5JCLA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
432
structure length
429
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPAPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFYSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Os09g0567300 protein
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
total genus 136
structure length 429
sequence length 432
chains with identical sequence B
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jclA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jclA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jclA02
3AD7B 4USRA 2BA9A 3OC4A 5JCMA 2GAHB 5U1OA 1JRZA 2VQ7A 4EQRA 2YWLA 3FIMB 3UCLA 4BURA 4U8LA 4H4UA 2H88A 4NEVA 1VRQB 4IA6A 4C5OA 4AT2A 4I58A 3BHKA 2XFOA 1GRFA 3K30A 2XLSA 2R9ZA 3RNMA 4Z25A 1F3PA 4RG3A 3C96A 4E0VA 3CNDA 4TM1A 1YQZA 4XWRA 1REOA 2WHDA 3NHOX 4YSHA 3SFDA 3AE3A 1H86A 1TDFA 3FMWA 4H4YA 4BV6A 3LJPA 4U2LA 1NPXA 3IHMA 3NGCX 2Y6RA 2C75A 3GD4A 1LPFA 3V3OA 4D04A 3QSMA 2WP5A 2A89A 2JB2A 3K7MX 2GH5A 1NEKA 4H4XA 3D8XA 4LA1A 1DJNA 1PBCA 4YXDA 4IVMB 4BK3A 1NHQA 4EQXA 3C4AA 4OCGA 2C67A 2YM2A 3CTYA 2RGOA 3AEDA 4EMWA 4Z2TA 2WDRA 3BNMA 5FMHA 1K0JA 1CJ2A 1BF3A 1FL2A 1ZOVA 3SFEA 5M10A 1DJQA 1EL8A 1IUUA 2YLZA 1IUSA 5KOWA 2H89A 4TM4A 3FPZA 3LB8A 5JCKA 3EANA 2GEWA 2EQ7A 2GRTA 4Z24A 4O5QA 1F8RA 3DH9A 1H83A 1GXFA 3IF9A 3ATQA 2BK4A 3AE1A 3COXA 2C65A 3VR8A 3S5WA 3AYJA 4Z2UA 5J60A 4UDRA 1BKWA 2C70A 1M64A 1Y0PA 3AE6A 3AYLA 3GWFA 3KKJA 3P4PA 2YVJA 3DGHA 3KVEA 3UOVA 2WDVA 1GRGA 2VVLA 5BRTA 1ELIA 3IC9A 4OPUA 1ZMDA 1ZMCA 4U8NA 2V3BA 3DK9A 5KVHA 2XLTA 4REKA 3AD9B 1PXBA 1DOCA 1GT8A 1Y56B 2APGA 2ARDA 2WETA 1Q1WA 3CGBA 2GV8A 2C72A 2NVKX 1TDOA 1ZY8A 2AR8A 3SGLA 2E5VA 4OPGA 3AEGA 3H8LA 3VR9A 4B66A 3AE7A 2JB3A 1QJDA 4Y4MA 4JQ9A 5JCIA 2XLUA 4H4ZA 1W4XA 4H4VA 4MJWA 3KPFA 4UDQA 3V3NA 3NK0X 4Z43A 4CNJA 2XDOA 4CCQA 4A7AA 3EF6A 4EIPA 2QA1A 2IIDA 1PN0A 1RP0A 4BJZA 4P9SA 3B6DA 1XDIA 2BS3A 3ICTA 3BI4A 1PXAA 1CJ3A 4GR1A 4YTPA 3V76A 3DK4A 4I59A 4H4QA 4OPLA 4J36A 2RGJA 1GTEA 4H4RA 4U2TA 4U8KA 1LTXR 4CCRA 3ALMA 1LV0A 4UP3A 5IQ1A 1PHHA 2YLXA 3AYIA 1YQ4A 4ZCCA 2B7RA 2C66A 2OLNA 2WU5A 1K0LA 3IHGA 2BCGG 3O0HA 4YWOA 1BZLA 2X8HA 2QA2A 2XLRA 3AE8A 3GDNA 3GDPA 1EBDA 3URHA 1IUVA 3AEEA 4NTDA 3CNTA 4JY2A 3SQPA 4OPIA 1IUTA 4A79A 5FS8A 1E1MA 4WX1A 2B9XA 4GRTA 3SM8A 4U8MA 1RSGA 3UP5A 3P4RA 1KNPA 5KWFA 5ER0A 2XYOA 5KXJA 1TDKA 3BHFA 1Y56A 4EM4A 1QO8A 2Q6UA 5KVIA 4B63A 1HYUA 2BCPA 2JB1A 1P2HA 3CN8A 1NG4A 1NHSA 2ZZCA 4J33A 4XXGA 1B4VA 1YY5A 3NN0X 2A87A 4U8JA 1OJDA 2Q0KA 2C73A 4RG4A 2ZZ0A 1KNRA 2JAEA 4ECHA 1PBFA 3JSKA 1GEUA 2GB0A 1XPQA 3CGCA 2V3AA 5J7XA 2O9ZA 3G5SA 3OZ2A 4USQA 4APNA 5JCNA 2WQYA 3DMEA 1KFYA 1S2QA 5BULA 4C77A 4LU6A 3VRBA 2AQJA 2GR1A 3BI5A 2YG7A 3UP4A 2WU2A 2ZBWA 4H4SA 1TDEA 4OPDA 1VG9A 1B37A 1E1LA 2DKHA 1NDAA 4JNQA 4U8IA 1L0VA 2YLSA 5KOXA 4YT0A 2C64A 2WPFA 1GALA 1GRTA 3Q6JA 3NTDA 3KA7A 3UKAA 1H82A 5GSNA 2BK3A 1FEBA 4K7ZA 4FDCB 2RABA 5U25A 3CPJG 3P4SA 2BYBA 1PJ7A 3I3LA 4EQSA 2Q0LA 5EB4A 1GRHA 4N9XA 3NYCA 1K4QA 3ADAB 1GTHA 4J34A 4TM3A 3GMBA 4K22A 3GYJA 1NHRA 3LADA 1CF3A 3NH3X 4H4WA 4B64A 4X4JA 1CC4A 2VZ2A 3P9UA 2TPRA 2WPCA 3UTHA 3NT6A 5IPYA 2NPXA 5KRQA 3M12A 4B67A 3DGZA 3ISHA 4A6NB 1TRBA 2GVCA 2RGHA 3WE0A 2EQ8A 2BC1A 2XFNA 2F5ZA 1PJ6A 2BS4A 4CBQA 1D4CA 3AEBA 4K2XA 1MO9A 2VRMA 4GUVA 5CKUA 1YKJA 1IUWA 3ATRA 1LJ1A 3UOXA 1JNRA 2FJBA 1BWCA 4TM0A 2X3NA 1H6VA 1ZOYA 1GRAA 1PBDA 1SEZA 4JNAA 3ZDNA 4A99A 1ONFA 1CL0A 4CY6A 3UKFA 3BNUA 1F8WA 3QJ4A 2JBVA 2YQUA 4GF7A 3UKKA 5HXIA 2Z5XA 3ITJA 4TLZA 1FOHA 2QAEA 4EIQA 2X8CA 2YLWA 2BK5A 1ZK7A 3RP7A 1B5QA 3PO7A 4IV9A 1L9DA 3AE9A 3P4QA 3DA1A 5FS6A 1X31B 4LIIA 3LOVA 4NEWA 1JEHA 4H4PA 1E1KA 3IWAA 2EQ9A 2GAGB 3CIRA 1D5TA 1GNDA 5BVAA 2R0CA 4A9WA 5M0ZA 1UKVG 3NIXA 3LZXA 1B8SA 1OJAA 2Q7VA 2XVFA 3PVCA 4EMJA 3FG2P 5U63A 2J3NA 1N1PA 4HB9A 2FJDA 1VG0A 2GMJA 5FS7A 3ZYXA 2R45A 4PABA 1KSSA 1TDNA 2BXSA 3AD8B 4A6NA 4JDRA 5EBKA 3T37A 1N4WA 1V59A 3II4A 1TYPA 3QSEA 2BABA 3CNPA 5JCLA 1GERA 3F8DA 2XLPA 1E39A 1YQ3A 1L9EA 1F6MA 3RHAA 1NHPA 2AAQA 3L1RA 3H4KA 2IVEA 2V61A 3RP6A 4K5RA 3NK2X 3DJJA 1TYTA 4AOXA 4H2QA 1JRYA 2BACA 4M52A 2YR4A 5FS9A 3CPIG 5HY5A 1RYIA 1COYA 4A65A 2R46A 1OJ9A 5C2TA 4BJYA 4TLXA 5LV9A 2XVIA 1FECA 1DXLA 3L8KA 1EL7A 1NENA 4C3XA 3CNJA 3NTAA 1OJTA 1K0IA 2ZZBA 3CGEA 3ALJA 2R4JA 3EAOA 2VQBA 3Q9TA 3S61A 1D7LA 1PBBA 4BK2A 4UDPA 1H7WA 2B76A 4H2RA 1H81A 2WP9A 4J57A 3E1TA 2VVLG 4H4TA 2JKCA 2C3DA 1OJCA 2OLOA 3GRSA 1MXTA 2E1MA 1AOGA 3CGDA 1D4EA 1GOSA 2R0PA 3ICRA 4YSXA 2C76A 2YLTA 2WOVA 2WP6A 1JU2A 5TR3A 2XFQA 3M0OA 2XFUA 3FBSA 3KD9A 4NTCA 2WPEA 3QFAA 2DKIA 2TMDA 2C7GA 2IVDA 2BC0A 2I0ZA 2V60A 1NAAA 4KPRA 3NN6X 3GWDA 3H8IA 4H7UA 2OAMA 4YSYA 4OPTA 2YG6A 3AB1A 1ZKQA 4DSGA 2WS3A 1XANA 1O5WA 2YR5A 3NRNA 2CFYA 3DJGX 1JRXA 1KDGA 3AECA 4H50A 2PHHA 2YG4A 2YR6A 3BI2A 1ZDLA 3D1CA 1MOKA 4X9MA 3GD3A 4Z2RA 5CQFA 1IJHA 1O95A 1CC2A 4O5UA 2YG3A 2E4GA 4X9NA 4Z26A 1L9CA 1O94A 2XCGA 3DK8A 2CVJA 1LQTA 1N4UA 4IA5A 4CNKA 2JK6A 1XHCA 5HYMA 2CULA 2V5ZA 3AE5A 4EM3A 5HHFA 1EL9A 3UTFA 3ABVA 4C74A 4GDPA 3RP8A 4DSHA 4WCTA 3GSIA 3KLJA 1S2YA 3AEFA 4J2WA 4PAAA 4B69A 2B7SA 4U2SA 2YVGA 2GR0A 2GQWA 1CHUA 2VOUA 1E6EA 3UOYA 3NNEA 2FJEA 5EOWA 3VRAA 2YVFA 3DJDA 4HA6A 3R9UA 2EQ6A 2R4EA 4BK1A 1FCDA 4CRTA 3UOZA 4DNAA 1Q9IA 1GESA 4CY8A 3QVPA 1DNCA 3AE4A 4Z44A 2GMHA 4YKGA 2YAUA 3VQRA 2GQFA 1GETA 1NG3A 1S3BA 4ZCDA 4B65A 2FBWA 2V6OA 1VQWA 1CC6A 3AXBA 1FEAA 2C3CA 3CPHG 4AOSA 4XWZA 4YKFA 4RSLA 4NZHA 3I6DA 3G5QA 3P1WA 3B3RA 1ZX9A 2ACZA 2YM1A 5EB5A 2X50A 2GR3A 4OPCA 1EL5A 3F8PA 3NK1X 3F8RA 3NYEA 2W0HA 4JY3A 3GYIA 5GRTA 4U8PA 3G5RA 2X99A 3NLCA 2PYXA 3UKQA 4ZN0A 3PS9A 2CDUA 4YTMA 1BGJA 1M6IA 2GR2A 4FK1A 1GPEA 4AP3A 4FX9A 4GDEA 4AP1A 1DODA 1GV4A 1H7XA 1CBOA 4K8DA 1DOEA 2Y6QA 2B9YA 2UZZA 5C3JA 2WBAA 1GRBA 2QCUA 4FK1C 1H84A 2B9WA 4D03A 5L46A 3GRTA 3NG7X 1D7YA 2FJAA 4YTNA 1GREA 2WEUA 5IQ4A 1Q1RA 3AE2A 4IVOB 3UKLA 3ICSA 3KU9A 1PDHA 3CNSA 1Z6LA 3K7QX 4C3YA 4AT0A 3NYFA 1GSNA 2XVJA 1PXCA 2R0GA 3M13A 3QSSA 1JOAA 4Y4NA 1S3EA 1DOBA 3QVRA 1KF6A 3EPTA 1CJCA 4NTEA 3UKPA 3UTGA 1LQUA 3VRDB 4ADWA 2WOIA 4YSZA 2OA1A 4EQWA 4EMIA 4Y4LA 1PJ5A 1P2EA 1KSUA 1QLBA 5DBJA 4U8OA 3ALLA 3GMCA 4B1BA 5BUKA 3K7TA 3HZLA 2WOWA 1BGNA 1CJ4A 2XVEA 2BS2A 2OALA 3UKHA 1D4DA 1ZP0A 2BXRA 2XVHA 1N4VA 3QFBA 1PBEA 1PS9A 3REDA 2VRLA 4H2NA 4H2PA 3AWIA 1E7PA 2Z5YA 1JNZA 2YLRA 4GCMA 4DGKA 2YG5A 3LXDA 2A8XA 2VVMA 3AEAA 1E1NA 2XFPA 3C4NA 1LVLA 2WESA 2HQMA 4A5LA 3LZWA 3UTEA 4B68A 4J31A 1VDCA 4ICYA 4KX6A 3NKSA 4JN9A 4J56A 2GF3A 2WDQA 4K5SA 4OVIA 2X8GA 1F8SA 3DJEA 1IUXA
chains in the Genus database with same CATH superfamily
4H1ZA 2ONEA 2GAHB 3DG6A 2YWLA 4U8LA 4H4UA 3U4FA 1VRQB 4AT2A 2XLSA 2R9ZA 3RNMA 4Z25A 1F3PA 4E0VA 3C96A 3SZCA 1REOA 3FMWA 3ZVHB 4HCDA 4U2LA 1NPXA 3GD4A 1LPFA 1W6TA 2GH5A 1SJDA 4YXDA 4BK3A 3AN1A 2C67A 3BNMA 1EL8A 1IUUA 3SX6A 5JCKA 3MUCA 2GGHA 4UDRA 1BKWA 1Y0PA 1MRAA 2FKPA 4OPUA 4U8NA 2PU0A 2V3BA 3DK9A 4REKA 3TOYA 1PXBA 3PWIA 1DOCA 1Y56B 2ARDA 1N5XA 2C72A 1MNSA 2NVKX 2E5VA 2OO6A 3H8LA 3HYVA 2XLUA 4H4VA 4MJWA 3V3NA 4CNJA 4CCQA 3MSYA 2QA1A 1CJ3A 4GR1A 4I59A 4OPLA 4U2TA 1T3QC 3ALMA 3H8AA 2WU5A 5BUKA 2BCGG 4YWOA 3URHA 4NTDA 4JY2A 1IUTA 1E1MA 5KXJA 4II3A 4B63A 4G9KA 2JB1A 3CN8A 1NG4A 4XXGA 1B4VA 3R0KA 2A87A 2PMQA 1OJDA 4RG4A 1KNRA 1PBFA 1GEUA 3CGCA 3G5SA 4H19A 1N63C 4LU6A 2AQJA 3FYYA 3OTRA 3UP4A 2ZBWA 1TDEA 1ONEA 1B37A 1E1LA 1GRTA 3Q6JA 3UJRA 1FEBA 3QTPA 2RABA 3CPJG 4G8TA 3I3LA 2OPJA 2Q0LA 3UXKA 3NYCA 1K4QA 3GYJA 4B64A 4X4JA 2PTZA 3RITA 5KRQA 3M12A 4B67A 3DGZA 3PFRA 2EQ8A 1D4CA 3ATRA 2DW7A 1PDZA 5FJPA 2FJBA 3V3WA 5FJTA 3VA8A 1BQGA 2Z5XA 2GGEA 4EIQA 3TTEA 3AE9A 3DA1A 4NEWA 3IWAA 2EQ9A 2GAGB 3CIRA 1GNDA 4F4RA 1B8SA 3PVCA 1N1PA 5FS7A 3AD8B 1TDNA 3RO6A 4JDRA 5KMQA 1TYPA 3VCCA 2I5QA 3QSEA 1GERA 3H4KA 3CXBA 3RP6A 3NZGA 4K5RA 3DJJA 2BACA 2YR4A 1FO4A 5FS9A 5HY5A 2OG9A 4TLXA 2XVIA 1FECA 1JCTA 1OJTA 2VQBA 1F9CA 4GGBA 1D7LA 3GYXA 4BK2A 3E1TA 4H4TA 3DFYA 1D4EA 2YLTA 2WP6A 3R25A 5TR3A 3M0OA 2DKIA 1VDVA 3JW7A 2V60A 1NAAA 3H8IA 3DG3A 4YSYA 2YG6A 3T9PA 1ZKQA 4DSGA 2YR5A 1XANA 1O5WA 1JRXA 4HNLA 4H50A 2PHHA 4Z2RA 3GD3A 1IJHA 2YG3A 2E4GA 4X9NA 1L9CA 2CVJA 1XHCA 2W54A 4WCTA 3GSIA 4J2WA 4PAAA 2GR0A 3A7UA 1X2GA 3NNEA 3DJDA 3R9UA 4BK1A 4DNAA 2GMHA 4YKGA 2GQFA 1GETA 3AXBA 1VQWA 4AOSA 2C3CA 3EEZA 4NZHA 3I6DA 1OEPA 2GR3A 4GMEA 3NYEA 2W0HA 5GRTA 4Z1YA 3UCDA 2XH7A 2QJJA 2PYXA 2XGZA 3PS9A 1RVKA 4FK1A 3AM9A 1GV4A 5KNLA 5EU9A 2WBAA 2QCUA 2XH4A 3ZVHA 4D03A 3NG7X 1D7YA 2FJAA 5ENLA 3UKLA 2GGJA 2XVJA 1PXCA 3QSSA 1JOAA 4KT2A 1DOBA 1CJCA 2HXTA 4A35A 1LQUA 3VRDB 2OX4A 4U8OA 3GMCA 4B1BA 3OP2A 3ZVIA 2WOWA 2XVEA 2BXRA 2PTXA 3Q4DA 2VRLA 4H2NA 3TWAA 3LXDA 2VVMA 4DHGA 1LVLA 3ES8A 4KX6A 3H7VA 4JN9A 4OVIA 1F8SA 1IUXA 3AD7B 4USRA 3BJSA 2VQ7A 3D46A 3FIMB 3PWGA 1KKOA 3UCLA 2P0IA 4NEVA 2XSXA 3RR1A 3RCYA 4I58A 3K30A 2OFJA 2OQYA 4TM1A 2MUCA 3V4BA 3SN1A 3IHMA 2C75A 3I6EA 3QSMA 5BOFA 1NEKA 1MDRA 4LA1A 3UCCA 4IVMB 3FJ4A 4OCGA 1JROA 1R0MA 1KD0A 4Z2TA 1BF3A 1V97A 1DJQA 2YLZA 1FFVC 2GRTA 4Z24A 5KMRA 3IF9A 2AL2A 3ATQA 2BK4A 3AE1A 1N61C 4A6GA 3VR8A 1FHUA 3AE6A 3KKJA 2YVJA 3DGHA 3KVEA 2WDVA 4ENLA 2HZGA 5BRTA 3A7RA 2AL1A 5FJOA 1GT8A 1Q1WA 2ZC8A 3CGBA 3OZYA 2AR8A 4OPGA 4Y4MA 2HXUA 3JVAA 4UDQA 3NVWB 3KPFA 2IIDA 3SR6B 1PXAA 2PTYA 1LV0A 2YLXA 1YQ4A 2OLNA 1SJBA 2XLRA 3GDPA 3GDNA 1EBDA 1IUVA 4IHCA 5FS8A 2AKMA 2GL5A 3SM8A 5KWFA 1KNPA 2XYOA 1N62C 3P0WA 2C4CA 4JHMA 3BHFA 4EM4A 5KVIA 1P48A 2BCPA 3OPSA 1NHSA 1XPYA 3SYIA 3NN0X 4U8JA 2C73A 2ZZ0A 1XPQA 3NXLA 3OZ2A 1KFYA 1S2QA 5BULA 3VC6A 2YG7A 2WU2A 4G6GA 1NDAA 3BSMA 2DW6A 3DIPA 3KA7A 3KPKA 3CAWA 3N4EA 3P4SA 5EB4A 4N9XA 1IYXA 1KCZA 2QDEA 3GMBA 1CF3A 3LADA 3NH3X 4H4WA 1CC4A 3P9UA 2TPRA 3ISHA 2RGHA 3WE0A 1PJ6A 2BS4A 4K2XA 3OZMA 5CKUA 1SB3B 2E5AA 3FXGA 3T14A 1MDLA 4TM0A 3SZWA 1H6VA 3CXOA 3ZDNA 2PP1A 1EBHA 3UKFA 1F8WA 3QJ4A 2JBVA 3A7AA 2QAEA 3T2KA 2YLWA 3PO7A 4IV9A 2BRAA 5FS6A 2PA6A 5BVAA 5G5GB 2NQLA 3SJNA 2Q7VA 2XVFA 4HB9A 2GMJA 4PABA 1KSSA 4A6NA 3T8QA 1N4WA 3TW9A 1V59A 3II4A 3CNPA 3F8DA 2XLPA 3RHAA 1NHPA 3L1RA 2V61A 4TVWA 4X2PA 4AOXA 3CPIG 3H12A 1COYA 4A65A 2R46A 1ECQA 3CT2A 3ZLHA 3CNJA 3HPFA 3ALJA 3EAOA 4E4UA 3Q9TA 3S61A 3MZNA 2PCEA 4UDPA 4H2RA 2JKCA 3D47A 2C3DA 1OJCA 3GRSA 1MXTA 3ICRA 2R0PA 5FJRA 3U9IA 1JU2A 3QFAA 3NN6X 4H7UA 2BC0A 2PP3A 4KPRA 3AMZA 4OPTA 3AB1A 3AECA 1S7MA 3H70A 3BI2A 1ZDLA 3D1CA 4ZCWA 4X9MA 1CC2A 2PSNA 5BOEA 1O94A 3DK8A 2JK6A 2CULA 3AE5A 4EM3A 3RP8A 4GAPA 2XH0A 3KLJA 2GQWA 2VOUA 3UOYA 2FJEA 5EOWA 2PGEA 4GISA 2YVFA 2R4EA 3UOZA 1GESA 4CY8A 3AE4A 2YAUA 3SQSA 3VQRA 1S3BA 1NG3A 4B65A 2V6OA 4YKFA 2OZ8A 3IJLA 3G5QA 2ACZA 2YM1A 5EB5A 2PS2A 4OPCA 4JY3A 3GYIA 4GYPA 1GPEA 4AP1A 1DODA 1H7XA 4K8DA 1DOEA 2B9YA 1GRBA 1H84A 5L46A 3GRTA 3SZFA 5IQ4A 1Q1RA 3ICSA 3TCSA 3GO2A 1GSNA 3RRAA 2PU1A 2W3SA 3TJ4A 2WOIA 4MGGA 4EQWA 4EMIA 1PJ5A 3L5OA 1KSUA 1QLBA 1FHVA 3ALLA 3VFCA 2O56A 3UKHA 2BS2A 5JRBA 3ETRB 4HPNA 2XVHA 1SJCA 3V5FA 3V5CA 1N4VA 1PS9A 4DYEA 2Z5YA 2YLRA 4G6HA 4DGKA 2YG5A 4J3ZA 1BKHA 3FV9A 2XFPA 4A3RA 2FYMA 2HQMA 3S47A 3NKSA 4K5SA 2X8GA 5JCMA 5U1OA 1JRZA 3SXIA 3NS1B 6ENLA 3K1GA 2H88A 2XFOA 1GRFA 4RG3A 1YQZA 3ES7A 4XWRA 2WHDA 3NHOX 4YSHA 2PPGA 3AE3A 3VCNA 4FI4A 4H4YA 4BV6A 3LJPA 1KKRA 2Y6RA 3V3OA 2WP5A 3K7MX 4H4XA 1DJNA 1PBCA 4E6MA 3IJIA 3CTYA 1TKKA 2RGOA 3AEDA 5FMHA 1K0JA 1FL2A 1ZOVA 5M10A 1IUSA 4TM4A 3FPZA 3TQPA 2EQ7A 4O5QA 3R0UA 3DH9A 3IJQA 1H83A 3T0KA 3FCPA 3AYJA 3DGBA 2C70A 3P4PA 3AYLA 4KWSA 2VVLA 5KMSA 1ELIA 3IC9A 4JN8A 1ZMDA 1ZMCA 5KVHA 1H2IA 3STPA 2WETA 2OQHA 1TDOA 3SGLA 2W55A 3VR9A 4B66A 2JB3A 1QJDA 3CYJA 4JQ9A 5JCIA 4H4ZA 1W4XA 3R1ZA 4Z43A 4EIPA 3EF6A 4BJZA 2PODA 3MQTA 4P9SA 3B6DA 3ICTA 4KEMA 3BI4A 7ENLA 4YTPA 3V76A 3DK4A 1VQZA 1GTEA 3P93A 4U8KA 1LTXR 3QLDA 1PHHA 3AYIA 2B7RA 4IP5A 3IHGA 1K0LA 4IL0A 3O0HA 5KOWA 1BZLA 2X8HA 3CNTA 3SQPA 4E4FA 4WX1A 4GRTA 5ER0A 1SJAA 3SN4A 1Y56A 2Q6UA 3KUMA 2ZADA 3T31A 1P2HA 4J33A 2ZZCA 1EC9A 4G7FA 4ECHA 2GB0A 4H2HA 4USQA 2QJMA 2WQYA 3DMEA 4OPDA 1VG9A 2PGWA 4U8IA 1L0VA 2YLSA 4YT0A 3HYXA 2WPFA 1GALA 3NTDA 3UKAA 1TZZA 4K1WA 5GSNA 5U25A 3T4WA 2BYBA 4EQSA 3CK5A 5J04A 3ADAB 4J34A 3S5SA 3UTHA 3T6CA 5IPYA 3NT6A 2NPXA 3PG6A 3GY1A 3VC5A 2BC1A 2XFNA 4CBQA 4ZA0A 1MO9A 3I6TA 2VRMA 1YKJA 1LJ1A 1JNRA 3SZ0A 1EC8A 1ZOYA 4IP4A 1CL0A 1WYGA 5HXIA 5G5HB 1ZK7A 1B5QA 1L9DA 4GIRA 1XS2A 1X31B 3LOVA 1WUFA 1E1KA 2R0CA 4A9WA 3NIXA 4EMJA 2J3NA 3HRDC 3ZYXA 2R45A 3T37A 4ZOHB 3RGTA 2BABA 3CB3A 5JCLA 3UJ2A 1E39A 1JPMA 2GGGA 2IVEA 3PK7A 4NWZA 3NK2X 4M52A 4IT1A 3NFUA 4G74A 1YEYA 1DXLA 3SSZA 2OLAA 3NTAA 2ZZBA 4DXKA 1PBBA 1H7WA 2B76A 1H81A 2WP9A 1AOGA 1GOSA 4YSXA 2QJNA 4YWSA 2XFQA 2XFUA 3KD9A 2IVDA 2C7GA 2I0ZA 3N6JA 4E5TA 2WS3A 3NRNA 3DJGX 1KDGA 4KPLA 5CQFA 1O95A 5IDZA 3DG7A 4Z26A 4NNJA 2XCGA 1LQTA 1N4UA 4IA5A 4CNKA 2QQ6A 3R07C 5HHFA 4C74A 3BOXA 4DSHA 1S2YA 2AKZA 2B7SA 4U2SA 1E6EA 3TJIA 4DWDA 3NRZB 3UJSA 4HA6A 2EQ6A 1FCDA 2BRYA 4CRTA 1Q9IA 3QVPA 1DNCA 4EWJA 4ZCDA 3Q45A 1FEAA 4XWZA 3P1WA 1KN0A 1EBGA 2X50A 3NK1X 2GSHA 3G5RA 4ZN0A 1BGJA 2GR2A 4FX9A 4GDEA 2Y6QA 5C3JA 4FK1C 1TE6A 4E8GA 1GREA 3AE2A 3KU9A 1PDHA 3CNSA 3K7QX 4AT0A 3NYFA 1S3EA 3QVRA 3ENLA 1KF6A 4NTEA 2QGYA 3UTGA 2PTWA 3DDMA 4ADWA 4YSZA 2OA1A 1P2EA 5DBJA 4G73A 3K7TA 3HZLA 1BGNA 4JN7A 3SY4A 3QFBA 4H2PA 4GAVA 1X2HA 3MKCA 3R10A 3N4FA 1EC7A 3NVZB 1E1NA 3C4NA 3LZWA 4B68A 2WDQA 3DJEA 2BA9A 3T2ZA 3OC4A 3ZLFA 4EQRA 2PP0A 4BURA 2AL2B 1ELSA 4IA6A 1NU5A 4C5OA 3BHKA 3CNDA 3I4KA 3SFDA 4J1OA 4HNCA 2OVLA 1H86A 1TDFA 3NGCX 4D04A 2A89A 2JB2A 3FVDA 3D8XA 1NHQA 4EQXA 3C4AA 3DFHA 2YM2A 4HYRA 3MWCA 4EMWA 2WDRA 1CJ2A 1RM6B 3SFEA 3UJFA 3QN3A 2H89A 3LB8A 2GEWA 3EANA 1F8RA 1GXFA 3COXA 3VDGA 2C65A 2OZTA 3S5WA 4Z2UA 5J60A 1M64A 3UOVA 3GWFA 1GRGA 3T2YA 2XLTA 3AD9B 4H83A 4DN1A 2APGA 2GV8A 4GFIA 1ZY8A 3AEGA 3JZUA 3AE7A 3THUA 1MUCA 3IK4A 3NK0X 2XDOA 4A7AA 3QKEA 4K2SA 1PN0A 1RP0A 1XDIA 2BS3A 2P88A 4H4QA 4J36A 2RGJA 4H4RA 4CCRA 4UP3A 5IQ1A 2MNRA 4ZCCA 2C66A 2QA2A 3AE8A 3AEEA 4A79A 1L8PA 4OPIA 3ZLGA 2B9XA 4U8MA 1RSGA 3UP5A 3P4RA 2W3RA 1TDKA 1QO8A 1HYUA 4TVYA 3B9JB 4DX3A 1YY5A 2Q0KA 2XH2A 5FJUA 2JAEA 3JSKA 3OW1A 3NO1A 5KMPA 2V3AA 5J7XA 2O9ZA 4APNA 5JCNA 4Z17A 4C77A 3VRBA 2GR1A 3BI5A 4H4SA 2DKHA 1FIQB 4JNQA 5KOXA 2C64A 4IL2A 1H82A 2BK3A 4K7ZA 4FDCB 2GDQA 1PJ7A 1GRHA 1GTHA 4TM3A 4K22A 1NHRA 1NELA 4II2A 2VZ2A 2WPCA 2P3ZA 4GGHA 4A6NB 1TRBA 2GVCA 2F5ZA 2QDDA 3AEBA 4HCLA 4GUVA 3NVYB 1IUWA 4K8GA 3UOXA 3DERA 3UGVA 1BWCA 2X3NA 1GRAA 1PBDA 1SEZA 4JNAA 4A99A 1ONFA 4CY6A 4FP1A 3BNUA 4GF7A 3UKKA 2P8BA 2YQUA 3HYWA 3ITJA 4TLZA 1FOHA 2X8CA 3UXLA 3RP7A 3DESA 2BK5A 3P3BA 3P4QA 4LIIA 1JEHA 4H4PA 1D5TA 1DTNA 5M0ZA 1UKVG 3LZXA 1OJAA 3NVVB 5U63A 3FG2P 1N60C 2FJDA 1VG0A 2BXSA 5EBKA 1N5WC 1JPDX 2OKTA 1YQ3A 1L9EA 1F6MA 2AAQA 1TYTA 4H2QA 1JRYA 4HCHA 1RYIA 1OJ9A 5C2TA 4BJYA 5LV9A 2P8CA 3L8KA 4ROPA 1EL7A 1NENA 4C3XA 2OZ3A 1K0IA 3CGEA 2RDXA 2R4JA 1P43A 4J57A 3DEQA 2VVLG 2OLOA 2E1MA 3CGDA 4MKSA 2C76A 2WOVA 1JDFA 4NTCA 3FBSA 2POZA 2WPEA 2TMDA 3HW2A 1ZXIC 3GWDA 2OAMA 3QPEA 1JRPA 2CFYA 2YR6A 2YG4A 1MOKA 3SBFA 4O5UA 1E9IA 1FFUC 5HYMA 2V5ZA 1EL9A 3UTFA 3ABVA 4GDPA 3D9XA 3UJEA 3AEFA 4B69A 2YVGA 1CHUA 3VRAA 4Z44A 3EUB3 3EKGA 4MMWA 3TWBA 2FBWA 1CC6A 3CPHG 2HNEA 2GGIA 4RSLA 3B3RA 1ZX9A 1EL5A 3F8PA 3F8RA 3R11A 4U8PA 2X99A 3NLCA 3UKQA 2CDUA 4YTMA 3N6HA 1M6IA 3B97A 2QVHA 4AP3A 1CBOA 3MY9A 4GYPC 2E3TA 2UZZA 3GC2A 3SN0A 2B9WA 4YTNA 2WEUA 4IVOB 1R6WA 1Z6LA 4C3YA 4HN8A 2R0GA 1PDYA 3M13A 4Y4NA 3EPTA 3UKPA 4IZGA 4Y4LA 3GD6A 4M0XA 1STZA 1CJ4A 3CMMA 2OALA 1D4DA 1ZP0A 1PBEA 3REDA 3AWIA 4M6UA 1E7PA 1JNZA 4GCMA 2A8XA 3AEAA 2CHRA 2WESA 4A5LA 3UTEA 4J31A 1VDCA 4ICYA 1WUEA 4J56A 2GF3A
chains in the Genus database with same CATH topology
3AD7B 4USRA 2BA9A 3T2ZA 3OC4A 5JCMA 2GAHB 5U1OA 1JRZA 3SXIA 2VQ7A 4EQRA 2YWLA 3FIMB 3UCLA 4BURA 4U8LA 4H4UA 2H88A 4NEVA 1VRQB 4IA6A 4C5OA 4AT2A 4I58A 3BHKA 2XFOA 1GRFA 3K30A 2XLSA 2R9ZA 3RNMA 4Z25A 1F3PA 4RG3A 3C96A 4E0VA 3CNDA 4TM1A 1YQZA 4XWRA 1REOA 3SZCA 2WHDA 3NHOX 4YSHA 3SFDA 3AE3A 1H86A 1TDFA 3FMWA 4H4YA 4BV6A 3LJPA 4U2LA 1NPXA 3IHMA 3NGCX 2Y6RA 2C75A 3GD4A 1LPFA 3V3OA 4D04A 3QSMA 2WP5A 2A89A 2JB2A 3K7MX 2GH5A 1NEKA 4H4XA 3D8XA 4LA1A 1DJNA 1PBCA 4YXDA 4IVMB 4BK3A 1NHQA 4EQXA 3C4AA 4OCGA 2C67A 2YM2A 3CTYA 2RGOA 3AEDA 4EMWA 4Z2TA 2WDRA 3BNMA 5FMHA 1K0JA 1CJ2A 1BF3A 1FL2A 1ZOVA 3SFEA 5M10A 1DJQA 1EL8A 1IUUA 2YLZA 1IUSA 3SX6A 5KOWA 2H89A 4TM4A 3FPZA 3LB8A 5JCKA 3EANA 2GEWA 2EQ7A 2GRTA 4Z24A 4O5QA 1F8RA 5KMRA 3DH9A 1H83A 1GXFA 3IF9A 3T0KA 3ATQA 2BK4A 3AE1A 3COXA 2C65A 3VR8A 3S5WA 3AYJA 4Z2UA 5J60A 4UDRA 1BKWA 2C70A 1M64A 1Y0PA 3AE6A 3AYLA 3GWFA 3KKJA 3P4PA 2YVJA 3DGHA 3KVEA 3UOVA 2WDVA 1GRGA 2VVLA 5BRTA 1ELIA 3IC9A 5KMSA 4OPUA 1ZMDA 1ZMCA 3T2YA 4U8NA 2V3BA 3DK9A 5KVHA 2XLTA 4REKA 1H2IA 3AD9B 1PXBA 1DOCA 1GT8A 1Y56B 2APGA 2ARDA 2WETA 1Q1WA 3CGBA 2GV8A 2C72A 2NVKX 1TDOA 1ZY8A 2AR8A 3SGLA 2E5VA 4OPGA 3AEGA 3H8LA 3VR9A 4B66A 3AE7A 3HYVA 2JB3A 1QJDA 4Y4MA 4JQ9A 5JCIA 2XLUA 4H4ZA 1W4XA 4H4VA 4MJWA 3KPFA 4UDQA 3V3NA 3NK0X 4Z43A 4CNJA 2XDOA 4CCQA 4A7AA 3EF6A 4EIPA 2QA1A 2IIDA 1PN0A 1RP0A 4BJZA 4P9SA 3B6DA 1XDIA 2BS3A 3ICTA 3BI4A 1PXAA 1CJ3A 4GR1A 4YTPA 3V76A 3DK4A 4I59A 4H4QA 4OPLA 4J36A 2RGJA 1GTEA 4H4RA 4U2TA 4U8KA 1LTXR 4CCRA 3ALMA 1LV0A 4UP3A 5IQ1A 1PHHA 2YLXA 3AYIA 1YQ4A 4ZCCA 2B7RA 2C66A 2OLNA 2WU5A 1K0LA 3IHGA 2BCGG 3O0HA 4YWOA 1BZLA 2X8HA 2QA2A 2XLRA 3AE8A 3GDNA 3GDPA 1EBDA 3URHA 1IUVA 3AEEA 4NTDA 3CNTA 4JY2A 3SQPA 4OPIA 1IUTA 4A79A 5FS8A 1E1MA 4WX1A 2B9XA 4GRTA 3SM8A 4U8MA 1RSGA 3UP5A 3P4RA 1KNPA 5KWFA 5ER0A 2XYOA 2C4CA 5KXJA 1TDKA 3BHFA 1Y56A 4EM4A 1QO8A 2Q6UA 5KVIA 4II3A 4B63A 1HYUA 4G9KA 2BCPA 3T31A 2JB1A 1P2HA 3CN8A 1NG4A 1NHSA 2ZZCA 4J33A 4XXGA 3SYIA 1B4VA 1YY5A 3NN0X 2A87A 4U8JA 1OJDA 2Q0KA 2C73A 4RG4A 2ZZ0A 1KNRA 2JAEA 4ECHA 1PBFA 3JSKA 1GEUA 2GB0A 5KMPA 1XPQA 3CGCA 2V3AA 5J7XA 2O9ZA 3G5SA 3OZ2A 4USQA 4APNA 5JCNA 2WQYA 3DMEA 1KFYA 1S2QA 5BULA 4C77A 4LU6A 3VRBA 2AQJA 2GR1A 3BI5A 2YG7A 3UP4A 2WU2A 2ZBWA 4G6GA 4H4SA 1TDEA 4OPDA 1VG9A 1B37A 1E1LA 2DKHA 1NDAA 4JNQA 4U8IA 1L0VA 2YLSA 5KOXA 4YT0A 2C64A 3HYXA 2WPFA 1GALA 1GRTA 3Q6JA 3NTDA 3KA7A 3KPKA 3UKAA 1H82A 5GSNA 2BK3A 1FEBA 4K7ZA 4FDCB 2RABA 5U25A 3CPJG 3P4SA 2BYBA 1PJ7A 3I3LA 4EQSA 2Q0LA 5EB4A 1GRHA 4N9XA 3NYCA 1K4QA 3ADAB 1GTHA 4J34A 4TM3A 3GMBA 4K22A 3GYJA 1NHRA 3LADA 1CF3A 3NH3X 4H4WA 4II2A 4B64A 4X4JA 1CC4A 2VZ2A 3P9UA 2TPRA 2WPCA 3UTHA 3NT6A 5IPYA 2NPXA 5KRQA 3M12A 4B67A 3PG6A 3DGZA 3ISHA 4A6NB 1TRBA 2GVCA 2RGHA 3WE0A 2EQ8A 2BC1A 2XFNA 2F5ZA 1PJ6A 2BS4A 4CBQA 1D4CA 3AEBA 4K2XA 1MO9A 2VRMA 4GUVA 5CKUA 1YKJA 1IUWA 3T14A 3ATRA 1LJ1A 3UOXA 1JNRA 2FJBA 1BWCA 3SZ0A 4TM0A 2X3NA 3SZWA 1H6VA 1ZOYA 1GRAA 1PBDA 1SEZA 4JNAA 3ZDNA 4A99A 1ONFA 1CL0A 4CY6A 3UKFA 3BNUA 1F8WA 3QJ4A 2JBVA 2YQUA 4GF7A 3UKKA 3HYWA 5HXIA 2Z5XA 3ITJA 4TLZA 1FOHA 2QAEA 3T2KA 2X8CA 4EIQA 2YLWA 2BK5A 1ZK7A 3RP7A 1B5QA 3PO7A 4IV9A 1L9DA 3AE9A 2BRAA 3P4QA 3DA1A 5FS6A 1X31B 4LIIA 3LOVA 4NEWA 1JEHA 4H4PA 1E1KA 3IWAA 2EQ9A 2GAGB 3CIRA 1D5TA 1GNDA 5BVAA 2R0CA 4A9WA 5M0ZA 1UKVG 3NIXA 3LZXA 1B8SA 1OJAA 2Q7VA 2XVFA 3PVCA 4EMJA 3FG2P 5U63A 2J3NA 1N1PA 4HB9A 2FJDA 1VG0A 2GMJA 5FS7A 3ZYXA 2R45A 4PABA 1KSSA 1TDNA 2BXSA 3AD8B 4A6NA 4JDRA 5KMQA 5EBKA 3T37A 1N4WA 1V59A 3II4A 1TYPA 3QSEA 2BABA 3CNPA 5JCLA 1GERA 3F8DA 2XLPA 1E39A 1YQ3A 1L9EA 1F6MA 3RHAA 1NHPA 2AAQA 3L1RA 3H4KA 2IVEA 2V61A 3RP6A 4K5RA 4NWZA 3NK2X 3DJJA 1TYTA 4AOXA 4H2QA 1JRYA 2BACA 4M52A 2YR4A 5FS9A 3CPIG 5HY5A 1RYIA 1COYA 4A65A 2R46A 1OJ9A 5C2TA 4BJYA 4TLXA 4G74A 5LV9A 2XVIA 1FECA 1DXLA 3L8KA 1EL7A 1NENA 4C3XA 3CNJA 3NTAA 1OJTA 1K0IA 2ZZBA 3CGEA 3ALJA 2R4JA 3EAOA 2VQBA 3Q9TA 3S61A 1D7LA 1PBBA 3GYXA 4BK2A 4UDPA 1H7WA 2B76A 4H2RA 1H81A 2WP9A 4J57A 3E1TA 2VVLG 4H4TA 2JKCA 2C3DA 1OJCA 2OLOA 3GRSA 1MXTA 2E1MA 1AOGA 3CGDA 1D4EA 1GOSA 2R0PA 3ICRA 4YSXA 2C76A 2YLTA 2WOVA 2WP6A 1JU2A 5TR3A 2XFQA 3M0OA 2XFUA 3FBSA 3KD9A 4NTCA 2WPEA 3QFAA 2DKIA 2TMDA 2C7GA 2IVDA 2BC0A 2I0ZA 2V60A 1NAAA 4KPRA 3NN6X 3GWDA 3H8IA 4H7UA 2OAMA 4YSYA 4OPTA 2YG6A 3AB1A 1ZKQA 4DSGA 2WS3A 1XANA 1O5WA 2YR5A 3NRNA 2CFYA 3DJGX 1JRXA 1KDGA 1S7MA 3AECA 4H50A 2PHHA 2YG4A 2YR6A 3BI2A 1ZDLA 3D1CA 1MOKA 4X9MA 3GD3A 4Z2RA 5CQFA 1IJHA 1O95A 1CC2A 4O5UA 2YG3A 2E4GA 4X9NA 4Z26A 1L9CA 4NNJA 1O94A 2XCGA 3DK8A 2CVJA 1LQTA 1N4UA 4IA5A 4CNKA 2JK6A 1XHCA 5HYMA 2CULA 2V5ZA 3AE5A 4EM3A 5HHFA 1EL9A 3UTFA 3ABVA 4C74A 4GDPA 3RP8A 4DSHA 4GAPA 4WCTA 3GSIA 3D9XA 3KLJA 1S2YA 3AEFA 4J2WA 4PAAA 4B69A 2B7SA 4U2SA 2YVGA 2GR0A 2GQWA 1CHUA 2VOUA 1E6EA 3UOYA 3NNEA 2FJEA 5EOWA 3VRAA 2YVFA 3DJDA 4HA6A 3R9UA 2EQ6A 2R4EA 4BK1A 1FCDA 2BRYA 4CRTA 3UOZA 4DNAA 1Q9IA 1GESA 4CY8A 3QVPA 1DNCA 3AE4A 4Z44A 2GMHA 4YKGA 2YAUA 3VQRA 2GQFA 1GETA 1NG3A 1S3BA 4ZCDA 4B65A 2FBWA 2V6OA 1VQWA 1CC6A 3AXBA 1FEAA 2C3CA 3CPHG 4AOSA 4XWZA 4YKFA 4RSLA 4NZHA 3I6DA 3G5QA 3P1WA 3B3RA 1ZX9A 2ACZA 1KN0A 2YM1A 5EB5A 2X50A 2GR3A 4OPCA 1EL5A 3F8PA 3NK1X 3F8RA 3NYEA 2W0HA 4JY3A 3GYIA 5GRTA 4U8PA 3G5RA 2X99A 3NLCA 2PYXA 3UKQA 4ZN0A 3PS9A 2CDUA 4YTMA 1BGJA 1M6IA 2GR2A 4FK1A 1GPEA 4AP3A 4FX9A 4GDEA 4AP1A 1DODA 1GV4A 1H7XA 1CBOA 4K8DA 1DOEA 5KNLA 2Y6QA 2B9YA 2UZZA 5C3JA 2WBAA 1GRBA 2QCUA 4FK1C 1H84A 2B9WA 4D03A 5L46A 3GRTA 3NG7X 1D7YA 2FJAA 4YTNA 1GREA 2WEUA 3SZFA 5IQ4A 1Q1RA 3AE2A 4IVOB 3UKLA 3ICSA 3KU9A 1PDHA 3CNSA 1Z6LA 3K7QX 4C3YA 4AT0A 3NYFA 1GSNA 2XVJA 1PXCA 2R0GA 3M13A 3QSSA 1JOAA 4Y4NA 1S3EA 1DOBA 3QVRA 1KF6A 3EPTA 1CJCA 4NTEA 3UKPA 3UTGA 1LQUA 3VRDB 4ADWA 2WOIA 4YSZA 2OA1A 4EQWA 4EMIA 4Y4LA 1PJ5A 1P2EA 3L5OA 1KSUA 1QLBA 4G73A 4U8OA 5DBJA 3ALLA 3GMCA 4B1BA 5BUKA 3K7TA 3HZLA 2WOWA 1BGNA 1CJ4A 2XVEA 2BS2A 2OALA 3CMMA 5JRBA 3UKHA 1D4DA 1ZP0A 2BXRA 3SY4A 2XVHA 1N4VA 3QFBA 1PBEA 1PS9A 3REDA 2VRLA 4H2NA 4H2PA 4GAVA 3AWIA 1E7PA 2Z5YA 1JNZA 2YLRA 4G6HA 4GCMA 4DGKA 2YG5A 3LXDA 2A8XA 2VVMA 3AEAA 1E1NA 2XFPA 3C4NA 1LVLA 2WESA 2HQMA 4A5LA 3LZWA 3UTEA 4B68A 4J31A 1VDCA 4ICYA 4KX6A 3NKSA 4JN9A 4J56A 2GF3A 2WDQA 4K5SA 4OVIA 2X8GA 1F8SA 3DJEA 1IUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AD7 B;  4USR A;  2BA9 A;  3OC4 A;  5JCM A;  2GAH B;  5U1O A;  1JRZ A;  2VQ7 A;  4EQR A;  2YWL A;  3FIM B;  3UCL A;  4BUR A;  4U8L A;  4H4U A;  2H88 A;  4NEV A;  1VRQ B;  4IA6 A;  4C5O A;  4AT2 A;  4I58 A;  3BHK A;  2XFO A;  1GRF A;  3K30 A;  2XLS A;  2R9Z A;  3RNM A;  4Z25 A;  1F3P A;  4RG3 A;  3C96 A;  4E0V A;  3CND A;  4TM1 A;  1YQZ A;  4XWR A;  1REO A;  2WHD A;  3NHO X;  4YSH A;  3SFD A;  3AE3 A;  1H86 A;  1TDF A;  3FMW A;  4H4Y A;  4BV6 A;  3LJP A;  4U2L A;  1NPX A;  3IHM A;  3NGC X;  2Y6R A;  2C75 A;  3GD4 A;  1LPF A;  3V3O A;  4D04 A;  3QSM A;  2WP5 A;  2A89 A;  2JB2 A;  3K7M X;  2GH5 A;  1NEK A;  4H4X A;  3D8X A;  4LA1 A;  1DJN A;  1PBC A;  4YXD A;  4IVM B;  4BK3 A;  1NHQ A;  4EQX A;  3C4A A;  4OCG A;  2C67 A;  2YM2 A;  3CTY A;  2RGO A;  3AED A;  4EMW A;  4Z2T A;  2WDR A;  3BNM A;  5FMH A;  1K0J A;  1CJ2 A;  1BF3 A;  1FL2 A;  1ZOV A;  3SFE A;  5M10 A;  1DJQ A;  1EL8 A;  1IUU A;  2YLZ A;  1IUS A;  5KOW A;  2H89 A;  4TM4 A;  3FPZ A;  3LB8 A;  5JCK A;  3EAN A;  2GEW A;  2EQ7 A;  2GRT A;  4Z24 A;  4O5Q A;  1F8R A;  3DH9 A;  1H83 A;  1GXF A;  3IF9 A;  3ATQ A;  2BK4 A;  3AE1 A;  3COX A;  2C65 A;  3VR8 A;  3S5W A;  3AYJ A;  4Z2U A;  5J60 A;  4UDR A;  1BKW A;  2C70 A;  1M64 A;  1Y0P A;  3AE6 A;  3AYL A;  3GWF A;  3KKJ A;  3P4P A;  2YVJ A;  3DGH A;  3KVE A;  3UOV A;  2WDV A;  1GRG A;  2VVL A;  5BRT A;  1ELI A;  3IC9 A;  4OPU A;  1ZMD A;  1ZMC A;  4U8N A;  2V3B A;  3DK9 A;  5KVH A;  2XLT A;  4REK A;  3AD9 B;  1PXB A;  1DOC A;  1GT8 A;  1Y56 B;  2APG A;  2ARD A;  2WET A;  1Q1W A;  3CGB A;  2GV8 A;  2C72 A;  2NVK X;  1TDO A;  1ZY8 A;  2AR8 A;  3SGL A;  2E5V A;  4OPG A;  3AEG A;  3H8L A;  3VR9 A;  4B66 A;  3AE7 A;  2JB3 A;  1QJD A;  4Y4M A;  4JQ9 A;  5JCI A;  2XLU A;  4H4Z A;  1W4X A;  4H4V A;  4MJW A;  3KPF A;  4UDQ A;  3V3N A;  3NK0 X;  4Z43 A;  4CNJ A;  2XDO A;  4CCQ A;  4A7A A;  3EF6 A;  4EIP A;  2QA1 A;  2IID A;  1PN0 A;  1RP0 A;  4BJZ A;  4P9S A;  3B6D A;  1XDI A;  2BS3 A;  3ICT A;  3BI4 A;  1PXA A;  1CJ3 A;  4GR1 A;  4YTP A;  3V76 A;  3DK4 A;  4I59 A;  4H4Q A;  4OPL A;  4J36 A;  2RGJ A;  1GTE A;  4H4R A;  4U2T A;  4U8K A;  1LTX R;  4CCR A;  3ALM A;  1LV0 A;  4UP3 A;  5IQ1 A;  1PHH A;  2YLX A;  3AYI A;  1YQ4 A;  4ZCC A;  2B7R A;  2C66 A;  2OLN A;  2WU5 A;  1K0L A;  3IHG A;  2BCG G;  3O0H A;  4YWO A;  1BZL A;  2X8H A;  2QA2 A;  2XLR A;  3AE8 A;  3GDN A;  3GDP A;  1EBD A;  3URH A;  1IUV A;  3AEE A;  4NTD A;  3CNT A;  4JY2 A;  3SQP A;  4OPI A;  1IUT A;  4A79 A;  5FS8 A;  1E1M A;  4WX1 A;  2B9X A;  4GRT A;  3SM8 A;  4U8M A;  1RSG A;  3UP5 A;  3P4R A;  1KNP A;  5KWF A;  5ER0 A;  2XYO A;  5KXJ A;  1TDK A;  3BHF A;  1Y56 A;  4EM4 A;  1QO8 A;  2Q6U A;  5KVI A;  4B63 A;  1HYU A;  2BCP A;  2JB1 A;  1P2H A;  3CN8 A;  1NG4 A;  1NHS A;  2ZZC A;  4J33 A;  4XXG A;  1B4V A;  1YY5 A;  3NN0 X;  2A87 A;  4U8J A;  1OJD A;  2Q0K A;  2C73 A;  4RG4 A;  2ZZ0 A;  1KNR A;  2JAE A;  4ECH A;  1PBF A;  3JSK A;  1GEU A;  2GB0 A;  1XPQ A;  3CGC A;  2V3A A;  5J7X A;  2O9Z A;  3G5S A;  3OZ2 A;  4USQ A;  4APN A;  5JCN A;  2WQY A;  3DME A;  1KFY A;  1S2Q A;  5BUL A;  4C77 A;  4LU6 A;  3VRB A;  2AQJ A;  2GR1 A;  3BI5 A;  2YG7 A;  3UP4 A;  2WU2 A;  2ZBW A;  4H4S A;  1TDE A;  4OPD A;  1VG9 A;  1B37 A;  1E1L A;  2DKH A;  1NDA A;  4JNQ A;  4U8I A;  1L0V A;  2YLS A;  5KOX A;  4YT0 A;  2C64 A;  2WPF A;  1GAL A;  1GRT A;  3Q6J A;  3NTD A;  3KA7 A;  3UKA A;  1H82 A;  5GSN A;  2BK3 A;  1FEB A;  4K7Z A;  4FDC B;  2RAB A;  5U25 A;  3CPJ G;  3P4S A;  2BYB A;  1PJ7 A;  3I3L A;  4EQS A;  2Q0L A;  5EB4 A;  1GRH A;  4N9X A;  3NYC A;  1K4Q A;  3ADA B;  1GTH A;  4J34 A;  4TM3 A;  3GMB A;  4K22 A;  3GYJ A;  1NHR A;  3LAD A;  1CF3 A;  3NH3 X;  4H4W A;  4B64 A;  4X4J A;  1CC4 A;  2VZ2 A;  3P9U A;  2TPR A;  2WPC A;  3UTH A;  3NT6 A;  5IPY A;  2NPX A;  5KRQ A;  3M12 A;  4B67 A;  3DGZ A;  3ISH A;  4A6N B;  1TRB A;  2GVC A;  2RGH A;  3WE0 A;  2EQ8 A;  2BC1 A;  2XFN A;  2F5Z A;  1PJ6 A;  2BS4 A;  4CBQ A;  1D4C A;  3AEB A;  4K2X A;  1MO9 A;  2VRM A;  4GUV A;  5CKU A;  1YKJ A;  1IUW A;  3ATR A;  1LJ1 A;  3UOX A;  1JNR A;  2FJB A;  1BWC A;  4TM0 A;  2X3N A;  1H6V A;  1ZOY A;  1GRA A;  1PBD A;  1SEZ A;  4JNA A;  3ZDN A;  4A99 A;  1ONF A;  1CL0 A;  4CY6 A;  3UKF A;  3BNU A;  1F8W A;  3QJ4 A;  2JBV A;  2YQU A;  4GF7 A;  3UKK A;  5HXI A;  2Z5X A;  3ITJ A;  4TLZ A;  1FOH A;  2QAE A;  4EIQ A;  2X8C A;  2YLW A;  2BK5 A;  1ZK7 A;  3RP7 A;  1B5Q A;  3PO7 A;  4IV9 A;  1L9D A;  3AE9 A;  3P4Q A;  3DA1 A;  5FS6 A;  1X31 B;  4LII A;  3LOV A;  4NEW A;  1JEH A;  4H4P A;  1E1K A;  3IWA A;  2EQ9 A;  2GAG B;  3CIR A;  1D5T A;  1GND A;  5BVA A;  2R0C A;  4A9W A;  5M0Z A;  1UKV G;  3NIX A;  3LZX A;  1B8S A;  1OJA A;  2Q7V A;  2XVF A;  3PVC A;  4EMJ A;  3FG2 P;  5U63 A;  2J3N A;  1N1P A;  4HB9 A;  2FJD A;  1VG0 A;  2GMJ A;  5FS7 A;  3ZYX A;  2R45 A;  4PAB A;  1KSS A;  1TDN A;  2BXS A;  3AD8 B;  4A6N A;  4JDR A;  5EBK A;  3T37 A;  1N4W A;  1V59 A;  3II4 A;  1TYP A;  3QSE A;  2BAB A;  3CNP A;  5JCL A;  1GER A;  3F8D A;  2XLP A;  1E39 A;  1YQ3 A;  1L9E A;  1F6M A;  3RHA A;  1NHP A;  2AAQ A;  3L1R A;  3H4K A;  2IVE A;  2V61 A;  3RP6 A;  4K5R A;  3NK2 X;  3DJJ A;  1TYT A;  4AOX A;  4H2Q A;  1JRY A;  2BAC A;  4M52 A;  2YR4 A;  5FS9 A;  3CPI G;  5HY5 A;  1RYI A;  1COY A;  4A65 A;  2R46 A;  1OJ9 A;  5C2T A;  4BJY A;  4TLX A;  5LV9 A;  2XVI A;  1FEC A;  1DXL A;  3L8K A;  1EL7 A;  1NEN A;  4C3X A;  3CNJ A;  3NTA A;  1OJT A;  1K0I A;  2ZZB A;  3CGE A;  3ALJ A;  2R4J A;  3EAO A;  2VQB A;  3Q9T A;  3S61 A;  1D7L A;  1PBB A;  4BK2 A;  4UDP A;  1H7W A;  2B76 A;  4H2R A;  1H81 A;  2WP9 A;  4J57 A;  3E1T A;  2VVL G;  4H4T A;  2JKC A;  2C3D A;  1OJC A;  2OLO A;  3GRS A;  1MXT A;  2E1M A;  1AOG A;  3CGD A;  1D4E A;  1GOS A;  2R0P A;  3ICR A;  4YSX A;  2C76 A;  2YLT A;  2WOV A;  2WP6 A;  1JU2 A;  5TR3 A;  2XFQ A;  3M0O A;  2XFU A;  3FBS A;  3KD9 A;  4NTC A;  2WPE A;  3QFA A;  2DKI A;  2TMD A;  2C7G A;  2IVD A;  2BC0 A;  2I0Z A;  2V60 A;  1NAA A;  4KPR A;  3NN6 X;  3GWD A;  3H8I A;  4H7U A;  2OAM A;  4YSY A;  4OPT A;  2YG6 A;  3AB1 A;  1ZKQ A;  4DSG A;  2WS3 A;  1XAN A;  1O5W A;  2YR5 A;  3NRN A;  2CFY A;  3DJG X;  1JRX A;  1KDG A;  3AEC A;  4H50 A;  2PHH A;  2YG4 A;  2YR6 A;  3BI2 A;  1ZDL A;  3D1C A;  1MOK A;  4X9M A;  3GD3 A;  4Z2R A;  5CQF A;  1IJH A;  1O95 A;  1CC2 A;  4O5U A;  2YG3 A;  2E4G A;  4X9N A;  4Z26 A;  1L9C A;  1O94 A;  2XCG A;  3DK8 A;  2CVJ A;  1LQT A;  1N4U A;  4IA5 A;  4CNK A;  2JK6 A;  1XHC A;  5HYM A;  2CUL A;  2V5Z A;  3AE5 A;  4EM3 A;  5HHF A;  1EL9 A;  3UTF A;  3ABV A;  4C74 A;  4GDP A;  3RP8 A;  4DSH A;  4WCT A;  3GSI A;  3KLJ A;  1S2Y A;  3AEF A;  4J2W A;  4PAA A;  4B69 A;  2B7S A;  4U2S A;  2YVG A;  2GR0 A;  2GQW A;  1CHU A;  2VOU A;  1E6E A;  3UOY A;  3NNE A;  2FJE A;  5EOW A;  3VRA A;  2YVF A;  3DJD A;  4HA6 A;  3R9U A;  2EQ6 A;  2R4E A;  4BK1 A;  1FCD A;  4CRT A;  3UOZ A;  4DNA A;  1Q9I A;  1GES A;  4CY8 A;  3QVP A;  1DNC A;  3AE4 A;  4Z44 A;  2GMH A;  4YKG A;  2YAU A;  3VQR A;  2GQF A;  1GET A;  1NG3 A;  1S3B A;  4ZCD A;  4B65 A;  2FBW A;  2V6O A;  1VQW A;  1CC6 A;  3AXB A;  1FEA A;  2C3C A;  3CPH G;  4AOS A;  4XWZ A;  4YKF A;  4RSL A;  4NZH A;  3I6D A;  3G5Q A;  3P1W A;  3B3R A;  1ZX9 A;  2ACZ A;  2YM1 A;  5EB5 A;  2X50 A;  2GR3 A;  4OPC A;  1EL5 A;  3F8P A;  3NK1 X;  3F8R A;  3NYE A;  2W0H A;  4JY3 A;  3GYI A;  5GRT A;  4U8P A;  3G5R A;  2X99 A;  3NLC A;  2PYX A;  3UKQ A;  4ZN0 A;  3PS9 A;  2CDU A;  4YTM A;  1BGJ A;  1M6I A;  2GR2 A;  4FK1 A;  1GPE A;  4AP3 A;  4FX9 A;  4GDE A;  4AP1 A;  1DOD A;  1GV4 A;  1H7X A;  1CBO A;  4K8D A;  1DOE A;  2Y6Q A;  2B9Y A;  2UZZ A;  5C3J A;  2WBA A;  1GRB A;  2QCU A;  4FK1 C;  1H84 A;  2B9W A;  4D03 A;  5L46 A;  3GRT A;  3NG7 X;  1D7Y A;  2FJA A;  4YTN A;  1GRE A;  2WEU A;  5IQ4 A;  1Q1R A;  3AE2 A;  4IVO B;  3UKL A;  3ICS A;  3KU9 A;  1PDH A;  3CNS A;  1Z6L A;  3K7Q X;  4C3Y A;  4AT0 A;  3NYF A;  1GSN A;  2XVJ A;  1PXC A;  2R0G A;  3M13 A;  3QSS A;  1JOA A;  4Y4N A;  1S3E A;  1DOB A;  3QVR A;  1KF6 A;  3EPT A;  1CJC A;  4NTE A;  3UKP A;  3UTG A;  1LQU A;  3VRD B;  4ADW A;  2WOI A;  4YSZ A;  2OA1 A;  4EQW A;  4EMI A;  4Y4L A;  1PJ5 A;  1P2E A;  1KSU A;  1QLB A;  5DBJ A;  4U8O A;  3ALL A;  3GMC A;  4B1B A;  5BUK A;  3K7T A;  3HZL A;  2WOW A;  1BGN A;  1CJ4 A;  2XVE A;  2BS2 A;  2OAL A;  3UKH A;  1D4D A;  1ZP0 A;  2BXR A;  2XVH A;  1N4V A;  3QFB A;  1PBE A;  1PS9 A;  3RED A;  2VRL A;  4H2N A;  4H2P A;  3AWI A;  1E7P A;  2Z5Y A;  1JNZ A;  2YLR A;  4GCM A;  4DGK A;  2YG5 A;  3LXD A;  2A8X A;  2VVM A;  3AEA A;  1E1N A;  2XFP A;  3C4N A;  1LVL A;  2WES A;  2HQM A;  4A5L A;  3LZW A;  3UTE A;  4B68 A;  4J31 A;  1VDC A;  4ICY A;  4KX6 A;  3NKS A;  4JN9 A;  4J56 A;  2GF3 A;  2WDQ A;  4K5S A;  4OVI A;  2X8G A;  1F8S A;  3DJE A;  1IUX A; 
#chains in the Genus database with same CATH topology
 4H1Z A;  2ONE A;  2GAH B;  3DG6 A;  2YWL A;  4U8L A;  4H4U A;  3U4F A;  1VRQ B;  4AT2 A;  2XLS A;  2R9Z A;  3RNM A;  4Z25 A;  1F3P A;  4E0V A;  3C96 A;  3SZC A;  1REO A;  3FMW A;  3ZVH B;  4HCD A;  4U2L A;  1NPX A;  3GD4 A;  1LPF A;  1W6T A;  2GH5 A;  1SJD A;  4YXD A;  4BK3 A;  3AN1 A;  2C67 A;  3BNM A;  1EL8 A;  1IUU A;  3SX6 A;  5JCK A;  3MUC A;  2GGH A;  4UDR A;  1BKW A;  1Y0P A;  1MRA A;  2FKP A;  4OPU A;  4U8N A;  2PU0 A;  2V3B A;  3DK9 A;  4REK A;  3TOY A;  1PXB A;  3PWI A;  1DOC A;  1Y56 B;  2ARD A;  1N5X A;  2C72 A;  1MNS A;  2NVK X;  2E5V A;  2OO6 A;  3H8L A;  3HYV A;  2XLU A;  4H4V A;  4MJW A;  3V3N A;  4CNJ A;  4CCQ A;  3MSY A;  2QA1 A;  1CJ3 A;  4GR1 A;  4I59 A;  4OPL A;  4U2T A;  1T3Q C;  3ALM A;  3H8A A;  2WU5 A;  5BUK A;  2BCG G;  4YWO A;  3URH A;  4NTD A;  4JY2 A;  1IUT A;  1E1M A;  5KXJ A;  4II3 A;  4B63 A;  4G9K A;  2JB1 A;  3CN8 A;  1NG4 A;  4XXG A;  1B4V A;  3R0K A;  2A87 A;  2PMQ A;  1OJD A;  4RG4 A;  1KNR A;  1PBF A;  1GEU A;  3CGC A;  3G5S A;  4H19 A;  1N63 C;  4LU6 A;  2AQJ A;  3FYY A;  3OTR A;  3UP4 A;  2ZBW A;  1TDE A;  1ONE A;  1B37 A;  1E1L A;  1GRT A;  3Q6J A;  3UJR A;  1FEB A;  3QTP A;  2RAB A;  3CPJ G;  4G8T A;  3I3L A;  2OPJ A;  2Q0L A;  3UXK A;  3NYC A;  1K4Q A;  3GYJ A;  4B64 A;  4X4J A;  2PTZ A;  3RIT A;  5KRQ A;  3M12 A;  4B67 A;  3DGZ A;  3PFR A;  2EQ8 A;  1D4C A;  3ATR A;  2DW7 A;  1PDZ A;  5FJP A;  2FJB A;  3V3W A;  5FJT A;  3VA8 A;  1BQG A;  2Z5X A;  2GGE A;  4EIQ A;  3TTE A;  3AE9 A;  3DA1 A;  4NEW A;  3IWA A;  2EQ9 A;  2GAG B;  3CIR A;  1GND A;  4F4R A;  1B8S A;  3PVC A;  1N1P A;  5FS7 A;  3AD8 B;  1TDN A;  3RO6 A;  4JDR A;  5KMQ A;  1TYP A;  3VCC A;  2I5Q A;  3QSE A;  1GER A;  3H4K A;  3CXB A;  3RP6 A;  3NZG A;  4K5R A;  3DJJ A;  2BAC A;  2YR4 A;  1FO4 A;  5FS9 A;  5HY5 A;  2OG9 A;  4TLX A;  2XVI A;  1FEC A;  1JCT A;  1OJT A;  2VQB A;  1F9C A;  4GGB A;  1D7L A;  3GYX A;  4BK2 A;  3E1T A;  4H4T A;  3DFY A;  1D4E A;  2YLT A;  2WP6 A;  3R25 A;  5TR3 A;  3M0O A;  2DKI A;  1VDV A;  3JW7 A;  2V60 A;  1NAA A;  3H8I A;  3DG3 A;  4YSY A;  2YG6 A;  3T9P A;  1ZKQ A;  4DSG A;  2YR5 A;  1XAN A;  1O5W A;  1JRX A;  4HNL A;  4H50 A;  2PHH A;  4Z2R A;  3GD3 A;  1IJH A;  2YG3 A;  2E4G A;  4X9N A;  1L9C A;  2CVJ A;  1XHC A;  2W54 A;  4WCT A;  3GSI A;  4J2W A;  4PAA A;  2GR0 A;  3A7U A;  1X2G A;  3NNE A;  3DJD A;  3R9U A;  4BK1 A;  4DNA A;  2GMH A;  4YKG A;  2GQF A;  1GET A;  3AXB A;  1VQW A;  4AOS A;  2C3C A;  3EEZ A;  4NZH A;  3I6D A;  1OEP A;  2GR3 A;  4GME A;  3NYE A;  2W0H A;  5GRT A;  4Z1Y A;  3UCD A;  2XH7 A;  2QJJ A;  2PYX A;  2XGZ A;  3PS9 A;  1RVK A;  4FK1 A;  3AM9 A;  1GV4 A;  5KNL A;  5EU9 A;  2WBA A;  2QCU A;  2XH4 A;  3ZVH A;  4D03 A;  3NG7 X;  1D7Y A;  2FJA A;  5ENL A;  3UKL A;  2GGJ A;  2XVJ A;  1PXC A;  3QSS A;  1JOA A;  4KT2 A;  1DOB A;  1CJC A;  2HXT A;  4A35 A;  1LQU A;  3VRD B;  2OX4 A;  4U8O A;  3GMC A;  4B1B A;  3OP2 A;  3ZVI A;  2WOW A;  2XVE A;  2BXR A;  2PTX A;  3Q4D A;  2VRL A;  4H2N A;  3TWA A;  3LXD A;  2VVM A;  4DHG A;  1LVL A;  3ES8 A;  4KX6 A;  3H7V A;  4JN9 A;  4OVI A;  1F8S A;  1IUX A;  3AD7 B;  4USR A;  3BJS A;  2VQ7 A;  3D46 A;  3FIM B;  3PWG A;  1KKO A;  3UCL A;  2P0I A;  4NEV A;  2XSX A;  3RR1 A;  3RCY A;  4I58 A;  3K30 A;  2OFJ A;  2OQY A;  4TM1 A;  2MUC A;  3V4B A;  3SN1 A;  3IHM A;  2C75 A;  3I6E A;  3QSM A;  5BOF A;  1NEK A;  1MDR A;  4LA1 A;  3UCC A;  4IVM B;  3FJ4 A;  4OCG A;  1JRO A;  1R0M A;  1KD0 A;  4Z2T A;  1BF3 A;  1V97 A;  1DJQ A;  2YLZ A;  1FFV C;  2GRT A;  4Z24 A;  5KMR A;  3IF9 A;  2AL2 A;  3ATQ A;  2BK4 A;  3AE1 A;  1N61 C;  4A6G A;  3VR8 A;  1FHU A;  3AE6 A;  3KKJ A;  2YVJ A;  3DGH A;  3KVE A;  2WDV A;  4ENL A;  2HZG A;  5BRT A;  3A7R A;  2AL1 A;  5FJO A;  1GT8 A;  1Q1W A;  2ZC8 A;  3CGB A;  3OZY A;  2AR8 A;  4OPG A;  4Y4M A;  2HXU A;  3JVA A;  4UDQ A;  3NVW B;  3KPF A;  2IID A;  3SR6 B;  1PXA A;  2PTY A;  1LV0 A;  2YLX A;  1YQ4 A;  2OLN A;  1SJB A;  2XLR A;  3GDP A;  3GDN A;  1EBD A;  1IUV A;  4IHC A;  5FS8 A;  2AKM A;  2GL5 A;  3SM8 A;  5KWF A;  1KNP A;  2XYO A;  1N62 C;  3P0W A;  2C4C A;  4JHM A;  3BHF A;  4EM4 A;  5KVI A;  1P48 A;  2BCP A;  3OPS A;  1NHS A;  1XPY A;  3SYI A;  3NN0 X;  4U8J A;  2C73 A;  2ZZ0 A;  1XPQ A;  3NXL A;  3OZ2 A;  1KFY A;  1S2Q A;  5BUL A;  3VC6 A;  2YG7 A;  2WU2 A;  4G6G A;  1NDA A;  3BSM A;  2DW6 A;  3DIP A;  3KA7 A;  3KPK A;  3CAW A;  3N4E A;  3P4S A;  5EB4 A;  4N9X A;  1IYX A;  1KCZ A;  2QDE A;  3GMB A;  1CF3 A;  3LAD A;  3NH3 X;  4H4W A;  1CC4 A;  3P9U A;  2TPR A;  3ISH A;  2RGH A;  3WE0 A;  1PJ6 A;  2BS4 A;  4K2X A;  3OZM A;  5CKU A;  1SB3 B;  2E5A A;  3FXG A;  3T14 A;  1MDL A;  4TM0 A;  3SZW A;  1H6V A;  3CXO A;  3ZDN A;  2PP1 A;  1EBH A;  3UKF A;  1F8W A;  3QJ4 A;  2JBV A;  3A7A A;  2QAE A;  3T2K A;  2YLW A;  3PO7 A;  4IV9 A;  2BRA A;  5FS6 A;  2PA6 A;  5BVA A;  5G5G B;  2NQL A;  3SJN A;  2Q7V A;  2XVF A;  4HB9 A;  2GMJ A;  4PAB A;  1KSS A;  4A6N A;  3T8Q A;  1N4W A;  3TW9 A;  1V59 A;  3II4 A;  3CNP A;  3F8D A;  2XLP A;  3RHA A;  1NHP A;  3L1R A;  2V61 A;  4TVW A;  4X2P A;  4AOX A;  3CPI G;  3H12 A;  1COY A;  4A65 A;  2R46 A;  1ECQ A;  3CT2 A;  3ZLH A;  3CNJ A;  3HPF A;  3ALJ A;  3EAO A;  4E4U A;  3Q9T A;  3S61 A;  3MZN A;  2PCE A;  4UDP A;  4H2R A;  2JKC A;  3D47 A;  2C3D A;  1OJC A;  3GRS A;  1MXT A;  3ICR A;  2R0P A;  5FJR A;  3U9I A;  1JU2 A;  3QFA A;  3NN6 X;  4H7U A;  2BC0 A;  2PP3 A;  4KPR A;  3AMZ A;  4OPT A;  3AB1 A;  3AEC A;  1S7M A;  3H70 A;  3BI2 A;  1ZDL A;  3D1C A;  4ZCW A;  4X9M A;  1CC2 A;  2PSN A;  5BOE A;  1O94 A;  3DK8 A;  2JK6 A;  2CUL A;  3AE5 A;  4EM3 A;  3RP8 A;  4GAP A;  2XH0 A;  3KLJ A;  2GQW A;  2VOU A;  3UOY A;  2FJE A;  5EOW A;  2PGE A;  4GIS A;  2YVF A;  2R4E A;  3UOZ A;  1GES A;  4CY8 A;  3AE4 A;  2YAU A;  3SQS A;  3VQR A;  1S3B A;  1NG3 A;  4B65 A;  2V6O A;  4YKF A;  2OZ8 A;  3IJL A;  3G5Q A;  2ACZ A;  2YM1 A;  5EB5 A;  2PS2 A;  4OPC A;  4JY3 A;  3GYI A;  4GYP A;  1GPE A;  4AP1 A;  1DOD A;  1H7X A;  4K8D A;  1DOE A;  2B9Y A;  1GRB A;  1H84 A;  5L46 A;  3GRT A;  3SZF A;  5IQ4 A;  1Q1R A;  3ICS A;  3TCS A;  3GO2 A;  1GSN A;  3RRA A;  2PU1 A;  2W3S A;  3TJ4 A;  2WOI A;  4MGG A;  4EQW A;  4EMI A;  1PJ5 A;  3L5O A;  1KSU A;  1QLB A;  1FHV A;  3ALL A;  3VFC A;  2O56 A;  3UKH A;  2BS2 A;  5JRB A;  3ETR B;  4HPN A;  2XVH A;  1SJC A;  3V5F A;  3V5C A;  1N4V A;  1PS9 A;  4DYE A;  2Z5Y A;  2YLR A;  4G6H A;  4DGK A;  2YG5 A;  4J3Z A;  1BKH A;  3FV9 A;  2XFP A;  4A3R A;  2FYM A;  2HQM A;  3S47 A;  3NKS A;  4K5S A;  2X8G A;  5JCM A;  5U1O A;  1JRZ A;  3SXI A;  3NS1 B;  6ENL A;  3K1G A;  2H88 A;  2XFO A;  1GRF A;  4RG3 A;  1YQZ A;  3ES7 A;  4XWR A;  2WHD A;  3NHO X;  4YSH A;  2PPG A;  3AE3 A;  3VCN A;  4FI4 A;  4H4Y A;  4BV6 A;  3LJP A;  1KKR A;  2Y6R A;  3V3O A;  2WP5 A;  3K7M X;  4H4X A;  1DJN A;  1PBC A;  4E6M A;  3IJI A;  3CTY A;  1TKK A;  2RGO A;  3AED A;  5FMH A;  1K0J A;  1FL2 A;  1ZOV A;  5M10 A;  1IUS A;  4TM4 A;  3FPZ A;  3TQP A;  2EQ7 A;  4O5Q A;  3R0U A;  3DH9 A;  3IJQ A;  1H83 A;  3T0K A;  3FCP A;  3AYJ A;  3DGB A;  2C70 A;  3P4P A;  3AYL A;  4KWS A;  2VVL A;  5KMS A;  1ELI A;  3IC9 A;  4JN8 A;  1ZMD A;  1ZMC A;  5KVH A;  1H2I A;  3STP A;  2WET A;  2OQH A;  1TDO A;  3SGL A;  2W55 A;  3VR9 A;  4B66 A;  2JB3 A;  1QJD A;  3CYJ A;  4JQ9 A;  5JCI A;  4H4Z A;  1W4X A;  3R1Z A;  4Z43 A;  4EIP A;  3EF6 A;  4BJZ A;  2POD A;  3MQT A;  4P9S A;  3B6D A;  3ICT A;  4KEM A;  3BI4 A;  7ENL A;  4YTP A;  3V76 A;  3DK4 A;  1VQZ A;  1GTE A;  3P93 A;  4U8K A;  1LTX R;  3QLD A;  1PHH A;  3AYI A;  2B7R A;  4IP5 A;  3IHG A;  1K0L A;  4IL0 A;  3O0H A;  5KOW A;  1BZL A;  2X8H A;  3CNT A;  3SQP A;  4E4F A;  4WX1 A;  4GRT A;  5ER0 A;  1SJA A;  3SN4 A;  1Y56 A;  2Q6U A;  3KUM A;  2ZAD A;  3T31 A;  1P2H A;  4J33 A;  2ZZC A;  1EC9 A;  4G7F A;  4ECH A;  2GB0 A;  4H2H A;  4USQ A;  2QJM A;  2WQY A;  3DME A;  4OPD A;  1VG9 A;  2PGW A;  4U8I A;  1L0V A;  2YLS A;  4YT0 A;  3HYX A;  2WPF A;  1GAL A;  3NTD A;  3UKA A;  1TZZ A;  4K1W A;  5GSN A;  5U25 A;  3T4W A;  2BYB A;  4EQS A;  3CK5 A;  5J04 A;  3ADA B;  4J34 A;  3S5S A;  3UTH A;  3T6C A;  5IPY A;  3NT6 A;  2NPX A;  3PG6 A;  3GY1 A;  3VC5 A;  2BC1 A;  2XFN A;  4CBQ A;  4ZA0 A;  1MO9 A;  3I6T A;  2VRM A;  1YKJ A;  1LJ1 A;  1JNR A;  3SZ0 A;  1EC8 A;  1ZOY A;  4IP4 A;  1CL0 A;  1WYG A;  5HXI A;  5G5H B;  1ZK7 A;  1B5Q A;  1L9D A;  4GIR A;  1XS2 A;  1X31 B;  3LOV A;  1WUF A;  1E1K A;  2R0C A;  4A9W A;  3NIX A;  4EMJ A;  2J3N A;  3HRD C;  3ZYX A;  2R45 A;  3T37 A;  4ZOH B;  3RGT A;  2BAB A;  3CB3 A;  5JCL A;  3UJ2 A;  1E39 A;  1JPM A;  2GGG A;  2IVE A;  3PK7 A;  4NWZ A;  3NK2 X;  4M52 A;  4IT1 A;  3NFU A;  4G74 A;  1YEY A;  1DXL A;  3SSZ A;  2OLA A;  3NTA A;  2ZZB A;  4DXK A;  1PBB A;  1H7W A;  2B76 A;  1H81 A;  2WP9 A;  1AOG A;  1GOS A;  4YSX A;  2QJN A;  4YWS A;  2XFQ A;  2XFU A;  3KD9 A;  2IVD A;  2C7G A;  2I0Z A;  3N6J A;  4E5T A;  2WS3 A;  3NRN A;  3DJG X;  1KDG A;  4KPL A;  5CQF A;  1O95 A;  5IDZ A;  3DG7 A;  4Z26 A;  4NNJ A;  2XCG A;  1LQT A;  1N4U A;  4IA5 A;  4CNK A;  2QQ6 A;  3R07 C;  5HHF A;  4C74 A;  3BOX A;  4DSH A;  1S2Y A;  2AKZ A;  2B7S A;  4U2S A;  1E6E A;  3TJI A;  4DWD A;  3NRZ B;  3UJS A;  4HA6 A;  2EQ6 A;  1FCD A;  2BRY A;  4CRT A;  1Q9I A;  3QVP A;  1DNC A;  4EWJ A;  4ZCD A;  3Q45 A;  1FEA A;  4XWZ A;  3P1W A;  1KN0 A;  1EBG A;  2X50 A;  3NK1 X;  2GSH A;  3G5R A;  4ZN0 A;  1BGJ A;  2GR2 A;  4FX9 A;  4GDE A;  2Y6Q A;  5C3J A;  4FK1 C;  1TE6 A;  4E8G A;  1GRE A;  3AE2 A;  3KU9 A;  1PDH A;  3CNS A;  3K7Q X;  4AT0 A;  3NYF A;  1S3E A;  3QVR A;  3ENL A;  1KF6 A;  4NTE A;  2QGY A;  3UTG A;  2PTW A;  3DDM A;  4ADW A;  4YSZ A;  2OA1 A;  1P2E A;  5DBJ A;  4G73 A;  3K7T A;  3HZL A;  1BGN A;  4JN7 A;  3SY4 A;  3QFB A;  4H2P A;  4GAV A;  1X2H A;  3MKC A;  3R10 A;  3N4F A;  1EC7 A;  3NVZ B;  1E1N A;  3C4N A;  3LZW A;  4B68 A;  2WDQ A;  3DJE A;  2BA9 A;  3T2Z A;  3OC4 A;  3ZLF A;  4EQR A;  2PP0 A;  4BUR A;  2AL2 B;  1ELS A;  4IA6 A;  1NU5 A;  4C5O A;  3BHK A;  3CND A;  3I4K A;  3SFD A;  4J1O A;  4HNC A;  2OVL A;  1H86 A;  1TDF A;  3NGC X;  4D04 A;  2A89 A;  2JB2 A;  3FVD A;  3D8X A;  1NHQ A;  4EQX A;  3C4A A;  3DFH A;  2YM2 A;  4HYR A;  3MWC A;  4EMW A;  2WDR A;  1CJ2 A;  1RM6 B;  3SFE A;  3UJF A;  3QN3 A;  2H89 A;  3LB8 A;  2GEW A;  3EAN A;  1F8R A;  1GXF A;  3COX A;  3VDG A;  2C65 A;  2OZT A;  3S5W A;  4Z2U A;  5J60 A;  1M64 A;  3UOV A;  3GWF A;  1GRG A;  3T2Y A;  2XLT A;  3AD9 B;  4H83 A;  4DN1 A;  2APG A;  2GV8 A;  4GFI A;  1ZY8 A;  3AEG A;  3JZU A;  3AE7 A;  3THU A;  1MUC A;  3IK4 A;  3NK0 X;  2XDO A;  4A7A A;  3QKE A;  4K2S A;  1PN0 A;  1RP0 A;  1XDI A;  2BS3 A;  2P88 A;  4H4Q A;  4J36 A;  2RGJ A;  4H4R A;  4CCR A;  4UP3 A;  5IQ1 A;  2MNR A;  4ZCC A;  2C66 A;  2QA2 A;  3AE8 A;  3AEE A;  4A79 A;  1L8P A;  4OPI A;  3ZLG A;  2B9X A;  4U8M A;  1RSG A;  3UP5 A;  3P4R A;  2W3R A;  1TDK A;  1QO8 A;  1HYU A;  4TVY A;  3B9J B;  4DX3 A;  1YY5 A;  2Q0K A;  2XH2 A;  5FJU A;  2JAE A;  3JSK A;  3OW1 A;  3NO1 A;  5KMP A;  2V3A A;  5J7X A;  2O9Z A;  4APN A;  5JCN A;  4Z17 A;  4C77 A;  3VRB A;  2GR1 A;  3BI5 A;  4H4S A;  2DKH A;  1FIQ B;  4JNQ A;  5KOX A;  2C64 A;  4IL2 A;  1H82 A;  2BK3 A;  4K7Z A;  4FDC B;  2GDQ A;  1PJ7 A;  1GRH A;  1GTH A;  4TM3 A;  4K22 A;  1NHR A;  1NEL A;  4II2 A;  2VZ2 A;  2WPC A;  2P3Z A;  4GGH A;  4A6N B;  1TRB A;  2GVC A;  2F5Z A;  2QDD A;  3AEB A;  4HCL A;  4GUV A;  3NVY B;  1IUW A;  4K8G A;  3UOX A;  3DER A;  3UGV A;  1BWC A;  2X3N A;  1GRA A;  1PBD A;  1SEZ A;  4JNA A;  4A99 A;  1ONF A;  4CY6 A;  4FP1 A;  3BNU A;  4GF7 A;  3UKK A;  2P8B A;  2YQU A;  3HYW A;  3ITJ A;  4TLZ A;  1FOH A;  2X8C A;  3UXL A;  3RP7 A;  3DES A;  2BK5 A;  3P3B A;  3P4Q A;  4LII A;  1JEH A;  4H4P A;  1D5T A;  1DTN A;  5M0Z A;  1UKV G;  3LZX A;  1OJA A;  3NVV B;  5U63 A;  3FG2 P;  1N60 C;  2FJD A;  1VG0 A;  2BXS A;  5EBK A;  1N5W C;  1JPD X;  2OKT A;  1YQ3 A;  1L9E A;  1F6M A;  2AAQ A;  1TYT A;  4H2Q A;  1JRY A;  4HCH A;  1RYI A;  1OJ9 A;  5C2T A;  4BJY A;  5LV9 A;  2P8C A;  3L8K A;  4ROP A;  1EL7 A;  1NEN A;  4C3X A;  2OZ3 A;  1K0I A;  3CGE A;  2RDX A;  2R4J A;  1P43 A;  4J57 A;  3DEQ A;  2VVL G;  2OLO A;  2E1M A;  3CGD A;  4MKS A;  2C76 A;  2WOV A;  1JDF A;  4NTC A;  3FBS A;  2POZ A;  2WPE A;  2TMD A;  3HW2 A;  1ZXI C;  3GWD A;  2OAM A;  3QPE A;  1JRP A;  2CFY A;  2YR6 A;  2YG4 A;  1MOK A;  3SBF A;  4O5U A;  1E9I A;  1FFU C;  5HYM A;  2V5Z A;  1EL9 A;  3UTF A;  3ABV A;  4GDP A;  3D9X A;  3UJE A;  3AEF A;  4B69 A;  2YVG A;  1CHU A;  3VRA A;  4Z44 A;  3EUB 3;  3EKG A;  4MMW A;  3TWB A;  2FBW A;  1CC6 A;  3CPH G;  2HNE A;  2GGI A;  4RSL A;  3B3R A;  1ZX9 A;  1EL5 A;  3F8P A;  3F8R A;  3R11 A;  4U8P A;  2X99 A;  3NLC A;  3UKQ A;  2CDU A;  4YTM A;  3N6H A;  1M6I A;  3B97 A;  2QVH A;  4AP3 A;  1CBO A;  3MY9 A;  4GYP C;  2E3T A;  2UZZ A;  3GC2 A;  3SN0 A;  2B9W A;  4YTN A;  2WEU A;  4IVO B;  1R6W A;  1Z6L A;  4C3Y A;  4HN8 A;  2R0G A;  1PDY A;  3M13 A;  4Y4N A;  3EPT A;  3UKP A;  4IZG A;  4Y4L A;  3GD6 A;  4M0X A;  1STZ A;  1CJ4 A;  3CMM A;  2OAL A;  1D4D A;  1ZP0 A;  1PBE A;  3RED A;  3AWI A;  4M6U A;  1E7P A;  1JNZ A;  4GCM A;  2A8X A;  3AEA A;  2CHR A;  2WES A;  4A5L A;  3UTE A;  4J31 A;  1VDC A;  4ICY A;  1WUE A;  4J56 A;  2GF3 A; 
#chains in the Genus database with same CATH homology
 3AD7 B;  4USR A;  2BA9 A;  3T2Z A;  3OC4 A;  5JCM A;  2GAH B;  5U1O A;  1JRZ A;  3SXI A;  2VQ7 A;  4EQR A;  2YWL A;  3FIM B;  3UCL A;  4BUR A;  4U8L A;  4H4U A;  2H88 A;  4NEV A;  1VRQ B;  4IA6 A;  4C5O A;  4AT2 A;  4I58 A;  3BHK A;  2XFO A;  1GRF A;  3K30 A;  2XLS A;  2R9Z A;  3RNM A;  4Z25 A;  1F3P A;  4RG3 A;  3C96 A;  4E0V A;  3CND A;  4TM1 A;  1YQZ A;  4XWR A;  1REO A;  3SZC A;  2WHD A;  3NHO X;  4YSH A;  3SFD A;  3AE3 A;  1H86 A;  1TDF A;  3FMW A;  4H4Y A;  4BV6 A;  3LJP A;  4U2L A;  1NPX A;  3IHM A;  3NGC X;  2Y6R A;  2C75 A;  3GD4 A;  1LPF A;  3V3O A;  4D04 A;  3QSM A;  2WP5 A;  2A89 A;  2JB2 A;  3K7M X;  2GH5 A;  1NEK A;  4H4X A;  3D8X A;  4LA1 A;  1DJN A;  1PBC A;  4YXD A;  4IVM B;  4BK3 A;  1NHQ A;  4EQX A;  3C4A A;  4OCG A;  2C67 A;  2YM2 A;  3CTY A;  2RGO A;  3AED A;  4EMW A;  4Z2T A;  2WDR A;  3BNM A;  5FMH A;  1K0J A;  1CJ2 A;  1BF3 A;  1FL2 A;  1ZOV A;  3SFE A;  5M10 A;  1DJQ A;  1EL8 A;  1IUU A;  2YLZ A;  1IUS A;  3SX6 A;  5KOW A;  2H89 A;  4TM4 A;  3FPZ A;  3LB8 A;  5JCK A;  3EAN A;  2GEW A;  2EQ7 A;  2GRT A;  4Z24 A;  4O5Q A;  1F8R A;  5KMR A;  3DH9 A;  1H83 A;  1GXF A;  3IF9 A;  3T0K A;  3ATQ A;  2BK4 A;  3AE1 A;  3COX A;  2C65 A;  3VR8 A;  3S5W A;  3AYJ A;  4Z2U A;  5J60 A;  4UDR A;  1BKW A;  2C70 A;  1M64 A;  1Y0P A;  3AE6 A;  3AYL A;  3GWF A;  3KKJ A;  3P4P A;  2YVJ A;  3DGH A;  3KVE A;  3UOV A;  2WDV A;  1GRG A;  2VVL A;  5BRT A;  1ELI A;  3IC9 A;  5KMS A;  4OPU A;  1ZMD A;  1ZMC A;  3T2Y A;  4U8N A;  2V3B A;  3DK9 A;  5KVH A;  2XLT A;  4REK A;  1H2I A;  3AD9 B;  1PXB A;  1DOC A;  1GT8 A;  1Y56 B;  2APG A;  2ARD A;  2WET A;  1Q1W A;  3CGB A;  2GV8 A;  2C72 A;  2NVK X;  1TDO A;  1ZY8 A;  2AR8 A;  3SGL A;  2E5V A;  4OPG A;  3AEG A;  3H8L A;  3VR9 A;  4B66 A;  3AE7 A;  3HYV A;  2JB3 A;  1QJD A;  4Y4M A;  4JQ9 A;  5JCI A;  2XLU A;  4H4Z A;  1W4X A;  4H4V A;  4MJW A;  3KPF A;  4UDQ A;  3V3N A;  3NK0 X;  4Z43 A;  4CNJ A;  2XDO A;  4CCQ A;  4A7A A;  3EF6 A;  4EIP A;  2QA1 A;  2IID A;  1PN0 A;  1RP0 A;  4BJZ A;  4P9S A;  3B6D A;  1XDI A;  2BS3 A;  3ICT A;  3BI4 A;  1PXA A;  1CJ3 A;  4GR1 A;  4YTP A;  3V76 A;  3DK4 A;  4I59 A;  4H4Q A;  4OPL A;  4J36 A;  2RGJ A;  1GTE A;  4H4R A;  4U2T A;  4U8K A;  1LTX R;  4CCR A;  3ALM A;  1LV0 A;  4UP3 A;  5IQ1 A;  1PHH A;  2YLX A;  3AYI A;  1YQ4 A;  4ZCC A;  2B7R A;  2C66 A;  2OLN A;  2WU5 A;  1K0L A;  3IHG A;  2BCG G;  3O0H A;  4YWO A;  1BZL A;  2X8H A;  2QA2 A;  2XLR A;  3AE8 A;  3GDN A;  3GDP A;  1EBD A;  3URH A;  1IUV A;  3AEE A;  4NTD A;  3CNT A;  4JY2 A;  3SQP A;  4OPI A;  1IUT A;  4A79 A;  5FS8 A;  1E1M A;  4WX1 A;  2B9X A;  4GRT A;  3SM8 A;  4U8M A;  1RSG A;  3UP5 A;  3P4R A;  1KNP A;  5KWF A;  5ER0 A;  2XYO A;  2C4C A;  5KXJ A;  1TDK A;  3BHF A;  1Y56 A;  4EM4 A;  1QO8 A;  2Q6U A;  5KVI A;  4II3 A;  4B63 A;  1HYU A;  4G9K A;  2BCP A;  3T31 A;  2JB1 A;  1P2H A;  3CN8 A;  1NG4 A;  1NHS A;  2ZZC A;  4J33 A;  4XXG A;  3SYI A;  1B4V A;  1YY5 A;  3NN0 X;  2A87 A;  4U8J A;  1OJD A;  2Q0K A;  2C73 A;  4RG4 A;  2ZZ0 A;  1KNR A;  2JAE A;  4ECH A;  1PBF A;  3JSK A;  1GEU A;  2GB0 A;  5KMP A;  1XPQ A;  3CGC A;  2V3A A;  5J7X A;  2O9Z A;  3G5S A;  3OZ2 A;  4USQ A;  4APN A;  5JCN A;  2WQY A;  3DME A;  1KFY A;  1S2Q A;  5BUL A;  4C77 A;  4LU6 A;  3VRB A;  2AQJ A;  2GR1 A;  3BI5 A;  2YG7 A;  3UP4 A;  2WU2 A;  2ZBW A;  4G6G A;  4H4S A;  1TDE A;  4OPD A;  1VG9 A;  1B37 A;  1E1L A;  2DKH A;  1NDA A;  4JNQ A;  4U8I A;  1L0V A;  2YLS A;  5KOX A;  4YT0 A;  2C64 A;  3HYX A;  2WPF A;  1GAL A;  1GRT A;  3Q6J A;  3NTD A;  3KA7 A;  3KPK A;  3UKA A;  1H82 A;  5GSN A;  2BK3 A;  1FEB A;  4K7Z A;  4FDC B;  2RAB A;  5U25 A;  3CPJ G;  3P4S A;  2BYB A;  1PJ7 A;  3I3L A;  4EQS A;  2Q0L A;  5EB4 A;  1GRH A;  4N9X A;  3NYC A;  1K4Q A;  3ADA B;  1GTH A;  4J34 A;  4TM3 A;  3GMB A;  4K22 A;  3GYJ A;  1NHR A;  3LAD A;  1CF3 A;  3NH3 X;  4H4W A;  4II2 A;  4B64 A;  4X4J A;  1CC4 A;  2VZ2 A;  3P9U A;  2TPR A;  2WPC A;  3UTH A;  3NT6 A;  5IPY A;  2NPX A;  5KRQ A;  3M12 A;  4B67 A;  3PG6 A;  3DGZ A;  3ISH A;  4A6N B;  1TRB A;  2GVC A;  2RGH A;  3WE0 A;  2EQ8 A;  2BC1 A;  2XFN A;  2F5Z A;  1PJ6 A;  2BS4 A;  4CBQ A;  1D4C A;  3AEB A;  4K2X A;  1MO9 A;  2VRM A;  4GUV A;  5CKU A;  1YKJ A;  1IUW A;  3T14 A;  3ATR A;  1LJ1 A;  3UOX A;  1JNR A;  2FJB A;  1BWC A;  3SZ0 A;  4TM0 A;  2X3N A;  3SZW A;  1H6V A;  1ZOY A;  1GRA A;  1PBD A;  1SEZ A;  4JNA A;  3ZDN A;  4A99 A;  1ONF A;  1CL0 A;  4CY6 A;  3UKF A;  3BNU A;  1F8W A;  3QJ4 A;  2JBV A;  2YQU A;  4GF7 A;  3UKK A;  3HYW A;  5HXI A;  2Z5X A;  3ITJ A;  4TLZ A;  1FOH A;  2QAE A;  3T2K A;  2X8C A;  4EIQ A;  2YLW A;  2BK5 A;  1ZK7 A;  3RP7 A;  1B5Q A;  3PO7 A;  4IV9 A;  1L9D A;  3AE9 A;  2BRA A;  3P4Q A;  3DA1 A;  5FS6 A;  1X31 B;  4LII A;  3LOV A;  4NEW A;  1JEH A;  4H4P A;  1E1K A;  3IWA A;  2EQ9 A;  2GAG B;  3CIR A;  1D5T A;  1GND A;  5BVA A;  2R0C A;  4A9W A;  5M0Z A;  1UKV G;  3NIX A;  3LZX A;  1B8S A;  1OJA A;  2Q7V A;  2XVF A;  3PVC A;  4EMJ A;  3FG2 P;  5U63 A;  2J3N A;  1N1P A;  4HB9 A;  2FJD A;  1VG0 A;  2GMJ A;  5FS7 A;  3ZYX A;  2R45 A;  4PAB A;  1KSS A;  1TDN A;  2BXS A;  3AD8 B;  4A6N A;  4JDR A;  5KMQ A;  5EBK A;  3T37 A;  1N4W A;  1V59 A;  3II4 A;  1TYP A;  3QSE A;  2BAB A;  3CNP A;  5JCL A;  1GER A;  3F8D A;  2XLP A;  1E39 A;  1YQ3 A;  1L9E A;  1F6M A;  3RHA A;  1NHP A;  2AAQ A;  3L1R A;  3H4K A;  2IVE A;  2V61 A;  3RP6 A;  4K5R A;  4NWZ A;  3NK2 X;  3DJJ A;  1TYT A;  4AOX A;  4H2Q A;  1JRY A;  2BAC A;  4M52 A;  2YR4 A;  5FS9 A;  3CPI G;  5HY5 A;  1RYI A;  1COY A;  4A65 A;  2R46 A;  1OJ9 A;  5C2T A;  4BJY A;  4TLX A;  4G74 A;  5LV9 A;  2XVI A;  1FEC A;  1DXL A;  3L8K A;  1EL7 A;  1NEN A;  4C3X A;  3CNJ A;  3NTA A;  1OJT A;  1K0I A;  2ZZB A;  3CGE A;  3ALJ A;  2R4J A;  3EAO A;  2VQB A;  3Q9T A;  3S61 A;  1D7L A;  1PBB A;  3GYX A;  4BK2 A;  4UDP A;  1H7W A;  2B76 A;  4H2R A;  1H81 A;  2WP9 A;  4J57 A;  3E1T A;  2VVL G;  4H4T A;  2JKC A;  2C3D A;  1OJC A;  2OLO A;  3GRS A;  1MXT A;  2E1M A;  1AOG A;  3CGD A;  1D4E A;  1GOS A;  2R0P A;  3ICR A;  4YSX A;  2C76 A;  2YLT A;  2WOV A;  2WP6 A;  1JU2 A;  5TR3 A;  2XFQ A;  3M0O A;  2XFU A;  3FBS A;  3KD9 A;  4NTC A;  2WPE A;  3QFA A;  2DKI A;  2TMD A;  2C7G A;  2IVD A;  2BC0 A;  2I0Z A;  2V60 A;  1NAA A;  4KPR A;  3NN6 X;  3GWD A;  3H8I A;  4H7U A;  2OAM A;  4YSY A;  4OPT A;  2YG6 A;  3AB1 A;  1ZKQ A;  4DSG A;  2WS3 A;  1XAN A;  1O5W A;  2YR5 A;  3NRN A;  2CFY A;  3DJG X;  1JRX A;  1KDG A;  1S7M A;  3AEC A;  4H50 A;  2PHH A;  2YG4 A;  2YR6 A;  3BI2 A;  1ZDL A;  3D1C A;  1MOK A;  4X9M A;  3GD3 A;  4Z2R A;  5CQF A;  1IJH A;  1O95 A;  1CC2 A;  4O5U A;  2YG3 A;  2E4G A;  4X9N A;  4Z26 A;  1L9C A;  4NNJ A;  1O94 A;  2XCG A;  3DK8 A;  2CVJ A;  1LQT A;  1N4U A;  4IA5 A;  4CNK A;  2JK6 A;  1XHC A;  5HYM A;  2CUL A;  2V5Z A;  3AE5 A;  4EM3 A;  5HHF A;  1EL9 A;  3UTF A;  3ABV A;  4C74 A;  4GDP A;  3RP8 A;  4DSH A;  4GAP A;  4WCT A;  3GSI A;  3D9X A;  3KLJ A;  1S2Y A;  3AEF A;  4J2W A;  4PAA A;  4B69 A;  2B7S A;  4U2S A;  2YVG A;  2GR0 A;  2GQW A;  1CHU A;  2VOU A;  1E6E A;  3UOY A;  3NNE A;  2FJE A;  5EOW A;  3VRA A;  2YVF A;  3DJD A;  4HA6 A;  3R9U A;  2EQ6 A;  2R4E A;  4BK1 A;  1FCD A;  2BRY A;  4CRT A;  3UOZ A;  4DNA A;  1Q9I A;  1GES A;  4CY8 A;  3QVP A;  1DNC A;  3AE4 A;  4Z44 A;  2GMH A;  4YKG A;  2YAU A;  3VQR A;  2GQF A;  1GET A;  1NG3 A;  1S3B A;  4ZCD A;  4B65 A;  2FBW A;  2V6O A;  1VQW A;  1CC6 A;  3AXB A;  1FEA A;  2C3C A;  3CPH G;  4AOS A;  4XWZ A;  4YKF A;  4RSL A;  4NZH A;  3I6D A;  3G5Q A;  3P1W A;  3B3R A;  1ZX9 A;  2ACZ A;  1KN0 A;  2YM1 A;  5EB5 A;  2X50 A;  2GR3 A;  4OPC A;  1EL5 A;  3F8P A;  3NK1 X;  3F8R A;  3NYE A;  2W0H A;  4JY3 A;  3GYI A;  5GRT A;  4U8P A;  3G5R A;  2X99 A;  3NLC A;  2PYX A;  3UKQ A;  4ZN0 A;  3PS9 A;  2CDU A;  4YTM A;  1BGJ A;  1M6I A;  2GR2 A;  4FK1 A;  1GPE A;  4AP3 A;  4FX9 A;  4GDE A;  4AP1 A;  1DOD A;  1GV4 A;  1H7X A;  1CBO A;  4K8D A;  1DOE A;  5KNL A;  2Y6Q A;  2B9Y A;  2UZZ A;  5C3J A;  2WBA A;  1GRB A;  2QCU A;  4FK1 C;  1H84 A;  2B9W A;  4D03 A;  5L46 A;  3GRT A;  3NG7 X;  1D7Y A;  2FJA A;  4YTN A;  1GRE A;  2WEU A;  3SZF A;  5IQ4 A;  1Q1R A;  3AE2 A;  4IVO B;  3UKL A;  3ICS A;  3KU9 A;  1PDH A;  3CNS A;  1Z6L A;  3K7Q X;  4C3Y A;  4AT0 A;  3NYF A;  1GSN A;  2XVJ A;  1PXC A;  2R0G A;  3M13 A;  3QSS A;  1JOA A;  4Y4N A;  1S3E A;  1DOB A;  3QVR A;  1KF6 A;  3EPT A;  1CJC A;  4NTE A;  3UKP A;  3UTG A;  1LQU A;  3VRD B;  4ADW A;  2WOI A;  4YSZ A;  2OA1 A;  4EQW A;  4EMI A;  4Y4L A;  1PJ5 A;  1P2E A;  3L5O A;  1KSU A;  1QLB A;  4G73 A;  4U8O A;  5DBJ A;  3ALL A;  3GMC A;  4B1B A;  5BUK A;  3K7T A;  3HZL A;  2WOW A;  1BGN A;  1CJ4 A;  2XVE A;  2BS2 A;  2OAL A;  3CMM A;  5JRB A;  3UKH A;  1D4D A;  1ZP0 A;  2BXR A;  3SY4 A;  2XVH A;  1N4V A;  3QFB A;  1PBE A;  1PS9 A;  3RED A;  2VRL A;  4H2N A;  4H2P A;  4GAV A;  3AWI A;  1E7P A;  2Z5Y A;  1JNZ A;  2YLR A;  4G6H A;  4GCM A;  4DGK A;  2YG5 A;  3LXD A;  2A8X A;  2VVM A;  3AEA A;  1E1N A;  2XFP A;  3C4N A;  1LVL A;  2WES A;  2HQM A;  4A5L A;  3LZW A;  3UTE A;  4B68 A;  4J31 A;  1VDC A;  4ICY A;  4KX6 A;  3NKS A;  4JN9 A;  4J56 A;  2GF3 A;  2WDQ A;  4K5S A;  4OVI A;  2X8G A;  1F8S A;  3DJE A;  1IUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...