5JCKA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
432
structure length
432
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPEPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFYSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVANIEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Os09g0567300 protein
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
total genus 140
structure length 432
sequence length 432
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jckA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jckA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jckA02
4H2NA 3P1WA 4U8LA 4A79A 2V5ZA 3EANA 3NK1X 3ZYXA 4H2QA 4IA6A 1S2YA 4YSYA 3QSMA 3AYIA 1O94A 1KNRA 4JNAA 1LQUA 2WOVA 3P4QA 3PS9A 4NZHA 3AE1A 1L9EA 4OPDA 2BXRA 4C3XA 4Y4NA 3DJJA 1D4CA 3AD7B 4EM4A 1OJDA 4A65A 1N1PA 2CDUA 3UP4A 4C74A 3FIMB 3QJ4A 1FECA 4TLZA 1GRTA 4LU6A 3V3OA 4CNJA 5ER0A 1GESA 1XHCA 1GRAA 4O5UA 2GMHA 4IVMB 2YQUA 5U63A 1DXLA 4UDPA 5FS7A 2XVHA 1E7PA 4PAAA 4EQRA 3UOZA 3LZXA 2YG4A 1PJ5A 3IWAA 1Z6LA 1E1LA 4H50A 4OPLA 4B68A 1GV4A 2H89A 1L9DA 1TDFA 4ZCCA 1EBDA 4J36A 1PJ6A 4H4VA 1JOAA 3AE8A 3CNPA 2V6OA 3KKJA 4TM1A 3AD8B 1DOBA 1AOGA 1MO9A 2GR1A 2R45A 3BHFA 1PJ7A 3T37A 4YKFA 1GTHA 4Z2UA 2YLRA 4U2TA 4M52A 3VRAA 4IVOB 3UTHA 1TDNA 1OJAA 5HY5A 1TDEA 4DNAA 4EQSA 2X50A 4H4XA 4J57A 1FCDA 3GRSA 1JRXA 1X31B 1PXCA 3AE3A 3UOXA 3QFAA 4CCRA 2GV8A 4BJZA 5BRTA 1PBBA 2WP5A 3DK4A 1P2HA 1K0IA 4RSLA 1VG9A 3S61A 4YTNA 1FEBA 4WX1A 4UDRA 2VVMA 3UTFA 2YM1A 4RG3A 3NN0X 3GYIA 2R4JA 3L8KA 3AEFA 4REKA 1Y56B 3UKKA 4BK2A 2XVFA 3QFBA 5HHFA 4H4RA 1IJHA 2OA1A 4K5SA 2BS3A 1P2EA 3EF6A 2XLPA 2R0CA 4LA1A 3B6DA 2RGJA 4B66A 3DJEA 3H8IA 4B67A 4USQA 4YKGA 2GR2A 1DOCA 1KDGA 1KSSA 3COXA 3RP8A 2YLTA 2RGOA 3DMEA 3ICTA 1OJTA 2XVEA 2WDRA 3ALJA 3AE4A 1E1NA 2JBVA 3R9UA 4H7UA 1GALA 2YR5A 1CBOA 2FJAA 2YG3A 4APNA 1E39A 2WETA 1ZDLA 1GT8A 1TDKA 1F8SA 2WS3A 2BCGG 3AEAA 3NIXA 2HQMA 4CY6A 2WU5A 3NK0X 1VG0A 2YG6A 5CQFA 5JCNA 5HXIA 5KWFA 4B64A 3P4SA 4K22A 1TRBA 2B7SA 4BV6A 4CNKA 5M10A 5EBKA 4C3YA 3BI4A 3P4PA 4YSXA 1PBDA 3CN8A 3K7QX 3NTAA 2X8GA 2QA1A 4UP3A 5CKUA 3NKSA 1DOEA 4GRTA 3LJPA 1TYPA 3KU9A 1KFYA 2GAGB 4FK1C 1LPFA 4U8NA 4USRA 1S3BA 2R0GA 3QVPA 1Q9IA 1F6MA 1GRFA 1B8SA 3LB8A 3F8RA 1BF3A 2E5VA 2ZZCA 1BKWA 4YTPA 2VQBA 3SM8A 5GSNA 1PBFA 2XVIA 4Y4MA 3RP7A 2ACZA 3UKPA 2JK6A 3HZLA 3KD9A 1EL7A 1RSGA 4FX9A 4NEWA 1Q1RA 2R9ZA 1LV0A 1VQWA 5EB4A 1PBCA 1D4DA 1S2QA 4I59A 2VVLA 3NGCX 4XXGA 1PDHA 3AE6A 2BA9A 1GSNA 1V59A 2C72A 2GAHB 2YR6A 4J56A 3VR9A 2BABA 2W0HA 4H2RA 5JCIA 4X9NA 5C3JA 4FK1A 4GDPA 4BK3A 1H7WA 2CVJA 1M64A 3NNEA 1CJ2A 4OPCA 3M13A 1D5TA 2H88A 4GDEA 4AT2A 1E1MA 4Z26A 2X99A 1H82A 2Y6RA 3ITJA 2Y6QA 3P4RA 2RGHA 1H84A 3C96A 4JN9A 1REOA 2YVFA 1KF6A 2E4GA 4D04A 2XYOA 4JNQA 3ZDNA 3CIRA 3ATRA 4J31A 4D03A 4ECHA 1NHRA 4Z2RA 3AECA 3KVEA 4C77A 1GEUA 4YSHA 4H4SA 2QA2A 1LTXR 1QO8A 3ALMA 4OVIA 1B4VA 1DJNA 4O5QA 4KX6A 3EAOA 4X4JA 5KOWA 4ADWA 2XDOA 4U8PA 4U8IA 3GD4A 3VRBA 4DGKA 3M0OA 2A87A 3CGBA 2FBWA 3VRDB 4UDQA 2JKCA 4BJYA 1BZLA 1UKVG 2C76A 2ZZBA 1FOHA 3NYEA 3GSIA 2VZ2A 2BACA 3NN6X 4AP1A 2XVJA 3GWFA 5M0ZA 1GETA 2IVDA 4U8JA 2GEWA 1L0VA 2A89A 1S3EA 3Q9TA 1GREA 4AOXA 4TM0A 4J33A 3CNTA 1JNRA 4B1BA 2UZZA 3KA7A 1F3PA 2AQJA 3UTGA 4YXDA 2XLTA 4IA5A 2WPEA 3AD9B 4C5OA 3CGDA 3IHGA 3CGCA 1ZOYA 2XFQA 4OPGA 1YKJA 4Z44A 3UKFA 5GRTA 1LVLA 2WPCA 3FG2P 3NYFA 4Z24A 4A6NA 4EQWA 5HYMA 2WDQA 1QJDA 2Q6UA 3ICSA 4P9SA 2C3CA 3AXBA 3D1CA 4XWRA 3ALLA 2BCPA 4EIQA 2CULA 3I6DA 3VR8A 2OLNA 3QSSA 2GF3A 3P9UA 1GTEA 2TPRA 4EMWA 2BC1A 1ZK7A 5L46A 4B65A 2BS4A 2OAMA 1ZMCA 3NH3X 3REDA 1JNZA 2B9XA 2YG5A 4I58A 3UP5A 1FEAA 1Y0PA 1XDIA 2X8HA 2YG7A 2WP6A 2WPFA 2WOIA 2NPXA 2Q0KA 1D4EA 3NK2X 4H4WA 2VRMA 4N9XA 2OALA 3CNSA 3L1RA 5JCLA 3UKAA 2Z5XA 4NTEA 4EMJA 2RABA 1GRGA 3RP6A 3ICRA 4WCTA 1ZP0A 4LIIA 2ZBWA 3UKLA 1F8RA 1GNDA 3BNMA 3ISHA 4A7AA 4CCQA 3AYJA 2EQ8A 1Q1WA 4A99A 2WESA 5FS6A 1H6VA 2AAQA 2C3DA 4TM3A 2O9ZA 5EOWA 4H2PA 1KSUA 3AE9A 4H4PA 3CNJA 2JB3A 2VQ7A 2BXSA 2YVJA 1DODA 2JB1A 4B69A 2BC0A 3G5SA 1IUVA 3CGEA 2DKIA 4X9MA 4BURA 2C66A 2GQFA 2OLOA 1NDAA 2X3NA 1GERA 5EB5A 4YT0A 3NYCA 3UKHA 2YAUA 2VRLA 1JRZA 3GD3A 4FDCB 2QAEA 3AEBA 4U2LA 3DGHA 2JB2A 4U8MA 5IQ1A 4NTCA 3SFDA 1H7XA 2QCUA 4GUVA 1ZX9A 2J3NA 4GR1A 2BK4A 3DK8A 3OC4A 2B7RA 5DBJA 1BGNA 1NENA 2Z5YA 3I3LA 3NRNA 2F5ZA 2R46A 2C64A 1B37A 5FS9A 4A6NB 5KXJA 3NG7X 1M6IA 2GRTA 2VVLG 2XFNA 2FJEA 4AOSA 2BK5A 3PVCA 3F8PA 2FJBA 3B3RA 2GMJA 3D8XA 4OPIA 2V3AA 1RP0A 4YSZA 3S5WA 3AEEA 2C73A 3II4A 3AE7A 4B63A 1NHSA 1JU2A 4Z43A 1L9CA 1ONFA 1D7LA 3M12A 1H83A 4TM4A 1E1KA 4NTDA 3DK9A 1VRQB 3H4KA 2GQWA 2XCGA 3EPTA 3F8DA 1NHQA 1CJ3A 3DH9A 1GRHA 1N4WA 4MJWA 3AE5A 2WDVA 4GF7A 2YLSA 4JY2A 1IUTA 5J60A 4H4UA 3JSKA 5U1OA 3LZWA 5C2TA 1RYIA 2BYBA 2CFYA 1GOSA 2X8CA 4CBQA 3CPIG 4A5LA 2EQ7A 2WEUA 1K4QA 2YM2A 2R4EA 4HA6A 2WU2A 3CNDA 3RHAA 2XFPA 1PS9A 2BK3A 2ZZ0A 5KVHA 2WQYA 1JRYA 1NAAA 2I0ZA 1NG3A 1ELIA 3K30A 3KLJA 1EL9A 4K8DA 2EQ6A 3RNMA 1CC2A 1PHHA 1BWCA 3E1TA 5FMHA 4J2WA 3UKQA 4DSGA 4JDRA 5JCKA 4J34A 1N4VA 4U8OA 4H4QA 2YLWA 3O0HA 4CRTA 1NPXA 4NEVA 4RG4A 3V3NA 1D7YA 2C7GA 2XLUA 3NHOX 5KRQA 1JEHA 3AEGA 1ZKQA 3GRTA 1XPQA 2B76A 4H4ZA 1CC6A 1HYUA 2A8XA 5J7XA 2PYXA 3BI2A 2R0PA 4Y4LA 3BI5A 2VOUA 3CPHG 3DJGX 3UCLA 3FMWA 2V60A 4CY8A 4OPTA 2C75A 2C70A 5BVAA 5KOXA 3H8LA 4EMIA 2E1MA 1GXFA 1IUXA 3FPZA 1H86A 2GR0A 3AE2A 3AB1A 2AR8A 1XANA 4ICYA 3K7TA 3SQPA 1W4XA 3VQRA 4EM3A 4KPRA 2B9WA 3GMCA 3DGZA 1OJ9A 3QSEA 3URHA 1MOKA 1NEKA 2XFOA 2YR4A 1CC4A 2V3BA 5IQ4A 1ZY8A 4K7ZA 3K7MX 3GWDA 4ZN0A 1GRBA 4JY3A 1IUUA 1KNPA 3GDPA 3PO7A 3AWIA 1O5WA 4DSHA 3GMBA 1CHUA 3DJDA 2GB0A 1YY5A 3CPJG 4H4TA 1NHPA 4H4YA 1K0JA 4GCMA 4U8KA 2YLXA 2TMDA 1N4UA 1DJQA 2WP9A 3UTEA 3GYJA 3FBSA 2ARDA 4PABA 1PXBA 4TLXA 4OCGA 4HB9A 2YWLA 1ZMDA 1YQZA 1YQ4A 3G5RA 3IHMA 4Z2TA 3LXDA 1H81A 4OPUA 3AYLA 3BNUA 4IV9A 2Q7VA 3BHKA 2APGA 2V61A 3V76A 1NG4A 3C4AA 1FL2A 3CTYA 2WHDA 1BGJA 3UOVA 2GVCA 3AEDA 5FS8A 4A9WA 2NVKX 3LOVA 1OJCA 1YQ3A 3NT6A 3KPFA 2XFUA 2YVGA 2DKHA 3SFEA 2IVEA 5KVIA 1E6EA 5LV9A 3ABVA 1LQTA 1CJ4A 5U25A 1COYA 4K5RA 4AT0A 1CJCA 4JQ9A 2PHHA 2GH5A 5JCMA 1CL0A 2WOWA 1EL8A 3QVRA 4YWOA 1CF3A 1IUSA 4K2XA 1SEZA 4Z25A 4EIPA 1VDCA 2B9YA 2WBAA 3SGLA 4E0VA 5BULA 3ATQA 4ZCDA 3G5QA 3DA1A 2EQ9A 3LADA 1LJ1A 1ZOVA 2BS2A 3IF9A 3UOYA 1TYTA 3IC9A 2C67A 2XLRA 2JAEA 3ADAB 4U2SA 1B5QA 3Q6JA 5IPYA 1MXTA 1TDOA 5BUKA 2C65A 1PN0A 5TR3A 3WE0A 1F8WA 1GPEA 3NLCA 1DNCA 4XWZA 1K0LA 3C4NA 1EL5A 3NTDA 3OZ2A 1Y56A 2Q0LA 2YLZA 2GR3A 4AP3A 4BK1A 3GDNA 4EQXA 1QLBA 1IUWA 2FJDA 2XLSA 1O95A 4YTMA 1PBEA 1PXAA 2IIDA
chains in the Genus database with same CATH superfamily
3P1WA 4A79A 2V5ZA 3QSMA 1N60C 4YWSA 2WOVA 4NZHA 3DJJA 4A65A 2CDUA 3UP4A 3FIMB 4LU6A 1NELA 2OQYA 3RGTA 5ER0A 1GRAA 4O5UA 4IVMB 4GISA 2YQUA 4UDPA 4PAAA 3MUCA 1KN0A 1E1LA 1TDFA 4J36A 4G9KA 3AE8A 3KKJA 3CXBA 2R45A 3T37A 3D46A 4Z2UA 3KUMA 4IVOB 5HY5A 4DNAA 3GRSA 2WP5A 1P2HA 2ZC8A 4WX1A 4UDRA 2VVMA 2YM1A 4RG3A 5KMSA 3GYIA 4E4UA 3SY4A 3BOXA 5HHFA 1IJHA 4F4RA 3EF6A 2R0CA 4KPLA 4B66A 3DJEA 4YKGA 3L5OA 1KDGA 1KSSA 3COXA 3DMEA 3ALJA 3R9UA 2YR5A 2YG3A 3R25A 2WETA 1F8SA 2WS3A 2YG6A 4CNKA 3SBFA 3T8QA 5EBKA 3IJIA 3BI4A 3K7QX 3NTAA 3NKSA 4GRTA 3KU9A 1KFYA 2GAGB 1LPFA 3SZCA 4U8NA 4USRA 1S3BA 1Q9IA 2GSHA 2E5VA 2ZZCA 4E8GA 4Y4MA 3TTEA 3KD9A 2XH7A 5J04A 4DXKA 2R9ZA 1LV0A 1VQWA 5EB4A 1D4DA 4E6MA 3RRAA 3AE6A 1GSNA 2YR6A 3P3BA 4J56A 2W54A 1SJAA 2PODA 1M64A 3NNEA 4GYPA 4OPCA 2H88A 4ZA0A 2E4GA 4D04A 4GIRA 2P0IA 3KVEA 1GEUA 3ALMA 1B4VA 3MKCA 3EAOA 2XDOA 4GAPA 4NNJA 4H83A 4DGKA 3VRDB 2FBWA 4IHCA 2JKCA 1BZLA 1UKVG 3DFHA 2VZ2A 4A6GA 2BACA 3NN6X 2GEWA 5FJUA 1T3QC 3QTPA 1S3EA 4AOXA 1GREA 4J3ZA 3CNTA 4B1BA 1WUEA 1F3PA 2FKPA 2XLTA 4C5OA 4Z44A 3UKFA 3NYFA 3FG2P 3D1CA 3ALLA 4A35A 3VR8A 2OLNA 3QSSA 2GF3A 4EMWA 2MUCA 5L46A 4B65A 4GGBA 2BS4A 4IL2A 3NH3X 2YG5A 1TZZA 4I58A 2X8HA 2WP6A 2Q0KA 1D4EA 2VRMA 4NTEA 3ICRA 5KNLA 4WCTA 3UKLA 4A7AA 4CCQA 1F8RA 3CMMA 3T0KA 4A99A 4NWZA 5EOWA 4H4PA 1ZXIC 2JB1A 4B69A 2BC0A 2XSXA 3CGEA 2DKIA 4BURA 2C66A 4MMWA 2OLOA 4YT0A 2QAEA 4M0XA 4U2LA 4U8MA 1H7XA 2QCUA 2J3NA 2B7RA 5DBJA 3I3LA 2R46A 1STZA 1B37A 2GRTA 3ENLA 2FJBA 3II4A 4HCHA 5KMQA 4Z43A 3CYJA 1ONFA 1GRHA 4MJWA 3AE5A 2YLSA 4K2SA 5J60A 3NVVB 3CPIG 4A5LA 2EQ7A 2GL5A 2WEUA 1K4QA 1TKKA 5G5HB 1BKHA 2ZZ0A 4HNCA 4FI4A 4K8DA 2EQ6A 3QLDA 1N4VA 1ELSA 3O0HA 4NEVA 3A7RA 3V3NA 2C7GA 4H4ZA 1HYUA 2A8XA 2PYXA 4Y4LA 2RDXA 4OPTA 3H8LA 1H86A 2GR0A 3FYYA 3AE2A 3AB1A 3JZUA 4ICYA 3TWBA 3K7TA 4IP5A 4M6UA 4EWJA 2PCEA 1OJ9A 2XFOA 5IQ4A 4HNLA 3K7MX 3T2YA 2PS2A 3PO7A 4DSHA 2GB0A 3ZVHA 1N4UA 1DJQA 4OCGA 1YQZA 3LXDA 4OPUA 2Q7VA 3CTYA 3AEDA 3SZFA 1OJCA 3ABVA 3QVRA 3UJRA 1VDCA 5BULA 4K1WA 1ZOVA 3ADAB 2C67A 4U2SA 3I4KA 5IPYA 1MXTA 1TDOA 1N63C 1DNCA 2E3TA 1L8PA 1K0LA 3C4NA 3NTDA 2NQLA 2Q0LA 3UJSA 2PMQA 3NK1X 3EANA 3UXKA 4YSYA 1JROA 3AYIA 4GFIA 4ZOHB 3P4QA 1L9EA 2BXRA 4EM4A 1OJDA 1VDVA 4TLZA 1GRTA 1GESA 1DXLA 3QKEA 5FS7A 1Z6LA 1EBDA 2V6OA 3AD8B 4TVYA 1DOBA 1MO9A 4G6GA 1PJ7A 1GTHA 2YLRA 4U2TA 3DGBA 4M52A 3I6EA 1TDEA 5FJPA 1JRXA 3AE3A 4ZCWA 1PXCA 4G74A 4CCRA 2GV8A 3DK4A 4G8TA 3T9PA 1FEBA 3UTFA 3NN0X 3L8KA 3AEFA 1Y56B 4BK2A 3QFBA 2BS3A 2XLPA 3B6DA 3H8IA 4B67A 5ENLA 2OG9A 2YLTA 2RGOA 3ICTA 1OJTA 2XVEA 3TJ4A 3AE4A 4H7UA 3GO2A 3R0UA 1CBOA 2FJAA 3SYIA 1ZDLA 1GT8A 1TDKA 4E5TA 2PTYA 3ES7A 3CT2A 3THUA 5KWFA 5M10A 4BV6A 4YSXA 3P4PA 1PBDA 4UP3A 5CKUA 1TYPA 3HPFA 2DW6A 3CK5A 1WYGA 2XVIA 2JK6A 5G5GB 2AKZA 1Q1RA 1S2QA 2QDDA 3TJIA 4XXGA 3UGVA 2BA9A 1V59A 3SJNA 2W0HA 5JCIA 3SSZA 4FK1A 4GDPA 3PK7A 4H1ZA 1CJ2A 3HYWA 4G6HA 4GDEA 2X99A 1H82A 3GD6A 3ITJA 2GGIA 3RO6A 3H12A 4JNQA 2I5QA 3CIRA 1NHRA 3OW1A 4Z2RA 1DJNA 4KX6A 2W55A 4U8PA 4JHMA 1XS2A 3VRBA 2OLAA 3M0OA 2A87A 3CGBA 4UDQA 4HYRA 4BJYA 3NYEA 1GETA 2IVDA 4U8JA 1L0VA 3Q9TA 2POZA 3KA7A 2AQJA 4IA5A 4Z1YA 3IHGA 1ZOYA 2XFQA 1YKJA 1FFVC 5GRTA 5HYMA 4A6NA 1QJDA 4P9SA 3AXBA 2BRYA 2O56A 3B97A 3I6DA 1GTEA 1ZK7A 2OAMA 3UP5A 2YG7A 3UKAA 5JCLA 1GRGA 2ZBWA 4LIIA 2E5AA 1Q1WA 3B9JB 3R1ZA 3HYVA 5FS6A 2OKTA 1H6VA 2O9ZA 3A7UA 3QN3A 2ONEA 3G5SA 1IUVA 3DG6A 4MGGA 2GQFA 1NDAA 3NYCA 3H8AA 3AEBA 2JB2A 2HXTA 5IQ1A 4NTCA 1SJDA 2OQHA 4GUVA 1ZX9A 3NXLA 3NVYB 2BK4A 3OC4A 1BQGA 2OZ3A 2QGYA 1BGNA 3P93A 3NRNA 2F5ZA 5FS9A 5KXJA 3NG7X 2BK5A 3PVCA 3AM9A 2GMJA 3D8XA 2V3AA 3DDMA 2C73A 1NHSA 3M12A 1H83A 2DW7A 3DK9A 1VRQB 3EPTA 1NHQA 1CJ3A 4IZGA 3TW9A 3DH9A 1N4WA 2WDVA 4GF7A 4DWDA 3JSKA 5U1OA 3LZWA 4ROPA 3T31A 3NFUA 3T4WA 1KCZA 4HA6A 2WU2A 3CNDA 5KVHA 2WQYA 1NAAA 2I0ZA 3STPA 3RNMA 1CC2A 4J2WA 3UKQA 3OZMA 4JDRA 4U8OA 2OZTA 1EC7A 4CRTA 1NPXA 3T6CA 4RG4A 3SZ0A 4IT1A 3NHOX 3UCDA 2HXUA 2B76A 1RVKA 1CC6A 3BI2A 2R0PA 3SX6A 3CPHG 3TCSA 3DJGX 4CY8A 1IUXA 3ES8A 3S5SA 1W4XA 4EM3A 2P8BA 1NEKA 2YR4A 3JVAA 3FV9A 1ZY8A 4ZN0A 3GDPA 1O5WA 1CHUA 3DJDA 1MNSA 2AL2B 3CPJG 4GCMA 1DTNA 4U8KA 2GGJA 1VQZA 2YLXA 2TMDA 2WP9A 2PGWA 4HB9A 2YWLA 1ZMDA 3NZGA 1YQ4A 1EBGA 3G5RA 3IHMA 4Z2TA 1H81A 1JDFA 3AYLA 3BHKA 3HYXA 3SN1A 3CXOA 1EBHA 3UOVA 1BGJA 2XH0A 4FP1A 1YQ3A 2XFUA 2YVGA 1LQTA 4K5RA 4JQ9A 2PHHA 1CL0A 2WOWA 2PGEA 3V5CA 4YWOA 1IUSA 4Z25A 4E0VA 4DN1A 3N4FA 3DA1A 2EQ9A 3LADA 3SN0A 3IF9A 3UOYA 1X2GA 1OEPA 4GMEA 1B5QA 2C65A 5TR3A 3ZLGA 3MSYA 1EL5A 4AP3A 3GDNA 2PU0A 2QQ6A 2XLSA 1IUWA 1O95A 2PTWA 1PBEA 5IDZA 2FYMA 1PXAA 1E9IA 4JNAA 3PS9A 4C3XA 3AE1A 3JW7A 4Y4NA 3AD7B 3DG3A 4CNJA 4DHGA 1XHCA 2XVHA 3LZXA 3IJQA 2YG4A 4OPLA 2H89A 4IP4A 1L9DA 1PJ6A 1JOAA 3CNPA 2GR1A 3BHFA 1MDRA 4YKFA 3ZVIA 2BRAA 3UTHA 1TDNA 2QVHA 4EQSA 3HRDC 4J57A 1X31B 3UOXA 3QFAA 5BRTA 1K0IA 1VG9A 3S61A 4YTNA 3FCPA 4REKA 4DYEA 4K5SA 3SN4A 4K8GA 4USQA 1DOCA 1V97A 3NS1B 4KWSA 2JBVA 3MZNA 7ENLA 2GGHA 1X2HA 4APNA 4HCDA 1E39A 2BCGG 3AEAA 3NIXA 4CY6A 3SR6B 1VG0A 5CQFA 3FJ4A 5HXIA 4K22A 1TRBA 2B7SA 3P0WA 2X8GA 2QA1A 2GGGA 3PG6A 3QVPA 4GYPC 1MDLA 1GRFA 1B8SA 4H2HA 1BKWA 4YTPA 2VQBA 5GSNA 1TE6A 3RP7A 1F9CA 5KMPA 2QJJA 1RSGA 4NEWA 3AMZA 1PBCA 2VVLA 1PDHA 2C72A 2GAHB 4A3RA 3VR9A 5C3JA 3NO1A 1H7WA 2CVJA 3RCYA 4AT2A 4Z26A 2Y6QA 3P4RA 1H84A 3C96A 1YEYA 1REOA 4D03A 1WUFA 3IJLA 1ECQA 4C77A 4YSHA 4H4SA 2QA2A 4OVIA 1QO8A 4X4JA 1N62C 4ADWA 5KOWA 4U8IA 3K1GA 2QDEA 3GD4A 2C76A 3GSIA 1S7MA 1ONEA 4AP1A 2XVJA 3GWFA 5M0ZA 4HPNA 3EEZA 4J33A 1JNRA 3UTGA 4YXDA 2WPEA 3AD9B 4OPGA 2XH2A 4Z24A 2WPCA 3ICSA 4XWRA 4MKSA 3P9UA 2TPRA 2BC1A 3I6TA 1ZMCA 3REDA 3Q4DA 2B9XA 1XDIA 2NPXA 3NK2X 4N9XA 4H4WA 3RP6A 1GNDA 3NRZB 4X2PA 2AAQA 4TM3A 2JB3A 2VQ7A 1SJCA 3MWCA 4X9MA 3N6HA 1GERA 5EB5A 3HW2A 2YAUA 1JRZA 3GD3A 3MQTA 4ENLA 1RM6B 3ZLFA 3DGHA 3AN1A 3SFDA 6ENLA 4GR1A 3DK8A 1NENA 2Z5YA 4G7FA 5BOFA 4DX3A 4HN8A 3B3RA 2ZADA 1RP0A 4YSZA 4B63A 1JU2A 4KT2A 2GQWA 3V5FA 3VFCA 4JY2A 1PDYA 4H4UA 5C2TA 3VC6A 3VC5A 5KMRA 2R4EA 3DERA 2XFPA 1R6WA 3RR1A 1PS9A 2BK3A 1JRYA 3N6JA 3TOYA 3KLJA 1EC9A 3E1TA 5FMHA 3VCNA 4J34A 4IL0A 3RITA 1JPMA 2XLUA 5KRQA 1JEHA 1ZKQA 2PU1A 1N5XA 3UCLA 3NVWB 2C75A 2C70A 5KOXA 4EMIA 2E1MA 3EKGA 3OP2A 2OO6A 2AR8A 1R0MA 3SQPA 1FHVA 3NVZB 3VQRA 2AKMA 3QSEA 1H2IA 3DGZA 1XPYA 3PWIA 3GWDA 2OPJA 3GMBA 3UJEA 1NHPA 4H4YA 3FBSA 3DIPA 1PXBA 2P3ZA 3BNUA 2QJMA 2APGA 2V61A 4KEMA 1N5WC 4A9WA 3NT6A 2IVEA 5KVIA 1E6EA 5LV9A 5U25A 4AT0A 1CJCA 5JCMA 1FHUA 4J1OA 1W6TA 1EL8A 1SEZA 2HNEA 3R07C 2WBAA 3SGLA 3ATQA 4ZCDA 3G5QA 2PP3A 1TYTA 2XLRA 2JAEA 3Q6JA 5BUKA 1PN0A 3U9IA 1GPEA 5JRBA 4XWZA 3DEQA 1EC8A 3ZVHB 5BOEA 1Y56A 2YLZA 4BK1A 4EQXA 1QLBA 2IIDA 4H2NA 4U8LA 3TQPA 3ZYXA 4H2QA 4IA6A 1S2YA 1O94A 1KNRA 1LQUA 4OPDA 3PFRA 1D4CA 1N1PA 4C74A 3QJ4A 1FECA 3V3OA 2PA6A 1SB3B 2GMHA 5U63A 2GGEA 3U4FA 1E7PA 3R0KA 4EQRA 3UOZA 1PJ5A 3IWAA 4B68A 4H50A 1GV4A 4ZCCA 2W3SA 4H4VA 4TM1A 4JN7A 1AOGA 3DG7A 3R10A 4HCLA 3VRAA 4JN8A 1OJAA 2X50A 4H4XA 1FCDA 1PDZA 4II2A 4BJZA 3MY9A 1PBBA 4RSLA 2XH4A 2R4JA 3DESA 3UKKA 2XVFA 1SJBA 4H4RA 2OA1A 1P2EA 2P8CA 4LA1A 2RGJA 4TVWA 2GR2A 3RP8A 5FJTA 2WDRA 3T2KA 1E1NA 1GALA 4G73A 2HQMA 4GGHA 2WU5A 3NK0X 4H19A 4E4FA 5JCNA 3UCCA 3P4SA 4B64A 3KPKA 4C3YA 3CN8A 1DOEA 3LJPA 4FK1C 3GC2A 2R0GA 3BJSA 1F6MA 3LB8A 3F8RA 1BF3A 3UXLA 3SM8A 1PBFA 3IK4A 3OPSA 2ACZA 3UKPA 3HZLA 1EL7A 4FX9A 4I59A 3NGCX 2PTZA 2BABA 4H2RA 4X9NA 4BK3A 1MRAA 3M13A 1D5TA 1E1MA 2Y6RA 2RGHA 4JN9A 2YVFA 1KF6A 2XYOA 3ZDNA 1JRPA 3ATRA 4J31A 4ECHA 3AECA 3T2ZA 1LTXR 4O5QA 1NU5A 3H70A 4II3A 2ZZBA 1FOHA 1FFUC 3V4BA 2A89A 4TM0A 2UZZA 3CGDA 3CGCA 2AL1A 1LVLA 4EQWA 1JPDX 2Q6UA 2WDQA 3UJFA 2C3CA 5FJOA 2BCPA 4EIQA 1JCTA 2CULA 2OFJA 1MUCA 1JNZA 2PSNA 1FEAA 1Y0PA 2WPFA 2WOIA 2OALA 3CNSA 3L1RA 2Z5XA 4EMJA 2RABA 1ZP0A 3BNMA 3ISHA 3AYJA 2EQ8A 2GDQA 2PP1A 2WESA 2OX4A 2C3DA 4H2PA 1KSUA 3AE9A 3CNJA 2BXSA 2YVJA 1DODA 1KKOA 3VCCA 2X3NA 1KD0A 3UKHA 2VRLA 4FDCB 2C64A 2QJNA 4A6NB 2XGZA 1M6IA 2PPGA 2VVLG 1IYXA 2XFNA 2FJEA 4AOSA 3OZYA 3F8PA 4OPIA 3PWGA 3S5WA 3AEEA 3FVDA 3AE7A 4Z17A 3VA8A 1L9CA 1D7LA 4TM4A 1E1KA 4NTDA 3H4KA 2XCGA 3F8DA 2P88A 3FXGA 1P43A 3Q45A 3A7AA 1IUTA 3S47A 1KKRA 2AL2A 3QPEA 3CAWA 1RYIA 2BYBA 2CFYA 1GOSA 2X8CA 4CBQA 2OZ8A 2YM2A 5FJRA 3RHAA 1NG3A 1ELIA 3K30A 1EL9A 3EUB3 1PHHA 1BWCA 4DSGA 5JCKA 3D47A 4H4QA 2YLWA 1D7YA 3AEGA 2W3RA 3GRTA 1FO4A 1XPQA 5J7XA 3BI5A 2VOUA 2CHRA 3FMWA 2V60A 5BVAA 1GXFA 3FPZA 1XANA 3GMCA 4KPRA 2B9WA 3URHA 1MOKA 3GY1A 1CC4A 2V3BA 4K7ZA 1GRBA 4JY3A 1IUUA 4GAVA 1KNPA 3AWIA 1YY5A 4H4TA 1K0JA 2MNRA 3VDGA 3UTEA 3GYJA 3UJ2A 2ARDA 4PABA 4TLXA 3R11A 4IV9A 3V76A 1NG4A 3C4AA 1FL2A 2PP0A 2WHDA 3SQSA 2GVCA 5FS8A 2NVKX 3LOVA 3V3WA 3H7VA 3KPFA 2DKHA 3SFEA 1CJ4A 1COYA 3OTRA 3N4EA 2GH5A 1FIQB 3TWAA 1CF3A 4K2XA 3BSMA 2PTXA 4EIPA 3SXIA 2B9YA 3DFYA 3T14A 3D9XA 1LJ1A 2BS2A 3IC9A 3SZWA 3GYXA 5EU9A 1P48A 3WE0A 1F8WA 3NLCA 1N61C 3ETRB 2OVLA 2C4CA 3OZ2A 2GR3A 2HZGA 2FJDA 3CB3A 4YTMA 3ZLHA
chains in the Genus database with same CATH topology
4H2NA 3P1WA 4U8LA 4A79A 2V5ZA 3EANA 3NK1X 3ZYXA 4H2QA 4IA6A 1S2YA 4YSYA 3QSMA 3AYIA 1O94A 1KNRA 4JNAA 1LQUA 2WOVA 3P4QA 3PS9A 4NZHA 3AE1A 1L9EA 4OPDA 2BXRA 4C3XA 4Y4NA 3DJJA 1D4CA 3AD7B 4EM4A 1OJDA 4A65A 1N1PA 2CDUA 3UP4A 4C74A 3FIMB 3QJ4A 1FECA 4TLZA 1GRTA 4LU6A 3V3OA 4CNJA 5ER0A 1GESA 1XHCA 1GRAA 4O5UA 2GMHA 4IVMB 2YQUA 5U63A 1DXLA 4UDPA 5FS7A 2XVHA 1E7PA 4PAAA 4EQRA 3UOZA 1KN0A 2YG4A 3LZXA 1PJ5A 3IWAA 1Z6LA 1E1LA 4H50A 4OPLA 4B68A 1GV4A 2H89A 1L9DA 1TDFA 4ZCCA 1EBDA 4J36A 1PJ6A 4G9KA 4H4VA 1JOAA 3AE8A 3CNPA 2V6OA 3KKJA 4TM1A 3AD8B 1DOBA 1AOGA 1MO9A 2GR1A 2R45A 3BHFA 1PJ7A 4G6GA 3T37A 4YKFA 1GTHA 4Z2UA 2YLRA 4U2TA 4M52A 3VRAA 4IVOB 2BRAA 3UTHA 1TDNA 1OJAA 5HY5A 1TDEA 4DNAA 4EQSA 2X50A 4H4XA 4J57A 1FCDA 3GRSA 1JRXA 1X31B 1PXCA 3AE3A 4G74A 3UOXA 3QFAA 4CCRA 2GV8A 4II2A 4BJZA 5BRTA 1PBBA 2WP5A 3DK4A 1P2HA 1K0IA 4RSLA 1VG9A 3S61A 4YTNA 1FEBA 4WX1A 4UDRA 2VVMA 3UTFA 2YM1A 4RG3A 3NN0X 5KMSA 3GYIA 2R4JA 3L8KA 3AEFA 4REKA 3SY4A 1Y56B 3UKKA 4BK2A 2XVFA 3QFBA 5HHFA 4H4RA 1IJHA 2OA1A 4K5SA 2BS3A 1P2EA 3EF6A 2XLPA 2R0CA 4LA1A 3B6DA 2RGJA 4B66A 3DJEA 3H8IA 4B67A 4USQA 4YKGA 2GR2A 1DOCA 3L5OA 1KDGA 1KSSA 3COXA 3RP8A 2YLTA 2RGOA 3DMEA 3ICTA 1OJTA 2XVEA 2WDRA 3ALJA 3AE4A 3T2KA 1E1NA 2JBVA 3R9UA 4H7UA 1GALA 2YR5A 1CBOA 2FJAA 2YG3A 4APNA 4G73A 3SYIA 1E39A 2WETA 1ZDLA 1GT8A 1TDKA 1F8SA 2WS3A 2BCGG 3AEAA 3NIXA 2HQMA 4CY6A 2WU5A 3NK0X 1VG0A 2YG6A 5CQFA 5JCNA 5HXIA 5KWFA 4B64A 3P4SA 3KPKA 1TRBA 2B7SA 4BV6A 4K22A 4CNKA 5M10A 5EBKA 4C3YA 3BI4A 3P4PA 4YSXA 1PBDA 3CN8A 3K7QX 3NTAA 2X8GA 2QA1A 4UP3A 5CKUA 3NKSA 1DOEA 4GRTA 3LJPA 1TYPA 3KU9A 1KFYA 2GAGB 4FK1C 1LPFA 3SZCA 4U8NA 4USRA 1S3BA 3PG6A 2R0GA 3QVPA 1Q9IA 1F6MA 1GRFA 1B8SA 3LB8A 3F8RA 1BF3A 2E5VA 2ZZCA 1BKWA 4YTPA 2VQBA 3SM8A 5GSNA 1PBFA 2XVIA 4Y4MA 3RP7A 2ACZA 3UKPA 2JK6A 3HZLA 5KMPA 3KD9A 1EL7A 1RSGA 4FX9A 4NEWA 1Q1RA 2R9ZA 1LV0A 1VQWA 5EB4A 1PBCA 1D4DA 1S2QA 4I59A 2VVLA 3NGCX 4XXGA 1PDHA 3AE6A 2BA9A 1GSNA 1V59A 2C72A 2GAHB 2YR6A 4J56A 3VR9A 2BABA 2W0HA 4H2RA 5JCIA 4X9NA 5C3JA 4FK1A 4GDPA 4BK3A 1H7WA 2CVJA 1M64A 3NNEA 1CJ2A 4OPCA 3M13A 1D5TA 2H88A 3HYWA 4G6HA 4GDEA 4AT2A 1E1MA 4Z26A 2X99A 1H82A 2Y6RA 3ITJA 2Y6QA 3P4RA 2RGHA 1H84A 3C96A 4JN9A 1REOA 2YVFA 1KF6A 2E4GA 4D04A 2XYOA 4JNQA 3ZDNA 3CIRA 3ATRA 4J31A 4D03A 4ECHA 1NHRA 4Z2RA 3AECA 3KVEA 3T2ZA 4C77A 1GEUA 4YSHA 4H4SA 2QA2A 1LTXR 1QO8A 3ALMA 4OVIA 1B4VA 1DJNA 4O5QA 4KX6A 3EAOA 4X4JA 5KOWA 4ADWA 2XDOA 4GAPA 4U8PA 4NNJA 4U8IA 3GD4A 3VRBA 4II3A 4DGKA 3M0OA 2A87A 3CGBA 2FBWA 3VRDB 4UDQA 2JKCA 4BJYA 1BZLA 1UKVG 2C76A 2ZZBA 1FOHA 3NYEA 3GSIA 1S7MA 2VZ2A 2BACA 3NN6X 4AP1A 2XVJA 3GWFA 5M0ZA 1GETA 2IVDA 4U8JA 2GEWA 1L0VA 2A89A 1S3EA 3Q9TA 1GREA 4AOXA 4TM0A 4J33A 3CNTA 1JNRA 4B1BA 2UZZA 3KA7A 1F3PA 2AQJA 3UTGA 4YXDA 2XLTA 4IA5A 2WPEA 3AD9B 4C5OA 3CGDA 3IHGA 3CGCA 1ZOYA 2XFQA 4OPGA 1YKJA 4Z44A 3UKFA 5GRTA 1LVLA 2WPCA 3FG2P 3NYFA 4Z24A 4A6NA 4EQWA 5HYMA 2WDQA 1QJDA 2Q6UA 3ICSA 4P9SA 2C3CA 3AXBA 3D1CA 4XWRA 3ALLA 2BCPA 2BRYA 4EIQA 2CULA 3I6DA 3VR8A 2OLNA 3QSSA 2GF3A 3P9UA 1GTEA 2TPRA 4EMWA 2BC1A 1ZK7A 5L46A 4B65A 2BS4A 2OAMA 1ZMCA 3NH3X 3REDA 1JNZA 2B9XA 2YG5A 4I58A 3UP5A 1FEAA 1Y0PA 1XDIA 2X8HA 2YG7A 2WP6A 2WPFA 2WOIA 2NPXA 2Q0KA 1D4EA 3NK2X 4H4WA 2VRMA 4N9XA 2OALA 3CNSA 3L1RA 5JCLA 3UKAA 2Z5XA 4NTEA 4EMJA 2RABA 1GRGA 3RP6A 3ICRA 5KNLA 4WCTA 1ZP0A 4LIIA 2ZBWA 3UKLA 1F8RA 1GNDA 3BNMA 3ISHA 4A7AA 4CCQA 3AYJA 2EQ8A 3CMMA 1Q1WA 3T0KA 4A99A 3HYVA 2WESA 5FS6A 1H6VA 4NWZA 2AAQA 2C3DA 4TM3A 2O9ZA 5EOWA 4H2PA 1KSUA 3AE9A 4H4PA 3CNJA 2JB3A 2VQ7A 2BXSA 2YVJA 1DODA 2JB1A 4B69A 2BC0A 3G5SA 1IUVA 3CGEA 2DKIA 4X9MA 4BURA 2C66A 2GQFA 2OLOA 1NDAA 2X3NA 1GERA 5EB5A 4YT0A 3NYCA 3UKHA 2YAUA 2VRLA 1JRZA 3GD3A 4FDCB 2QAEA 3AEBA 4U2LA 3DGHA 2JB2A 4U8MA 5IQ1A 4NTCA 3SFDA 1H7XA 2QCUA 4GUVA 1ZX9A 2J3NA 4GR1A 2BK4A 3DK8A 3OC4A 2B7RA 5DBJA 1BGNA 1NENA 2Z5YA 3I3LA 3NRNA 2F5ZA 2R46A 2C64A 1B37A 5FS9A 4A6NB 5KXJA 3NG7X 1M6IA 2GRTA 2VVLG 2XFNA 2FJEA 4AOSA 2BK5A 3PVCA 3F8PA 2FJBA 3B3RA 2GMJA 3D8XA 4OPIA 2V3AA 1RP0A 4YSZA 3S5WA 3AEEA 2C73A 3II4A 3AE7A 4B63A 1NHSA 5KMQA 1JU2A 4Z43A 1L9CA 1ONFA 1D7LA 3M12A 1H83A 4TM4A 1E1KA 4NTDA 3DK9A 1VRQB 3H4KA 2GQWA 2XCGA 3EPTA 3F8DA 1NHQA 1CJ3A 3DH9A 1GRHA 1N4WA 4MJWA 3AE5A 2WDVA 4GF7A 2YLSA 4JY2A 1IUTA 5J60A 4H4UA 3JSKA 5U1OA 3LZWA 3T31A 5C2TA 1RYIA 2BYBA 2CFYA 1GOSA 2X8CA 4CBQA 3CPIG 4A5LA 2EQ7A 2WEUA 1K4QA 2YM2A 5KMRA 2R4EA 4HA6A 2WU2A 3CNDA 3RHAA 2XFPA 1PS9A 2BK3A 2ZZ0A 5KVHA 2WQYA 1JRYA 1NAAA 2I0ZA 1NG3A 1ELIA 3K30A 3KLJA 1EL9A 4K8DA 2EQ6A 3RNMA 1CC2A 1PHHA 1BWCA 3E1TA 5FMHA 4J2WA 3UKQA 4DSGA 4JDRA 5JCKA 4J34A 1N4VA 4U8OA 4H4QA 2YLWA 3O0HA 4CRTA 1NPXA 4NEVA 4RG4A 3V3NA 1D7YA 3SZ0A 2C7GA 2XLUA 3NHOX 5KRQA 1JEHA 3AEGA 1ZKQA 3GRTA 1XPQA 2B76A 4H4ZA 1CC6A 1HYUA 2A8XA 5J7XA 2PYXA 3BI2A 2R0PA 4Y4LA 3BI5A 3SX6A 2VOUA 3CPHG 3DJGX 3UCLA 3FMWA 2V60A 4CY8A 4OPTA 2C75A 2C70A 5BVAA 5KOXA 3H8LA 4EMIA 2E1MA 1GXFA 1IUXA 3FPZA 1H86A 2GR0A 3AE2A 3AB1A 2AR8A 1XANA 4ICYA 3K7TA 3SQPA 1W4XA 3VQRA 4EM3A 4KPRA 2B9WA 1H2IA 3DGZA 1OJ9A 3GMCA 3QSEA 3URHA 1MOKA 1NEKA 2XFOA 2YR4A 1CC4A 2V3BA 5IQ4A 1ZY8A 4K7ZA 3K7MX 3GWDA 3T2YA 1GRBA 4JY3A 1IUUA 4GAVA 1KNPA 4ZN0A 3GDPA 3PO7A 3AWIA 1O5WA 4DSHA 3GMBA 1CHUA 3DJDA 2GB0A 1YY5A 3CPJG 4H4TA 1NHPA 4H4YA 1K0JA 4GCMA 4U8KA 2YLXA 2TMDA 1N4UA 1DJQA 2WP9A 3UTEA 3GYJA 3FBSA 2ARDA 4PABA 1PXBA 4TLXA 4OCGA 4HB9A 2YWLA 1ZMDA 1YQZA 1YQ4A 3G5RA 3IHMA 4Z2TA 3LXDA 1H81A 4OPUA 3AYLA 3BNUA 4IV9A 2Q7VA 3BHKA 2APGA 2V61A 3V76A 3HYXA 1NG4A 3C4AA 1FL2A 3CTYA 2WHDA 1BGJA 3UOVA 2GVCA 3AEDA 3SZFA 5FS8A 4A9WA 2NVKX 3LOVA 1OJCA 1YQ3A 3NT6A 3KPFA 2XFUA 2YVGA 2DKHA 3SFEA 2IVEA 5KVIA 1E6EA 5LV9A 3ABVA 1LQTA 1CJ4A 5U25A 1COYA 4K5RA 4AT0A 1CJCA 4JQ9A 2PHHA 2GH5A 5JCMA 1CL0A 2WOWA 1EL8A 3QVRA 4YWOA 1CF3A 1IUSA 4K2XA 1SEZA 4Z25A 4EIPA 1VDCA 2B9YA 2WBAA 3SXIA 3SGLA 4E0VA 5BULA 3ATQA 4ZCDA 3G5QA 3DA1A 2EQ9A 3LADA 3T14A 3D9XA 1LJ1A 1ZOVA 2BS2A 3IF9A 3UOYA 1TYTA 3IC9A 2C67A 2XLRA 2JAEA 3ADAB 4U2SA 3SZWA 1B5QA 3Q6JA 3GYXA 5IPYA 1MXTA 1TDOA 5BUKA 2C65A 1PN0A 5TR3A 3WE0A 1F8WA 1GPEA 3NLCA 1DNCA 5JRBA 4XWZA 1K0LA 3C4NA 1EL5A 3NTDA 2C4CA 3OZ2A 1Y56A 2Q0LA 2YLZA 2GR3A 4AP3A 4BK1A 3GDNA 4EQXA 1QLBA 1IUWA 2FJDA 2XLSA 1O95A 4YTMA 1PBEA 1PXAA 2IIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2N A;  3P1W A;  4U8L A;  4A79 A;  2V5Z A;  3EAN A;  3NK1 X;  3ZYX A;  4H2Q A;  4IA6 A;  1S2Y A;  4YSY A;  3QSM A;  3AYI A;  1O94 A;  1KNR A;  4JNA A;  1LQU A;  2WOV A;  3P4Q A;  3PS9 A;  4NZH A;  3AE1 A;  1L9E A;  4OPD A;  2BXR A;  4C3X A;  4Y4N A;  3DJJ A;  1D4C A;  3AD7 B;  4EM4 A;  1OJD A;  4A65 A;  1N1P A;  2CDU A;  3UP4 A;  4C74 A;  3FIM B;  3QJ4 A;  1FEC A;  4TLZ A;  1GRT A;  4LU6 A;  3V3O A;  4CNJ A;  5ER0 A;  1GES A;  1XHC A;  1GRA A;  4O5U A;  2GMH A;  4IVM B;  2YQU A;  5U63 A;  1DXL A;  4UDP A;  5FS7 A;  2XVH A;  1E7P A;  4PAA A;  4EQR A;  3UOZ A;  3LZX A;  2YG4 A;  1PJ5 A;  3IWA A;  1Z6L A;  1E1L A;  4H50 A;  4OPL A;  4B68 A;  1GV4 A;  2H89 A;  1L9D A;  1TDF A;  4ZCC A;  1EBD A;  4J36 A;  1PJ6 A;  4H4V A;  1JOA A;  3AE8 A;  3CNP A;  2V6O A;  3KKJ A;  4TM1 A;  3AD8 B;  1DOB A;  1AOG A;  1MO9 A;  2GR1 A;  2R45 A;  3BHF A;  1PJ7 A;  3T37 A;  4YKF A;  1GTH A;  4Z2U A;  2YLR A;  4U2T A;  4M52 A;  3VRA A;  4IVO B;  3UTH A;  1TDN A;  1OJA A;  5HY5 A;  1TDE A;  4DNA A;  4EQS A;  2X50 A;  4H4X A;  4J57 A;  1FCD A;  3GRS A;  1JRX A;  1X31 B;  1PXC A;  3AE3 A;  3UOX A;  3QFA A;  4CCR A;  2GV8 A;  4BJZ A;  5BRT A;  1PBB A;  2WP5 A;  3DK4 A;  1P2H A;  1K0I A;  4RSL A;  1VG9 A;  3S61 A;  4YTN A;  1FEB A;  4WX1 A;  4UDR A;  2VVM A;  3UTF A;  2YM1 A;  4RG3 A;  3NN0 X;  3GYI A;  2R4J A;  3L8K A;  3AEF A;  4REK A;  1Y56 B;  3UKK A;  4BK2 A;  2XVF A;  3QFB A;  5HHF A;  4H4R A;  1IJH A;  2OA1 A;  4K5S A;  2BS3 A;  1P2E A;  3EF6 A;  2XLP A;  2R0C A;  4LA1 A;  3B6D A;  2RGJ A;  4B66 A;  3DJE A;  3H8I A;  4B67 A;  4USQ A;  4YKG A;  2GR2 A;  1DOC A;  1KDG A;  1KSS A;  3COX A;  3RP8 A;  2YLT A;  2RGO A;  3DME A;  3ICT A;  1OJT A;  2XVE A;  2WDR A;  3ALJ A;  3AE4 A;  1E1N A;  2JBV A;  3R9U A;  4H7U A;  1GAL A;  2YR5 A;  1CBO A;  2FJA A;  2YG3 A;  4APN A;  1E39 A;  2WET A;  1ZDL A;  1GT8 A;  1TDK A;  1F8S A;  2WS3 A;  2BCG G;  3AEA A;  3NIX A;  2HQM A;  4CY6 A;  2WU5 A;  3NK0 X;  1VG0 A;  2YG6 A;  5CQF A;  5JCN A;  5HXI A;  5KWF A;  4B64 A;  3P4S A;  4K22 A;  1TRB A;  2B7S A;  4BV6 A;  4CNK A;  5M10 A;  5EBK A;  4C3Y A;  3BI4 A;  3P4P A;  4YSX A;  1PBD A;  3CN8 A;  3K7Q X;  3NTA A;  2X8G A;  2QA1 A;  4UP3 A;  5CKU A;  3NKS A;  1DOE A;  4GRT A;  3LJP A;  1TYP A;  3KU9 A;  1KFY A;  2GAG B;  4FK1 C;  1LPF A;  4U8N A;  4USR A;  1S3B A;  2R0G A;  3QVP A;  1Q9I A;  1F6M A;  1GRF A;  1B8S A;  3LB8 A;  3F8R A;  1BF3 A;  2E5V A;  2ZZC A;  1BKW A;  4YTP A;  2VQB A;  3SM8 A;  5GSN A;  1PBF A;  2XVI A;  4Y4M A;  3RP7 A;  2ACZ A;  3UKP A;  2JK6 A;  3HZL A;  3KD9 A;  1EL7 A;  1RSG A;  4FX9 A;  4NEW A;  1Q1R A;  2R9Z A;  1LV0 A;  1VQW A;  5EB4 A;  1PBC A;  1D4D A;  1S2Q A;  4I59 A;  2VVL A;  3NGC X;  4XXG A;  1PDH A;  3AE6 A;  2BA9 A;  1GSN A;  1V59 A;  2C72 A;  2GAH B;  2YR6 A;  4J56 A;  3VR9 A;  2BAB A;  2W0H A;  4H2R A;  5JCI A;  4X9N A;  5C3J A;  4FK1 A;  4GDP A;  4BK3 A;  1H7W A;  2CVJ A;  1M64 A;  3NNE A;  1CJ2 A;  4OPC A;  3M13 A;  1D5T A;  2H88 A;  4GDE A;  4AT2 A;  1E1M A;  4Z26 A;  2X99 A;  1H82 A;  2Y6R A;  3ITJ A;  2Y6Q A;  3P4R A;  2RGH A;  1H84 A;  3C96 A;  4JN9 A;  1REO A;  2YVF A;  1KF6 A;  2E4G A;  4D04 A;  2XYO A;  4JNQ A;  3ZDN A;  3CIR A;  3ATR A;  4J31 A;  4D03 A;  4ECH A;  1NHR A;  4Z2R A;  3AEC A;  3KVE A;  4C77 A;  1GEU A;  4YSH A;  4H4S A;  2QA2 A;  1LTX R;  1QO8 A;  3ALM A;  4OVI A;  1B4V A;  1DJN A;  4O5Q A;  4KX6 A;  3EAO A;  4X4J A;  5KOW A;  4ADW A;  2XDO A;  4U8P A;  4U8I A;  3GD4 A;  3VRB A;  4DGK A;  3M0O A;  2A87 A;  3CGB A;  2FBW A;  3VRD B;  4UDQ A;  2JKC A;  4BJY A;  1BZL A;  1UKV G;  2C76 A;  2ZZB A;  1FOH A;  3NYE A;  3GSI A;  2VZ2 A;  2BAC A;  3NN6 X;  4AP1 A;  2XVJ A;  3GWF A;  5M0Z A;  1GET A;  2IVD A;  4U8J A;  2GEW A;  1L0V A;  2A89 A;  1S3E A;  3Q9T A;  1GRE A;  4AOX A;  4TM0 A;  4J33 A;  3CNT A;  1JNR A;  4B1B A;  2UZZ A;  3KA7 A;  1F3P A;  2AQJ A;  3UTG A;  4YXD A;  2XLT A;  4IA5 A;  2WPE A;  3AD9 B;  4C5O A;  3CGD A;  3IHG A;  3CGC A;  1ZOY A;  2XFQ A;  4OPG A;  1YKJ A;  4Z44 A;  3UKF A;  5GRT A;  1LVL A;  2WPC A;  3FG2 P;  3NYF A;  4Z24 A;  4A6N A;  4EQW A;  5HYM A;  2WDQ A;  1QJD A;  2Q6U A;  3ICS A;  4P9S A;  2C3C A;  3AXB A;  3D1C A;  4XWR A;  3ALL A;  2BCP A;  4EIQ A;  2CUL A;  3I6D A;  3VR8 A;  2OLN A;  3QSS A;  2GF3 A;  3P9U A;  1GTE A;  2TPR A;  4EMW A;  2BC1 A;  1ZK7 A;  5L46 A;  4B65 A;  2BS4 A;  2OAM A;  1ZMC A;  3NH3 X;  3RED A;  1JNZ A;  2B9X A;  2YG5 A;  4I58 A;  3UP5 A;  1FEA A;  1Y0P A;  1XDI A;  2X8H A;  2YG7 A;  2WP6 A;  2WPF A;  2WOI A;  2NPX A;  2Q0K A;  1D4E A;  3NK2 X;  4H4W A;  2VRM A;  4N9X A;  2OAL A;  3CNS A;  3L1R A;  5JCL A;  3UKA A;  2Z5X A;  4NTE A;  4EMJ A;  2RAB A;  1GRG A;  3RP6 A;  3ICR A;  4WCT A;  1ZP0 A;  4LII A;  2ZBW A;  3UKL A;  1F8R A;  1GND A;  3BNM A;  3ISH A;  4A7A A;  4CCQ A;  3AYJ A;  2EQ8 A;  1Q1W A;  4A99 A;  2WES A;  5FS6 A;  1H6V A;  2AAQ A;  2C3D A;  4TM3 A;  2O9Z A;  5EOW A;  4H2P A;  1KSU A;  3AE9 A;  4H4P A;  3CNJ A;  2JB3 A;  2VQ7 A;  2BXS A;  2YVJ A;  1DOD A;  2JB1 A;  4B69 A;  2BC0 A;  3G5S A;  1IUV A;  3CGE A;  2DKI A;  4X9M A;  4BUR A;  2C66 A;  2GQF A;  2OLO A;  1NDA A;  2X3N A;  1GER A;  5EB5 A;  4YT0 A;  3NYC A;  3UKH A;  2YAU A;  2VRL A;  1JRZ A;  3GD3 A;  4FDC B;  2QAE A;  3AEB A;  4U2L A;  3DGH A;  2JB2 A;  4U8M A;  5IQ1 A;  4NTC A;  3SFD A;  1H7X A;  2QCU A;  4GUV A;  1ZX9 A;  2J3N A;  4GR1 A;  2BK4 A;  3DK8 A;  3OC4 A;  2B7R A;  5DBJ A;  1BGN A;  1NEN A;  2Z5Y A;  3I3L A;  3NRN A;  2F5Z A;  2R46 A;  2C64 A;  1B37 A;  5FS9 A;  4A6N B;  5KXJ A;  3NG7 X;  1M6I A;  2GRT A;  2VVL G;  2XFN A;  2FJE A;  4AOS A;  2BK5 A;  3PVC A;  3F8P A;  2FJB A;  3B3R A;  2GMJ A;  3D8X A;  4OPI A;  2V3A A;  1RP0 A;  4YSZ A;  3S5W A;  3AEE A;  2C73 A;  3II4 A;  3AE7 A;  4B63 A;  1NHS A;  1JU2 A;  4Z43 A;  1L9C A;  1ONF A;  1D7L A;  3M12 A;  1H83 A;  4TM4 A;  1E1K A;  4NTD A;  3DK9 A;  1VRQ B;  3H4K A;  2GQW A;  2XCG A;  3EPT A;  3F8D A;  1NHQ A;  1CJ3 A;  3DH9 A;  1GRH A;  1N4W A;  4MJW A;  3AE5 A;  2WDV A;  4GF7 A;  2YLS A;  4JY2 A;  1IUT A;  5J60 A;  4H4U A;  3JSK A;  5U1O A;  3LZW A;  5C2T A;  1RYI A;  2BYB A;  2CFY A;  1GOS A;  2X8C A;  4CBQ A;  3CPI G;  4A5L A;  2EQ7 A;  2WEU A;  1K4Q A;  2YM2 A;  2R4E A;  4HA6 A;  2WU2 A;  3CND A;  3RHA A;  2XFP A;  1PS9 A;  2BK3 A;  2ZZ0 A;  5KVH A;  2WQY A;  1JRY A;  1NAA A;  2I0Z A;  1NG3 A;  1ELI A;  3K30 A;  3KLJ A;  1EL9 A;  4K8D A;  2EQ6 A;  3RNM A;  1CC2 A;  1PHH A;  1BWC A;  3E1T A;  5FMH A;  4J2W A;  3UKQ A;  4DSG A;  4JDR A;  5JCK A;  4J34 A;  1N4V A;  4U8O A;  4H4Q A;  2YLW A;  3O0H A;  4CRT A;  1NPX A;  4NEV A;  4RG4 A;  3V3N A;  1D7Y A;  2C7G A;  2XLU A;  3NHO X;  5KRQ A;  1JEH A;  3AEG A;  1ZKQ A;  3GRT A;  1XPQ A;  2B76 A;  4H4Z A;  1CC6 A;  1HYU A;  2A8X A;  5J7X A;  2PYX A;  3BI2 A;  2R0P A;  4Y4L A;  3BI5 A;  2VOU A;  3CPH G;  3DJG X;  3UCL A;  3FMW A;  2V60 A;  4CY8 A;  4OPT A;  2C75 A;  2C70 A;  5BVA A;  5KOX A;  3H8L A;  4EMI A;  2E1M A;  1GXF A;  1IUX A;  3FPZ A;  1H86 A;  2GR0 A;  3AE2 A;  3AB1 A;  2AR8 A;  1XAN A;  4ICY A;  3K7T A;  3SQP A;  1W4X A;  3VQR A;  4EM3 A;  4KPR A;  2B9W A;  3GMC A;  3DGZ A;  1OJ9 A;  3QSE A;  3URH A;  1MOK A;  1NEK A;  2XFO A;  2YR4 A;  1CC4 A;  2V3B A;  5IQ4 A;  1ZY8 A;  4K7Z A;  3K7M X;  3GWD A;  4ZN0 A;  1GRB A;  4JY3 A;  1IUU A;  1KNP A;  3GDP A;  3PO7 A;  3AWI A;  1O5W A;  4DSH A;  3GMB A;  1CHU A;  3DJD A;  2GB0 A;  1YY5 A;  3CPJ G;  4H4T A;  1NHP A;  4H4Y A;  1K0J A;  4GCM A;  4U8K A;  2YLX A;  2TMD A;  1N4U A;  1DJQ A;  2WP9 A;  3UTE A;  3GYJ A;  3FBS A;  2ARD A;  4PAB A;  1PXB A;  4TLX A;  4OCG A;  4HB9 A;  2YWL A;  1ZMD A;  1YQZ A;  1YQ4 A;  3G5R A;  3IHM A;  4Z2T A;  3LXD A;  1H81 A;  4OPU A;  3AYL A;  3BNU A;  4IV9 A;  2Q7V A;  3BHK A;  2APG A;  2V61 A;  3V76 A;  1NG4 A;  3C4A A;  1FL2 A;  3CTY A;  2WHD A;  1BGJ A;  3UOV A;  2GVC A;  3AED A;  5FS8 A;  4A9W A;  2NVK X;  3LOV A;  1OJC A;  1YQ3 A;  3NT6 A;  3KPF A;  2XFU A;  2YVG A;  2DKH A;  3SFE A;  2IVE A;  5KVI A;  1E6E A;  5LV9 A;  3ABV A;  1LQT A;  1CJ4 A;  5U25 A;  1COY A;  4K5R A;  4AT0 A;  1CJC A;  4JQ9 A;  2PHH A;  2GH5 A;  5JCM A;  1CL0 A;  2WOW A;  1EL8 A;  3QVR A;  4YWO A;  1CF3 A;  1IUS A;  4K2X A;  1SEZ A;  4Z25 A;  4EIP A;  1VDC A;  2B9Y A;  2WBA A;  3SGL A;  4E0V A;  5BUL A;  3ATQ A;  4ZCD A;  3G5Q A;  3DA1 A;  2EQ9 A;  3LAD A;  1LJ1 A;  1ZOV A;  2BS2 A;  3IF9 A;  3UOY A;  1TYT A;  3IC9 A;  2C67 A;  2XLR A;  2JAE A;  3ADA B;  4U2S A;  1B5Q A;  3Q6J A;  5IPY A;  1MXT A;  1TDO A;  5BUK A;  2C65 A;  1PN0 A;  5TR3 A;  3WE0 A;  1F8W A;  1GPE A;  3NLC A;  1DNC A;  4XWZ A;  1K0L A;  3C4N A;  1EL5 A;  3NTD A;  3OZ2 A;  1Y56 A;  2Q0L A;  2YLZ A;  2GR3 A;  4AP3 A;  4BK1 A;  3GDN A;  4EQX A;  1QLB A;  1IUW A;  2FJD A;  2XLS A;  1O95 A;  4YTM A;  1PBE A;  1PXA A;  2IID A; 
#chains in the Genus database with same CATH topology
 3P1W A;  4A79 A;  2V5Z A;  3QSM A;  1N60 C;  4YWS A;  2WOV A;  4NZH A;  3DJJ A;  4A65 A;  2CDU A;  3UP4 A;  3FIM B;  4LU6 A;  1NEL A;  2OQY A;  3RGT A;  5ER0 A;  1GRA A;  4O5U A;  4IVM B;  4GIS A;  2YQU A;  4UDP A;  4PAA A;  3MUC A;  1KN0 A;  1E1L A;  1TDF A;  4J36 A;  4G9K A;  3AE8 A;  3KKJ A;  3CXB A;  2R45 A;  3T37 A;  3D46 A;  4Z2U A;  3KUM A;  4IVO B;  5HY5 A;  4DNA A;  3GRS A;  2WP5 A;  1P2H A;  2ZC8 A;  4WX1 A;  4UDR A;  2VVM A;  2YM1 A;  4RG3 A;  5KMS A;  3GYI A;  4E4U A;  3SY4 A;  3BOX A;  5HHF A;  1IJH A;  4F4R A;  3EF6 A;  2R0C A;  4KPL A;  4B66 A;  3DJE A;  4YKG A;  3L5O A;  1KDG A;  1KSS A;  3COX A;  3DME A;  3ALJ A;  3R9U A;  2YR5 A;  2YG3 A;  3R25 A;  2WET A;  1F8S A;  2WS3 A;  2YG6 A;  4CNK A;  3SBF A;  3T8Q A;  5EBK A;  3IJI A;  3BI4 A;  3K7Q X;  3NTA A;  3NKS A;  4GRT A;  3KU9 A;  1KFY A;  2GAG B;  1LPF A;  3SZC A;  4U8N A;  4USR A;  1S3B A;  1Q9I A;  2GSH A;  2E5V A;  2ZZC A;  4E8G A;  4Y4M A;  3TTE A;  3KD9 A;  2XH7 A;  5J04 A;  4DXK A;  2R9Z A;  1LV0 A;  1VQW A;  5EB4 A;  1D4D A;  4E6M A;  3RRA A;  3AE6 A;  1GSN A;  2YR6 A;  3P3B A;  4J56 A;  2W54 A;  1SJA A;  2POD A;  1M64 A;  3NNE A;  4GYP A;  4OPC A;  2H88 A;  4ZA0 A;  2E4G A;  4D04 A;  4GIR A;  2P0I A;  3KVE A;  1GEU A;  3ALM A;  1B4V A;  3MKC A;  3EAO A;  2XDO A;  4GAP A;  4NNJ A;  4H83 A;  4DGK A;  3VRD B;  2FBW A;  4IHC A;  2JKC A;  1BZL A;  1UKV G;  3DFH A;  2VZ2 A;  4A6G A;  2BAC A;  3NN6 X;  2GEW A;  5FJU A;  1T3Q C;  3QTP A;  1S3E A;  4AOX A;  1GRE A;  4J3Z A;  3CNT A;  4B1B A;  1WUE A;  1F3P A;  2FKP A;  2XLT A;  4C5O A;  4Z44 A;  3UKF A;  3NYF A;  3FG2 P;  3D1C A;  3ALL A;  4A35 A;  3VR8 A;  2OLN A;  3QSS A;  2GF3 A;  4EMW A;  2MUC A;  5L46 A;  4B65 A;  4GGB A;  2BS4 A;  4IL2 A;  3NH3 X;  2YG5 A;  1TZZ A;  4I58 A;  2X8H A;  2WP6 A;  2Q0K A;  1D4E A;  2VRM A;  4NTE A;  3ICR A;  5KNL A;  4WCT A;  3UKL A;  4A7A A;  4CCQ A;  1F8R A;  3CMM A;  3T0K A;  4A99 A;  4NWZ A;  5EOW A;  4H4P A;  1ZXI C;  2JB1 A;  4B69 A;  2BC0 A;  2XSX A;  3CGE A;  2DKI A;  4BUR A;  2C66 A;  4MMW A;  2OLO A;  4YT0 A;  2QAE A;  4M0X A;  4U2L A;  4U8M A;  1H7X A;  2QCU A;  2J3N A;  2B7R A;  5DBJ A;  3I3L A;  2R46 A;  1STZ A;  1B37 A;  2GRT A;  3ENL A;  2FJB A;  3II4 A;  4HCH A;  5KMQ A;  4Z43 A;  3CYJ A;  1ONF A;  1GRH A;  4MJW A;  3AE5 A;  2YLS A;  4K2S A;  5J60 A;  3NVV B;  3CPI G;  4A5L A;  2EQ7 A;  2GL5 A;  2WEU A;  1K4Q A;  1TKK A;  5G5H B;  1BKH A;  2ZZ0 A;  4HNC A;  4FI4 A;  4K8D A;  2EQ6 A;  3QLD A;  1N4V A;  1ELS A;  3O0H A;  4NEV A;  3A7R A;  3V3N A;  2C7G A;  4H4Z A;  1HYU A;  2A8X A;  2PYX A;  4Y4L A;  2RDX A;  4OPT A;  3H8L A;  1H86 A;  2GR0 A;  3FYY A;  3AE2 A;  3AB1 A;  3JZU A;  4ICY A;  3TWB A;  3K7T A;  4IP5 A;  4M6U A;  4EWJ A;  2PCE A;  1OJ9 A;  2XFO A;  5IQ4 A;  4HNL A;  3K7M X;  3T2Y A;  2PS2 A;  3PO7 A;  4DSH A;  2GB0 A;  3ZVH A;  1N4U A;  1DJQ A;  4OCG A;  1YQZ A;  3LXD A;  4OPU A;  2Q7V A;  3CTY A;  3AED A;  3SZF A;  1OJC A;  3ABV A;  3QVR A;  3UJR A;  1VDC A;  5BUL A;  4K1W A;  1ZOV A;  3ADA B;  2C67 A;  4U2S A;  3I4K A;  5IPY A;  1MXT A;  1TDO A;  1N63 C;  1DNC A;  2E3T A;  1L8P A;  1K0L A;  3C4N A;  3NTD A;  2NQL A;  2Q0L A;  3UJS A;  2PMQ A;  3NK1 X;  3EAN A;  3UXK A;  4YSY A;  1JRO A;  3AYI A;  4GFI A;  4ZOH B;  3P4Q A;  1L9E A;  2BXR A;  4EM4 A;  1OJD A;  1VDV A;  4TLZ A;  1GRT A;  1GES A;  1DXL A;  3QKE A;  5FS7 A;  1Z6L A;  1EBD A;  2V6O A;  3AD8 B;  4TVY A;  1DOB A;  1MO9 A;  4G6G A;  1PJ7 A;  1GTH A;  2YLR A;  4U2T A;  3DGB A;  4M52 A;  3I6E A;  1TDE A;  5FJP A;  1JRX A;  3AE3 A;  4ZCW A;  1PXC A;  4G74 A;  4CCR A;  2GV8 A;  3DK4 A;  4G8T A;  3T9P A;  1FEB A;  3UTF A;  3NN0 X;  3L8K A;  3AEF A;  1Y56 B;  4BK2 A;  3QFB A;  2BS3 A;  2XLP A;  3B6D A;  3H8I A;  4B67 A;  5ENL A;  2OG9 A;  2YLT A;  2RGO A;  3ICT A;  1OJT A;  2XVE A;  3TJ4 A;  3AE4 A;  4H7U A;  3GO2 A;  3R0U A;  1CBO A;  2FJA A;  3SYI A;  1ZDL A;  1GT8 A;  1TDK A;  4E5T A;  2PTY A;  3ES7 A;  3CT2 A;  3THU A;  5KWF A;  5M10 A;  4BV6 A;  4YSX A;  3P4P A;  1PBD A;  4UP3 A;  5CKU A;  1TYP A;  3HPF A;  2DW6 A;  3CK5 A;  1WYG A;  2XVI A;  2JK6 A;  5G5G B;  2AKZ A;  1Q1R A;  1S2Q A;  2QDD A;  3TJI A;  4XXG A;  3UGV A;  2BA9 A;  1V59 A;  3SJN A;  2W0H A;  5JCI A;  3SSZ A;  4FK1 A;  4GDP A;  3PK7 A;  4H1Z A;  1CJ2 A;  3HYW A;  4G6H A;  4GDE A;  2X99 A;  1H82 A;  3GD6 A;  3ITJ A;  2GGI A;  3RO6 A;  3H12 A;  4JNQ A;  2I5Q A;  3CIR A;  1NHR A;  3OW1 A;  4Z2R A;  1DJN A;  4KX6 A;  2W55 A;  4U8P A;  4JHM A;  1XS2 A;  3VRB A;  2OLA A;  3M0O A;  2A87 A;  3CGB A;  4UDQ A;  4HYR A;  4BJY A;  3NYE A;  1GET A;  2IVD A;  4U8J A;  1L0V A;  3Q9T A;  2POZ A;  3KA7 A;  2AQJ A;  4IA5 A;  4Z1Y A;  3IHG A;  1ZOY A;  2XFQ A;  1YKJ A;  1FFV C;  5GRT A;  5HYM A;  4A6N A;  1QJD A;  4P9S A;  3AXB A;  2BRY A;  2O56 A;  3B97 A;  3I6D A;  1GTE A;  1ZK7 A;  2OAM A;  3UP5 A;  2YG7 A;  3UKA A;  5JCL A;  1GRG A;  2ZBW A;  4LII A;  2E5A A;  1Q1W A;  3B9J B;  3R1Z A;  3HYV A;  5FS6 A;  2OKT A;  1H6V A;  2O9Z A;  3A7U A;  3QN3 A;  2ONE A;  3G5S A;  1IUV A;  3DG6 A;  4MGG A;  2GQF A;  1NDA A;  3NYC A;  3H8A A;  3AEB A;  2JB2 A;  2HXT A;  5IQ1 A;  4NTC A;  1SJD A;  2OQH A;  4GUV A;  1ZX9 A;  3NXL A;  3NVY B;  2BK4 A;  3OC4 A;  1BQG A;  2OZ3 A;  2QGY A;  1BGN A;  3P93 A;  3NRN A;  2F5Z A;  5FS9 A;  5KXJ A;  3NG7 X;  2BK5 A;  3PVC A;  3AM9 A;  2GMJ A;  3D8X A;  2V3A A;  3DDM A;  2C73 A;  1NHS A;  3M12 A;  1H83 A;  2DW7 A;  3DK9 A;  1VRQ B;  3EPT A;  1NHQ A;  1CJ3 A;  4IZG A;  3TW9 A;  3DH9 A;  1N4W A;  2WDV A;  4GF7 A;  4DWD A;  3JSK A;  5U1O A;  3LZW A;  4ROP A;  3T31 A;  3NFU A;  3T4W A;  1KCZ A;  4HA6 A;  2WU2 A;  3CND A;  5KVH A;  2WQY A;  1NAA A;  2I0Z A;  3STP A;  3RNM A;  1CC2 A;  4J2W A;  3UKQ A;  3OZM A;  4JDR A;  4U8O A;  2OZT A;  1EC7 A;  4CRT A;  1NPX A;  3T6C A;  4RG4 A;  3SZ0 A;  4IT1 A;  3NHO X;  3UCD A;  2HXU A;  2B76 A;  1RVK A;  1CC6 A;  3BI2 A;  2R0P A;  3SX6 A;  3CPH G;  3TCS A;  3DJG X;  4CY8 A;  1IUX A;  3ES8 A;  3S5S A;  1W4X A;  4EM3 A;  2P8B A;  1NEK A;  2YR4 A;  3JVA A;  3FV9 A;  1ZY8 A;  4ZN0 A;  3GDP A;  1O5W A;  1CHU A;  3DJD A;  1MNS A;  2AL2 B;  3CPJ G;  4GCM A;  1DTN A;  4U8K A;  2GGJ A;  1VQZ A;  2YLX A;  2TMD A;  2WP9 A;  2PGW A;  4HB9 A;  2YWL A;  1ZMD A;  3NZG A;  1YQ4 A;  1EBG A;  3G5R A;  3IHM A;  4Z2T A;  1H81 A;  1JDF A;  3AYL A;  3BHK A;  3HYX A;  3SN1 A;  3CXO A;  1EBH A;  3UOV A;  1BGJ A;  2XH0 A;  4FP1 A;  1YQ3 A;  2XFU A;  2YVG A;  1LQT A;  4K5R A;  4JQ9 A;  2PHH A;  1CL0 A;  2WOW A;  2PGE A;  3V5C A;  4YWO A;  1IUS A;  4Z25 A;  4E0V A;  4DN1 A;  3N4F A;  3DA1 A;  2EQ9 A;  3LAD A;  3SN0 A;  3IF9 A;  3UOY A;  1X2G A;  1OEP A;  4GME A;  1B5Q A;  2C65 A;  5TR3 A;  3ZLG A;  3MSY A;  1EL5 A;  4AP3 A;  3GDN A;  2PU0 A;  2QQ6 A;  2XLS A;  1IUW A;  1O95 A;  2PTW A;  1PBE A;  5IDZ A;  2FYM A;  1PXA A;  1E9I A;  4JNA A;  3PS9 A;  4C3X A;  3AE1 A;  3JW7 A;  4Y4N A;  3AD7 B;  3DG3 A;  4CNJ A;  4DHG A;  1XHC A;  2XVH A;  3LZX A;  3IJQ A;  2YG4 A;  4OPL A;  2H89 A;  4IP4 A;  1L9D A;  1PJ6 A;  1JOA A;  3CNP A;  2GR1 A;  3BHF A;  1MDR A;  4YKF A;  3ZVI A;  2BRA A;  3UTH A;  1TDN A;  2QVH A;  4EQS A;  3HRD C;  4J57 A;  1X31 B;  3UOX A;  3QFA A;  5BRT A;  1K0I A;  1VG9 A;  3S61 A;  4YTN A;  3FCP A;  4REK A;  4DYE A;  4K5S A;  3SN4 A;  4K8G A;  4USQ A;  1DOC A;  1V97 A;  3NS1 B;  4KWS A;  2JBV A;  3MZN A;  7ENL A;  2GGH A;  1X2H A;  4APN A;  4HCD A;  1E39 A;  2BCG G;  3AEA A;  3NIX A;  4CY6 A;  3SR6 B;  1VG0 A;  5CQF A;  3FJ4 A;  5HXI A;  4K22 A;  1TRB A;  2B7S A;  3P0W A;  2X8G A;  2QA1 A;  2GGG A;  3PG6 A;  3QVP A;  4GYP C;  1MDL A;  1GRF A;  1B8S A;  4H2H A;  1BKW A;  4YTP A;  2VQB A;  5GSN A;  1TE6 A;  3RP7 A;  1F9C A;  5KMP A;  2QJJ A;  1RSG A;  4NEW A;  3AMZ A;  1PBC A;  2VVL A;  1PDH A;  2C72 A;  2GAH B;  4A3R A;  3VR9 A;  5C3J A;  3NO1 A;  1H7W A;  2CVJ A;  3RCY A;  4AT2 A;  4Z26 A;  2Y6Q A;  3P4R A;  1H84 A;  3C96 A;  1YEY A;  1REO A;  4D03 A;  1WUF A;  3IJL A;  1ECQ A;  4C77 A;  4YSH A;  4H4S A;  2QA2 A;  4OVI A;  1QO8 A;  4X4J A;  1N62 C;  4ADW A;  5KOW A;  4U8I A;  3K1G A;  2QDE A;  3GD4 A;  2C76 A;  3GSI A;  1S7M A;  1ONE A;  4AP1 A;  2XVJ A;  3GWF A;  5M0Z A;  4HPN A;  3EEZ A;  4J33 A;  1JNR A;  3UTG A;  4YXD A;  2WPE A;  3AD9 B;  4OPG A;  2XH2 A;  4Z24 A;  2WPC A;  3ICS A;  4XWR A;  4MKS A;  3P9U A;  2TPR A;  2BC1 A;  3I6T A;  1ZMC A;  3RED A;  3Q4D A;  2B9X A;  1XDI A;  2NPX A;  3NK2 X;  4N9X A;  4H4W A;  3RP6 A;  1GND A;  3NRZ B;  4X2P A;  2AAQ A;  4TM3 A;  2JB3 A;  2VQ7 A;  1SJC A;  3MWC A;  4X9M A;  3N6H A;  1GER A;  5EB5 A;  3HW2 A;  2YAU A;  1JRZ A;  3GD3 A;  3MQT A;  4ENL A;  1RM6 B;  3ZLF A;  3DGH A;  3AN1 A;  3SFD A;  6ENL A;  4GR1 A;  3DK8 A;  1NEN A;  2Z5Y A;  4G7F A;  5BOF A;  4DX3 A;  4HN8 A;  3B3R A;  2ZAD A;  1RP0 A;  4YSZ A;  4B63 A;  1JU2 A;  4KT2 A;  2GQW A;  3V5F A;  3VFC A;  4JY2 A;  1PDY A;  4H4U A;  5C2T A;  3VC6 A;  3VC5 A;  5KMR A;  2R4E A;  3DER A;  2XFP A;  1R6W A;  3RR1 A;  1PS9 A;  2BK3 A;  1JRY A;  3N6J A;  3TOY A;  3KLJ A;  1EC9 A;  3E1T A;  5FMH A;  3VCN A;  4J34 A;  4IL0 A;  3RIT A;  1JPM A;  2XLU A;  5KRQ A;  1JEH A;  1ZKQ A;  2PU1 A;  1N5X A;  3UCL A;  3NVW B;  2C75 A;  2C70 A;  5KOX A;  4EMI A;  2E1M A;  3EKG A;  3OP2 A;  2OO6 A;  2AR8 A;  1R0M A;  3SQP A;  1FHV A;  3NVZ B;  3VQR A;  2AKM A;  3QSE A;  1H2I A;  3DGZ A;  1XPY A;  3PWI A;  3GWD A;  2OPJ A;  3GMB A;  3UJE A;  1NHP A;  4H4Y A;  3FBS A;  3DIP A;  1PXB A;  2P3Z A;  3BNU A;  2QJM A;  2APG A;  2V61 A;  4KEM A;  1N5W C;  4A9W A;  3NT6 A;  2IVE A;  5KVI A;  1E6E A;  5LV9 A;  5U25 A;  4AT0 A;  1CJC A;  5JCM A;  1FHU A;  4J1O A;  1W6T A;  1EL8 A;  1SEZ A;  2HNE A;  3R07 C;  2WBA A;  3SGL A;  3ATQ A;  4ZCD A;  3G5Q A;  2PP3 A;  1TYT A;  2XLR A;  2JAE A;  3Q6J A;  5BUK A;  1PN0 A;  3U9I A;  1GPE A;  5JRB A;  4XWZ A;  3DEQ A;  1EC8 A;  3ZVH B;  5BOE A;  1Y56 A;  2YLZ A;  4BK1 A;  4EQX A;  1QLB A;  2IID A;  4H2N A;  4U8L A;  3TQP A;  3ZYX A;  4H2Q A;  4IA6 A;  1S2Y A;  1O94 A;  1KNR A;  1LQU A;  4OPD A;  3PFR A;  1D4C A;  1N1P A;  4C74 A;  3QJ4 A;  1FEC A;  3V3O A;  2PA6 A;  1SB3 B;  2GMH A;  5U63 A;  2GGE A;  3U4F A;  1E7P A;  3R0K A;  4EQR A;  3UOZ A;  1PJ5 A;  3IWA A;  4B68 A;  4H50 A;  1GV4 A;  4ZCC A;  2W3S A;  4H4V A;  4TM1 A;  4JN7 A;  1AOG A;  3DG7 A;  3R10 A;  4HCL A;  3VRA A;  4JN8 A;  1OJA A;  2X50 A;  4H4X A;  1FCD A;  1PDZ A;  4II2 A;  4BJZ A;  3MY9 A;  1PBB A;  4RSL A;  2XH4 A;  2R4J A;  3DES A;  3UKK A;  2XVF A;  1SJB A;  4H4R A;  2OA1 A;  1P2E A;  2P8C A;  4LA1 A;  2RGJ A;  4TVW A;  2GR2 A;  3RP8 A;  5FJT A;  2WDR A;  3T2K A;  1E1N A;  1GAL A;  4G73 A;  2HQM A;  4GGH A;  2WU5 A;  3NK0 X;  4H19 A;  4E4F A;  5JCN A;  3UCC A;  3P4S A;  4B64 A;  3KPK A;  4C3Y A;  3CN8 A;  1DOE A;  3LJP A;  4FK1 C;  3GC2 A;  2R0G A;  3BJS A;  1F6M A;  3LB8 A;  3F8R A;  1BF3 A;  3UXL A;  3SM8 A;  1PBF A;  3IK4 A;  3OPS A;  2ACZ A;  3UKP A;  3HZL A;  1EL7 A;  4FX9 A;  4I59 A;  3NGC X;  2PTZ A;  2BAB A;  4H2R A;  4X9N A;  4BK3 A;  1MRA A;  3M13 A;  1D5T A;  1E1M A;  2Y6R A;  2RGH A;  4JN9 A;  2YVF A;  1KF6 A;  2XYO A;  3ZDN A;  1JRP A;  3ATR A;  4J31 A;  4ECH A;  3AEC A;  3T2Z A;  1LTX R;  4O5Q A;  1NU5 A;  3H70 A;  4II3 A;  2ZZB A;  1FOH A;  1FFU C;  3V4B A;  2A89 A;  4TM0 A;  2UZZ A;  3CGD A;  3CGC A;  2AL1 A;  1LVL A;  4EQW A;  1JPD X;  2Q6U A;  2WDQ A;  3UJF A;  2C3C A;  5FJO A;  2BCP A;  4EIQ A;  1JCT A;  2CUL A;  2OFJ A;  1MUC A;  1JNZ A;  2PSN A;  1FEA A;  1Y0P A;  2WPF A;  2WOI A;  2OAL A;  3CNS A;  3L1R A;  2Z5X A;  4EMJ A;  2RAB A;  1ZP0 A;  3BNM A;  3ISH A;  3AYJ A;  2EQ8 A;  2GDQ A;  2PP1 A;  2WES A;  2OX4 A;  2C3D A;  4H2P A;  1KSU A;  3AE9 A;  3CNJ A;  2BXS A;  2YVJ A;  1DOD A;  1KKO A;  3VCC A;  2X3N A;  1KD0 A;  3UKH A;  2VRL A;  4FDC B;  2C64 A;  2QJN A;  4A6N B;  2XGZ A;  1M6I A;  2PPG A;  2VVL G;  1IYX A;  2XFN A;  2FJE A;  4AOS A;  3OZY A;  3F8P A;  4OPI A;  3PWG A;  3S5W A;  3AEE A;  3FVD A;  3AE7 A;  4Z17 A;  3VA8 A;  1L9C A;  1D7L A;  4TM4 A;  1E1K A;  4NTD A;  3H4K A;  2XCG A;  3F8D A;  2P88 A;  3FXG A;  1P43 A;  3Q45 A;  3A7A A;  1IUT A;  3S47 A;  1KKR A;  2AL2 A;  3QPE A;  3CAW A;  1RYI A;  2BYB A;  2CFY A;  1GOS A;  2X8C A;  4CBQ A;  2OZ8 A;  2YM2 A;  5FJR A;  3RHA A;  1NG3 A;  1ELI A;  3K30 A;  1EL9 A;  3EUB 3;  1PHH A;  1BWC A;  4DSG A;  5JCK A;  3D47 A;  4H4Q A;  2YLW A;  1D7Y A;  3AEG A;  2W3R A;  3GRT A;  1FO4 A;  1XPQ A;  5J7X A;  3BI5 A;  2VOU A;  2CHR A;  3FMW A;  2V60 A;  5BVA A;  1GXF A;  3FPZ A;  1XAN A;  3GMC A;  4KPR A;  2B9W A;  3URH A;  1MOK A;  3GY1 A;  1CC4 A;  2V3B A;  4K7Z A;  1GRB A;  4JY3 A;  1IUU A;  4GAV A;  1KNP A;  3AWI A;  1YY5 A;  4H4T A;  1K0J A;  2MNR A;  3VDG A;  3UTE A;  3GYJ A;  3UJ2 A;  2ARD A;  4PAB A;  4TLX A;  3R11 A;  4IV9 A;  3V76 A;  1NG4 A;  3C4A A;  1FL2 A;  2PP0 A;  2WHD A;  3SQS A;  2GVC A;  5FS8 A;  2NVK X;  3LOV A;  3V3W A;  3H7V A;  3KPF A;  2DKH A;  3SFE A;  1CJ4 A;  1COY A;  3OTR A;  3N4E A;  2GH5 A;  1FIQ B;  3TWA A;  1CF3 A;  4K2X A;  3BSM A;  2PTX A;  4EIP A;  3SXI A;  2B9Y A;  3DFY A;  3T14 A;  3D9X A;  1LJ1 A;  2BS2 A;  3IC9 A;  3SZW A;  3GYX A;  5EU9 A;  1P48 A;  3WE0 A;  1F8W A;  3NLC A;  1N61 C;  3ETR B;  2OVL A;  2C4C A;  3OZ2 A;  2GR3 A;  2HZG A;  2FJD A;  3CB3 A;  4YTM A;  3ZLH A; 
#chains in the Genus database with same CATH homology
 4H2N A;  3P1W A;  4U8L A;  4A79 A;  2V5Z A;  3EAN A;  3NK1 X;  3ZYX A;  4H2Q A;  4IA6 A;  1S2Y A;  4YSY A;  3QSM A;  3AYI A;  1O94 A;  1KNR A;  4JNA A;  1LQU A;  2WOV A;  3P4Q A;  3PS9 A;  4NZH A;  3AE1 A;  1L9E A;  4OPD A;  2BXR A;  4C3X A;  4Y4N A;  3DJJ A;  1D4C A;  3AD7 B;  4EM4 A;  1OJD A;  4A65 A;  1N1P A;  2CDU A;  3UP4 A;  4C74 A;  3FIM B;  3QJ4 A;  1FEC A;  4TLZ A;  1GRT A;  4LU6 A;  3V3O A;  4CNJ A;  5ER0 A;  1GES A;  1XHC A;  1GRA A;  4O5U A;  2GMH A;  4IVM B;  2YQU A;  5U63 A;  1DXL A;  4UDP A;  5FS7 A;  2XVH A;  1E7P A;  4PAA A;  4EQR A;  3UOZ A;  1KN0 A;  2YG4 A;  3LZX A;  1PJ5 A;  3IWA A;  1Z6L A;  1E1L A;  4H50 A;  4OPL A;  4B68 A;  1GV4 A;  2H89 A;  1L9D A;  1TDF A;  4ZCC A;  1EBD A;  4J36 A;  1PJ6 A;  4G9K A;  4H4V A;  1JOA A;  3AE8 A;  3CNP A;  2V6O A;  3KKJ A;  4TM1 A;  3AD8 B;  1DOB A;  1AOG A;  1MO9 A;  2GR1 A;  2R45 A;  3BHF A;  1PJ7 A;  4G6G A;  3T37 A;  4YKF A;  1GTH A;  4Z2U A;  2YLR A;  4U2T A;  4M52 A;  3VRA A;  4IVO B;  2BRA A;  3UTH A;  1TDN A;  1OJA A;  5HY5 A;  1TDE A;  4DNA A;  4EQS A;  2X50 A;  4H4X A;  4J57 A;  1FCD A;  3GRS A;  1JRX A;  1X31 B;  1PXC A;  3AE3 A;  4G74 A;  3UOX A;  3QFA A;  4CCR A;  2GV8 A;  4II2 A;  4BJZ A;  5BRT A;  1PBB A;  2WP5 A;  3DK4 A;  1P2H A;  1K0I A;  4RSL A;  1VG9 A;  3S61 A;  4YTN A;  1FEB A;  4WX1 A;  4UDR A;  2VVM A;  3UTF A;  2YM1 A;  4RG3 A;  3NN0 X;  5KMS A;  3GYI A;  2R4J A;  3L8K A;  3AEF A;  4REK A;  3SY4 A;  1Y56 B;  3UKK A;  4BK2 A;  2XVF A;  3QFB A;  5HHF A;  4H4R A;  1IJH A;  2OA1 A;  4K5S A;  2BS3 A;  1P2E A;  3EF6 A;  2XLP A;  2R0C A;  4LA1 A;  3B6D A;  2RGJ A;  4B66 A;  3DJE A;  3H8I A;  4B67 A;  4USQ A;  4YKG A;  2GR2 A;  1DOC A;  3L5O A;  1KDG A;  1KSS A;  3COX A;  3RP8 A;  2YLT A;  2RGO A;  3DME A;  3ICT A;  1OJT A;  2XVE A;  2WDR A;  3ALJ A;  3AE4 A;  3T2K A;  1E1N A;  2JBV A;  3R9U A;  4H7U A;  1GAL A;  2YR5 A;  1CBO A;  2FJA A;  2YG3 A;  4APN A;  4G73 A;  3SYI A;  1E39 A;  2WET A;  1ZDL A;  1GT8 A;  1TDK A;  1F8S A;  2WS3 A;  2BCG G;  3AEA A;  3NIX A;  2HQM A;  4CY6 A;  2WU5 A;  3NK0 X;  1VG0 A;  2YG6 A;  5CQF A;  5JCN A;  5HXI A;  5KWF A;  4B64 A;  3P4S A;  3KPK A;  1TRB A;  2B7S A;  4BV6 A;  4K22 A;  4CNK A;  5M10 A;  5EBK A;  4C3Y A;  3BI4 A;  3P4P A;  4YSX A;  1PBD A;  3CN8 A;  3K7Q X;  3NTA A;  2X8G A;  2QA1 A;  4UP3 A;  5CKU A;  3NKS A;  1DOE A;  4GRT A;  3LJP A;  1TYP A;  3KU9 A;  1KFY A;  2GAG B;  4FK1 C;  1LPF A;  3SZC A;  4U8N A;  4USR A;  1S3B A;  3PG6 A;  2R0G A;  3QVP A;  1Q9I A;  1F6M A;  1GRF A;  1B8S A;  3LB8 A;  3F8R A;  1BF3 A;  2E5V A;  2ZZC A;  1BKW A;  4YTP A;  2VQB A;  3SM8 A;  5GSN A;  1PBF A;  2XVI A;  4Y4M A;  3RP7 A;  2ACZ A;  3UKP A;  2JK6 A;  3HZL A;  5KMP A;  3KD9 A;  1EL7 A;  1RSG A;  4FX9 A;  4NEW A;  1Q1R A;  2R9Z A;  1LV0 A;  1VQW A;  5EB4 A;  1PBC A;  1D4D A;  1S2Q A;  4I59 A;  2VVL A;  3NGC X;  4XXG A;  1PDH A;  3AE6 A;  2BA9 A;  1GSN A;  1V59 A;  2C72 A;  2GAH B;  2YR6 A;  4J56 A;  3VR9 A;  2BAB A;  2W0H A;  4H2R A;  5JCI A;  4X9N A;  5C3J A;  4FK1 A;  4GDP A;  4BK3 A;  1H7W A;  2CVJ A;  1M64 A;  3NNE A;  1CJ2 A;  4OPC A;  3M13 A;  1D5T A;  2H88 A;  3HYW A;  4G6H A;  4GDE A;  4AT2 A;  1E1M A;  4Z26 A;  2X99 A;  1H82 A;  2Y6R A;  3ITJ A;  2Y6Q A;  3P4R A;  2RGH A;  1H84 A;  3C96 A;  4JN9 A;  1REO A;  2YVF A;  1KF6 A;  2E4G A;  4D04 A;  2XYO A;  4JNQ A;  3ZDN A;  3CIR A;  3ATR A;  4J31 A;  4D03 A;  4ECH A;  1NHR A;  4Z2R A;  3AEC A;  3KVE A;  3T2Z A;  4C77 A;  1GEU A;  4YSH A;  4H4S A;  2QA2 A;  1LTX R;  1QO8 A;  3ALM A;  4OVI A;  1B4V A;  1DJN A;  4O5Q A;  4KX6 A;  3EAO A;  4X4J A;  5KOW A;  4ADW A;  2XDO A;  4GAP A;  4U8P A;  4NNJ A;  4U8I A;  3GD4 A;  3VRB A;  4II3 A;  4DGK A;  3M0O A;  2A87 A;  3CGB A;  2FBW A;  3VRD B;  4UDQ A;  2JKC A;  4BJY A;  1BZL A;  1UKV G;  2C76 A;  2ZZB A;  1FOH A;  3NYE A;  3GSI A;  1S7M A;  2VZ2 A;  2BAC A;  3NN6 X;  4AP1 A;  2XVJ A;  3GWF A;  5M0Z A;  1GET A;  2IVD A;  4U8J A;  2GEW A;  1L0V A;  2A89 A;  1S3E A;  3Q9T A;  1GRE A;  4AOX A;  4TM0 A;  4J33 A;  3CNT A;  1JNR A;  4B1B A;  2UZZ A;  3KA7 A;  1F3P A;  2AQJ A;  3UTG A;  4YXD A;  2XLT A;  4IA5 A;  2WPE A;  3AD9 B;  4C5O A;  3CGD A;  3IHG A;  3CGC A;  1ZOY A;  2XFQ A;  4OPG A;  1YKJ A;  4Z44 A;  3UKF A;  5GRT A;  1LVL A;  2WPC A;  3FG2 P;  3NYF A;  4Z24 A;  4A6N A;  4EQW A;  5HYM A;  2WDQ A;  1QJD A;  2Q6U A;  3ICS A;  4P9S A;  2C3C A;  3AXB A;  3D1C A;  4XWR A;  3ALL A;  2BCP A;  2BRY A;  4EIQ A;  2CUL A;  3I6D A;  3VR8 A;  2OLN A;  3QSS A;  2GF3 A;  3P9U A;  1GTE A;  2TPR A;  4EMW A;  2BC1 A;  1ZK7 A;  5L46 A;  4B65 A;  2BS4 A;  2OAM A;  1ZMC A;  3NH3 X;  3RED A;  1JNZ A;  2B9X A;  2YG5 A;  4I58 A;  3UP5 A;  1FEA A;  1Y0P A;  1XDI A;  2X8H A;  2YG7 A;  2WP6 A;  2WPF A;  2WOI A;  2NPX A;  2Q0K A;  1D4E A;  3NK2 X;  4H4W A;  2VRM A;  4N9X A;  2OAL A;  3CNS A;  3L1R A;  5JCL A;  3UKA A;  2Z5X A;  4NTE A;  4EMJ A;  2RAB A;  1GRG A;  3RP6 A;  3ICR A;  5KNL A;  4WCT A;  1ZP0 A;  4LII A;  2ZBW A;  3UKL A;  1F8R A;  1GND A;  3BNM A;  3ISH A;  4A7A A;  4CCQ A;  3AYJ A;  2EQ8 A;  3CMM A;  1Q1W A;  3T0K A;  4A99 A;  3HYV A;  2WES A;  5FS6 A;  1H6V A;  4NWZ A;  2AAQ A;  2C3D A;  4TM3 A;  2O9Z A;  5EOW A;  4H2P A;  1KSU A;  3AE9 A;  4H4P A;  3CNJ A;  2JB3 A;  2VQ7 A;  2BXS A;  2YVJ A;  1DOD A;  2JB1 A;  4B69 A;  2BC0 A;  3G5S A;  1IUV A;  3CGE A;  2DKI A;  4X9M A;  4BUR A;  2C66 A;  2GQF A;  2OLO A;  1NDA A;  2X3N A;  1GER A;  5EB5 A;  4YT0 A;  3NYC A;  3UKH A;  2YAU A;  2VRL A;  1JRZ A;  3GD3 A;  4FDC B;  2QAE A;  3AEB A;  4U2L A;  3DGH A;  2JB2 A;  4U8M A;  5IQ1 A;  4NTC A;  3SFD A;  1H7X A;  2QCU A;  4GUV A;  1ZX9 A;  2J3N A;  4GR1 A;  2BK4 A;  3DK8 A;  3OC4 A;  2B7R A;  5DBJ A;  1BGN A;  1NEN A;  2Z5Y A;  3I3L A;  3NRN A;  2F5Z A;  2R46 A;  2C64 A;  1B37 A;  5FS9 A;  4A6N B;  5KXJ A;  3NG7 X;  1M6I A;  2GRT A;  2VVL G;  2XFN A;  2FJE A;  4AOS A;  2BK5 A;  3PVC A;  3F8P A;  2FJB A;  3B3R A;  2GMJ A;  3D8X A;  4OPI A;  2V3A A;  1RP0 A;  4YSZ A;  3S5W A;  3AEE A;  2C73 A;  3II4 A;  3AE7 A;  4B63 A;  1NHS A;  5KMQ A;  1JU2 A;  4Z43 A;  1L9C A;  1ONF A;  1D7L A;  3M12 A;  1H83 A;  4TM4 A;  1E1K A;  4NTD A;  3DK9 A;  1VRQ B;  3H4K A;  2GQW A;  2XCG A;  3EPT A;  3F8D A;  1NHQ A;  1CJ3 A;  3DH9 A;  1GRH A;  1N4W A;  4MJW A;  3AE5 A;  2WDV A;  4GF7 A;  2YLS A;  4JY2 A;  1IUT A;  5J60 A;  4H4U A;  3JSK A;  5U1O A;  3LZW A;  3T31 A;  5C2T A;  1RYI A;  2BYB A;  2CFY A;  1GOS A;  2X8C A;  4CBQ A;  3CPI G;  4A5L A;  2EQ7 A;  2WEU A;  1K4Q A;  2YM2 A;  5KMR A;  2R4E A;  4HA6 A;  2WU2 A;  3CND A;  3RHA A;  2XFP A;  1PS9 A;  2BK3 A;  2ZZ0 A;  5KVH A;  2WQY A;  1JRY A;  1NAA A;  2I0Z A;  1NG3 A;  1ELI A;  3K30 A;  3KLJ A;  1EL9 A;  4K8D A;  2EQ6 A;  3RNM A;  1CC2 A;  1PHH A;  1BWC A;  3E1T A;  5FMH A;  4J2W A;  3UKQ A;  4DSG A;  4JDR A;  5JCK A;  4J34 A;  1N4V A;  4U8O A;  4H4Q A;  2YLW A;  3O0H A;  4CRT A;  1NPX A;  4NEV A;  4RG4 A;  3V3N A;  1D7Y A;  3SZ0 A;  2C7G A;  2XLU A;  3NHO X;  5KRQ A;  1JEH A;  3AEG A;  1ZKQ A;  3GRT A;  1XPQ A;  2B76 A;  4H4Z A;  1CC6 A;  1HYU A;  2A8X A;  5J7X A;  2PYX A;  3BI2 A;  2R0P A;  4Y4L A;  3BI5 A;  3SX6 A;  2VOU A;  3CPH G;  3DJG X;  3UCL A;  3FMW A;  2V60 A;  4CY8 A;  4OPT A;  2C75 A;  2C70 A;  5BVA A;  5KOX A;  3H8L A;  4EMI A;  2E1M A;  1GXF A;  1IUX A;  3FPZ A;  1H86 A;  2GR0 A;  3AE2 A;  3AB1 A;  2AR8 A;  1XAN A;  4ICY A;  3K7T A;  3SQP A;  1W4X A;  3VQR A;  4EM3 A;  4KPR A;  2B9W A;  1H2I A;  3DGZ A;  1OJ9 A;  3GMC A;  3QSE A;  3URH A;  1MOK A;  1NEK A;  2XFO A;  2YR4 A;  1CC4 A;  2V3B A;  5IQ4 A;  1ZY8 A;  4K7Z A;  3K7M X;  3GWD A;  3T2Y A;  1GRB A;  4JY3 A;  1IUU A;  4GAV A;  1KNP A;  4ZN0 A;  3GDP A;  3PO7 A;  3AWI A;  1O5W A;  4DSH A;  3GMB A;  1CHU A;  3DJD A;  2GB0 A;  1YY5 A;  3CPJ G;  4H4T A;  1NHP A;  4H4Y A;  1K0J A;  4GCM A;  4U8K A;  2YLX A;  2TMD A;  1N4U A;  1DJQ A;  2WP9 A;  3UTE A;  3GYJ A;  3FBS A;  2ARD A;  4PAB A;  1PXB A;  4TLX A;  4OCG A;  4HB9 A;  2YWL A;  1ZMD A;  1YQZ A;  1YQ4 A;  3G5R A;  3IHM A;  4Z2T A;  3LXD A;  1H81 A;  4OPU A;  3AYL A;  3BNU A;  4IV9 A;  2Q7V A;  3BHK A;  2APG A;  2V61 A;  3V76 A;  3HYX A;  1NG4 A;  3C4A A;  1FL2 A;  3CTY A;  2WHD A;  1BGJ A;  3UOV A;  2GVC A;  3AED A;  3SZF A;  5FS8 A;  4A9W A;  2NVK X;  3LOV A;  1OJC A;  1YQ3 A;  3NT6 A;  3KPF A;  2XFU A;  2YVG A;  2DKH A;  3SFE A;  2IVE A;  5KVI A;  1E6E A;  5LV9 A;  3ABV A;  1LQT A;  1CJ4 A;  5U25 A;  1COY A;  4K5R A;  4AT0 A;  1CJC A;  4JQ9 A;  2PHH A;  2GH5 A;  5JCM A;  1CL0 A;  2WOW A;  1EL8 A;  3QVR A;  4YWO A;  1CF3 A;  1IUS A;  4K2X A;  1SEZ A;  4Z25 A;  4EIP A;  1VDC A;  2B9Y A;  2WBA A;  3SXI A;  3SGL A;  4E0V A;  5BUL A;  3ATQ A;  4ZCD A;  3G5Q A;  3DA1 A;  2EQ9 A;  3LAD A;  3T14 A;  3D9X A;  1LJ1 A;  1ZOV A;  2BS2 A;  3IF9 A;  3UOY A;  1TYT A;  3IC9 A;  2C67 A;  2XLR A;  2JAE A;  3ADA B;  4U2S A;  3SZW A;  1B5Q A;  3Q6J A;  3GYX A;  5IPY A;  1MXT A;  1TDO A;  5BUK A;  2C65 A;  1PN0 A;  5TR3 A;  3WE0 A;  1F8W A;  1GPE A;  3NLC A;  1DNC A;  5JRB A;  4XWZ A;  1K0L A;  3C4N A;  1EL5 A;  3NTD A;  2C4C A;  3OZ2 A;  1Y56 A;  2Q0L A;  2YLZ A;  2GR3 A;  4AP3 A;  4BK1 A;  3GDN A;  4EQX A;  1QLB A;  1IUW A;  2FJD A;  2XLS A;  1O95 A;  4YTM A;  1PBE A;  1PXA A;  2IID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...