5JCIA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
432
structure length
432
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPEPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFYSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVANIEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Os09g0567300 protein
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
total genus 141
structure length 432
sequence length 432
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jciA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jciA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jciA02
3KVEA 4JQ9A 5CKUA 1MO9A 1NHSA 5KVIA 2C67A 2V6OA 3GD3A 3Q6JA 1CC6A 1OJ9A 3OC4A 3GWDA 1NEKA 3SGLA 2EQ9A 3QFAA 3RP6A 4H2NA 4MJWA 3CPHG 1YY5A 3UP4A 4YSXA 4X9MA 2JKCA 4GDPA 4OPIA 3CGDA 1GETA 4K8DA 3GMCA 2R0PA 2BCPA 1JOAA 5DBJA 2XDOA 4OVIA 4CBQA 2X99A 4P9SA 3CN8A 3C4NA 3AXBA 1EL5A 4UDRA 1DOBA 4Y4LA 4A7AA 2VVMA 3G5RA 1PHHA 1MXTA 2JB2A 5HYMA 3BHKA 4AP3A 3IF9A 3CNTA 1GV4A 2ZZ0A 1D4CA 4C74A 4BJYA 1PJ7A 2WOVA 2JK6A 2APGA 2OAMA 1E1NA 1O94A 4ICYA 2WU2A 3CTYA 4U8OA 3UOZA 3C96A 2YVFA 1JNZA 3UKKA 1ONFA 2CVJA 2XFPA 1GTHA 1D4DA 2ZBWA 2WHDA 2OA1A 3H8LA 2WPFA 3DK4A 1M64A 3FPZA 4GR1A 1PJ5A 2BC0A 2B9YA 2BK4A 4ZCDA 4AT0A 5HXIA 5FS8A 4PABA 5EBKA 2GR3A 1L0VA 2YLTA 4BK2A 4K7ZA 2WOWA 4GUVA 4OPDA 2BABA 2UZZA 1PBEA 5EB4A 1X31B 4U8NA 3ZYXA 3ATQA 1ZOVA 2R4EA 3S61A 3KU9A 2V60A 4JDRA 2WQYA 2YLZA 3AB1A 3G5SA 1JRZA 2ZZBA 3UTHA 1D5TA 1GERA 2BCGG 3LZXA 4JY2A 2NPXA 2ACZA 5KOXA 4K5RA 2YVJA 3H8IA 3NK0X 2VQBA 1LPFA 4BV6A 2PYXA 1Q1WA 3DGHA 1ZK7A 1L9EA 2GAHB 1OJAA 1Y0PA 2GVCA 3FG2P 4A9WA 1S3BA 1IUWA 4KX6A 3LOVA 4A79A 4J33A 3CGBA 2R4JA 1JRYA 2WP5A 2BXRA 3KD9A 1S2QA 1O95A 3FMWA 1GPEA 2XVEA 4OPCA 1NPXA 3DA1A 1YQZA 2HQMA 2JAEA 5KXJA 4FX9A 2E5VA 3BNUA 2YQUA 1IUSA 2JB3A 4PAAA 2RABA 2YVGA 4USRA 2H88A 2CFYA 4J2WA 3K7TA 4C3XA 2F5ZA 2R46A 4WCTA 1D4EA 4CRTA 4H4ZA 5FMHA 1BGNA 4B66A 3QSMA 3NYFA 3UTGA 1GRAA 1ZP0A 2GV8A 1DXLA 4H4SA 2RGOA 1PBFA 1ZMCA 1TDOA 3AE5A 3F8PA 1EL8A 4Y4MA 1BGJA 4B64A 3P4SA 1DODA 3RP7A 4D03A 1CJ2A 4TLZA 4U2TA 2GRTA 4Z2UA 5FS7A 1FOHA 4A65A 4YTNA 2OLOA 4REKA 2WETA 4TM3A 1GALA 2A8XA 3DK9A 2XLRA 3I3LA 1KNPA 4YSHA 3AEAA 1XDIA 3RHAA 2YM2A 5M0ZA 2GAGB 4O5QA 4FDCB 3DJEA 4TM0A 1COYA 4A6NB 3QVPA 2X8GA 1E39A 1H81A 3QVRA 3UKQA 4EM3A 3EANA 4DNAA 2V61A 3L1RA 4U2SA 1IUTA 2AR8A 3E1TA 2C70A 2GMJA 4FK1A 4C3YA 4Z2TA 1N4WA 2XLTA 2Q0LA 2YLSA 4APNA 4J57A 4H4RA 3NTAA 3VRDB 3NHOX 4YKGA 1EL7A 1TDFA 2O9ZA 2VZ2A 4I58A 1GRHA 3ICRA 4EM4A 3M13A 5BUKA 5GRTA 2YAUA 1B37A 4J31A 4U8KA 3PVCA 2YG6A 1YQ4A 3UOYA 3URHA 3K30A 2BS4A 3ZDNA 1XANA 2YG7A 3LXDA 4B1BA 2IIDA 3K7MX 2YG3A 1F8SA 3P4QA 2IVDA 4Y4NA 4E0VA 1IUXA 3L8KA 4TM4A 5JCNA 1IUUA 3DMEA 3HZLA 4WX1A 4H4XA 1REOA 3GYIA 2TPRA 3NNEA 4K2XA 2W0HA 4LIIA 1KFYA 1LV0A 2DKHA 2XVFA 1YQ3A 2X8CA 3BNMA 1H86A 4J56A 3CNJA 2E4GA 2WPCA 2YLWA 5U25A 3VR8A 3AEBA 1PXBA 4J36A 2QA1A 2GR1A 3GRTA 5KVHA 3GSIA 1K0JA 3AD8B 1KDGA 3M12A 3REDA 2VVLA 5BULA 3CGCA 3SQPA 2R0CA 3NLCA 1KNRA 5KRQA 3B3RA 2Y6QA 4X9NA 4YKFA 3NIXA 4A6NA 3ALLA 3NRNA 5IPYA 1FEBA 2C3DA 1DOEA 1OJDA 2GH5A 2TMDA 4A5LA 2GR0A 3F8DA 1MOKA 1DJQA 3QFBA 1JNRA 5JCIA 2B7SA 3NT6A 4JY3A 1P2EA 1PDHA 4TM1A 3II4A 2XFOA 1CL0A 3FIMB 3ABVA 3DJJA 2H89A 3CGEA 1CC4A 4JN9A 4YTMA 3VQRA 3JSKA 2Q0KA 2BS3A 2ARDA 1NHPA 1CF3A 1D7LA 1H84A 5FS6A 5CQFA 2B76A 4GCMA 3AEFA 2X50A 1KF6A 4NEVA 5JCKA 1TRBA 2YLRA 3ICTA 4NTEA 4Z44A 1GREA 2XLPA 3ATRA 3UKFA 3GD4A 2Q7VA 2BA9A 1W4XA 5J7XA 4C5OA 1H7WA 1LVLA 2IVEA 2DKIA 4NZHA 3AE9A 2FJBA 1P2HA 1FECA 4A99A 2EQ6A 1E1LA 2I0ZA 1ZX9A 4BJZA 3G5QA 4EMIA 3LB8A 4ZN0A 1CJ4A 3P4PA 1DJNA 1VG0A 5J60A 3NN6X 1VG9A 4YT0A 4FK1C 3NN0X 5C2TA 3UCLA 4OPGA 5GSNA 3SFEA 5C3JA 1VRQB 4O5UA 2RGJA 4OPTA 4M52A 3ISHA 2CDUA 4EMJA 1H82A 1NHRA 4XWZA 3DK8A 1BZLA 3NH3X 4I59A 3GMBA 3ALJA 4N9XA 3NYEA 1QLBA 4BK1A 2WDQA 3ICSA 1B4VA 2XVIA 4D04A 4LU6A 3ALMA 1Z6LA 3SFDA 2GEWA 2WP9A 3UKPA 2C72A 1GRBA 3NTDA 3DGZA 1B8SA 1RYIA 4HB9A 5JCLA 3D8XA 1EBDA 3S5WA 2GQWA 1LJ1A 2XFQA 3CPIG 2WS3A 1XPQA 4GF7A 1AOGA 4EQXA 1IUVA 2FJAA 4H2RA 1N4UA 2BC1A 2WEUA 3CNSA 3V76A 1GTEA 2XFNA 2NVKX 2WU5A 2V3AA 2V3BA 2XFUA 2XYOA 4IV9A 1DOCA 1H6VA 2GQFA 3GWFA 5IQ4A 4IA5A 3QJ4A 2GMHA 1F8RA 1K0LA 3UTEA 1FEAA 2B9WA 2A89A 3OZ2A 1GT8A 4JNAA 3O0HA 2QA2A 1GOSA 1OJCA 1PBDA 4EQSA 3LADA 4EQRA 2BS2A 2E1MA 4U8LA 2BK3A 4XWRA 1Q1RA 1DNCA 1ZY8A 3AEGA 2WOIA 5TR3A 2FBWA 4H4TA 4Z24A 3KPFA 2JBVA 1SEZA 1ZMDA 1GRFA 1XHCA 5JCMA 1HYUA 1Y56B 1D7YA 4DGKA 1YKJA 4UP3A 4JNQA 1LTXR 5IQ1A 1GSNA 2YM1A 2WDRA 5ER0A 4CY8A 5FS9A 1NENA 4H4QA 4NTCA 3GDNA 2YG5A 4AOXA 5KWFA 2C3CA 2XVJA 5U1OA 1ZOYA 4TLXA 1S3EA 2CULA 3UOVA 3AE7A 4B67A 3DH9A 2BXSA 2ZZCA 2WDVA 3BI4A 1ELIA 2C75A 4YSYA 4U8PA 3AD7B 2B9XA 5HHFA 4CNKA 3COXA 3IWAA 4H4VA 2A87A 2C66A 2PHHA 3QSEA 3CPJG 4K5SA 4YWOA 2X8HA 4USQA 3KLJA 1E7PA 4CNJA 3NYCA 2RGHA 1E1KA 3KA7A 1S2YA 1JRXA 2C7GA 5BVAA 1TDKA 1F3PA 1E6EA 1TDNA 1K0IA 4EIQA 3VRBA 3PO7A 3AYJA 3AYIA 2C76A 3IHMA 3I6DA 1TDEA 4UDPA 1PJ6A 4Z25A 1CJ3A 2GF3A 1H7XA 2X3NA 2OLNA 3BI5A 1BF3A 2B7RA 3GDPA 2YR6A 2WBAA 3LJPA 2EQ7A 4HA6A 1Q9IA 1BWCA 2VQ7A 3RP8A 1Y56A 3ITJA 1E1MA 4IA6A 4X4JA 4GRTA 4LA1A 3BHFA 5L46A 4U2LA 4C77A 1GXFA 4U8JA 1O5WA 4OPUA 3RNMA 2WESA 2BACA 3AE4A 1NDAA 1LQUA 2VRLA 3P4RA 3ADAB 3T37A 2Q6UA 1GNDA 4YXDA 1ZDLA 1GEUA 1B5QA 3AE2A 4Z43A 4OCGA 1PBBA 1NG4A 1L9DA 4BK3A 3GYJA 2GB0A 1RP0A 4RG4A 4NEWA 1L9CA 4IVMB 4K22A 1PXAA 2Z5YA 1PBCA 1V59A 1CBOA 1F6MA 1VQWA 1KSSA 2BYBA 3UKHA 4J34A 4YTPA 4Z26A 4H4YA 1KSUA 2WPEA 2AQJA 3BI2A 1TYTA 2QAEA 1OJTA 1LQTA 1VDCA 2JB1A 4H2QA 1ZKQA 5EB5A 1K4QA 3IC9A 3NK1X 2YR4A 5EOWA 4B68A 3NK2X 4U8MA 4CY6A 5U63A 1NAAA 4EIPA 3AE3A 3CNPA 4B69A 1FCDA 4H7UA 1TYPA 3UKLA 1F8WA 1H83A 2GR2A 2C64A 2XLUA 1CJCA 3M0OA 4KPRA 3LZWA 4NTDA 3AD9B 2VOUA 3NGCX 4UDQA 3SM8A 3UOXA 4H50A 4DSGA 2V5ZA 2C73A 4OPLA 2YLXA 4B65A 1JU2A 3AEEA 4RG3A 2YG4A 4U8IA 4CCQA 3VR9A 1BKWA 4YSZA 2VRMA 1GRGA 1M6IA 3H4KA 2AAQA 4BURA 4AT2A 3F8RA 3AE6A 1QO8A 3EAOA 1FL2A 2XLSA 4ZCCA 3PS9A 2OALA 1N1PA 1PS9A 3B6DA 3Q9TA 2EQ8A 2R0GA 3KKJA 5BRTA 3V3OA 2XVHA 1PN0A 3AECA 3R9UA 3AE1A 3WE0A 3GRSA 1EL9A 3UKAA 1QJDA 3IHGA 3CIRA 1GESA 2QCUA 1PXCA 1GRTA 3AWIA 3AEDA 2R9ZA 4RSLA 3EPTA 3D1CA 4DSHA 3P9UA 2YWLA 3FBSA 3DJDA 3EF6A 1N4VA 1CHUA 1CC2A 2XCGA 4EMWA 2VVLG 2J3NA 2WP6A 2Z5XA 4GDEA 4AP1A 5LV9A 4B63A 2Y6RA 4ADWA 1IJHA 3P1WA 4CCRA 2FJDA 5KOWA 2C65A 4XXGA 3UP5A 3DJGX 3CNDA 4H4WA 2R45A 3AYLA 1JEHA 4EQWA 4AOSA 4Z2RA 1NHQA 3NKSA 3NG7X 4H4PA 4IVOB 3C4AA 2FJEA 3V3NA 1NG3A 4ECHA 3UTFA 3VRAA 3QSSA 2YR5A 4H4UA 1UKVG 5M10A 3K7QX 5HY5A 1RSGA 4H2PA 3AE8A 2BK5A
chains in the Genus database with same CATH superfamily
3KVEA 3V4BA 5CKUA 1P48A 2PP1A 1NHSA 5KVIA 3GD3A 1OJ9A 4HNCA 2EQ9A 3RP6A 1YY5A 1W6TA 3UP4A 4GDPA 1JDFA 2QGYA 2XDOA 4OVIA 2X99A 1F9CA 4UDRA 1GV4A 1D4CA 3KPKA 2ONEA 4ICYA 1E1NA 3N6HA 4U8OA 3DERA 1JNZA 1D4DA 3FPZA 2P3ZA 5EBKA 1DTNA 5EB4A 1X31B 3ZYXA 2R4EA 2QJNA 3AB1A 2PU1A 1GERA 2BCGG 2YVJA 1N5WC 1ZK7A 3FG2P 1IUWA 4KX6A 4A79A 3KD9A 4OPCA 1YQZA 2HQMA 2JAEA 4FX9A 2E5VA 2H88A 2F5ZA 4E8GA 2R46A 2AKMA 4B66A 3UTGA 1PBFA 3D47A 2ZADA 4Y4MA 1CJ2A 1FOHA 4YTNA 4REKA 2OFJA 1GALA 2XLRA 1XDIA 5FJPA 2YM2A 4O5QA 3HPFA 2X8GA 4EM3A 3L1RA 4U2SA 3PFRA 1IUTA 2C70A 1WUFA 2GMJA 4Z2TA 2XLTA 3T2KA 4YKGA 2O9ZA 2VZ2A 4EM4A 5GRTA 1B37A 4JN8A 3EKGA 3HYXA 2YG6A 1YQ4A 3URHA 3ZDNA 2YG7A 1PDYA 3K7MX 1F8SA 4Y4NA 3DEQA 5JCNA 2TPRA 2QVHA 1LV0A 2DKHA 1YQ3A 2QJMA 2WPCA 3V5FA 5U25A 2YLWA 4J36A 4X2PA 3GRTA 3PWIA 1SJBA 3Q45A 2VVLA 5BULA 4MKSA 3B3RA 2Y6QA 1MNSA 4A6NA 3Q4DA 3FV9A 1DOEA 1OJDA 4A5LA 3ABVA 3CGEA 1CF3A 1H84A 2B76A 4GCMA 3K1GA 4NEVA 5JRBA 5EU9A 2PMQA 2XLPA 4Z44A 3NXLA 5J7XA 1H7WA 1LVLA 2IVEA 2DKIA 2XH4A 3JW7A 1P2HA 2EQ6A 4HYRA 1E1LA 1ZX9A 4A35A 4BJZA 4EMIA 1FHUA 3LB8A 4HCDA 1DJNA 1VG0A 1VG9A 4YT0A 3MQTA 3UCLA 4OPGA 1VRQB 4O5UA 4OPTA 3QTPA 3NH3X 3R1ZA 1N62C 3NYEA 2WDQA 2XVIA 1Z6LA 1RYIA 2BRAA 1EBDA 2GQWA 2PP3A 2WS3A 1AOGA 1ZXIC 1FFUC 4IA5A 2GMHA 3UTEA 2A89A 3UXKA 2QA2A 2BS2A 4EQRA 2BK3A 2WOIA 2FBWA 1NU5A 1GRFA 1HYUA 1D7YA 4DGKA 4J1OA 3DG3A 5ER0A 4AOXA 5U1OA 2CULA 3UOVA 3DH9A 3SR6B 1ELIA 3SZWA 4YSYA 3A7AA 5HHFA 4CNKA 3IWAA 4H4VA 4KT2A 4K5SA 2X8HA 4USQA 3ES8A 3R11A 3EEZA 3KA7A 2OQYA 2C7GA 3SYIA 1TDKA 1F3PA 4K2SA 1TDNA 3VRBA 4H83A 3IHMA 3I6DA 1SB3B 1TDEA 1CJ3A 3QKEA 5FJRA 1BF3A 2B7RA 1TKKA 2WBAA 1BWCA 3RP8A 4GRTA 3OW1A 1GXFA 1O5WA 3RNMA 2BACA 2AL2A 1LQUA 3P4RA 3ADAB 3SXIA 2PTYA 7ENLA 4JHMA 4K1WA 4YWSA 4Z26A 4HNLA 1K4QA 3CB3A 4EIPA 3CNPA 3VCCA 1FCDA 1H83A 2XLUA 2C4CA 3LZWA 3AD9B 2VOUA 4H50A 4DSGA 3DESA 2YLXA 3MSYA 4RG3A 1BKWA 2GGHA 4AT2A 1MUCA 3AE6A 6ENLA 1WUEA 1N1PA 3B6DA 2EQ8A 3UXLA 3GRSA 3WE0A 3MUCA 3UKAA 3L5OA 3NVWB 3T4WA 3FBSA 4JN7A 4NWZA 2OZ3A 2XCGA 4EMWA 4GAPA 4GDEA 5KOWA 2C65A 4XXGA 3UP5A 3DJGX 5FJUA 2R45A 1JRPA 4IVOB 4H4PA 3C4AA 2FJEA 3T2ZA 1TZZA 3K7QX 4H2PA 3AE8A 3Q6JA 4A3RA 3QPEA 1EC9A 4YSXA 1GETA 3NVZB 1SJCA 4ZOHB 4P9SA 3C4NA 4E4FA 1N60C 4Y4LA 4A7AA 2VVMA 2JB2A 4AP3A 3IF9A 2ZZ0A 1P43A 2OAMA 3RCYA 4TVYA 2YVFA 1ONFA 3N6JA 2WHDA 4G74A 3BOXA 2PGEA 4GR1A 3B9JB 2B9YA 3CYJA 4AT0A 3DG6A 1IYXA 4BK2A 4IT1A 4K7ZA 4OPDA 2UZZA 3UJEA 3ATQA 1ZOVA 4JDRA 2YLZA 3G5SA 1JRZA 2ZZBA 3UTHA 1D5TA 4HCLA 3T0KA 3NK0X 4BV6A 3NRZB 1Q1WA 4A6GA 2GAHB 1OJAA 2GVCA 2OPJA 3NVYB 3GD6A 3CGBA 2R4JA 1S2QA 1MRAA 2XH0A 3AM9A 5KXJA 3BNUA 2XSXA 4PAAA 4J2WA 4C3XA 1D4EA 3NYFA 2P88A 2GV8A 3CK5A 3AE5A 3F8PA 4DWDA 2PCEA 3RP7A 4D03A 4U2TA 4Z2UA 5FS7A 4DXKA 1V97A 3DK9A 3I3LA 3RHAA 5M0ZA 4MMWA 3DJEA 1COYA 3QVPA 1E39A 3UKQA 3QVRA 4DNAA 2V61A 2AR8A 3E1TA 2YLSA 3NTAA 3NHOX 1TDFA 4I58A 3ICRA 3VFCA 3K30A 3ZLGA 3DMEA 1REOA 3GYIA 2W0HA 1H86A 2E4GA 3GSIA 1K0JA 3REDA 3SQPA 3OZMA 5KRQA 4X9NA 3NIXA 3ALLA 3NRNA 5IPYA 2C3DA 2TMDA 4MGGA 3NT6A 1STZA 4ZA0A 4E4UA 1P2EA 4GYPC 3DFYA 2GGGA 3DJJA 3JSKA 2BS3A 2ARDA 2X50A 1KF6A 5JCKA 3ICTA 3IJQA 4M0XA 4NTEA 1GREA 3UKFA 3GD4A 4GFIA 2OZ8A 4C5OA 3NS1B 1FECA 4EWJA 2I0ZA 1KD0A 3G5QA 3P3BA 1FFVC 2W55A 1FO4A 3NN6X 3NN0X 5C2TA 3SFEA 4M52A 4EMJA 1H82A 4XWZA 3ZLFA 3I6EA 4I59A 4BK1A 1B4VA 4D04A 2GEWA 2C72A 1GRBA 4G73A 3NTDA 1B8SA 3CPIG 4NNJA 1XPQA 4GF7A 3S5SA 3CMMA 4H2RA 2BC1A 1GTEA 3R07C 2XFNA 2WU5A 2V3AA 4IV9A 1DOCA 1H6VA 2XH7A 3GWFA 2P0IA 3QJ4A 1F8RA 3HW2A 3DDMA 1K0LA 1XS2A 3R10A 3O0HA 1OJCA 2OO6A 1PBDA 4EQSA 4XWRA 1Q1RA 4H4TA 4Z24A 1SEZA 1XHCA 5JCMA 1Y56B 3FYYA 4UP3A 4JNQA 1N63C 1GSNA 4CY8A 4H4QA 5KWFA 2C3CA 2XVJA 4TLXA 3H70A 3BI4A 2WDVA 2C75A 4U8PA 5KMRA 4DHGA 2A87A 2PHHA 4YWOA 3KLJA 1E6EA 4UDPA 2X3NA 2OLNA 3LJPA 2EQ7A 2VQ7A 3ITJA 4IA6A 4X4JA 3BHFA 4U2LA 2WESA 1MDRA 1ZDLA 1GEUA 4HPNA 4Z43A 4OCGA 3NVVB 1PBBA 1NG4A 4RG4A 4IVMB 4K22A 2OKTA 1PXAA 2Z5YA 1PBCA 1F6MA 1VQWA 4YTPA 1KSSA 3ZVHA 4H4YA 2AQJA 3BI2A 1OJTA 5EB5A 5IDZA 4B68A 3NK2X 1JCTA 4CY6A 4B69A 4H7UA 1TYPA 1F8WA 3SSZA 1H2IA 2C64A 4UDQA 4NTDA 2QDEA 3I4KA 2OX4A 4OPLA 3AEEA 3QN3A 2YG4A 4U8IA 3V3WA 1R0MA 2VRMA 1M6IA 2AAQA 3EAOA 2POZA 4G6GA 4TVWA 3PS9A 2OALA 1S7MA 3ENLA 1PDZA 3AECA 3AE1A 4IP5A 2HNEA 1QJDA 3IHGA 2QCUA 1PXCA 2W3SA 2R9ZA 3EPTA 3DJDA 3UJFA 1N4VA 2VVLG 3ETRB 1SJDA 2WP6A 4AP1A 3HRDC 5LV9A 4B63A 1RVKA 3H12A 1IJHA 3P1WA 4AOSA 1EC8A 4Z2RA 1KCZA 3V3NA 1NG3A 3UTFA 3VRAA 2YR5A 3TCSA 1ECQA 1RSGA 3SZCA 3IJLA 4F4RA 2OZTA 3THUA 2V6OA 3RRAA 3GWDA 3MY9A 3SGLA 3QFAA 4Z17A 4X9MA 2JKCA 4OPIA 3N4FA 4K8DA 3GMCA 1FIQB 4CBQA 3CN8A 3AXBA 2P8BA 1MXTA 3BHKA 4BJYA 1PJ7A 5KMQA 2FKPA 4GGHA 3CTYA 3UOZA 3UKKA 2CHRA 1GTHA 2ZBWA 2OA1A 3H8LA 2OQHA 2P8CA 1PJ5A 2BK4A 5HXIA 4ZCDA 5FS8A 4PABA 4H2HA 2WOWA 2BABA 3HYVA 5ENLA 3P0WA 3PWGA 3S61A 1L8PA 3LZXA 4JY2A 5KOXA 3H8IA 3ES7A 2VQBA 1LPFA 3DGHA 1L9EA 2DW7A 2BXRA 3CXOA 3FMWA 1GPEA 2XVEA 3DA1A 3DIPA 3MKCA 2YQUA 4Z1YA 2RABA 2YVGA 2CFYA 3SBFA 3K7TA 3SX6A 4WCTA 4H4ZA 1BGNA 3QSMA 4H4SA 2RGOA 1TDOA 1ZMCA 2HXTA 1EL8A 4B64A 1DODA 4TLZA 1ELSA 2GRTA 4A65A 2OLOA 2GL5A 2WETA 4YSHA 1KNPA 3AEAA 4TM0A 4A6NB 1H81A 4G7FA 3EANA 3U4FA 4IP4A 4C3YA 1N4WA 1N61C 5FJOA 2PPGA 4APNA 4H4RA 3EUB3 1EL7A 3GYXA 2I5QA 2OVLA 3A7UA 2BS4A 3LXDA 2IIDA 2YG3A 1IUXA 3L8KA 4TM4A 1IUUA 4WX1A 3UGVA 3BNMA 4J56A 3CNJA 4GIRA 2QA1A 2GR1A 5KVHA 3M12A 2R0CA 4YKFA 1FEBA 2GH5A 2GR0A 3F8DA 1MOKA 1DJQA 3QFBA 1YEYA 4GMEA 2B7SA 4JY3A 3OPSA 3SZFA 4TM1A 4IHCA 2XFOA 3FIMB 2H89A 1CC4A 4YTMA 3VQRA 2Q0KA 4E5TA 1D7LA 5FS6A 3UJRA 3AEFA 2YLRA 1TRBA 3ATRA 1BKHA 4M6UA 2Q7VA 2BA9A 1W4XA 3AE9A 2XGZA 4KEMA 3JVAA 1KN0A 5J60A 2HXUA 4GYPA 2RGJA 2CDUA 1NHRA 3DK8A 1BZLA 3GMBA 3A7RA 4N9XA 3ICSA 3ALMA 4G8TA 3SFDA 2PODA 3HYWA 3UKPA 3I6TA 4HB9A 3S5WA 1R6WA 1IUVA 4EQXA 2FJAA 2PA6A 2WEUA 3CNSA 2NVKX 1T3QC 2XFUA 2XYOA 5IQ4A 4GGBA 1FEAA 3OZ2A 2E1MA 1DNCA 1ZY8A 5TR3A 3KPFA 2JBVA 1ZMDA 3SN0A 3PK7A 1YKJA 1LTXR 5IQ1A 5FS9A 4NTCA 2YG5A 2AL2B 2BXSA 2ZZCA 4J3ZA 2E5AA 3BSMA 3COXA 1NELA 4II2A 4DYEA 3NO1A 3CPJG 3TWAA 1E7PA 4CNJA 3NYCA 2RGHA 3OP2A 4G9KA 4EIQA 3RGTA 2C76A 3UCDA 3R25A 3TJ4A 4Z25A 2GF3A 1H7XA 1XPYA 4HN8A 3T9PA 2YR6A 4HA6A 4LA1A 3AMZA 4U8JA 1E9IA 3R0UA 4OPUA 3H8AA 3AE4A 3TTEA 2Q6UA 4ENLA 3AE2A 4BK3A 3GYJA 4ROPA 1RP0A 4NEWA 3NZGA 1V59A 2O56A 3SN1A 1KSUA 1TYTA 2QAEA 1LQTA 1VDCA 2DW6A 5EOWA 5U63A 3AE3A 3UKLA 3UJSA 4KPRA 3NGCX 3T6CA 3SN4A 2V5ZA 1JU2A 4II3A 3STPA 3BJSA 4CCQA 3VR9A 4YSZA 1GRGA 3H4KA 4BURA 3F8RA 1QO8A 3FJ4A 2XLSA 4ZCCA 2R0GA 3DGBA 5BRTA 3R9UA 1EL9A 4IZGA 2PSNA 3CIRA 1GESA 1GRTA 2PTXA 3D1CA 4DSHA 3P9UA 2YWLA 2NQLA 1CHUA 2PU0A 1CC2A 1EBGA 4K8GA 4ADWA 2QDDA 5FJTA 3CNDA 4H4WA 3V5CA 3AYLA 1NHQA 3NKSA 3FCPA 4ECHA 1N5XA 4H4UA 3UJ2A 1UKVG 5M10A 5HY5A 2BK5A 3D9XA 4JQ9A 3SJNA 1MO9A 1KKOA 2C67A 1CC6A 3OC4A 1NEKA 4H2NA 4MJWA 3CPHG 3ZVIA 3T14A 3CGDA 2BRYA 2R0PA 2BCPA 1JOAA 5DBJA 3MZNA 3UCCA 1EL5A 1DOBA 3G5RA 3KUMA 1PHHA 5HYMA 3PG6A 3CNTA 4C74A 5G5HB 2WOVA 2JK6A 2APGA 1O94A 2WU2A 3C96A 2CVJA 2XFPA 1FHVA 2WPFA 3DK4A 1M64A 2BC0A 2GR3A 1L0VA 3GC2A 3QLDA 4DX3A 2YLTA 4FI4A 2W3RA 4GUVA 1PBEA 4U8NA 3T31A 3KU9A 2V60A 2WQYA 1JROA 1ONEA 5G5GB 2NPXA 2ACZA 4K5RA 2PYXA 3B97A 4G6HA 1Y0PA 4A9WA 1S3BA 3LOVA 4J33A 1JRYA 2WP5A 2GGIA 1O95A 1NPXA 1X2HA 1IUSA 2JB3A 2GGEA 2PS2A 4USRA 3VCNA 4KPLA 4ZCWA 2HZGA 4CRTA 4H19A 5FMHA 4E6MA 1GRAA 3RR1A 1ZP0A 3VC5A 1DXLA 2AKZA 3T8QA 3VC6A 3H7VA 1BGJA 4IL0A 3P4SA 1KKRA 4TM3A 2A8XA 4H1ZA 3TW9A 2GAGB 4FDCB 4FK1A 2Q0LA 4J57A 3VRDB 1GRHA 3M13A 5BUKA 2YAUA 4J31A 4U8KA 3PVCA 3UOYA 2AL1A 1XANA 4B1BA 3P4QA 2IVDA 4E0VA 3HZLA 4H4XA 3NNEA 4K2XA 4LIIA 3TQPA 1KFYA 2QJJA 2XVFA 2X8CA 4IL2A 3VR8A 3AEBA 1PXBA 2PTZA 4GAVA 3AD8B 1KDGA 3AN1A 3RITA 3CGCA 3NLCA 1KNRA 1JPMA 2PTWA 2ZC8A 3TJIA 5BOFA 3GY1A 1JNRA 5JCIA 1PDHA 3II4A 1VDVA 1CL0A 4JN9A 2FYMA 1RM6B 1NHPA 5CQFA 2MNRA 3SY4A 3JZUA 4NZHA 2FJBA 4KWSA 3VA8A 4A99A 1SJAA 3TOYA 4ZN0A 2PP0A 1CJ4A 3P93A 3P4PA 2GDQA 4FK1C 5C3JA 5GSNA 3ISHA 3CXBA 3ALJA 3DFHA 1QLBA 4LU6A 2WP9A 2GSHA 3DGZA 5JCLA 3D8XA 1EC7A 1MDLA 1LJ1A 2XFQA 1N4UA 3V76A 3CAWA 2V3BA 3FVDA 3U9IA 2GQFA 2B9WA 3ZLHA 5KMPA 1GT8A 4JNAA 1GOSA 4U8LA 3LADA 3AEGA 3R0KA 2YM1A 2WDRA 1NENA 3DG7A 3GDNA 1ZOYA 1S3EA 3AE7A 4B67A 3AD7B 2B9XA 2OG9A 2C66A 3QSEA 2PGWA 3SZ0A 2QQ6A 1E1KA 1S2YA 1JRXA 5BVAA 1VQZA 1X2GA 1K0IA 3ZVHB 3PO7A 3AYJA 3AYIA 3NFUA 2E3TA 3S47A 1PJ6A 3BI5A 4FP1A 5KNLA 3GDPA 3IJIA 1Q9IA 1Y56A 1E1MA 2MUCA 3CT2A 1OEPA 5L46A 4C77A 3D46A 1NDAA 2OLAA 2VRLA 3T37A 1GNDA 4GISA 4YXDA 1B5QA 4DN1A 1L9DA 2GB0A 1L9CA 1CBOA 3MWCA 3UKHA 2BYBA 4J34A 2WPEA 5BOEA 2JB1A 4H2QA 1ZKQA 3IC9A 3NK1X 2YR4A 4U8MA 1NAAA 2XH2A 3FXGA 2GR2A 1CJCA 3M0OA 3VDGA 3SM8A 3UOXA 3T2YA 3SQSA 2C73A 4B65A 1WYGA 4HCHA 1FL2A 1BQGA 3Q9TA 1JPDX 1PS9A 3KKJA 3V3OA 5J04A 2XVHA 1PN0A 3GO2A 3RO6A 3AWIA 3AEDA 4RSLA 2RDXA 5KMSA 3EF6A 3TWBA 2J3NA 3IK4A 2Z5XA 3OZYA 2Y6RA 4CCRA 2FJDA 2GGJA 1EBHA 1TE6A 3OTRA 1JEHA 4EQWA 3NG7X 3QSSA 3N4EA 2W54A
chains in the Genus database with same CATH topology
3D9XA 4JQ9A 3KVEA 5CKUA 1MO9A 1NHSA 5KVIA 2C67A 2V6OA 3GD3A 3Q6JA 1CC6A 1OJ9A 3OC4A 3GWDA 1NEKA 3SGLA 2EQ9A 3QFAA 3RP6A 4H2NA 4MJWA 3CPHG 1YY5A 3UP4A 4YSXA 4X9MA 2JKCA 4GDPA 4OPIA 3T14A 3CGDA 1GETA 4K8DA 2BRYA 3GMCA 2R0PA 2BCPA 1JOAA 5DBJA 2XDOA 4OVIA 4CBQA 2X99A 4P9SA 3CN8A 3C4NA 3AXBA 1EL5A 4UDRA 1DOBA 4Y4LA 4A7AA 2VVMA 3G5RA 1PHHA 1MXTA 2JB2A 5HYMA 3BHKA 4AP3A 3IF9A 3PG6A 3CNTA 1GV4A 2ZZ0A 1D4CA 3KPKA 4BJYA 1PJ7A 4C74A 2WOVA 2JK6A 2APGA 2OAMA 1E1NA 1O94A 4ICYA 5KMQA 2WU2A 3CTYA 4U8OA 3UOZA 3C96A 2YVFA 1JNZA 3UKKA 1ONFA 2CVJA 2XFPA 1GTHA 1D4DA 2ZBWA 2WHDA 2OA1A 3H8LA 4G74A 2WPFA 3DK4A 1M64A 3FPZA 4GR1A 1PJ5A 2BC0A 2B9YA 2BK4A 4ZCDA 4AT0A 5HXIA 5FS8A 4PABA 5EBKA 2GR3A 1L0VA 2YLTA 4BK2A 4K7ZA 2WOWA 4GUVA 4OPDA 2BABA 2UZZA 1PBEA 3HYVA 5EB4A 1X31B 4U8NA 3ZYXA 3T31A 3ATQA 1ZOVA 2R4EA 3S61A 3KU9A 2V60A 4JDRA 2WQYA 2YLZA 3AB1A 3G5SA 1JRZA 2ZZBA 3UTHA 1D5TA 1GERA 2BCGG 3LZXA 4JY2A 2NPXA 2ACZA 3T0KA 5KOXA 4K5RA 2YVJA 3H8IA 3NK0X 2VQBA 1LPFA 4BV6A 2PYXA 1Q1WA 3DGHA 1ZK7A 1L9EA 4G6HA 2GAHB 1OJAA 1Y0PA 2GVCA 3FG2P 4A9WA 1S3BA 1IUWA 4KX6A 3LOVA 4A79A 4J33A 3CGBA 2R4JA 1JRYA 2WP5A 2BXRA 3KD9A 1S2QA 1O95A 3FMWA 1GPEA 2XVEA 4OPCA 1NPXA 3DA1A 1YQZA 2HQMA 2JAEA 5KXJA 4FX9A 2E5VA 3BNUA 2YQUA 1IUSA 2JB3A 4PAAA 2RABA 2YVGA 4USRA 2H88A 2CFYA 4J2WA 3K7TA 4C3XA 2F5ZA 2R46A 3SX6A 4WCTA 1D4EA 4CRTA 4H4ZA 5FMHA 1BGNA 4B66A 3QSMA 3NYFA 3UTGA 1GRAA 1ZP0A 2GV8A 1DXLA 4H4SA 2RGOA 1PBFA 1ZMCA 1TDOA 3AE5A 3F8PA 1EL8A 4Y4MA 1BGJA 4B64A 3P4SA 1DODA 3RP7A 4D03A 1CJ2A 4TLZA 4U2TA 2GRTA 4Z2UA 5FS7A 1FOHA 4A65A 4YTNA 2OLOA 4REKA 2WETA 4TM3A 1GALA 2A8XA 3DK9A 2XLRA 3I3LA 1KNPA 4YSHA 3AEAA 1XDIA 3RHAA 2YM2A 5M0ZA 2GAGB 4O5QA 4FDCB 3DJEA 4TM0A 1COYA 4A6NB 3QVPA 2X8GA 1E39A 1H81A 3QVRA 3UKQA 4EM3A 3EANA 4DNAA 2V61A 3L1RA 4U2SA 1IUTA 2AR8A 3E1TA 2C70A 2GMJA 4FK1A 4C3YA 4Z2TA 1N4WA 2XLTA 2Q0LA 2YLSA 4APNA 4J57A 4H4RA 3NTAA 3T2KA 3VRDB 3NHOX 4YKGA 1EL7A 1TDFA 3GYXA 2O9ZA 2VZ2A 4I58A 1GRHA 3ICRA 4EM4A 3M13A 5BUKA 5GRTA 2YAUA 1B37A 4J31A 4U8KA 3PVCA 3HYXA 2YG6A 1YQ4A 3UOYA 3URHA 3K30A 2BS4A 3ZDNA 1XANA 2YG7A 3LXDA 4B1BA 2IIDA 3K7MX 2YG3A 1F8SA 3P4QA 2IVDA 4Y4NA 4E0VA 1IUXA 3L8KA 4TM4A 5JCNA 1IUUA 3DMEA 3HZLA 4WX1A 4H4XA 1REOA 3GYIA 2TPRA 3NNEA 4K2XA 2W0HA 4LIIA 1KFYA 1LV0A 2DKHA 2XVFA 1YQ3A 2X8CA 3BNMA 1H86A 4J56A 3CNJA 2E4GA 2WPCA 2YLWA 5U25A 3VR8A 3AEBA 1PXBA 4J36A 2QA1A 2GR1A 3GRTA 5KVHA 3GSIA 4GAVA 1K0JA 3AD8B 1KDGA 3M12A 3REDA 2VVLA 5BULA 3CGCA 3SQPA 2R0CA 3NLCA 1KNRA 5KRQA 3B3RA 2Y6QA 4X9NA 4YKFA 3NIXA 4A6NA 3ALLA 3NRNA 5IPYA 1FEBA 2C3DA 1DOEA 1OJDA 2GH5A 2TMDA 4A5LA 2GR0A 3F8DA 1MOKA 1DJQA 3QFBA 1JNRA 5JCIA 2B7SA 3NT6A 4JY3A 1P2EA 1PDHA 4TM1A 3SZFA 3II4A 2XFOA 1CL0A 3FIMB 3ABVA 3DJJA 2H89A 3CGEA 1CC4A 4JN9A 4YTMA 3VQRA 3JSKA 2Q0KA 2BS3A 2ARDA 1NHPA 1CF3A 1D7LA 1H84A 5FS6A 5CQFA 2B76A 4GCMA 3SY4A 3AEFA 2X50A 1KF6A 4NEVA 5JCKA 1TRBA 2YLRA 3ICTA 4NTEA 5JRBA 4Z44A 1GREA 2XLPA 3ATRA 3UKFA 3GD4A 2Q7VA 2BA9A 1W4XA 5J7XA 4C5OA 1H7WA 1LVLA 2IVEA 2DKIA 4NZHA 3AE9A 2FJBA 1P2HA 1FECA 4A99A 2EQ6A 1E1LA 2I0ZA 1ZX9A 4BJZA 3G5QA 4EMIA 3LB8A 4ZN0A 1CJ4A 1KN0A 3P4PA 1DJNA 1VG0A 5J60A 3NN6X 1VG9A 4YT0A 4FK1C 3NN0X 5C2TA 3UCLA 4OPGA 5GSNA 3SFEA 5C3JA 1VRQB 4O5UA 2RGJA 4OPTA 4M52A 3ISHA 2CDUA 4EMJA 1H82A 1NHRA 4XWZA 3DK8A 1BZLA 3NH3X 4I59A 3GMBA 3ALJA 4N9XA 3NYEA 1QLBA 4BK1A 2WDQA 3ICSA 1B4VA 2XVIA 4D04A 4LU6A 3ALMA 1Z6LA 3SFDA 2GEWA 3HYWA 2WP9A 3UKPA 2C72A 1GRBA 4G73A 3NTDA 3DGZA 1B8SA 1RYIA 4HB9A 2BRAA 5JCLA 3D8XA 1EBDA 3S5WA 2GQWA 1LJ1A 2XFQA 3CPIG 2WS3A 4NNJA 1XPQA 4GF7A 1AOGA 4EQXA 1IUVA 2FJAA 3CMMA 1N4UA 4H2RA 2BC1A 2WEUA 3CNSA 3V76A 1GTEA 2XFNA 2NVKX 2WU5A 2V3AA 2V3BA 2XFUA 2XYOA 4IV9A 1DOCA 1H6VA 2GQFA 3GWFA 5IQ4A 4IA5A 3QJ4A 2GMHA 1F8RA 1K0LA 3UTEA 1FEAA 2B9WA 2A89A 3OZ2A 1GT8A 5KMPA 4JNAA 3O0HA 2QA2A 1GOSA 1OJCA 1PBDA 4EQSA 3LADA 4EQRA 2BS2A 2E1MA 4U8LA 2BK3A 4XWRA 1Q1RA 1DNCA 1ZY8A 3AEGA 2WOIA 5TR3A 2FBWA 4H4TA 4Z24A 3KPFA 2JBVA 1SEZA 1ZMDA 1GRFA 1XHCA 5JCMA 1HYUA 1Y56B 1D7YA 4DGKA 1YKJA 4UP3A 4JNQA 1LTXR 5IQ1A 1GSNA 2YM1A 2WDRA 5ER0A 4CY8A 5FS9A 1NENA 4H4QA 4NTCA 3GDNA 2YG5A 4AOXA 5KWFA 2C3CA 2XVJA 5U1OA 1ZOYA 4TLXA 1S3EA 2CULA 3UOVA 3AE7A 4B67A 3DH9A 2BXSA 2ZZCA 2WDVA 3BI4A 1ELIA 3SZWA 2C75A 4YSYA 4U8PA 3AD7B 2B9XA 5KMRA 5HHFA 4CNKA 3COXA 3IWAA 4H4VA 4II2A 2A87A 2C66A 2PHHA 3QSEA 3CPJG 4K5SA 4YWOA 2X8HA 4USQA 3KLJA 1E7PA 3SZ0A 4CNJA 3NYCA 2RGHA 1E1KA 3KA7A 1S2YA 1JRXA 2C7GA 4G9KA 3SYIA 1TDKA 5BVAA 1F3PA 1E6EA 1TDNA 1K0IA 4EIQA 3VRBA 3PO7A 3AYJA 3AYIA 2C76A 3IHMA 3I6DA 1TDEA 4UDPA 1PJ6A 4Z25A 1CJ3A 2GF3A 1H7XA 2X3NA 2OLNA 3BI5A 1BF3A 5KNLA 2B7RA 3GDPA 2YR6A 2WBAA 3LJPA 2EQ7A 4HA6A 1Q9IA 1BWCA 2VQ7A 3RP8A 1Y56A 3ITJA 1E1MA 4IA6A 4X4JA 4GRTA 4LA1A 3BHFA 5L46A 4U2LA 4C77A 1GXFA 4U8JA 1O5WA 4OPUA 3RNMA 2WESA 2BACA 3AE4A 1NDAA 1LQUA 2VRLA 3P4RA 3ADAB 3T37A 2Q6UA 1GNDA 3SXIA 4YXDA 1ZDLA 1GEUA 1B5QA 3AE2A 4Z43A 4OCGA 1PBBA 1NG4A 1L9DA 4BK3A 3GYJA 2GB0A 1RP0A 4RG4A 4NEWA 1L9CA 4IVMB 4K22A 1PXAA 2Z5YA 1PBCA 1V59A 1CBOA 1F6MA 1VQWA 1KSSA 2BYBA 3UKHA 4J34A 4YTPA 4Z26A 4H4YA 1KSUA 2WPEA 2AQJA 3BI2A 1TYTA 2QAEA 1OJTA 1LQTA 1VDCA 2JB1A 4H2QA 1ZKQA 5EB5A 1K4QA 3IC9A 3NK1X 2YR4A 5EOWA 4B68A 3NK2X 4U8MA 4CY6A 5U63A 1NAAA 4EIPA 3AE3A 3CNPA 4B69A 1FCDA 4H7UA 1TYPA 3UKLA 1F8WA 1H83A 2GR2A 1H2IA 2C64A 2XLUA 1CJCA 3M0OA 4KPRA 2C4CA 3LZWA 3AD9B 2VOUA 3NGCX 4NTDA 3SM8A 3T2YA 4H50A 3UOXA 4DSGA 2V5ZA 2C73A 4OPLA 2YLXA 4B65A 1JU2A 3AEEA 4II3A 4RG3A 2YG4A 4U8IA 4CCQA 3VR9A 1BKWA 4YSZA 2VRMA 1GRGA 1M6IA 3H4KA 2AAQA 4BURA 4AT2A 3F8RA 3AE6A 1QO8A 3EAOA 1FL2A 4G6GA 2XLSA 4ZCCA 3PS9A 2OALA 1N1PA 1PS9A 3B6DA 1S7MA 2EQ8A 3Q9TA 2R0GA 3KKJA 5BRTA 3V3OA 2XVHA 1PN0A 3AECA 3R9UA 3AE1A 3WE0A 3GRSA 1EL9A 3UKAA 3L5OA 1QJDA 3IHGA 3CIRA 1GESA 2QCUA 1PXCA 1GRTA 3AWIA 3AEDA 2R9ZA 4RSLA 3EPTA 3D1CA 4DSHA 3P9UA 2YWLA 3FBSA 3DJDA 5KMSA 3EF6A 4NWZA 1N4VA 1CHUA 1CC2A 2XCGA 4EMWA 4UDQA 2VVLG 2J3NA 4GAPA 2WP6A 2Z5XA 4GDEA 4AP1A 5LV9A 4B63A 2Y6RA 4ADWA 1IJHA 3P1WA 4CCRA 2FJDA 5KOWA 2C65A 4XXGA 3UP5A 3DJGX 3CNDA 4H4WA 2R45A 3AYLA 1JEHA 4EQWA 4AOSA 4Z2RA 1NHQA 3NKSA 3NG7X 4H4PA 4IVOB 3C4AA 2FJEA 3V3NA 1NG3A 4ECHA 3T2ZA 3UTFA 3VRAA 3QSSA 2YR5A 4H4UA 1UKVG 5M10A 3K7QX 5HY5A 1RSGA 4H2PA 3AE8A 3SZCA 2BK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KVE A;  4JQ9 A;  5CKU A;  1MO9 A;  1NHS A;  5KVI A;  2C67 A;  2V6O A;  3GD3 A;  3Q6J A;  1CC6 A;  1OJ9 A;  3OC4 A;  3GWD A;  1NEK A;  3SGL A;  2EQ9 A;  3QFA A;  3RP6 A;  4H2N A;  4MJW A;  3CPH G;  1YY5 A;  3UP4 A;  4YSX A;  4X9M A;  2JKC A;  4GDP A;  4OPI A;  3CGD A;  1GET A;  4K8D A;  3GMC A;  2R0P A;  2BCP A;  1JOA A;  5DBJ A;  2XDO A;  4OVI A;  4CBQ A;  2X99 A;  4P9S A;  3CN8 A;  3C4N A;  3AXB A;  1EL5 A;  4UDR A;  1DOB A;  4Y4L A;  4A7A A;  2VVM A;  3G5R A;  1PHH A;  1MXT A;  2JB2 A;  5HYM A;  3BHK A;  4AP3 A;  3IF9 A;  3CNT A;  1GV4 A;  2ZZ0 A;  1D4C A;  4C74 A;  4BJY A;  1PJ7 A;  2WOV A;  2JK6 A;  2APG A;  2OAM A;  1E1N A;  1O94 A;  4ICY A;  2WU2 A;  3CTY A;  4U8O A;  3UOZ A;  3C96 A;  2YVF A;  1JNZ A;  3UKK A;  1ONF A;  2CVJ A;  2XFP A;  1GTH A;  1D4D A;  2ZBW A;  2WHD A;  2OA1 A;  3H8L A;  2WPF A;  3DK4 A;  1M64 A;  3FPZ A;  4GR1 A;  1PJ5 A;  2BC0 A;  2B9Y A;  2BK4 A;  4ZCD A;  4AT0 A;  5HXI A;  5FS8 A;  4PAB A;  5EBK A;  2GR3 A;  1L0V A;  2YLT A;  4BK2 A;  4K7Z A;  2WOW A;  4GUV A;  4OPD A;  2BAB A;  2UZZ A;  1PBE A;  5EB4 A;  1X31 B;  4U8N A;  3ZYX A;  3ATQ A;  1ZOV A;  2R4E A;  3S61 A;  3KU9 A;  2V60 A;  4JDR A;  2WQY A;  2YLZ A;  3AB1 A;  3G5S A;  1JRZ A;  2ZZB A;  3UTH A;  1D5T A;  1GER A;  2BCG G;  3LZX A;  4JY2 A;  2NPX A;  2ACZ A;  5KOX A;  4K5R A;  2YVJ A;  3H8I A;  3NK0 X;  2VQB A;  1LPF A;  4BV6 A;  2PYX A;  1Q1W A;  3DGH A;  1ZK7 A;  1L9E A;  2GAH B;  1OJA A;  1Y0P A;  2GVC A;  3FG2 P;  4A9W A;  1S3B A;  1IUW A;  4KX6 A;  3LOV A;  4A79 A;  4J33 A;  3CGB A;  2R4J A;  1JRY A;  2WP5 A;  2BXR A;  3KD9 A;  1S2Q A;  1O95 A;  3FMW A;  1GPE A;  2XVE A;  4OPC A;  1NPX A;  3DA1 A;  1YQZ A;  2HQM A;  2JAE A;  5KXJ A;  4FX9 A;  2E5V A;  3BNU A;  2YQU A;  1IUS A;  2JB3 A;  4PAA A;  2RAB A;  2YVG A;  4USR A;  2H88 A;  2CFY A;  4J2W A;  3K7T A;  4C3X A;  2F5Z A;  2R46 A;  4WCT A;  1D4E A;  4CRT A;  4H4Z A;  5FMH A;  1BGN A;  4B66 A;  3QSM A;  3NYF A;  3UTG A;  1GRA A;  1ZP0 A;  2GV8 A;  1DXL A;  4H4S A;  2RGO A;  1PBF A;  1ZMC A;  1TDO A;  3AE5 A;  3F8P A;  1EL8 A;  4Y4M A;  1BGJ A;  4B64 A;  3P4S A;  1DOD A;  3RP7 A;  4D03 A;  1CJ2 A;  4TLZ A;  4U2T A;  2GRT A;  4Z2U A;  5FS7 A;  1FOH A;  4A65 A;  4YTN A;  2OLO A;  4REK A;  2WET A;  4TM3 A;  1GAL A;  2A8X A;  3DK9 A;  2XLR A;  3I3L A;  1KNP A;  4YSH A;  3AEA A;  1XDI A;  3RHA A;  2YM2 A;  5M0Z A;  2GAG B;  4O5Q A;  4FDC B;  3DJE A;  4TM0 A;  1COY A;  4A6N B;  3QVP A;  2X8G A;  1E39 A;  1H81 A;  3QVR A;  3UKQ A;  4EM3 A;  3EAN A;  4DNA A;  2V61 A;  3L1R A;  4U2S A;  1IUT A;  2AR8 A;  3E1T A;  2C70 A;  2GMJ A;  4FK1 A;  4C3Y A;  4Z2T A;  1N4W A;  2XLT A;  2Q0L A;  2YLS A;  4APN A;  4J57 A;  4H4R A;  3NTA A;  3VRD B;  3NHO X;  4YKG A;  1EL7 A;  1TDF A;  2O9Z A;  2VZ2 A;  4I58 A;  1GRH A;  3ICR A;  4EM4 A;  3M13 A;  5BUK A;  5GRT A;  2YAU A;  1B37 A;  4J31 A;  4U8K A;  3PVC A;  2YG6 A;  1YQ4 A;  3UOY A;  3URH A;  3K30 A;  2BS4 A;  3ZDN A;  1XAN A;  2YG7 A;  3LXD A;  4B1B A;  2IID A;  3K7M X;  2YG3 A;  1F8S A;  3P4Q A;  2IVD A;  4Y4N A;  4E0V A;  1IUX A;  3L8K A;  4TM4 A;  5JCN A;  1IUU A;  3DME A;  3HZL A;  4WX1 A;  4H4X A;  1REO A;  3GYI A;  2TPR A;  3NNE A;  4K2X A;  2W0H A;  4LII A;  1KFY A;  1LV0 A;  2DKH A;  2XVF A;  1YQ3 A;  2X8C A;  3BNM A;  1H86 A;  4J56 A;  3CNJ A;  2E4G A;  2WPC A;  2YLW A;  5U25 A;  3VR8 A;  3AEB A;  1PXB A;  4J36 A;  2QA1 A;  2GR1 A;  3GRT A;  5KVH A;  3GSI A;  1K0J A;  3AD8 B;  1KDG A;  3M12 A;  3RED A;  2VVL A;  5BUL A;  3CGC A;  3SQP A;  2R0C A;  3NLC A;  1KNR A;  5KRQ A;  3B3R A;  2Y6Q A;  4X9N A;  4YKF A;  3NIX A;  4A6N A;  3ALL A;  3NRN A;  5IPY A;  1FEB A;  2C3D A;  1DOE A;  1OJD A;  2GH5 A;  2TMD A;  4A5L A;  2GR0 A;  3F8D A;  1MOK A;  1DJQ A;  3QFB A;  1JNR A;  5JCI A;  2B7S A;  3NT6 A;  4JY3 A;  1P2E A;  1PDH A;  4TM1 A;  3II4 A;  2XFO A;  1CL0 A;  3FIM B;  3ABV A;  3DJJ A;  2H89 A;  3CGE A;  1CC4 A;  4JN9 A;  4YTM A;  3VQR A;  3JSK A;  2Q0K A;  2BS3 A;  2ARD A;  1NHP A;  1CF3 A;  1D7L A;  1H84 A;  5FS6 A;  5CQF A;  2B76 A;  4GCM A;  3AEF A;  2X50 A;  1KF6 A;  4NEV A;  5JCK A;  1TRB A;  2YLR A;  3ICT A;  4NTE A;  4Z44 A;  1GRE A;  2XLP A;  3ATR A;  3UKF A;  3GD4 A;  2Q7V A;  2BA9 A;  1W4X A;  5J7X A;  4C5O A;  1H7W A;  1LVL A;  2IVE A;  2DKI A;  4NZH A;  3AE9 A;  2FJB A;  1P2H A;  1FEC A;  4A99 A;  2EQ6 A;  1E1L A;  2I0Z A;  1ZX9 A;  4BJZ A;  3G5Q A;  4EMI A;  3LB8 A;  4ZN0 A;  1CJ4 A;  3P4P A;  1DJN A;  1VG0 A;  5J60 A;  3NN6 X;  1VG9 A;  4YT0 A;  4FK1 C;  3NN0 X;  5C2T A;  3UCL A;  4OPG A;  5GSN A;  3SFE A;  5C3J A;  1VRQ B;  4O5U A;  2RGJ A;  4OPT A;  4M52 A;  3ISH A;  2CDU A;  4EMJ A;  1H82 A;  1NHR A;  4XWZ A;  3DK8 A;  1BZL A;  3NH3 X;  4I59 A;  3GMB A;  3ALJ A;  4N9X A;  3NYE A;  1QLB A;  4BK1 A;  2WDQ A;  3ICS A;  1B4V A;  2XVI A;  4D04 A;  4LU6 A;  3ALM A;  1Z6L A;  3SFD A;  2GEW A;  2WP9 A;  3UKP A;  2C72 A;  1GRB A;  3NTD A;  3DGZ A;  1B8S A;  1RYI A;  4HB9 A;  5JCL A;  3D8X A;  1EBD A;  3S5W A;  2GQW A;  1LJ1 A;  2XFQ A;  3CPI G;  2WS3 A;  1XPQ A;  4GF7 A;  1AOG A;  4EQX A;  1IUV A;  2FJA A;  4H2R A;  1N4U A;  2BC1 A;  2WEU A;  3CNS A;  3V76 A;  1GTE A;  2XFN A;  2NVK X;  2WU5 A;  2V3A A;  2V3B A;  2XFU A;  2XYO A;  4IV9 A;  1DOC A;  1H6V A;  2GQF A;  3GWF A;  5IQ4 A;  4IA5 A;  3QJ4 A;  2GMH A;  1F8R A;  1K0L A;  3UTE A;  1FEA A;  2B9W A;  2A89 A;  3OZ2 A;  1GT8 A;  4JNA A;  3O0H A;  2QA2 A;  1GOS A;  1OJC A;  1PBD A;  4EQS A;  3LAD A;  4EQR A;  2BS2 A;  2E1M A;  4U8L A;  2BK3 A;  4XWR A;  1Q1R A;  1DNC A;  1ZY8 A;  3AEG A;  2WOI A;  5TR3 A;  2FBW A;  4H4T A;  4Z24 A;  3KPF A;  2JBV A;  1SEZ A;  1ZMD A;  1GRF A;  1XHC A;  5JCM A;  1HYU A;  1Y56 B;  1D7Y A;  4DGK A;  1YKJ A;  4UP3 A;  4JNQ A;  1LTX R;  5IQ1 A;  1GSN A;  2YM1 A;  2WDR A;  5ER0 A;  4CY8 A;  5FS9 A;  1NEN A;  4H4Q A;  4NTC A;  3GDN A;  2YG5 A;  4AOX A;  5KWF A;  2C3C A;  2XVJ A;  5U1O A;  1ZOY A;  4TLX A;  1S3E A;  2CUL A;  3UOV A;  3AE7 A;  4B67 A;  3DH9 A;  2BXS A;  2ZZC A;  2WDV A;  3BI4 A;  1ELI A;  2C75 A;  4YSY A;  4U8P A;  3AD7 B;  2B9X A;  5HHF A;  4CNK A;  3COX A;  3IWA A;  4H4V A;  2A87 A;  2C66 A;  2PHH A;  3QSE A;  3CPJ G;  4K5S A;  4YWO A;  2X8H A;  4USQ A;  3KLJ A;  1E7P A;  4CNJ A;  3NYC A;  2RGH A;  1E1K A;  3KA7 A;  1S2Y A;  1JRX A;  2C7G A;  5BVA A;  1TDK A;  1F3P A;  1E6E A;  1TDN A;  1K0I A;  4EIQ A;  3VRB A;  3PO7 A;  3AYJ A;  3AYI A;  2C76 A;  3IHM A;  3I6D A;  1TDE A;  4UDP A;  1PJ6 A;  4Z25 A;  1CJ3 A;  2GF3 A;  1H7X A;  2X3N A;  2OLN A;  3BI5 A;  1BF3 A;  2B7R A;  3GDP A;  2YR6 A;  2WBA A;  3LJP A;  2EQ7 A;  4HA6 A;  1Q9I A;  1BWC A;  2VQ7 A;  3RP8 A;  1Y56 A;  3ITJ A;  1E1M A;  4IA6 A;  4X4J A;  4GRT A;  4LA1 A;  3BHF A;  5L46 A;  4U2L A;  4C77 A;  1GXF A;  4U8J A;  1O5W A;  4OPU A;  3RNM A;  2WES A;  2BAC A;  3AE4 A;  1NDA A;  1LQU A;  2VRL A;  3P4R A;  3ADA B;  3T37 A;  2Q6U A;  1GND A;  4YXD A;  1ZDL A;  1GEU A;  1B5Q A;  3AE2 A;  4Z43 A;  4OCG A;  1PBB A;  1NG4 A;  1L9D A;  4BK3 A;  3GYJ A;  2GB0 A;  1RP0 A;  4RG4 A;  4NEW A;  1L9C A;  4IVM B;  4K22 A;  1PXA A;  2Z5Y A;  1PBC A;  1V59 A;  1CBO A;  1F6M A;  1VQW A;  1KSS A;  2BYB A;  3UKH A;  4J34 A;  4YTP A;  4Z26 A;  4H4Y A;  1KSU A;  2WPE A;  2AQJ A;  3BI2 A;  1TYT A;  2QAE A;  1OJT A;  1LQT A;  1VDC A;  2JB1 A;  4H2Q A;  1ZKQ A;  5EB5 A;  1K4Q A;  3IC9 A;  3NK1 X;  2YR4 A;  5EOW A;  4B68 A;  3NK2 X;  4U8M A;  4CY6 A;  5U63 A;  1NAA A;  4EIP A;  3AE3 A;  3CNP A;  4B69 A;  1FCD A;  4H7U A;  1TYP A;  3UKL A;  1F8W A;  1H83 A;  2GR2 A;  2C64 A;  2XLU A;  1CJC A;  3M0O A;  4KPR A;  3LZW A;  4NTD A;  3AD9 B;  2VOU A;  3NGC X;  4UDQ A;  3SM8 A;  3UOX A;  4H50 A;  4DSG A;  2V5Z A;  2C73 A;  4OPL A;  2YLX A;  4B65 A;  1JU2 A;  3AEE A;  4RG3 A;  2YG4 A;  4U8I A;  4CCQ A;  3VR9 A;  1BKW A;  4YSZ A;  2VRM A;  1GRG A;  1M6I A;  3H4K A;  2AAQ A;  4BUR A;  4AT2 A;  3F8R A;  3AE6 A;  1QO8 A;  3EAO A;  1FL2 A;  2XLS A;  4ZCC A;  3PS9 A;  2OAL A;  1N1P A;  1PS9 A;  3B6D A;  3Q9T A;  2EQ8 A;  2R0G A;  3KKJ A;  5BRT A;  3V3O A;  2XVH A;  1PN0 A;  3AEC A;  3R9U A;  3AE1 A;  3WE0 A;  3GRS A;  1EL9 A;  3UKA A;  1QJD A;  3IHG A;  3CIR A;  1GES A;  2QCU A;  1PXC A;  1GRT A;  3AWI A;  3AED A;  2R9Z A;  4RSL A;  3EPT A;  3D1C A;  4DSH A;  3P9U A;  2YWL A;  3FBS A;  3DJD A;  3EF6 A;  1N4V A;  1CHU A;  1CC2 A;  2XCG A;  4EMW A;  2VVL G;  2J3N A;  2WP6 A;  2Z5X A;  4GDE A;  4AP1 A;  5LV9 A;  4B63 A;  2Y6R A;  4ADW A;  1IJH A;  3P1W A;  4CCR A;  2FJD A;  5KOW A;  2C65 A;  4XXG A;  3UP5 A;  3DJG X;  3CND A;  4H4W A;  2R45 A;  3AYL A;  1JEH A;  4EQW A;  4AOS A;  4Z2R A;  1NHQ A;  3NKS A;  3NG7 X;  4H4P A;  4IVO B;  3C4A A;  2FJE A;  3V3N A;  1NG3 A;  4ECH A;  3UTF A;  3VRA A;  3QSS A;  2YR5 A;  4H4U A;  1UKV G;  5M10 A;  3K7Q X;  5HY5 A;  1RSG A;  4H2P A;  3AE8 A;  2BK5 A; 
#chains in the Genus database with same CATH topology
 3KVE A;  3V4B A;  5CKU A;  1P48 A;  2PP1 A;  1NHS A;  5KVI A;  3GD3 A;  1OJ9 A;  4HNC A;  2EQ9 A;  3RP6 A;  1YY5 A;  1W6T A;  3UP4 A;  4GDP A;  1JDF A;  2QGY A;  2XDO A;  4OVI A;  2X99 A;  1F9C A;  4UDR A;  1GV4 A;  1D4C A;  3KPK A;  2ONE A;  4ICY A;  1E1N A;  3N6H A;  4U8O A;  3DER A;  1JNZ A;  1D4D A;  3FPZ A;  2P3Z A;  5EBK A;  1DTN A;  5EB4 A;  1X31 B;  3ZYX A;  2R4E A;  2QJN A;  3AB1 A;  2PU1 A;  1GER A;  2BCG G;  2YVJ A;  1N5W C;  1ZK7 A;  3FG2 P;  1IUW A;  4KX6 A;  4A79 A;  3KD9 A;  4OPC A;  1YQZ A;  2HQM A;  2JAE A;  4FX9 A;  2E5V A;  2H88 A;  2F5Z A;  4E8G A;  2R46 A;  2AKM A;  4B66 A;  3UTG A;  1PBF A;  3D47 A;  2ZAD A;  4Y4M A;  1CJ2 A;  1FOH A;  4YTN A;  4REK A;  2OFJ A;  1GAL A;  2XLR A;  1XDI A;  5FJP A;  2YM2 A;  4O5Q A;  3HPF A;  2X8G A;  4EM3 A;  3L1R A;  4U2S A;  3PFR A;  1IUT A;  2C70 A;  1WUF A;  2GMJ A;  4Z2T A;  2XLT A;  3T2K A;  4YKG A;  2O9Z A;  2VZ2 A;  4EM4 A;  5GRT A;  1B37 A;  4JN8 A;  3EKG A;  3HYX A;  2YG6 A;  1YQ4 A;  3URH A;  3ZDN A;  2YG7 A;  1PDY A;  3K7M X;  1F8S A;  4Y4N A;  3DEQ A;  5JCN A;  2TPR A;  2QVH A;  1LV0 A;  2DKH A;  1YQ3 A;  2QJM A;  2WPC A;  3V5F A;  5U25 A;  2YLW A;  4J36 A;  4X2P A;  3GRT A;  3PWI A;  1SJB A;  3Q45 A;  2VVL A;  5BUL A;  4MKS A;  3B3R A;  2Y6Q A;  1MNS A;  4A6N A;  3Q4D A;  3FV9 A;  1DOE A;  1OJD A;  4A5L A;  3ABV A;  3CGE A;  1CF3 A;  1H84 A;  2B76 A;  4GCM A;  3K1G A;  4NEV A;  5JRB A;  5EU9 A;  2PMQ A;  2XLP A;  4Z44 A;  3NXL A;  5J7X A;  1H7W A;  1LVL A;  2IVE A;  2DKI A;  2XH4 A;  3JW7 A;  1P2H A;  2EQ6 A;  4HYR A;  1E1L A;  1ZX9 A;  4A35 A;  4BJZ A;  4EMI A;  1FHU A;  3LB8 A;  4HCD A;  1DJN A;  1VG0 A;  1VG9 A;  4YT0 A;  3MQT A;  3UCL A;  4OPG A;  1VRQ B;  4O5U A;  4OPT A;  3QTP A;  3NH3 X;  3R1Z A;  1N62 C;  3NYE A;  2WDQ A;  2XVI A;  1Z6L A;  1RYI A;  2BRA A;  1EBD A;  2GQW A;  2PP3 A;  2WS3 A;  1AOG A;  1ZXI C;  1FFU C;  4IA5 A;  2GMH A;  3UTE A;  2A89 A;  3UXK A;  2QA2 A;  2BS2 A;  4EQR A;  2BK3 A;  2WOI A;  2FBW A;  1NU5 A;  1GRF A;  1HYU A;  1D7Y A;  4DGK A;  4J1O A;  3DG3 A;  5ER0 A;  4AOX A;  5U1O A;  2CUL A;  3UOV A;  3DH9 A;  3SR6 B;  1ELI A;  3SZW A;  4YSY A;  3A7A A;  5HHF A;  4CNK A;  3IWA A;  4H4V A;  4KT2 A;  4K5S A;  2X8H A;  4USQ A;  3ES8 A;  3R11 A;  3EEZ A;  3KA7 A;  2OQY A;  2C7G A;  3SYI A;  1TDK A;  1F3P A;  4K2S A;  1TDN A;  3VRB A;  4H83 A;  3IHM A;  3I6D A;  1SB3 B;  1TDE A;  1CJ3 A;  3QKE A;  5FJR A;  1BF3 A;  2B7R A;  1TKK A;  2WBA A;  1BWC A;  3RP8 A;  4GRT A;  3OW1 A;  1GXF A;  1O5W A;  3RNM A;  2BAC A;  2AL2 A;  1LQU A;  3P4R A;  3ADA B;  3SXI A;  2PTY A;  7ENL A;  4JHM A;  4K1W A;  4YWS A;  4Z26 A;  4HNL A;  1K4Q A;  3CB3 A;  4EIP A;  3CNP A;  3VCC A;  1FCD A;  1H83 A;  2XLU A;  2C4C A;  3LZW A;  3AD9 B;  2VOU A;  4H50 A;  4DSG A;  3DES A;  2YLX A;  3MSY A;  4RG3 A;  1BKW A;  2GGH A;  4AT2 A;  1MUC A;  3AE6 A;  6ENL A;  1WUE A;  1N1P A;  3B6D A;  2EQ8 A;  3UXL A;  3GRS A;  3WE0 A;  3MUC A;  3UKA A;  3L5O A;  3NVW B;  3T4W A;  3FBS A;  4JN7 A;  4NWZ A;  2OZ3 A;  2XCG A;  4EMW A;  4GAP A;  4GDE A;  5KOW A;  2C65 A;  4XXG A;  3UP5 A;  3DJG X;  5FJU A;  2R45 A;  1JRP A;  4IVO B;  4H4P A;  3C4A A;  2FJE A;  3T2Z A;  1TZZ A;  3K7Q X;  4H2P A;  3AE8 A;  3Q6J A;  4A3R A;  3QPE A;  1EC9 A;  4YSX A;  1GET A;  3NVZ B;  1SJC A;  4ZOH B;  4P9S A;  3C4N A;  4E4F A;  1N60 C;  4Y4L A;  4A7A A;  2VVM A;  2JB2 A;  4AP3 A;  3IF9 A;  2ZZ0 A;  1P43 A;  2OAM A;  3RCY A;  4TVY A;  2YVF A;  1ONF A;  3N6J A;  2WHD A;  4G74 A;  3BOX A;  2PGE A;  4GR1 A;  3B9J B;  2B9Y A;  3CYJ A;  4AT0 A;  3DG6 A;  1IYX A;  4BK2 A;  4IT1 A;  4K7Z A;  4OPD A;  2UZZ A;  3UJE A;  3ATQ A;  1ZOV A;  4JDR A;  2YLZ A;  3G5S A;  1JRZ A;  2ZZB A;  3UTH A;  1D5T A;  4HCL A;  3T0K A;  3NK0 X;  4BV6 A;  3NRZ B;  1Q1W A;  4A6G A;  2GAH B;  1OJA A;  2GVC A;  2OPJ A;  3NVY B;  3GD6 A;  3CGB A;  2R4J A;  1S2Q A;  1MRA A;  2XH0 A;  3AM9 A;  5KXJ A;  3BNU A;  2XSX A;  4PAA A;  4J2W A;  4C3X A;  1D4E A;  3NYF A;  2P88 A;  2GV8 A;  3CK5 A;  3AE5 A;  3F8P A;  4DWD A;  2PCE A;  3RP7 A;  4D03 A;  4U2T A;  4Z2U A;  5FS7 A;  4DXK A;  1V97 A;  3DK9 A;  3I3L A;  3RHA A;  5M0Z A;  4MMW A;  3DJE A;  1COY A;  3QVP A;  1E39 A;  3UKQ A;  3QVR A;  4DNA A;  2V61 A;  2AR8 A;  3E1T A;  2YLS A;  3NTA A;  3NHO X;  1TDF A;  4I58 A;  3ICR A;  3VFC A;  3K30 A;  3ZLG A;  3DME A;  1REO A;  3GYI A;  2W0H A;  1H86 A;  2E4G A;  3GSI A;  1K0J A;  3RED A;  3SQP A;  3OZM A;  5KRQ A;  4X9N A;  3NIX A;  3ALL A;  3NRN A;  5IPY A;  2C3D A;  2TMD A;  4MGG A;  3NT6 A;  1STZ A;  4ZA0 A;  4E4U A;  1P2E A;  4GYP C;  3DFY A;  2GGG A;  3DJJ A;  3JSK A;  2BS3 A;  2ARD A;  2X50 A;  1KF6 A;  5JCK A;  3ICT A;  3IJQ A;  4M0X A;  4NTE A;  1GRE A;  3UKF A;  3GD4 A;  4GFI A;  2OZ8 A;  4C5O A;  3NS1 B;  1FEC A;  4EWJ A;  2I0Z A;  1KD0 A;  3G5Q A;  3P3B A;  1FFV C;  2W55 A;  1FO4 A;  3NN6 X;  3NN0 X;  5C2T A;  3SFE A;  4M52 A;  4EMJ A;  1H82 A;  4XWZ A;  3ZLF A;  3I6E A;  4I59 A;  4BK1 A;  1B4V A;  4D04 A;  2GEW A;  2C72 A;  1GRB A;  4G73 A;  3NTD A;  1B8S A;  3CPI G;  4NNJ A;  1XPQ A;  4GF7 A;  3S5S A;  3CMM A;  4H2R A;  2BC1 A;  1GTE A;  3R07 C;  2XFN A;  2WU5 A;  2V3A A;  4IV9 A;  1DOC A;  1H6V A;  2XH7 A;  3GWF A;  2P0I A;  3QJ4 A;  1F8R A;  3HW2 A;  3DDM A;  1K0L A;  1XS2 A;  3R10 A;  3O0H A;  1OJC A;  2OO6 A;  1PBD A;  4EQS A;  4XWR A;  1Q1R A;  4H4T A;  4Z24 A;  1SEZ A;  1XHC A;  5JCM A;  1Y56 B;  3FYY A;  4UP3 A;  4JNQ A;  1N63 C;  1GSN A;  4CY8 A;  4H4Q A;  5KWF A;  2C3C A;  2XVJ A;  4TLX A;  3H70 A;  3BI4 A;  2WDV A;  2C75 A;  4U8P A;  5KMR A;  4DHG A;  2A87 A;  2PHH A;  4YWO A;  3KLJ A;  1E6E A;  4UDP A;  2X3N A;  2OLN A;  3LJP A;  2EQ7 A;  2VQ7 A;  3ITJ A;  4IA6 A;  4X4J A;  3BHF A;  4U2L A;  2WES A;  1MDR A;  1ZDL A;  1GEU A;  4HPN A;  4Z43 A;  4OCG A;  3NVV B;  1PBB A;  1NG4 A;  4RG4 A;  4IVM B;  4K22 A;  2OKT A;  1PXA A;  2Z5Y A;  1PBC A;  1F6M A;  1VQW A;  4YTP A;  1KSS A;  3ZVH A;  4H4Y A;  2AQJ A;  3BI2 A;  1OJT A;  5EB5 A;  5IDZ A;  4B68 A;  3NK2 X;  1JCT A;  4CY6 A;  4B69 A;  4H7U A;  1TYP A;  1F8W A;  3SSZ A;  1H2I A;  2C64 A;  4UDQ A;  4NTD A;  2QDE A;  3I4K A;  2OX4 A;  4OPL A;  3AEE A;  3QN3 A;  2YG4 A;  4U8I A;  3V3W A;  1R0M A;  2VRM A;  1M6I A;  2AAQ A;  3EAO A;  2POZ A;  4G6G A;  4TVW A;  3PS9 A;  2OAL A;  1S7M A;  3ENL A;  1PDZ A;  3AEC A;  3AE1 A;  4IP5 A;  2HNE A;  1QJD A;  3IHG A;  2QCU A;  1PXC A;  2W3S A;  2R9Z A;  3EPT A;  3DJD A;  3UJF A;  1N4V A;  2VVL G;  3ETR B;  1SJD A;  2WP6 A;  4AP1 A;  3HRD C;  5LV9 A;  4B63 A;  1RVK A;  3H12 A;  1IJH A;  3P1W A;  4AOS A;  1EC8 A;  4Z2R A;  1KCZ A;  3V3N A;  1NG3 A;  3UTF A;  3VRA A;  2YR5 A;  3TCS A;  1ECQ A;  1RSG A;  3SZC A;  3IJL A;  4F4R A;  2OZT A;  3THU A;  2V6O A;  3RRA A;  3GWD A;  3MY9 A;  3SGL A;  3QFA A;  4Z17 A;  4X9M A;  2JKC A;  4OPI A;  3N4F A;  4K8D A;  3GMC A;  1FIQ B;  4CBQ A;  3CN8 A;  3AXB A;  2P8B A;  1MXT A;  3BHK A;  4BJY A;  1PJ7 A;  5KMQ A;  2FKP A;  4GGH A;  3CTY A;  3UOZ A;  3UKK A;  2CHR A;  1GTH A;  2ZBW A;  2OA1 A;  3H8L A;  2OQH A;  2P8C A;  1PJ5 A;  2BK4 A;  5HXI A;  4ZCD A;  5FS8 A;  4PAB A;  4H2H A;  2WOW A;  2BAB A;  3HYV A;  5ENL A;  3P0W A;  3PWG A;  3S61 A;  1L8P A;  3LZX A;  4JY2 A;  5KOX A;  3H8I A;  3ES7 A;  2VQB A;  1LPF A;  3DGH A;  1L9E A;  2DW7 A;  2BXR A;  3CXO A;  3FMW A;  1GPE A;  2XVE A;  3DA1 A;  3DIP A;  3MKC A;  2YQU A;  4Z1Y A;  2RAB A;  2YVG A;  2CFY A;  3SBF A;  3K7T A;  3SX6 A;  4WCT A;  4H4Z A;  1BGN A;  3QSM A;  4H4S A;  2RGO A;  1TDO A;  1ZMC A;  2HXT A;  1EL8 A;  4B64 A;  1DOD A;  4TLZ A;  1ELS A;  2GRT A;  4A65 A;  2OLO A;  2GL5 A;  2WET A;  4YSH A;  1KNP A;  3AEA A;  4TM0 A;  4A6N B;  1H81 A;  4G7F A;  3EAN A;  3U4F A;  4IP4 A;  4C3Y A;  1N4W A;  1N61 C;  5FJO A;  2PPG A;  4APN A;  4H4R A;  3EUB 3;  1EL7 A;  3GYX A;  2I5Q A;  2OVL A;  3A7U A;  2BS4 A;  3LXD A;  2IID A;  2YG3 A;  1IUX A;  3L8K A;  4TM4 A;  1IUU A;  4WX1 A;  3UGV A;  3BNM A;  4J56 A;  3CNJ A;  4GIR A;  2QA1 A;  2GR1 A;  5KVH A;  3M12 A;  2R0C A;  4YKF A;  1FEB A;  2GH5 A;  2GR0 A;  3F8D A;  1MOK A;  1DJQ A;  3QFB A;  1YEY A;  4GME A;  2B7S A;  4JY3 A;  3OPS A;  3SZF A;  4TM1 A;  4IHC A;  2XFO A;  3FIM B;  2H89 A;  1CC4 A;  4YTM A;  3VQR A;  2Q0K A;  4E5T A;  1D7L A;  5FS6 A;  3UJR A;  3AEF A;  2YLR A;  1TRB A;  3ATR A;  1BKH A;  4M6U A;  2Q7V A;  2BA9 A;  1W4X A;  3AE9 A;  2XGZ A;  4KEM A;  3JVA A;  1KN0 A;  5J60 A;  2HXU A;  4GYP A;  2RGJ A;  2CDU A;  1NHR A;  3DK8 A;  1BZL A;  3GMB A;  3A7R A;  4N9X A;  3ICS A;  3ALM A;  4G8T A;  3SFD A;  2POD A;  3HYW A;  3UKP A;  3I6T A;  4HB9 A;  3S5W A;  1R6W A;  1IUV A;  4EQX A;  2FJA A;  2PA6 A;  2WEU A;  3CNS A;  2NVK X;  1T3Q C;  2XFU A;  2XYO A;  5IQ4 A;  4GGB A;  1FEA A;  3OZ2 A;  2E1M A;  1DNC A;  1ZY8 A;  5TR3 A;  3KPF A;  2JBV A;  1ZMD A;  3SN0 A;  3PK7 A;  1YKJ A;  1LTX R;  5IQ1 A;  5FS9 A;  4NTC A;  2YG5 A;  2AL2 B;  2BXS A;  2ZZC A;  4J3Z A;  2E5A A;  3BSM A;  3COX A;  1NEL A;  4II2 A;  4DYE A;  3NO1 A;  3CPJ G;  3TWA A;  1E7P A;  4CNJ A;  3NYC A;  2RGH A;  3OP2 A;  4G9K A;  4EIQ A;  3RGT A;  2C76 A;  3UCD A;  3R25 A;  3TJ4 A;  4Z25 A;  2GF3 A;  1H7X A;  1XPY A;  4HN8 A;  3T9P A;  2YR6 A;  4HA6 A;  4LA1 A;  3AMZ A;  4U8J A;  1E9I A;  3R0U A;  4OPU A;  3H8A A;  3AE4 A;  3TTE A;  2Q6U A;  4ENL A;  3AE2 A;  4BK3 A;  3GYJ A;  4ROP A;  1RP0 A;  4NEW A;  3NZG A;  1V59 A;  2O56 A;  3SN1 A;  1KSU A;  1TYT A;  2QAE A;  1LQT A;  1VDC A;  2DW6 A;  5EOW A;  5U63 A;  3AE3 A;  3UKL A;  3UJS A;  4KPR A;  3NGC X;  3T6C A;  3SN4 A;  2V5Z A;  1JU2 A;  4II3 A;  3STP A;  3BJS A;  4CCQ A;  3VR9 A;  4YSZ A;  1GRG A;  3H4K A;  4BUR A;  3F8R A;  1QO8 A;  3FJ4 A;  2XLS A;  4ZCC A;  2R0G A;  3DGB A;  5BRT A;  3R9U A;  1EL9 A;  4IZG A;  2PSN A;  3CIR A;  1GES A;  1GRT A;  2PTX A;  3D1C A;  4DSH A;  3P9U A;  2YWL A;  2NQL A;  1CHU A;  2PU0 A;  1CC2 A;  1EBG A;  4K8G A;  4ADW A;  2QDD A;  5FJT A;  3CND A;  4H4W A;  3V5C A;  3AYL A;  1NHQ A;  3NKS A;  3FCP A;  4ECH A;  1N5X A;  4H4U A;  3UJ2 A;  1UKV G;  5M10 A;  5HY5 A;  2BK5 A;  3D9X A;  4JQ9 A;  3SJN A;  1MO9 A;  1KKO A;  2C67 A;  1CC6 A;  3OC4 A;  1NEK A;  4H2N A;  4MJW A;  3CPH G;  3ZVI A;  3T14 A;  3CGD A;  2BRY A;  2R0P A;  2BCP A;  1JOA A;  5DBJ A;  3MZN A;  3UCC A;  1EL5 A;  1DOB A;  3G5R A;  3KUM A;  1PHH A;  5HYM A;  3PG6 A;  3CNT A;  4C74 A;  5G5H B;  2WOV A;  2JK6 A;  2APG A;  1O94 A;  2WU2 A;  3C96 A;  2CVJ A;  2XFP A;  1FHV A;  2WPF A;  3DK4 A;  1M64 A;  2BC0 A;  2GR3 A;  1L0V A;  3GC2 A;  3QLD A;  4DX3 A;  2YLT A;  4FI4 A;  2W3R A;  4GUV A;  1PBE A;  4U8N A;  3T31 A;  3KU9 A;  2V60 A;  2WQY A;  1JRO A;  1ONE A;  5G5G B;  2NPX A;  2ACZ A;  4K5R A;  2PYX A;  3B97 A;  4G6H A;  1Y0P A;  4A9W A;  1S3B A;  3LOV A;  4J33 A;  1JRY A;  2WP5 A;  2GGI A;  1O95 A;  1NPX A;  1X2H A;  1IUS A;  2JB3 A;  2GGE A;  2PS2 A;  4USR A;  3VCN A;  4KPL A;  4ZCW A;  2HZG A;  4CRT A;  4H19 A;  5FMH A;  4E6M A;  1GRA A;  3RR1 A;  1ZP0 A;  3VC5 A;  1DXL A;  2AKZ A;  3T8Q A;  3VC6 A;  3H7V A;  1BGJ A;  4IL0 A;  3P4S A;  1KKR A;  4TM3 A;  2A8X A;  4H1Z A;  3TW9 A;  2GAG B;  4FDC B;  4FK1 A;  2Q0L A;  4J57 A;  3VRD B;  1GRH A;  3M13 A;  5BUK A;  2YAU A;  4J31 A;  4U8K A;  3PVC A;  3UOY A;  2AL1 A;  1XAN A;  4B1B A;  3P4Q A;  2IVD A;  4E0V A;  3HZL A;  4H4X A;  3NNE A;  4K2X A;  4LII A;  3TQP A;  1KFY A;  2QJJ A;  2XVF A;  2X8C A;  4IL2 A;  3VR8 A;  3AEB A;  1PXB A;  2PTZ A;  4GAV A;  3AD8 B;  1KDG A;  3AN1 A;  3RIT A;  3CGC A;  3NLC A;  1KNR A;  1JPM A;  2PTW A;  2ZC8 A;  3TJI A;  5BOF A;  3GY1 A;  1JNR A;  5JCI A;  1PDH A;  3II4 A;  1VDV A;  1CL0 A;  4JN9 A;  2FYM A;  1RM6 B;  1NHP A;  5CQF A;  2MNR A;  3SY4 A;  3JZU A;  4NZH A;  2FJB A;  4KWS A;  3VA8 A;  4A99 A;  1SJA A;  3TOY A;  4ZN0 A;  2PP0 A;  1CJ4 A;  3P93 A;  3P4P A;  2GDQ A;  4FK1 C;  5C3J A;  5GSN A;  3ISH A;  3CXB A;  3ALJ A;  3DFH A;  1QLB A;  4LU6 A;  2WP9 A;  2GSH A;  3DGZ A;  5JCL A;  3D8X A;  1EC7 A;  1MDL A;  1LJ1 A;  2XFQ A;  1N4U A;  3V76 A;  3CAW A;  2V3B A;  3FVD A;  3U9I A;  2GQF A;  2B9W A;  3ZLH A;  5KMP A;  1GT8 A;  4JNA A;  1GOS A;  4U8L A;  3LAD A;  3AEG A;  3R0K A;  2YM1 A;  2WDR A;  1NEN A;  3DG7 A;  3GDN A;  1ZOY A;  1S3E A;  3AE7 A;  4B67 A;  3AD7 B;  2B9X A;  2OG9 A;  2C66 A;  3QSE A;  2PGW A;  3SZ0 A;  2QQ6 A;  1E1K A;  1S2Y A;  1JRX A;  5BVA A;  1VQZ A;  1X2G A;  1K0I A;  3ZVH B;  3PO7 A;  3AYJ A;  3AYI A;  3NFU A;  2E3T A;  3S47 A;  1PJ6 A;  3BI5 A;  4FP1 A;  5KNL A;  3GDP A;  3IJI A;  1Q9I A;  1Y56 A;  1E1M A;  2MUC A;  3CT2 A;  1OEP A;  5L46 A;  4C77 A;  3D46 A;  1NDA A;  2OLA A;  2VRL A;  3T37 A;  1GND A;  4GIS A;  4YXD A;  1B5Q A;  4DN1 A;  1L9D A;  2GB0 A;  1L9C A;  1CBO A;  3MWC A;  3UKH A;  2BYB A;  4J34 A;  2WPE A;  5BOE A;  2JB1 A;  4H2Q A;  1ZKQ A;  3IC9 A;  3NK1 X;  2YR4 A;  4U8M A;  1NAA A;  2XH2 A;  3FXG A;  2GR2 A;  1CJC A;  3M0O A;  3VDG A;  3SM8 A;  3UOX A;  3T2Y A;  3SQS A;  2C73 A;  4B65 A;  1WYG A;  4HCH A;  1FL2 A;  1BQG A;  3Q9T A;  1JPD X;  1PS9 A;  3KKJ A;  3V3O A;  5J04 A;  2XVH A;  1PN0 A;  3GO2 A;  3RO6 A;  3AWI A;  3AED A;  4RSL A;  2RDX A;  5KMS A;  3EF6 A;  3TWB A;  2J3N A;  3IK4 A;  2Z5X A;  3OZY A;  2Y6R A;  4CCR A;  2FJD A;  2GGJ A;  1EBH A;  1TE6 A;  3OTR A;  1JEH A;  4EQW A;  3NG7 X;  3QSS A;  3N4E A;  2W54 A; 
#chains in the Genus database with same CATH homology
 3D9X A;  4JQ9 A;  3KVE A;  5CKU A;  1MO9 A;  1NHS A;  5KVI A;  2C67 A;  2V6O A;  3GD3 A;  3Q6J A;  1CC6 A;  1OJ9 A;  3OC4 A;  3GWD A;  1NEK A;  3SGL A;  2EQ9 A;  3QFA A;  3RP6 A;  4H2N A;  4MJW A;  3CPH G;  1YY5 A;  3UP4 A;  4YSX A;  4X9M A;  2JKC A;  4GDP A;  4OPI A;  3T14 A;  3CGD A;  1GET A;  4K8D A;  2BRY A;  3GMC A;  2R0P A;  2BCP A;  1JOA A;  5DBJ A;  2XDO A;  4OVI A;  4CBQ A;  2X99 A;  4P9S A;  3CN8 A;  3C4N A;  3AXB A;  1EL5 A;  4UDR A;  1DOB A;  4Y4L A;  4A7A A;  2VVM A;  3G5R A;  1PHH A;  1MXT A;  2JB2 A;  5HYM A;  3BHK A;  4AP3 A;  3IF9 A;  3PG6 A;  3CNT A;  1GV4 A;  2ZZ0 A;  1D4C A;  3KPK A;  4BJY A;  1PJ7 A;  4C74 A;  2WOV A;  2JK6 A;  2APG A;  2OAM A;  1E1N A;  1O94 A;  4ICY A;  5KMQ A;  2WU2 A;  3CTY A;  4U8O A;  3UOZ A;  3C96 A;  2YVF A;  1JNZ A;  3UKK A;  1ONF A;  2CVJ A;  2XFP A;  1GTH A;  1D4D A;  2ZBW A;  2WHD A;  2OA1 A;  3H8L A;  4G74 A;  2WPF A;  3DK4 A;  1M64 A;  3FPZ A;  4GR1 A;  1PJ5 A;  2BC0 A;  2B9Y A;  2BK4 A;  4ZCD A;  4AT0 A;  5HXI A;  5FS8 A;  4PAB A;  5EBK A;  2GR3 A;  1L0V A;  2YLT A;  4BK2 A;  4K7Z A;  2WOW A;  4GUV A;  4OPD A;  2BAB A;  2UZZ A;  1PBE A;  3HYV A;  5EB4 A;  1X31 B;  4U8N A;  3ZYX A;  3T31 A;  3ATQ A;  1ZOV A;  2R4E A;  3S61 A;  3KU9 A;  2V60 A;  4JDR A;  2WQY A;  2YLZ A;  3AB1 A;  3G5S A;  1JRZ A;  2ZZB A;  3UTH A;  1D5T A;  1GER A;  2BCG G;  3LZX A;  4JY2 A;  2NPX A;  2ACZ A;  3T0K A;  5KOX A;  4K5R A;  2YVJ A;  3H8I A;  3NK0 X;  2VQB A;  1LPF A;  4BV6 A;  2PYX A;  1Q1W A;  3DGH A;  1ZK7 A;  1L9E A;  4G6H A;  2GAH B;  1OJA A;  1Y0P A;  2GVC A;  3FG2 P;  4A9W A;  1S3B A;  1IUW A;  4KX6 A;  3LOV A;  4A79 A;  4J33 A;  3CGB A;  2R4J A;  1JRY A;  2WP5 A;  2BXR A;  3KD9 A;  1S2Q A;  1O95 A;  3FMW A;  1GPE A;  2XVE A;  4OPC A;  1NPX A;  3DA1 A;  1YQZ A;  2HQM A;  2JAE A;  5KXJ A;  4FX9 A;  2E5V A;  3BNU A;  2YQU A;  1IUS A;  2JB3 A;  4PAA A;  2RAB A;  2YVG A;  4USR A;  2H88 A;  2CFY A;  4J2W A;  3K7T A;  4C3X A;  2F5Z A;  2R46 A;  3SX6 A;  4WCT A;  1D4E A;  4CRT A;  4H4Z A;  5FMH A;  1BGN A;  4B66 A;  3QSM A;  3NYF A;  3UTG A;  1GRA A;  1ZP0 A;  2GV8 A;  1DXL A;  4H4S A;  2RGO A;  1PBF A;  1ZMC A;  1TDO A;  3AE5 A;  3F8P A;  1EL8 A;  4Y4M A;  1BGJ A;  4B64 A;  3P4S A;  1DOD A;  3RP7 A;  4D03 A;  1CJ2 A;  4TLZ A;  4U2T A;  2GRT A;  4Z2U A;  5FS7 A;  1FOH A;  4A65 A;  4YTN A;  2OLO A;  4REK A;  2WET A;  4TM3 A;  1GAL A;  2A8X A;  3DK9 A;  2XLR A;  3I3L A;  1KNP A;  4YSH A;  3AEA A;  1XDI A;  3RHA A;  2YM2 A;  5M0Z A;  2GAG B;  4O5Q A;  4FDC B;  3DJE A;  4TM0 A;  1COY A;  4A6N B;  3QVP A;  2X8G A;  1E39 A;  1H81 A;  3QVR A;  3UKQ A;  4EM3 A;  3EAN A;  4DNA A;  2V61 A;  3L1R A;  4U2S A;  1IUT A;  2AR8 A;  3E1T A;  2C70 A;  2GMJ A;  4FK1 A;  4C3Y A;  4Z2T A;  1N4W A;  2XLT A;  2Q0L A;  2YLS A;  4APN A;  4J57 A;  4H4R A;  3NTA A;  3T2K A;  3VRD B;  3NHO X;  4YKG A;  1EL7 A;  1TDF A;  3GYX A;  2O9Z A;  2VZ2 A;  4I58 A;  1GRH A;  3ICR A;  4EM4 A;  3M13 A;  5BUK A;  5GRT A;  2YAU A;  1B37 A;  4J31 A;  4U8K A;  3PVC A;  3HYX A;  2YG6 A;  1YQ4 A;  3UOY A;  3URH A;  3K30 A;  2BS4 A;  3ZDN A;  1XAN A;  2YG7 A;  3LXD A;  4B1B A;  2IID A;  3K7M X;  2YG3 A;  1F8S A;  3P4Q A;  2IVD A;  4Y4N A;  4E0V A;  1IUX A;  3L8K A;  4TM4 A;  5JCN A;  1IUU A;  3DME A;  3HZL A;  4WX1 A;  4H4X A;  1REO A;  3GYI A;  2TPR A;  3NNE A;  4K2X A;  2W0H A;  4LII A;  1KFY A;  1LV0 A;  2DKH A;  2XVF A;  1YQ3 A;  2X8C A;  3BNM A;  1H86 A;  4J56 A;  3CNJ A;  2E4G A;  2WPC A;  2YLW A;  5U25 A;  3VR8 A;  3AEB A;  1PXB A;  4J36 A;  2QA1 A;  2GR1 A;  3GRT A;  5KVH A;  3GSI A;  4GAV A;  1K0J A;  3AD8 B;  1KDG A;  3M12 A;  3RED A;  2VVL A;  5BUL A;  3CGC A;  3SQP A;  2R0C A;  3NLC A;  1KNR A;  5KRQ A;  3B3R A;  2Y6Q A;  4X9N A;  4YKF A;  3NIX A;  4A6N A;  3ALL A;  3NRN A;  5IPY A;  1FEB A;  2C3D A;  1DOE A;  1OJD A;  2GH5 A;  2TMD A;  4A5L A;  2GR0 A;  3F8D A;  1MOK A;  1DJQ A;  3QFB A;  1JNR A;  5JCI A;  2B7S A;  3NT6 A;  4JY3 A;  1P2E A;  1PDH A;  4TM1 A;  3SZF A;  3II4 A;  2XFO A;  1CL0 A;  3FIM B;  3ABV A;  3DJJ A;  2H89 A;  3CGE A;  1CC4 A;  4JN9 A;  4YTM A;  3VQR A;  3JSK A;  2Q0K A;  2BS3 A;  2ARD A;  1NHP A;  1CF3 A;  1D7L A;  1H84 A;  5FS6 A;  5CQF A;  2B76 A;  4GCM A;  3SY4 A;  3AEF A;  2X50 A;  1KF6 A;  4NEV A;  5JCK A;  1TRB A;  2YLR A;  3ICT A;  4NTE A;  5JRB A;  4Z44 A;  1GRE A;  2XLP A;  3ATR A;  3UKF A;  3GD4 A;  2Q7V A;  2BA9 A;  1W4X A;  5J7X A;  4C5O A;  1H7W A;  1LVL A;  2IVE A;  2DKI A;  4NZH A;  3AE9 A;  2FJB A;  1P2H A;  1FEC A;  4A99 A;  2EQ6 A;  1E1L A;  2I0Z A;  1ZX9 A;  4BJZ A;  3G5Q A;  4EMI A;  3LB8 A;  4ZN0 A;  1CJ4 A;  1KN0 A;  3P4P A;  1DJN A;  1VG0 A;  5J60 A;  3NN6 X;  1VG9 A;  4YT0 A;  4FK1 C;  3NN0 X;  5C2T A;  3UCL A;  4OPG A;  5GSN A;  3SFE A;  5C3J A;  1VRQ B;  4O5U A;  2RGJ A;  4OPT A;  4M52 A;  3ISH A;  2CDU A;  4EMJ A;  1H82 A;  1NHR A;  4XWZ A;  3DK8 A;  1BZL A;  3NH3 X;  4I59 A;  3GMB A;  3ALJ A;  4N9X A;  3NYE A;  1QLB A;  4BK1 A;  2WDQ A;  3ICS A;  1B4V A;  2XVI A;  4D04 A;  4LU6 A;  3ALM A;  1Z6L A;  3SFD A;  2GEW A;  3HYW A;  2WP9 A;  3UKP A;  2C72 A;  1GRB A;  4G73 A;  3NTD A;  3DGZ A;  1B8S A;  1RYI A;  4HB9 A;  2BRA A;  5JCL A;  3D8X A;  1EBD A;  3S5W A;  2GQW A;  1LJ1 A;  2XFQ A;  3CPI G;  2WS3 A;  4NNJ A;  1XPQ A;  4GF7 A;  1AOG A;  4EQX A;  1IUV A;  2FJA A;  3CMM A;  1N4U A;  4H2R A;  2BC1 A;  2WEU A;  3CNS A;  3V76 A;  1GTE A;  2XFN A;  2NVK X;  2WU5 A;  2V3A A;  2V3B A;  2XFU A;  2XYO A;  4IV9 A;  1DOC A;  1H6V A;  2GQF A;  3GWF A;  5IQ4 A;  4IA5 A;  3QJ4 A;  2GMH A;  1F8R A;  1K0L A;  3UTE A;  1FEA A;  2B9W A;  2A89 A;  3OZ2 A;  1GT8 A;  5KMP A;  4JNA A;  3O0H A;  2QA2 A;  1GOS A;  1OJC A;  1PBD A;  4EQS A;  3LAD A;  4EQR A;  2BS2 A;  2E1M A;  4U8L A;  2BK3 A;  4XWR A;  1Q1R A;  1DNC A;  1ZY8 A;  3AEG A;  2WOI A;  5TR3 A;  2FBW A;  4H4T A;  4Z24 A;  3KPF A;  2JBV A;  1SEZ A;  1ZMD A;  1GRF A;  1XHC A;  5JCM A;  1HYU A;  1Y56 B;  1D7Y A;  4DGK A;  1YKJ A;  4UP3 A;  4JNQ A;  1LTX R;  5IQ1 A;  1GSN A;  2YM1 A;  2WDR A;  5ER0 A;  4CY8 A;  5FS9 A;  1NEN A;  4H4Q A;  4NTC A;  3GDN A;  2YG5 A;  4AOX A;  5KWF A;  2C3C A;  2XVJ A;  5U1O A;  1ZOY A;  4TLX A;  1S3E A;  2CUL A;  3UOV A;  3AE7 A;  4B67 A;  3DH9 A;  2BXS A;  2ZZC A;  2WDV A;  3BI4 A;  1ELI A;  3SZW A;  2C75 A;  4YSY A;  4U8P A;  3AD7 B;  2B9X A;  5KMR A;  5HHF A;  4CNK A;  3COX A;  3IWA A;  4H4V A;  4II2 A;  2A87 A;  2C66 A;  2PHH A;  3QSE A;  3CPJ G;  4K5S A;  4YWO A;  2X8H A;  4USQ A;  3KLJ A;  1E7P A;  3SZ0 A;  4CNJ A;  3NYC A;  2RGH A;  1E1K A;  3KA7 A;  1S2Y A;  1JRX A;  2C7G A;  4G9K A;  3SYI A;  1TDK A;  5BVA A;  1F3P A;  1E6E A;  1TDN A;  1K0I A;  4EIQ A;  3VRB A;  3PO7 A;  3AYJ A;  3AYI A;  2C76 A;  3IHM A;  3I6D A;  1TDE A;  4UDP A;  1PJ6 A;  4Z25 A;  1CJ3 A;  2GF3 A;  1H7X A;  2X3N A;  2OLN A;  3BI5 A;  1BF3 A;  5KNL A;  2B7R A;  3GDP A;  2YR6 A;  2WBA A;  3LJP A;  2EQ7 A;  4HA6 A;  1Q9I A;  1BWC A;  2VQ7 A;  3RP8 A;  1Y56 A;  3ITJ A;  1E1M A;  4IA6 A;  4X4J A;  4GRT A;  4LA1 A;  3BHF A;  5L46 A;  4U2L A;  4C77 A;  1GXF A;  4U8J A;  1O5W A;  4OPU A;  3RNM A;  2WES A;  2BAC A;  3AE4 A;  1NDA A;  1LQU A;  2VRL A;  3P4R A;  3ADA B;  3T37 A;  2Q6U A;  1GND A;  3SXI A;  4YXD A;  1ZDL A;  1GEU A;  1B5Q A;  3AE2 A;  4Z43 A;  4OCG A;  1PBB A;  1NG4 A;  1L9D A;  4BK3 A;  3GYJ A;  2GB0 A;  1RP0 A;  4RG4 A;  4NEW A;  1L9C A;  4IVM B;  4K22 A;  1PXA A;  2Z5Y A;  1PBC A;  1V59 A;  1CBO A;  1F6M A;  1VQW A;  1KSS A;  2BYB A;  3UKH A;  4J34 A;  4YTP A;  4Z26 A;  4H4Y A;  1KSU A;  2WPE A;  2AQJ A;  3BI2 A;  1TYT A;  2QAE A;  1OJT A;  1LQT A;  1VDC A;  2JB1 A;  4H2Q A;  1ZKQ A;  5EB5 A;  1K4Q A;  3IC9 A;  3NK1 X;  2YR4 A;  5EOW A;  4B68 A;  3NK2 X;  4U8M A;  4CY6 A;  5U63 A;  1NAA A;  4EIP A;  3AE3 A;  3CNP A;  4B69 A;  1FCD A;  4H7U A;  1TYP A;  3UKL A;  1F8W A;  1H83 A;  2GR2 A;  1H2I A;  2C64 A;  2XLU A;  1CJC A;  3M0O A;  4KPR A;  2C4C A;  3LZW A;  3AD9 B;  2VOU A;  3NGC X;  4NTD A;  3SM8 A;  3T2Y A;  4H50 A;  3UOX A;  4DSG A;  2V5Z A;  2C73 A;  4OPL A;  2YLX A;  4B65 A;  1JU2 A;  3AEE A;  4II3 A;  4RG3 A;  2YG4 A;  4U8I A;  4CCQ A;  3VR9 A;  1BKW A;  4YSZ A;  2VRM A;  1GRG A;  1M6I A;  3H4K A;  2AAQ A;  4BUR A;  4AT2 A;  3F8R A;  3AE6 A;  1QO8 A;  3EAO A;  1FL2 A;  4G6G A;  2XLS A;  4ZCC A;  3PS9 A;  2OAL A;  1N1P A;  1PS9 A;  3B6D A;  1S7M A;  2EQ8 A;  3Q9T A;  2R0G A;  3KKJ A;  5BRT A;  3V3O A;  2XVH A;  1PN0 A;  3AEC A;  3R9U A;  3AE1 A;  3WE0 A;  3GRS A;  1EL9 A;  3UKA A;  3L5O A;  1QJD A;  3IHG A;  3CIR A;  1GES A;  2QCU A;  1PXC A;  1GRT A;  3AWI A;  3AED A;  2R9Z A;  4RSL A;  3EPT A;  3D1C A;  4DSH A;  3P9U A;  2YWL A;  3FBS A;  3DJD A;  5KMS A;  3EF6 A;  4NWZ A;  1N4V A;  1CHU A;  1CC2 A;  2XCG A;  4EMW A;  4UDQ A;  2VVL G;  2J3N A;  4GAP A;  2WP6 A;  2Z5X A;  4GDE A;  4AP1 A;  5LV9 A;  4B63 A;  2Y6R A;  4ADW A;  1IJH A;  3P1W A;  4CCR A;  2FJD A;  5KOW A;  2C65 A;  4XXG A;  3UP5 A;  3DJG X;  3CND A;  4H4W A;  2R45 A;  3AYL A;  1JEH A;  4EQW A;  4AOS A;  4Z2R A;  1NHQ A;  3NKS A;  3NG7 X;  4H4P A;  4IVO B;  3C4A A;  2FJE A;  3V3N A;  1NG3 A;  4ECH A;  3T2Z A;  3UTF A;  3VRA A;  3QSS A;  2YR5 A;  4H4U A;  1UKV G;  5M10 A;  3K7Q X;  5HY5 A;  1RSG A;  4H2P A;  3AE8 A;  3SZC A;  2BK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...