9W A;  4B66 A;  3UXL A;  1T3Q C;  2OZT A;  2OX4 A;  4GGH A;  2E1M A;  3V5C A;  3LZW A;  3SY4 A;  1FOH A;  4A35 A;  1ZP0 A;  4Z26 A;  3SR6 B;  3AYJ A;  1NU5 A;  1NPX A;  1LV0 A;  3TJ4 A;  2FJA A;  4U2L A;  4CY8 A;  1MNS A;  1Z6L A;  1OJ9 A;  3FPZ A;  4J2W A;  1BZL A;  2ACZ A;  1NEL A;  1CJ2 A;  1E39 A;  2JBV A;  1KNP A;  4U8M A;  1CC2 A;  5BUL A;  2DW7 A;  2C72 A;  3M13 A;  3IJL A;  4CY6 A;  2GQF A;  3ICT A;  2Q6U A;  2OG9 A;  3COX A;  1TZZ A;  2BS2 A;  2W3S A;  2OPJ A;  2QJJ A;  2PTX A;  3AEB A;  3OZ2 A;  4II2 A;  4IA5 A;  1BGN A;  1TDF A;  3ICS A;  3IHG A;  1PHH A;  4Z2T A;  5G5H B;  2YG5 A;  2WPC A;  1ELS A;  2I0Z A;  3A7A A;  1Q1R A;  4TM0 A;  2OKT A;  2HZG A;  4IVM B;  3SFD A;  3CYJ A;  2BAB A;  3SGL A;  1NHP A;  5KXJ A;  2BXS A;  3NZG A;  2Z5X A;  3GYX A;  5C3J A;  3ATR A;  1OJD A;  4K5R A;  1ZDL A;  1PBB A;  2GGJ A;  3I4K A;  3VRA A;  3A7U A;  4YWO A;  2GVC A;  3NVZ B;  3I3L A;  2CVJ A;  1N5W C;  1ZY8 A;  3AE4 A;  1LPF A;  2DKH A;  3AMZ A;  3SYI A;  4BUR A;  3VRB A;  4YKG A;  4A5L A;  3NN0 X;  4KEM A;  4XXG A;  3ES8 A;  2GF3 A;  1CHU A;  3B6D A;  4K8D A;  3AM9 A;  3SN0 A;  2WES A;  3CPH G;  3JVA A;  3QTP A;  3GD6 A;  1TRB A;  1PS9 A;  3ATQ A;  3QLD A;  3DME A;  4ZN0 A;  4I58 A;  3F8D A;  3SQS A;  4Z25 A;  1XDI A;  1XHC A;  2YLX A;  3CNT A;  3S5W A;  3FBS A;  4OPL A;  3RP6 A;  3NYC A;  2A8X A;  4B1B A;  5BRT A;  4ADW A;  3UCC A;  4UDP A;  1KSS A;  2OO6 A;  3SSZ A;  1H7X A;  4ECH A;  4TLZ A;  4FX9 A;  2V5Z A;  3OZM A;  4DHG A;  1CJ4 A;  1TDN A;  4N9X A;  1STZ A;  2PYX A;  4E4F A;  3QSE A;  2DW6 A;  3UKQ A;  1E1K A;  3R25 A;  4TM4 A;  2BA9 A;  2VVL A;  3V3W A;  2GR2 A;  2XLP A;  3IJI A;  2XCG A;  4GYP A;  4A6N B;  4GAP A;  3VR9 A;  3ALM A;  1NHS A;  2OFJ A;  3QSM A;  4OPG A;  4H4T A;  2WHD A;  1E1L A;  3CXB A;  1GRB A;  5FJO A;  1MUC A;  4M0X A;  2CFY A;  3QN3 A;  1E7P A;  2VQB A;  5BUK A;  2GH5 A;  3MKC A;  4BK2 A;  4H4P A;  2Q0L A;  4EM4 A;  4C77 A;  1DOD A;  5M0Z A;  2GRT A;  4HCD A;  4U8K A;  3VC5 A;  4EM3 A;  2XVJ A;  1KKO A;  3NLC A;  1F6M A;  1TDE A;  2C3D A;  3DG6 A;  3D47 A;  3CNP A;  2ZZC A;  1FCD A;  2C73 A;  3DA1 A;  2PTW A;  2GQW A;  1B5Q A;  2GR1 A;  3IF9 A;  2QJM A;  2B9W A;  3DGB A;  2XSX A;  1H83 A;  4H4W A;  2J3N A;  4BV6 A;  3RO6 A;  1GOS A;  3BHF A;  2YLW A;  3VDG A;  2C75 A;  3FV9 A;  4ZCD A;  3DER A;  4H4R A;  3U9I A;  3T8Q A;  2WBA A;  1K0I A;  4H2N A;  2WPF A;  1IYX A;  4EMJ A;  3ABV A;  4JY2 A;  4OCG A;  3NKS A;  4OPT A;  4J57 A;  3AE6 A;  4AP1 A;  5GRT A;  2XFQ A;  1V59 A;  3C4A A;  4H4V A;  5HXI A;  3DFH A;  1EL8 A;  4A3R A;  3DK8 A;  3UGV A;  1H6V A;  4CNJ A;  1DNC A;  3C96 A;  4ROP A;  2WOW A;  3STP A;  1Y56 B;  3L8K A;  2YM2 A;  1H84 A;  3D1C A;  3V76 A;  3NYE A;  4EQX A;  2AL2 B;  2EQ8 A;  3T37 A;  3PS9 A;  1ZXI C;  3R07 C;  3UXK A;  2VOU A;  1FEB A;  2OVL A;  3TWA A;  1MDR A;  4MGG A;  3GRT A;  1DXL A;  2Z5Y A;  1JRY A;  2OLO A;  4II3 A;  4HPN A;  2RGO A;  3ZDN A;  3CT2 A;  3SBF A;  3P0W A;  3UTG A;  2JB3 A;  2V3B A;  3RP7 A;  2CUL A;  1JDF A;  3AEE A;  3VQR A;  5JCL A;  1L9C A;  3HRD C;  2C64 A;  4OPI A;  1FEC A;  2AAQ A;  3CGE A;  3T14 A;  3NTD A;  3DEQ A;  2YR5 A;  1CF3 A;  3D8X A;  3PWI A;  4GDE A;  4OPD A;  2FKP A;  5IQ4 A;  2HXU A;  4JHM A;  1OJT A;  1GRT A;  1SJA A;  1X2H A;  2BCG G;  2XVF A;  3T2Z A;  2YLR A;  4JN7 A;  3P4R A;  3DJG X;  1BWC A;  2IVD A;  3H7V A;  4HCH A;  3R10 A;  4Y4L A;  4KT2 A;  4LII A;  4YSY A;  2NVK X;  2X8H A;  3UOY A;  4YSH A;  2ZZB A;  2FBW A;  4CCQ A;  1CJ3 A;  2GSH A;  2B9Y A;  2YQU A;  3T2Y A;  3ICR A;  1NAA A;  3HYV A;  3FIM B;  4HB9 A;  2XLS A;  3NFU A;  1CC4 A;  2PP3 A;  4BJZ A;  3SFE A;  1WUF A;  3MZN A;  2EQ9 A;  2HNE A;  3T9P A;  4J31 A;  2W0H A;  1EC8 A;  4K22 A;  3S61 A;  4FP1 A;  3UTF A;  3AD7 B;  4BK1 A;  3D46 A;  3ADA B;  3GMC A;  1P43 A;  3BJS A;  1GT8 A;  1JU2 A;  2ZBW A;  3ZLH A;  7ENL A;  3N4E A;  5HHF A;  3LAD A;  1JNZ A;  1H81 A;  1N1P A;  5EBK A;  4USR A;  2GR3 A;  4J3Z A;  2RGH A;  3TCS A;  4B64 A;  3DDM A;  3GWD A;  4EIP A;  1JNR A;  3ZVH A;  3AYI A;  3FMW A;  2C76 A;  1BKH A;  2X8C A;  5EB5 A;  1MDL A;  3T6C A;  3DES A;  3AYL A;  2ZZ0 A;  1B8S A;  1ONE A;  3MUC A;  5BVA A;  4MKS A;  3QSS A;  1S2Q A;  4J34 A;  4IV9 A;  4H4Q A;  2R4J A;  2XVI A;  4BK3 A;  5EB4 A;  3LB8 A;  3WE0 A;  2P88 A;  4YTN A;  2BC1 A;  3P4Q A;  2YWL A;  2AKZ A;  3VCC A;  2B7S A;  1PXA A;  3AE2 A;  1RYI A;  2O56 A;  3NVW B;  1GEU A;  3OPS A;  3M0O A;  3UJR A;  3N4F A;  3KVE A;  3GD4 A;  3P93 A;  4EMW A;  3NK0 X;  3SN4 A;  4UP3 A;  3RGT A;  1FFV C;  2QA1 A;  4ENL A;  2FJE A;  1R6W A;  1N5X A;  4B69 A;  4FDC B;  2AR8 A;  3NK2 X;  2V60 A;  3ZVI A;  1NEN A;  3NT6 A;  3AE3 A;  1O5W A;  2YG4 A;  4J56 A;  1M6I A;  3ETR B;  1H86 A;  3CIR A;  3K30 A;  2XLT A;  2BK3 A;  4H2Q A;  3L5O A;  2GL5 A;  2A87 A;  1RVK A;  3RIT A;  3SZC A;  4LA1 A;  1YQ3 A;  4GUV A;  5JRB A;  3DFY A;  2UZZ A;  3H12 A;  4YKF A;  4X9M A;  1Q9I A;  5GSN A;  1R0M A;  5IDZ A;  1GND A;  1RSG A;  2O9Z A;  5U25 A;  3MWC A;  4H4Z A;  3HYX A;  1JPM A;  4U8N A;  3I6E A;  1ZMD A;  2FJB A;  3MSY A;  3UJ2 A;  4IL2 A;  5BOF A;  3AWI A;  2YR6 A;  3NTA A;  2E5V A;  2OAL A;  3OC4 A;  3TTE A;  3D9X A;  1KNR A;  3JW7 A;  2GGI A;  1E6E A;  2YVJ A;  1DOC A;  3ALL A;  5KWF A;  1FFU C;  2ONE A;  3NIX A;  4NNJ A;  4U2T A;  2HQM A;  2GDQ A;  1NEK A;  4NTE A;  1X31 B;  1GRG A;  4JDR A;  2XFP A;  2YG3 A;  2BYB A;  3SN1 A;  3DGH A;  4B65 A;  1F8S A;  2IID A;  4IVO B;  1GTE A;  2V3A A;  4EIQ A;  1VQZ A;  4TVW A;  1L9E A;  3GDP A;  4H4Y A;  3GY1 A;  1N4W A;  3BI4 A;  2C4C A;  4YSX A;  3QFB A;  3TW9 A;  4PAA A;  4G74 A;  3HYW A;  1IJH A;  2BK4 A;  2GAH B;  3MQT A;  2RDX A;  4DYE A;  1H7W A;  3V5F A;  4G6G A;  4XWZ A;  3UKA A;  5L46 A;  5KNL A;  3I6T A;  2QQ6 A;  3DH9 A;  4AOS A;  5JCK A;  5EU9 A;  1L0V A;  1L8P A;  1B37 A;  4NWZ A;  1MRA A;  3U4F A;  5JCI A;  4H4S A;  3RED A;  1OEP A;  2R4E A;  2YLS A;  1TE6 A;  3LJP A;  4LU6 A;  1NG3 A;  4O5Q A;  2QDE A;  1N62 C;  1D4C A;  3N6J A;  4Z24 A;  1YEY A;  1NHR A;  4K1W A;  3THU A;  3DG3 A;  5FJP A;  4TM3 A;  3CN8 A;  3FVD A;  3S47 A;  1PBF A;  4A7A A;  2JK6 A;  1Q1W A;  1VG9 A;  5LV9 A;  3SM8 A;  1DTN A;  3G5Q A;  3FG2 P;  4CCR A;  1D4E A;  1IUU A;  3UKF A;  2BRY A;  4E0V A;  2RGJ A;  1GRA A;  3S5S A;  3ZVH B;  4H50 A;  1GV4 A;  4GIS A;  4AT2 A;  1S2Y A;  2A89 A;  1S3E A;  4YTM A;  3AEA A;  4USQ A;  2X3N A;  2QVH A;  4APN A;  4KPR A;  4X9N A;  1CC6 A;  4HA6 A;  1ZK7 A;  3V3N A;  4C3Y A;  3NN6 X;  1PXB A;  3RP8 A;  3KU9 A;  6ENL A;  3RCY A;  2WU2 A;  3DIP A;  3H4K A;  1BGJ A;  1VDC A;  2XH4 A;  4GIR A;  3B9J B;  3KA7 A;  1JEH A;  2MNR A;  3KKJ A;  2YR4 A;  3ISH A;  1S7M A;  3JZU A;  2VRM A;  3SJN A;  1TKK A;  2QGY A;  1GTH A;  3BNM A;  3T31 A;  3R0U A;  2GB0 A;  3FYY A;  1WUE A;  3BHK A;  1TDO A;  1KKR A;  4C5O A;  4EQR A;  2XLR A;  2XH2 A;  3II4 A;  3CB3 A;  2W55 A;  1GSN A;  2X8G A;  3H8I A;  1XPY A;  1PBD A;  1PDH A;  1H82 A;  1PJ7 A;  3RRA A;  1PN0 A;  3UKL A;  4BJY A;  3UOV A;  1PDZ A;  2FYM A;  4AT0 A;  4IZG A;  3NNE A;  4D04 A;  1NHQ A;  4GR1 A;  2QAE A;  4GME A;  1TDK A;  3OTR A;  4EWJ A;  3PFR A;  2V6O A;  4U8O A;  3GD3 A;  2TPR A;  4KWS A;  3EAN A;  3K7M X;  3PVC A;  4P9S A;  2Y6Q A;  3RNM A;  2WDQ A;  1KN0 A;  2BAC A;  4CRT A;  2WQY A;  4DXK A;  3M12 A;  4G6H A;  1GRF A;  3T4W A;  1GXF A;  2OZ8 A;  4AP3 A;  2GMH A;  1MXT A;  3GDN A;  4C74 A;  1O94 A;  3NHO X; 
#chains in the Genus database with same CATH homology
 2Z5X A;  2X8C A;  3GYX A;  3LOV A;  5EB5 A;  3ATR A;  4DSG A;  5C3J A;  1OJD A;  2WOI A;  4K5R A;  4M52 A;  3SQP A;  1ZDL A;  2IVE A;  1PBB A;  2QCU A;  3AYL A;  2ZZ0 A;  4NTD A;  3UCL A;  2GVC A;  4YWO A;  3VRA A;  1B8S A;  3G5S A;  3O0H A;  3I3L A;  2CVJ A;  2WET A;  3SZW A;  5BVA A;  4G9K A;  3QSS A;  1S2Q A;  3AEF A;  1ZY8 A;  3AE4 A;  4J34 A;  4H4Q A;  2R4J A;  2XVI A;  1LPF A;  4IV9 A;  2DKH A;  4BK3 A;  4FK1 A;  2C3C A;  3SYI A;  3CGD A;  5EB4 A;  3LB8 A;  4BUR A;  3WE0 A;  3VRB A;  4YKG A;  1P2H A;  2GAG B;  3BI5 A;  3DJE A;  3ITJ A;  4A5L A;  4YTN A;  3DJJ A;  2BC1 A;  2Q7V A;  2YLT A;  3CMM A;  3NN0 X;  1UKV G;  3P4Q A;  4XXG A;  2E4G A;  2R46 A;  2YWL A;  5FS6 A;  2GF3 A;  1SEZ A;  1CHU A;  2C7G A;  2B7S A;  4K8D A;  3B6D A;  1PXA A;  4TM1 A;  3AE2 A;  2C65 A;  2H89 A;  5FS9 A;  4Y4N A;  1RYI A;  1BKW A;  3ALJ A;  1XPQ A;  2WES A;  3DJD A;  3CPH G;  1GEU A;  3M0O A;  4A99 A;  4YTP A;  3LXD A;  1PBE A;  2GMJ A;  3PG6 A;  3KVE A;  1H2I A;  4YSZ A;  2YG7 A;  3GD4 A;  2JAE A;  3LZX A;  1TRB A;  4EMW A;  1PS9 A;  2YM1 A;  3ATQ A;  3NK0 X;  2C70 A;  2PHH A;  4UP3 A;  3DME A;  2QA1 A;  3GYI A;  2FJE A;  1K0J A;  1QJD A;  5J60 A;  3IC9 A;  1CJC A;  4ZN0 A;  1Y56 A;  1HYU A;  3DK4 A;  2V61 A;  4B69 A;  5KMS A;  4FDC B;  2EQ7 A;  1LTX R;  2AR8 A;  3NK2 X;  4Z2R A;  2V60 A;  1NEN A;  4I58 A;  1F3P A;  1M64 A;  1BF3 A;  4DGK A;  1VRQ B;  1ZOV A;  3F8D A;  3NT6 A;  4H2P A;  2R0G A;  4Z25 A;  3AEC A;  1XDI A;  1XHC A;  2YLX A;  1O5W A;  1D7Y A;  3AE3 A;  2EQ6 A;  3CPJ G;  3CNT A;  5TR3 A;  2YG4 A;  4J56 A;  4UDQ A;  3KLJ A;  4GAV A;  5KMQ A;  1QLB A;  1EBD A;  3S5W A;  1M6I A;  3GWF A;  3FBS A;  4KX6 A;  4OPL A;  2C67 A;  3RP6 A;  3VRD B;  2R0C A;  1H86 A;  3NYC A;  4JNA A;  1GET A;  2YG6 A;  2A8X A;  3CIR A;  3K30 A;  4B1B A;  2XLT A;  5BRT A;  2BK3 A;  1ZOY A;  3L5O A;  4H2Q A;  4ADW A;  2A87 A;  4NZH A;  3SZC A;  4UDP A;  2XLU A;  4EQW A;  1KSS A;  4LA1 A;  1B4V A;  4GCM A;  1YQ3 A;  3UTH A;  1H7X A;  1LQT A;  4GUV A;  4ECH A;  3BNU A;  5JRB A;  4TLZ A;  2YAU A;  4FX9 A;  2V5Z A;  4JQ9 A;  2UZZ A;  1CJ4 A;  1TDN A;  1N4V A;  3UKP A;  2BC0 A;  4N9X A;  3NH3 X;  4YKF A;  2PYX A;  3QSE A;  1IUS A;  4X9M A;  3GRS A;  3AED A;  3GMB A;  1Q9I A;  5GSN A;  1E1K A;  3CNJ A;  3UKQ A;  1GND A;  1RSG A;  1PBC A;  3BI2 A;  5KOX A;  2O9Z A;  1YKJ A;  4TM4 A;  3CGB A;  5U25 A;  2GEW A;  4YT0 A;  2BA9 A;  5U63 A;  2VVL A;  2WP6 A;  3QVR A;  2R0P A;  4H4Z A;  3HYX A;  2VZ2 A;  2GR2 A;  3E1T A;  2FJD A;  1YY5 A;  2XLP A;  2XCG A;  3G5R A;  4U8N A;  1ZMD A;  2OLN A;  4JY3 A;  5IPY A;  4A6N B;  1KFY A;  4GAP A;  2FJB A;  3VR9 A;  3P1W A;  4CBQ A;  3EF6 A;  3CNS A;  4WX1 A;  1MO9 A;  1K0L A;  1NHS A;  3ALM A;  4A6N A;  4GF7 A;  4RG4 A;  3QSM A;  1E1M A;  2OAM A;  2YR6 A;  3AWI A;  4H4T A;  4OPG A;  2WHD A;  1E1L A;  3NTA A;  1GRB A;  2E5V A;  2QA2 A;  2OAL A;  4OPC A;  3C4N A;  4U8P A;  1L9D A;  3OC4 A;  1PJ5 A;  3RHA A;  1XAN A;  2CFY A;  3URH A;  3AXB A;  3D9X A;  4DNA A;  1E7P A;  1KNR A;  2VQB A;  3K7Q X;  1AOG A;  1GRE A;  1E6E A;  5BUK A;  5KMP A;  2GH5 A;  2XFO A;  4BK2 A;  1O95 A;  4H4P A;  4K2X A;  2Q0L A;  4EM4 A;  3AE1 A;  2AQJ A;  2YVJ A;  1DOC A;  1OJA A;  2BK5 A;  3EAO A;  4C77 A;  1DOD A;  2X99 A;  4D03 A;  1IUV A;  3ALL A;  2XVE A;  1K4Q A;  4FK1 C;  5M0Z A;  4B68 A;  2GRT A;  5JCM A;  5IQ1 A;  1CL0 A;  5KWF A;  1PJ6 A;  4U8K A;  3DK9 A;  3KPF A;  4EM3 A;  3AEG A;  2WS3 A;  4XWR A;  2XVJ A;  3NIX A;  4NNJ A;  4U2T A;  4ZCC A;  3AE7 A;  3IWA A;  4ICY A;  2HQM A;  3P4S A;  1NEK A;  2XFU A;  3ZYX A;  4NTE A;  1W4X A;  4OVI A;  3UP5 A;  1X31 B;  4RSL A;  1GRG A;  4JDR A;  2XFP A;  2X50 A;  2BYB A;  2YG3 A;  4B67 A;  3NLC A;  4A79 A;  3DGH A;  1F6M A;  3UKH A;  4B65 A;  4DSH A;  1TDE A;  4OPU A;  2C3D A;  1F8S A;  3VR8 A;  2IID A;  4IVO B;  3K7T A;  3CNP A;  1GTE A;  2V3A A;  5KRQ A;  2ZZC A;  1FCD A;  1GAL A;  2C73 A;  2BCP A;  3GYJ A;  1S3B A;  3DA1 A;  4EIQ A;  2RAB A;  2GQW A;  5KVH A;  1B5Q A;  2GR1 A;  2XDO A;  1L9E A;  3GDP A;  4H4Y A;  3IF9 A;  5FS7 A;  3NRN A;  4EQS A;  4Z44 A;  2B9W A;  1GES A;  1N4W A;  3BI4 A;  2C4C A;  3NG7 X;  3SZF A;  4YSX A;  3QFB A;  3CND A;  4PAA A;  2BS4 A;  5J7X A;  2VRL A;  1H83 A;  4G74 A;  1ONF A;  4H4W A;  3HYW A;  2J3N A;  4BV6 A;  1KSU A;  1IJH A;  2BK4 A;  2GAH B;  3QJ4 A;  2C66 A;  3SXI A;  2WDV A;  1GOS A;  5KOW A;  1H7W A;  4G6G A;  4XWZ A;  3BHF A;  2WEU A;  3UKA A;  2YLW A;  5L46 A;  2BXR A;  4H4X A;  1DJQ A;  1GER A;  1LJ1 A;  2R45 A;  2H88 A;  4IA6 A;  1MOK A;  5KNL A;  2C75 A;  1ZX9 A;  3P9U A;  2JB1 A;  3SX6 A;  4ZCD A;  4H4R A;  3DH9 A;  2JKC A;  3UOX A;  3R9U A;  4A65 A;  5JCK A;  4AOS A;  1QO8 A;  2WBA A;  1K0I A;  4H2N A;  2WPF A;  1L0V A;  2B9X A;  4EMJ A;  3ABV A;  4JY2 A;  4OCG A;  3NKS A;  3AE5 A;  3Q9T A;  1EL5 A;  3F8R A;  4OPT A;  4NWZ A;  1B37 A;  1IUX A;  4J57 A;  3AE6 A;  5KMR A;  4J36 A;  1JRX A;  4CNK A;  2OA1 A;  1JRZ A;  1RP0 A;  4AP1 A;  5GRT A;  1Y0P A;  2B7R A;  1V59 A;  2XFQ A;  4H4V A;  3C4A A;  5ER0 A;  1EL8 A;  2R9Z A;  1EL9 A;  1P2E A;  3DK8 A;  5HXI A;  5JCI A;  4CNJ A;  1H6V A;  1DNC A;  4H4S A;  3RED A;  1FEA A;  2R4E A;  1FL2 A;  2YLS A;  3C96 A;  4H4U A;  1GPE A;  3NK1 X;  3LJP A;  1F8W A;  2WOW A;  1KF6 A;  1ZKQ A;  1Y56 B;  4EMI A;  3F8P A;  3DGZ A;  4LU6 A;  3L8K A;  3PO7 A;  1NG3 A;  2YM2 A;  4TLX A;  1H84 A;  2XFN A;  3D1C A;  3SZ0 A;  3NYE A;  3UTE A;  3V76 A;  3T2K A;  4EQX A;  4O5Q A;  2VVL G;  1D4C A;  2EQ8 A;  1VG0 A;  4Z24 A;  2Q0K A;  2YLZ A;  3T37 A;  1NG4 A;  3PS9 A;  2VOU A;  2NPX A;  1NHR A;  5M10 A;  1FEB A;  4C3X A;  5U1O A;  4TM3 A;  1D5T A;  3CN8 A;  2GR0 A;  1PBF A;  2VQ7 A;  3CTY A;  4A7A A;  3GRT A;  1DXL A;  2Z5Y A;  1TYT A;  5DBJ A;  2DKI A;  1JRY A;  2OLO A;  2JK6 A;  4II3 A;  1IUT A;  3Q6J A;  4Z43 A;  1Q1W A;  4K7Z A;  1VG9 A;  4JN9 A;  2RGO A;  5LV9 A;  3SM8 A;  3ZDN A;  4K5S A;  4JNQ A;  1NDA A;  2YVG A;  3G5Q A;  3FG2 P;  4I59 A;  4CCR A;  1D4E A;  2WDR A;  3T0K A;  3KPK A;  3H8L A;  3UTG A;  3HZL A;  1IUU A;  2GV8 A;  2V3B A;  1YQ4 A;  2CUL A;  2JB3 A;  3RP7 A;  3AEE A;  3VQR A;  3UKF A;  5HYM A;  5FS8 A;  2BRY A;  3B3R A;  4U8L A;  1TYP A;  2RGJ A;  4E0V A;  5JCL A;  3IHM A;  1L9C A;  5KVI A;  2C64 A;  4NTC A;  1GRA A;  4OPI A;  1FEC A;  2AAQ A;  3CGE A;  3NTD A;  3T14 A;  4H50 A;  1OJC A;  1D4D A;  1F8R A;  4REK A;  1GV4 A;  2YR5 A;  1CBO A;  4AT2 A;  1S2Y A;  1CF3 A;  4GRT A;  2A89 A;  1LQU A;  1S3E A;  4YTM A;  2WPE A;  3UOZ A;  3AEA A;  4USQ A;  1DJN A;  2X3N A;  1DOE A;  1DOB A;  3D8X A;  2CDU A;  2WP5 A;  4Y4M A;  4APN A;  4UDR A;  4GDE A;  4OPD A;  1JOA A;  5JCN A;  4H2R A;  4AOX A;  4KPR A;  3AD9 B;  4X9N A;  4WCT A;  1CC6 A;  5IQ4 A;  4HA6 A;  4GDP A;  4U2S A;  2BS3 A;  3AD8 B;  4G73 A;  1ZK7 A;  1OJT A;  1GRT A;  1E1N A;  3V3N A;  2B76 A;  2Y6R A;  4C3Y A;  3NN6 X;  1PXB A;  1LVL A;  2ARD A;  2BCG G;  2XVH A;  2XVF A;  3AB1 A;  3KU9 A;  3RP8 A;  2YLR A;  2WP9 A;  1VQW A;  2BRA A;  3NYF A;  3P4R A;  4U8I A;  3DJG X;  1BWC A;  4A9W A;  2WU2 A;  2APG A;  4B66 A;  3H4K A;  1YQZ A;  2IVD A;  2XYO A;  2WOV A;  1BGJ A;  1IUW A;  3UP4 A;  2E1M A;  1EL7 A;  1VDC A;  3LZW A;  3SY4 A;  1FOH A;  3CPI G;  2VVM A;  4Y4L A;  4NEW A;  1ZP0 A;  3KA7 A;  4Z26 A;  1JEH A;  5CQF A;  4LII A;  4YSY A;  3KKJ A;  2YR4 A;  3AYJ A;  3ISH A;  1S7M A;  2VRM A;  2NVK X;  1REO A;  1NPX A;  1LV0 A;  1GTH A;  3BNM A;  2X8H A;  3T31 A;  3UOY A;  4YSH A;  2ZZB A;  3QFA A;  2FBW A;  1CJ3 A;  2FJA A;  2GB0 A;  4MJW A;  2TMD A;  4H7U A;  4U2L A;  4CCQ A;  5C2T A;  2YVF A;  4CY8 A;  2B9Y A;  4O5U A;  3I6D A;  3BHK A;  2YQU A;  3EPT A;  1TDO A;  3T2Y A;  4C5O A;  4EQR A;  1Z6L A;  3QVP A;  2XLR A;  1N4U A;  1OJ9 A;  3FPZ A;  4J2W A;  3ICR A;  1BZL A;  3II4 A;  1NAA A;  2ACZ A;  3HYV A;  3CGC A;  3FIM B;  1GSN A;  4HB9 A;  1CJ2 A;  2X8G A;  2F5Z A;  1E39 A;  2XLS A;  3H8I A;  2JBV A;  1CC4 A;  1KNP A;  1PBD A;  1PDH A;  3AE8 A;  4U8M A;  1CC2 A;  1H82 A;  5BUL A;  1GRH A;  5FMH A;  1PJ7 A;  1PN0 A;  3UKL A;  4BJZ A;  2C72 A;  4Z2U A;  3SFE A;  4BJY A;  3M13 A;  3UOV A;  4CY6 A;  2GQF A;  3ICT A;  2Q6U A;  4AT0 A;  3COX A;  2BS2 A;  3GSI A;  2EQ9 A;  4D04 A;  3NGC X;  3NNE A;  3L1R A;  1NHQ A;  4GR1 A;  2QAE A;  1TDK A;  3AEB A;  2W0H A;  3OZ2 A;  1ZMC A;  4J31 A;  4II2 A;  1D7L A;  5HY5 A;  4IA5 A;  4K22 A;  1BGN A;  2V6O A;  4U8O A;  3GD3 A;  2TPR A;  3S61 A;  1COY A;  3EAN A;  1TDF A;  3UTF A;  3K7M X;  3PVC A;  3AD7 B;  3ICS A;  4P9S A;  3T2Z A;  4B63 A;  4RG3 A;  4BK1 A;  5CKU A;  5EOW A;  2Y6Q A;  3IHG A;  1PHH A;  4J33 A;  3RNM A;  3ADA B;  3GMC A;  3KD9 A;  1GT8 A;  1JU2 A;  4Z2T A;  2ZBW A;  3JSK A;  2WDQ A;  5HHF A;  3LAD A;  1KN0 A;  1JNZ A;  1H81 A;  1N1P A;  2BAC A;  5EBK A;  2YG5 A;  4U8J A;  4USR A;  2GR3 A;  1PXC A;  4X4J A;  4CRT A;  2WPC A;  1ELI A;  4YXD A;  2WQY A;  2RGH A;  2JB2 A;  2I0Z A;  3UKK A;  3M12 A;  4G6H A;  4PAB A;  1Q1R A;  4TM0 A;  1GRF A;  4B64 A;  4NEV A;  1KDG A;  3GWD A;  1GXF A;  4EIP A;  4AP3 A;  1JNR A;  2GMH A;  1MXT A;  3AYI A;  3FMW A;  3GDN A;  4IVM B;  3SFD A;  2C76 A;  2BAB A;  4C74 A;  3AE9 A;  1O94 A;  2WU5 A;  3NHO X;  3SGL A;  1NHP A;  3P4P A;  3V3O A;  5KXJ A;  2BXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...