5JCMA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
432
structure length
429
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPEPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFFSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Os09g0567300 protein
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
total genus 140
structure length 429
sequence length 432
chains with identical sequence B
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jcmA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jcmA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jcmA02
2YR6A 3AECA 3AEGA 2IVDA 1GERA 4U8IA 2XFPA 3AEFA 1E6EA 1Y0PA 1NAAA 1KDGA 2YM1A 3BHKA 1JEHA 1BGJA 3CPIG 5KWFA 2YLZA 2OAMA 2BACA 3AD8B 2GV8A 3Q6JA 2VVLG 5C3JA 4H4SA 1VRQB 1S2QA 1GRBA 4A79A 3H4KA 2E4GA 3AE3A 4APNA 1F8RA 2R4JA 3FBSA 4K8DA 3CNSA 1GTHA 5EB4A 3SQPA 2JAEA 3CIRA 4YT0A 4IA5A 4EMWA 4NTDA 3ZYXA 4K7ZA 3GRTA 3LZWA 4ECHA 1PXBA 5JCKA 4IVMB 4A99A 3IC9A 2X3NA 3E1TA 4EQRA 1LVLA 1TYPA 3DH9A 2PYXA 1TDFA 2GQFA 2YR4A 2VQBA 1CJCA 1W4XA 2GVCA 2ZZCA 5FS9A 4JY3A 4YTPA 3DK4A 3PVCA 4H4XA 3K30A 3CNJA 1BWCA 2WOIA 1OJAA 3KKJA 4YSHA 2XLPA 1H84A 3O0HA 4B68A 1PS9A 3IWAA 1JNRA 3GDPA 2F5ZA 3KD9A 4NEVA 4NTEA 1D7YA 4B67A 3D1CA 2C3DA 3UTFA 4CBQA 4CNJA 1SEZA 1JRYA 4C3YA 4C5OA 3QVRA 1D4DA 4Y4LA 4U8LA 4BV6A 1D7LA 3GYIA 3RP7A 3SGLA 4OPIA 4X9MA 3P4SA 3FPZA 3R9UA 5HYMA 3CPJG 3CGBA 4CRTA 5FS7A 1Z6LA 2WS3A 3LADA 1CHUA 4TM1A 4BJYA 3WE0A 1GNDA 1B5QA 3UOVA 1VG9A 2GRTA 1NDAA 4H7UA 2NVKX 1K0JA 1ZMDA 4B66A 3DMEA 5FS6A 1XANA 1EL5A 2C65A 1YY5A 3UKFA 4ZCDA 3VR8A 4H2QA 2WOWA 1E1NA 1CJ3A 2C72A 3NLCA 4HA6A 1S3EA 4M52A 1DNCA 3PS9A 4CNKA 4Z24A 1E1LA 2C73A 3AD9B 4USRA 3UP5A 2WP5A 1H6VA 1CJ4A 4CY8A 3AE5A 3DGZA 3IHGA 4B1BA 4PABA 1TRBA 1L9CA 5TR3A 2YLWA 4NZHA 4A9WA 3V3OA 2R4EA 3DK8A 3IHMA 5M10A 4D03A 2JKCA 2UZZA 5ER0A 4DSGA 2VZ2A 2JK6A 3CGEA 3M0OA 3AD7B 1CJ2A 1GESA 1S2YA 2OA1A 3QFBA 2VOUA 1NG4A 5J7XA 3BNUA 4H4YA 3NK1X 3AYJA 4U8KA 5M0ZA 1AOGA 3DJJA 4J56A 3D8XA 1IJHA 2BYBA 4EQXA 4JY2A 3T37A 4BJZA 3K7MX 4CY6A 1DJQA 3AE4A 3KU9A 3OZ2A 4MJWA 1XHCA 1DOCA 3EF6A 3CNPA 3UTHA 5KOWA 1KF6A 1F8SA 3GYJA 1QO8A 1CC6A 2GF3A 4K2XA 2QAEA 2CVJA 5LV9A 1B4VA 2ACZA 2DKIA 3C4NA 2FJDA 2XFUA 1H86A 3P4QA 2XVIA 1ZKQA 5KVIA 4I59A 3G5SA 2WDQA 2VRLA 2GH5A 1COYA 1ZX9A 3QVPA 3ICTA 3QFAA 4IVOB 4UDRA 4A6NA 4YSZA 4J33A 2RGOA 3GD4A 1X31B 2GB0A 1LQUA 1RP0A 3ITJA 2B7SA 5J60A 3GDNA 2V3AA 4TM4A 2Y6RA 3REDA 3UKHA 3I6DA 1GRTA 1KSSA 4EM3A 2BCGG 1Q1RA 1GREA 1RSGA 3OC4A 1LJ1A 1YKJA 3FMWA 1D4EA 3F8RA 4J36A 4REKA 5CQFA 1L9EA 4A6NB 1LV0A 2TPRA 1KNPA 2BS4A 2BC0A 1BGNA 4HB9A 3CPHG 4BK2A 4EM4A 5EOWA 2EQ6A 1ZP0A 1D4CA 4U2LA 3DJGX 1PJ6A 3IF9A 1BKWA 4I58A 2B7RA 3ZDNA 4XWZA 2RABA 5KXJA 1E7PA 2C70A 1K0LA 5L46A 2Q0LA 1H7WA 3C96A 1D5TA 4GCMA 2Y6QA 4Z44A 1L9DA 3AE9A 3NTAA 1FL2A 2APGA 2XVEA 4U8MA 3VRDB 3S5WA 3CNDA 4YTMA 2WP9A 4ZN0A 1VQWA 5KVHA 3UKLA 4A65A 4J57A 1N4WA 1PXAA 3KA7A 4ADWA 3KPFA 3V76A 4YKGA 3BI4A 1HYUA 1GV4A 4H4QA 4H4TA 1JU2A 1NG3A 2YM2A 2C66A 2WQYA 1BZLA 3NK2X 4TM3A 3AEBA 2RGJA 2XDOA 1CL0A 1REOA 4OPCA 2V60A 4Z2UA 1O5WA 4K22A 2Z5YA 2YVJA 3VRAA 2W0HA 2C7GA 2JB1A 3RP6A 1YQ3A 2VRMA 3GMBA 4AT0A 1JOAA 4YXDA 1PBFA 3K7TA 1EL8A 3URHA 3BI5A 4JNAA 3ALMA 1FECA 1DJNA 1PXCA 3G5RA 4AOSA 4RG3A 3AE8A 1S3BA 4XWRA 2GMJA 1GXFA 4FDCB 2GQWA 3II4A 4B69A 2AAQA 4DNAA 3AEAA 4YSYA 2EQ8A 4D04A 4EMIA 1GRHA 2IVEA 3BI2A 2WPEA 1EL7A 1E39A 1JRXA 3AE6A 4N9XA 4OPGA 4OPDA 3DK9A 2GR1A 2XLSA 5DBJA 2A87A 3H8LA 1CF3A 1RYIA 3I3LA 1DOBA 3RNMA 1PBEA 3QSEA 2BK5A 2B9WA 3QSSA 4LIIA 4X9NA 1TDEA 2WDVA 2PHHA 4TM0A 2E5VA 1P2EA 3SM8A 3B3RA 2YG5A 1XDIA 2YLTA 3NRNA 2NPXA 2DKHA 2R0CA 1ONFA 3CGDA 4Z43A 2Q7VA 3AEEA 4OCGA 1FEAA 4Z26A 3Q9TA 1MOKA 4LA1A 2CDUA 4B65A 4H4VA 3DJEA 3CTYA 3EANA 5U63A 1DXLA 2X8GA 3NGCX 3C4AA 4OPTA 1PJ5A 5BULA 2BXSA 3NN0X 1OJ9A 2XLRA 3GWDA 1F3PA 3VQRA 3ISHA 1F8WA 3P9UA 3UOYA 4WX1A 5HY5A 1GTEA 1QJDA 2GEWA 1NHPA 1LTXR 3QJ4A 2Z5XA 1KSUA 1PHHA 3M13A 1F6MA 3UOXA 4C77A 2WP6A 4A5LA 2JB3A 2R0PA 2R46A 3GMCA 2I0ZA 3EAOA 2V61A 2GAHB 2VVMA 1PN0A 1H7XA 2TMDA 5KRQA 5IQ1A 2YVFA 2GR3A 1NHQA 1M6IA 2OLNA 4NEWA 4K5RA 1L0VA 2XLTA 2XYOA 4U8OA 5EB5A 4FK1A 2WPFA 2V6OA 1PBCA 3ATQA 4NTCA 3AEDA 3ALLA 2C67A 2JBVA 5HXIA 1EBDA 4LU6A 2YLSA 3AE1A 3SFEA 4AT2A 2X8CA 4UDPA 4P9SA 1E1MA 3COXA 4TLXA 4BK1A 3CN8A 1FEBA 5U25A 2VVLA 2XVHA 3LOVA 4XXGA 1B8SA 2R45A 3RHAA 3UTGA 5U1OA 3NN6X 2E1MA 2WOVA 1GOSA 3UTEA 3RP8A 1GRAA 1IUVA 4CCQA 2FBWA 1Y56A 1H81A 3VR9A 1NHRA 1TDNA 3LJPA 4Y4MA 2GR0A 1KFYA 1E1KA 4EIQA 3UCLA 4Y4NA 2YWLA 3M12A 1FOHA 1GEUA 2H89A 3GRSA 2YR5A 2YQUA 3NHOX 1OJDA 5BUKA 3GWFA 2YG3A 3DA1A 4PAAA 1Q9IA 3KLJA 1H83A 3LZXA 1CBOA 2AQJA 1MO9A 4IA6A 2R9ZA 1PBDA 1Y56B 2QCUA 4BURA 4JNQA 3G5QA 2V3BA 4YSXA 4GRTA 2AR8A 5JCMA 3PO7A 4YTNA 3DGHA 1TYTA 1XPQA 2GR2A 5IQ4A 3ALJA 2YVGA 3UOZA 1YQZA 2BA9A 4USQA 1VDCA 3NH3X 2C3CA 2OALA 1LPFA 1IUTA 5BRTA 5CKUA 5EBKA 3NTDA 1P2HA 1DODA 4H2PA 1GRGA 4ICYA 2V5ZA 4DGKA 2XFNA 4H50A 1GT8A 1TDKA 3F8DA 3K7QX 4KX6A 5JCLA 3AB1A 2WU5A 1PJ7A 4JQ9A 4Z2RA 3ICSA 1QLBA 5KOXA 2XCGA 4J31A 2XLUA 1IUXA 2XVJA 2X99A 4GDEA 2A8XA 4IV9A 1VG0A 4AP3A 4C74A 3AYIA 3LB8A 2EQ7A 4WCTA 2H88A 2OLOA 4ZCCA 4GF7A 2BABA 2ZZ0A 4Z2TA 4H4ZA 2X8HA 3GD3A 5FS8A 2WESA 2BK4A 3P1WA 4FX9A 3ABVA 4O5UA 3ADAB 4EMJA 4GDPA 3BHFA 4J34A 3CGCA 1FCDA 3NYEA 4CCRA 3NNEA 5JCIA 4H4UA 2XFOA 1K0IA 2QA1A 1BF3A 3H8IA 4H2RA 2WBAA 2IIDA 3B6DA 2A89A 1ZOVA 4J2WA 4BK3A 1N1PA 4YWOA 1GRFA 1MXTA 1CC4A 2Q6UA 2ZBWA 3NKSA 4O5QA 2YLRA 2XVFA 1M64A 2YG6A 1LQTA 3AXBA 2CFYA 4OPLA 3ICRA 4X4JA 5HHFA 3P4PA 3SFDA 2BC1A 5JCNA 2X50A 2FJEA 2Q0KA 2J3NA 4RSLA 3AWIA 4OVIA 2CULA 2XFQA 3LXDA 1JNZA 3P4RA 5FMHA 3EPTA 3NYFA 3V3NA 3DJDA 1V59A 3AE7A 2EQ9A 2BS2A 2YG4A 4U8NA 2C64A 2JB2A 2ARDA 2WDRA 2BS3A 2HQMA 3BNMA 1K4QA 1DOEA 2WPCA 1ELIA 1PDHA 3NK0X 2GMHA 3HZLA 1IUSA 4U8PA 4EIPA 4Z25A 2YLXA 1NEKA 2RGHA 2VQ7A 2WU2A 3NG7X 4U8JA 5GRTA 3NIXA 5BVAA 2YG7A 3GSIA 1NHSA 4AP1A 3L8KA 2QA2A 3AYLA 4U2SA 4E0VA 4TLZA 3UKQA 3UKKA 1N4UA 1JRZA 1CC2A 3NYCA 1UKVG 4JDRA 2B9YA 4H4RA 4KPRA 4EQWA 1TDOA 1O94A 1GPEA 2BCPA 2BXRA 2FJAA 2ZZBA 2FJBA 2B76A 1H82A 1Q1WA 1GETA 5GSNA 1OJTA 4OPUA 3UKAA 4AOXA 3FG2P 1ZK7A 4DSHA 2BK3A 4RG4A 3S61A 3FIMB 4U2TA 1IUUA 3CNTA 3ATRA 3QSMA 3UP4A 3VRBA 1ZY8A 1NENA 1ZMCA 2WHDA 2WETA 1KNRA 4FK1C 4GUVA 5C2TA 2B9XA 1B37A 2C75A 4JN9A 4H4PA 1EL9A 4UDQA 4YKFA 4A7AA 4B63A 2GAGB 4C3XA 2WEUA 4EQSA 3KVEA 2C76A 1OJCA 3F8PA 1GALA 3JSKA 3NT6A 4H4WA 3UKPA 4H2NA 1PBBA 1GSNA 1YQ4A 1ZDLA 1IUWA 3AE2A 4K5SA 4GR1A 3L1RA 1N4VA 4UP3A 5IPYA 1ZOYA 1O95A 2O9ZA 2R0GA 4B64A 2YAUA 1NPXA
chains in the Genus database with same CATH superfamily
3R25A 1KDGA 2DW7A 2VVLG 1S2QA 3FVDA 1GRBA 3H4KA 4YT0A 4K7ZA 5JCKA 3P93A 2NQLA 2X3NA 1JDFA 3E1TA 1TDFA 1CJCA 4GYPA 2GVCA 4H4XA 4GYPC 5IDZA 3O0HA 3KD9A 4C5OA 1D7LA 3R07C 3SGLA 4JN8A 1N61C 4OPIA 5HYMA 4CRTA 1Z6LA 4E4FA 4GGBA 3WE0A 1GNDA 2NVKX 1K0JA 2BRAA 3DMEA 5FS6A 3SZ0A 1XANA 1EL5A 3UKFA 4H2QA 2WOWA 3MQTA 1DNCA 3PS9A 4Z24A 3AD9B 3AE5A 3IHGA 5TR3A 4NZHA 3SY4A 3V3OA 3SJNA 3NVWB 4D03A 2JKCA 2BRYA 2JK6A 1GESA 2OA1A 5J7XA 3NK1X 2PGWA 1AOGA 4ROPA 1IJHA 4CY6A 4MJWA 2QJMA 3CNPA 1F8SA 3GYJA 1VQZA 2CVJA 2ACZA 1H86A 3Q45A 3G5SA 1ZX9A 3QFAA 4UDRA 4J33A 3CK5A 2RGOA 1RP0A 5J60A 4TM4A 3UKHA 2OKTA 1D4EA 4IP4A 4REKA 4A6NB 2BC0A 4BK2A 2XH2A 3MWCA 3ES7A 2EQ6A 3IF9A 3ZDNA 3T0KA 2OZ8A 1E7PA 2Q0LA 3S5WA 5FJUA 4YTMA 4H83A 4J57A 3KA7A 1PXAA 4ADWA 3BI4A 2OPJA 1WUFA 2YM2A 1BZLA 3SR6B 4TM3A 2XDOA 1CL0A 4OPCA 3V3WA 2HZGA 2Z5YA 4G9KA 3OPSA 2JB1A 3RP6A 1YQ3A 3G5RA 4DWDA 1GXFA 2AAQA 1EL7A 1JRXA 4OPGA 4OPDA 3DK9A 2GR1A 3FV9A 2A87A 3V5CA 4X9NA 3H7VA 2WDVA 4TM0A 2E5VA 3B3RA 1EC9A 3SXIA 1XDIA 3NRNA 2NPXA 2R0CA 4Z43A 3VCCA 3D46A 4OCGA 1FEAA 4Z26A 1MOKA 1VDVA 1KKRA 3DJEA 3CTYA 3DEQA 5U63A 1DXLA 2P88A 3UJRA 3NN0X 3GWDA 4G73A 3UOYA 1SJCA 4WX1A 2GEWA 1NHPA 3QJ4A 3N4FA 1KSUA 1PHHA 3DIPA 2JB3A 2R46A 2GAHB 1PN0A 1M6IA 2OLNA 5EB5A 4HCHA 4NTCA 4IT1A 5HXIA 1JPMA 3SFEA 1N63C 4UDPA 3DG6A 3TJIA 3CN8A 1FEBA 2VVLA 4XXGA 3RHAA 3UTGA 3NN6X 3HYWA 3RP8A 1GRAA 1IUVA 2MUCA 3VR9A 4Y4MA 4J3ZA 3PWIA 3RGTA 1STZA 3M12A 1KKOA 1GEUA 3EUB3 3GRSA 2H89A 2YR5A 5BUKA 3GWFA 2YG3A 2AL1A 2OQYA 1MO9A 2R9ZA 4JNQA 3ES8A 4YSXA 5IQ4A 3ALJA 2YVGA 3IJIA 1R6WA 3A7AA 2BA9A 3VC5A 1VDCA 3TW9A 1LPFA 1IUTA 5CKUA 5EBKA 2GL5A 3ZLHA 2XFNA 3AB1A 3SN1A 2XVJA 3MY9A 2PP3A 1VG0A 3AYIA 1R0MA 2PSNA 4GF7A 2ZZ0A 3EKGA 2X8HA 2P3ZA 4EMJA 4EWJA 4J34A 3PFRA 1FHVA 1XS2A 4H4UA 3GY1A 3H8IA 2IIDA 2GDQA 2PTYA 1CC4A 2PTWA 2ZBWA 1H2IA 2XFQA 3R11A 3LXDA 2CHRA 2P8CA 2EQ9A 2BS2A 2C64A 1PDHA 4Z25A 2WU2A 5BVAA 3UKKA 1N4UA 4DHGA 4E8GA 4JDRA 1DTNA 1O94A 2FJBA 1H82A 1Q1WA 2W3SA 3DERA 3FG2P 3H8AA 2BK3A 3S61A 3FIMB 3L5OA 5FJTA 3UP4A 3VRBA 4GUVA 3VFCA 4A7AA 3VCNA 4EQSA 1OJCA 3JSKA 1MUCA 3OTRA 1IUWA 4K5SA 4GR1A 1SJDA 3P0WA 4UP3A 1ZOYA 1S7MA 3RRAA 4B64A 2YR6A 2XFPA 3AEFA 1E6EA 1Y0PA 3CPIG 5KWFA 2OAMA 3AD8B 2GV8A 3Q6JA 5C3JA 3TQPA 4H19A 3FBSA 2JAEA 4G6HA 4EMWA 3GRTA 3N6HA 3TOYA 3NVZB 3OZYA 4MKSA 1LVLA 1TYPA 2ZZCA 4YTPA 3DK4A 1BWCA 2WOIA 2PA6A 4YSHA 3KPKA 4B68A 1JNRA 2F5ZA 2XH4A 1JROA 3ZVHB 4B67A 3SBFA 3D1CA 4CNJA 4CBQA 1SEZA 4C3YA 3QVRA 4Y4LA 4BV6A 5EU9A 3R9UA 3FPZA 3CPJG 3LADA 3VDGA 1YEYA 2OZTA 1B5QA 1NDAA 4H7UA 3Q4DA 1YY5A 3VR8A 1CJ3A 1E1LA 3UP5A 1H6VA 3DGZA 1TRBA 1L9CA 4A9WA 4DSGA 2VZ2A 1X2GA 3UJEA 1NG4A 3D9XA 4GAVA 3D8XA 2BYBA 4EQXA 2OLAA 4JY2A 4BJZA 1DJQA 3OZ2A 1XHCA 1DOCA 3UJSA 1CC6A 2GF3A 1B4VA 2DKIA 2XFUA 3P4QA 4KWSA 2WDQA 2GGJA 3ICTA 4YSZA 2ZC8A 3GD4A 3I4KA 3K1GA 3GDNA 2V3AA 2Y6RA 2PU1A 4EM3A 1WYGA 1RSGA 1GREA 1YKJA 3GO2A 1L9EA 5EOWA 1ZP0A 4U2LA 3V4BA 2QDDA 2B7RA 5KMPA 2C70A 4JHMA 3HPFA 3C96A 4GCMA 4Z44A 4G74A 3AE9A 1FL2A 3QPEA 3RCYA 3CNDA 2QDEA 3V76A 2PTZA 3CT2A 3NK2X 2C4CA 1REOA 1N60C 4K22A 3TCSA 3VRAA 4AT0A 1PBFA 3K7TA 3BI5A 3ENLA 1BQGA 3QTPA 1PXCA 4RG3A 3AE8A 3UJ2A 4TVYA 4B69A 4DNAA 3AEAA 4YSYA 2IVEA 2WPEA 4N9XA 4FI4A 4HCDA 5DBJA 3I3LA 1DOBA 2B9WA 3QSSA 1P2EA 5G5HB 2YG5A 2YLTA 1ONFA 3CGDA 3AEEA 1SJAA 1JCTA 4B65A 4II2A 2AL2A 1N5XA 4GMEA 3NGCX 4MMWA 4OPTA 3T6CA 1OJ9A 1F3PA 1OEPA 1F8WA 3T31A 1QJDA 3GD6A 3M13A 1F6MA 4C77A 2WP6A 4A5LA 2OQHA 2R0PA 3GMCA 3EAOA 2V61A 4HCLA 2TMDA 5IQ1A 1NHQA 1L0VA 4U8OA 4FK1A 3ATQA 2WPFA 3AEDA 2JBVA 1EBDA 3AE1A 4KEMA 4YWSA 4BK1A 4KT2A 5U25A 1B8SA 5KMSA 3JW7A 4CCQA 2FBWA 1Y56A 1FO4A 1KFYA 1E1KA 6ENLA 1OJDA 4MGGA 4PAAA 3KLJA 1H83A 4K2SA 1CBOA 3LZXA 1PBDA 4HYRA 2QCUA 4BURA 4HNCA 5FJOA 3DGHA 1N62C 1YQZA 4USQA 3VA8A 2OX4A 2C3CA 2ONEA 1FFVC 2OALA 5BRTA 2PCEA 1DODA 4DGKA 3F8DA 1GT8A 1MNSA 2WU5A 1QLBA 2XCGA 2XLUA 2X99A 4AP3A 3LB8A 1BKHA 2HXTA 3GD3A 5FS8A 3T14A 2BK4A 4O5UA 4FX9A 4ZOHB 3CGCA 4CCRA 3STPA 2WBAA 1N1PA 4ZCWA 4HPNA 1M64A 3AXBA 2CFYA 3ICRA 3SFDA 2X50A 2CULA 3CB3A 1ELSA 3AE7A 2XH0A 4U8NA 2WDRA 2JB2A 2HQMA 1MDRA 3NK0X 2GMHA 3HZLA 1IUSA 4U8PA 2VQ7A 3NG7X 3QLDA 2YG7A 3GSIA 1NHSA 3L8KA 2QA2A 3AYLA 1XPYA 4GIRA 4U2SA 3UKQA 3NYCA 4KPRA 4EQWA 1TDOA 2BXRA 2ZZBA 3NS1B 1OJTA 2XGZA 3UKAA 2PGEA 1ZY8A 2WETA 5C2TA 2C75A 4H4PA 4UDQA 4B63A 4C3XA 2FKPA 3NT6A 1GSNA 3AE2A 3I6EA 1O95A 2R0GA 4HNLA 1NPXA 3AECA 2IVDA 1GERA 4U8IA 2YM1A 1JEHA 5BOFA 2YLZA 2BACA 1JPDX 3B9JB 4NWZA 2R4JA 4K8DA 1GTHA 5EB4A 3CIRA 4IA5A 3LZWA 4GISA 1X2HA 4IVMB 4A99A 2PYXA 3DH9A 3NFUA 4II3A 3DESA 4JY3A 3DG7A 1EBHA 2GGGA 1OJAA 1H84A 3SZCA 1PS9A 5BOEA 4KPLA 3GDPA 4NTEA 2C3DA 3UTFA 1D4DA 4U8LA 3RP7A 3P4SA 3CGBA 5FS7A 3UXLA 3SX6A 3ZVIA 3NZGA 3U4FA 4BJYA 2GRTA 3KUMA 4G6GA 1ZMDA 2AKMA 4B66A 2C72A 2W3RA 3IJQA 4CNKA 1TKKA 3UCCA 2WP5A 4CY8A 4B1BA 2GGEA 2R4EA 3IHMA 5FJRA 2UZZA 5ER0A 3SYIA 3CGEA 2DW6A 4DX3A 3QFBA 2VOUA 2PS2A 5M0ZA 3DJJA 3S47A 4J56A 2OG9A 5JRBA 3AE4A 2E3TA 3EF6A 5KOWA 4ENLA 2QAEA 5LV9A 3C4NA 3TTEA 4Z1YA 2FJDA 2XVIA 1ZKQA 3OW1A 2PTXA 4I59A 1COYA 3QVPA 2I5QA 4IL2A 4A6NA 2GB0A 3MZNA 3REDA 1EBGA 2BCGG 3FMWA 3OC4A 3F8RA 5CQFA 3RO6A 2BS4A 4HB9A 4DN1A 2P8BA 3NRZB 4M6UA 1NU5A 1H7WA 1D5TA 2Y6QA 3NO1A 3R10A 4U8MA 2PODA 2WP9A 4ZN0A 5KVHA 3UKLA 3KPFA 4YKGA 3A7RA 1HYUA 4H4QA 1JU2A 1NG3A 2WQYA 2MNRA 3AEBA 2RGJA 4Z2UA 3V5FA 2YVJA 2W0HA 4YXDA 4H2HA 1EL8A 4JNAA 3IJLA 3AM9A 3ALMA 4GFIA 4AOSA 2OVLA 4XWRA 2GMJA 3QKEA 4FDCB 3II4A 3T2KA 2EQ8A 4D04A 4EMIA 1GRHA 3BI2A 1PDYA 1FHUA 2XLSA 1CF3A 1RYIA 3QSEA 2BK5A 2GSHA 3I6TA 4LIIA 2PHHA 2DKHA 3T4WA 2Q7VA 4LA1A 2RDXA 2CDUA 3OZMA 3B97A 3EANA 2X8GA 3A7UA 3OP2A 1PJ5A 3VQRA 3ZLFA 3P9UA 1GTEA 1LTXR 1V97A 1JRPA 1TE6A 3UOXA 2I0ZA 2VVMA 3T9PA 5KRQA 2YVFA 2GR3A 4K5RA 2XYOA 1W6TA 2V6OA 3ALLA 3SN0A 3COXA 2XVHA 2R45A 5G5GB 5U1OA 1GOSA 1H81A 1NHRA 1TDNA 2QVHA 4DXKA 4EIQA 4HN8A 2YWLA 1RVKA 1Q9IA 2AQJA 4IA6A 4NNJA 3G5QA 2AR8A 5JCMA 4YTNA 1TYTA 1KN0A 1XPQA 2QJJA 3N4EA 3GYXA 3UOZA 3NH3X 3HRDC 4X2PA 3P3BA 3NTDA 3UGVA 3EEZA 4ICYA 1T3QC 4KX6A 1IYXA 1PJ7A 4Z2RA 3ICSA 3THUA 3HW2A 4J31A 2GGIA 1IUXA 4IV9A 4C74A 2EQ7A 4WCTA 2H88A 4ZCCA 2BABA 4Z2TA 4FP1A 3ADAB 4GDPA 1FCDA 2XFOA 1K0IA 5FJPA 2QA1A 1BF3A 3UXKA 4H2RA 3B6DA 2A89A 4E4UA 3PWGA 2Q6UA 2YLRA 2YG6A 1LQTA 5HHFA 2BC1A 5JCNA 2FJEA 4RSLA 2J3NA 3AWIA 4OVIA 1JNZA 5FMHA 3EPTA 3NYFA 3V3NA 3DJDA 1V59A 2YG4A 2ARDA 2BS3A 1ELIA 3JZUA 4EIPA 3HYXA 2YLXA 2RGHA 2O56A 4E0VA 4TLZA 4ZA0A 1JRZA 1CC2A 4H4RA 2BCPA 2B76A 4GAPA 3S5SA 1GETA 4AOXA 1ZK7A 4DSHA 4RG4A 1KD0A 3CNTA 3ATRA 3CXBA 2WHDA 4FK1C 1KNRA 2B9XA 1B37A 4TVWA 7ENLA 4YKFA 3KVEA 3F8PA 1GALA 3MKCA 3UKPA 1PBBA 1YQ4A 1ZDLA 1N4VA 5IPYA 4E6MA 3GC2A 3AEGA 3U9IA 3BHKA 1NAAA 1BGJA 5KMQA 3SN4A 4H4SA 1VRQB 4A79A 2E4GA 5KNLA 3AE3A 2OFJA 4APNA 1F8RA 3CNSA 2QQ6A 3SQPA 1MDLA 4NTDA 3ZYXA 4ECHA 1PXBA 3IC9A 4EQRA 2GQFA 2YR4A 2VQBA 1W4XA 3ZVHA 5FS9A 3PVCA 3CXOA 3K30A 3CNJA 3D47A 3KKJA 3FXGA 2XLPA 3IWAA 4NEVA 1D7YA 3NXLA 1JRYA 1EC8A 3GYIA 3JVAA 4X9MA 4Z17A 2WS3A 1ECQA 1P48A 1CHUA 4TM1A 3UOVA 1VG9A 2OO6A 3BSMA 2FYMA 4G7FA 2C65A 4K8GA 4ZCDA 1E1NA 3NLCA 4HA6A 1S3EA 3NVVB 4M52A 2C73A 4USRA 1CJ4A 4PABA 2YLWA 1TZZA 4E5TA 3DK8A 2QJNA 5M10A 2ZADA 1SJBA 2QGYA 3FCPA 2XSXA 3M0OA 3TWBA 1CJ2A 3AD7B 1S2YA 3BNUA 4H4YA 3AYJA 4U8KA 3T37A 3K7MX 3KU9A 3UTHA 1KF6A 1QO8A 4K2XA 5KVIA 2VRLA 2GH5A 3ETRB 4IVOB 3BOXA 1X31B 1LQUA 3ITJA 2B7SA 3RR1A 2HNEA 4H1ZA 1GRTA 3AN1A 1KSSA 3I6DA 1Q1RA 1LJ1A 4J36A 1MRAA 1LV0A 2TPRA 1KNPA 1BGNA 3CPHG 1NELA 2PU0A 4EM4A 4A35A 1D4CA 3DJGX 1PJ6A 1BKWA 4I58A 4XWZA 2RABA 3NVYB 5KXJA 1K0LA 5L46A 3H12A 1L9DA 3NTAA 2APGA 2XVEA 3VRDB 1VQWA 3RITA 3N6JA 4A65A 1N4WA 1GV4A 4IL0A 4H4TA 2C66A 5J04A 2POZA 2V60A 1O5WA 3H70A 2C7GA 4IZGA 2VRMA 1ONEA 3GMBA 1JOAA 3URHA 1FECA 1DJNA 1L8PA 1ZXIC 4J1OA 1S3BA 2GQWA 1F9CA 1PDZA 1EC7A 1E39A 3DG3A 3AE6A 3H8LA 3RNMA 1PBEA 3CAWA 1TDEA 3DFYA 3SM8A 3T2YA 1E9IA 3Q9TA 2W54A 1WUEA 4H4VA 2PPGA 3C4AA 5BULA 2BXSA 2XLRA 3ISHA 2E5AA 5HY5A 2XH7A 3PK7A 2Z5XA 3SQSA 2AL2B 3T8QA 2P0IA 1H7XA 4JN7A 4NEWA 2XLTA 1RM6B 4M0XA 1FFUC 1PBCA 2C67A 4LU6A 2YLSA 4AT2A 2X8CA 3AMZA 4P9SA 1E1MA 5ENLA 4TLXA 1KCZA 3LOVA 2PP0A 2E1MA 3BJSA 2WOVA 3UTEA 3R1ZA 3LJPA 2GR0A 3UCLA 4Y4NA 1FOHA 2YQUA 3NHOX 3DA1A 1Y56B 2V3BA 4GRTA 3PO7A 3DDMA 4G8TA 4DYEA 4A6GA 2GR2A 2HXUA 3UJFA 3CYJA 3IK4A 3SZWA 3SSZA 1P2HA 4GGHA 4H2PA 1GRGA 2V5ZA 1N5WC 4H50A 1TDKA 3K7QX 5JCLA 4JQ9A 5KOXA 3DFHA 4GDEA 2A8XA 4K1WA 2AKZA 2OLOA 4H4ZA 2WESA 3P1WA 3ABVA 2W55A 3BHFA 2PMQA 3NYEA 3NNEA 5JCIA 2PP1A 3R0UA 3HYVA 3TJ4A 1ZOVA 4J2WA 3QN3A 4BK3A 4YWOA 1GRFA 1MXTA 3T2ZA 3NKSA 4O5QA 2XVFA 4X4JA 3VC6A 4OPLA 1FIQB 3ZLGA 3P4PA 2Q0KA 3R0KA 1SB3B 3P4RA 2OZ3A 3UCDA 2GGHA 3PG6A 3BNMA 1K4QA 1DOEA 2WPCA 4U8JA 1NEKA 5GRTA 3NIXA 4AP1A 4A3RA 3FJ4A 4IP5A 3TWAA 1UKVG 2B9YA 1GPEA 1P43A 2FJAA 4F4RA 5GSNA 4OPUA 3DGBA 4U2TA 1IUUA 3QSMA 3MUCA 1NENA 1ZMCA 4JN9A 5KMRA 1EL9A 4IHCA 2GAGB 2WEUA 3FYYA 2C76A 4H4WA 3CMMA 4H2NA 3L1RA 2O9ZA 3SZFA 3MSYA 2YAUA
chains in the Genus database with same CATH topology
2YR6A 3AECA 3AEGA 2IVDA 1GERA 4U8IA 2XFPA 3AEFA 1E6EA 1Y0PA 1NAAA 1KDGA 2YM1A 3BHKA 1JEHA 1BGJA 3CPIG 5KWFA 2YLZA 2OAMA 5KMQA 2BACA 3AD8B 2GV8A 3Q6JA 2VVLG 5C3JA 4H4SA 1VRQB 4NWZA 1S2QA 1GRBA 4A79A 3H4KA 2E4GA 5KNLA 3AE3A 4APNA 1F8RA 2R4JA 3FBSA 4K8DA 3CNSA 1GTHA 5EB4A 3SQPA 2JAEA 3CIRA 4YT0A 4G6HA 4IA5A 4EMWA 4NTDA 3ZYXA 4K7ZA 3GRTA 3LZWA 4ECHA 1PXBA 5JCKA 4IVMB 4A99A 3IC9A 2X3NA 3E1TA 4EQRA 1LVLA 1TYPA 3DH9A 2PYXA 1TDFA 2GQFA 4II3A 2YR4A 2VQBA 1CJCA 1W4XA 2GVCA 2ZZCA 5FS9A 4JY3A 4YTPA 3DK4A 3PVCA 4H4XA 3K30A 3CNJA 1BWCA 2WOIA 1OJAA 3KKJA 4YSHA 2XLPA 1H84A 3O0HA 3SZCA 3KPKA 4B68A 1PS9A 3IWAA 1JNRA 3GDPA 2F5ZA 3KD9A 4NEVA 4NTEA 1D7YA 4B67A 3D1CA 2C3DA 3UTFA 4CBQA 4CNJA 1SEZA 1JRYA 4C3YA 4C5OA 3QVRA 1D4DA 4Y4LA 4U8LA 4BV6A 1D7LA 3GYIA 3RP7A 3SGLA 4OPIA 4X9MA 3P4SA 3FPZA 3R9UA 5HYMA 3CPJG 3CGBA 4CRTA 5FS7A 1Z6LA 2WS3A 3SX6A 3LADA 1CHUA 4TM1A 4BJYA 3WE0A 1GNDA 1B5QA 3UOVA 1VG9A 2GRTA 1NDAA 4G6GA 2NVKX 4H7UA 1K0JA 1ZMDA 2BRAA 4B66A 3DMEA 5FS6A 3SZ0A 1XANA 1EL5A 2C65A 1YY5A 3UKFA 4ZCDA 3VR8A 4H2QA 2WOWA 1E1NA 1CJ3A 2C72A 3NLCA 4HA6A 1S3EA 4M52A 1DNCA 3PS9A 4CNKA 4Z24A 1E1LA 2C73A 3AD9B 4USRA 3UP5A 2WP5A 1H6VA 1CJ4A 4CY8A 3AE5A 3DGZA 3IHGA 4B1BA 4PABA 1TRBA 1L9CA 5TR3A 2YLWA 4NZHA 3SY4A 4A9WA 3V3OA 2R4EA 3DK8A 3IHMA 5M10A 4D03A 2JKCA 2BRYA 2UZZA 5ER0A 4DSGA 2VZ2A 3SYIA 2JK6A 3CGEA 3M0OA 3AD7B 1CJ2A 1GESA 1S2YA 2OA1A 3QFBA 2VOUA 1NG4A 5J7XA 3D9XA 3BNUA 4GAVA 4H4YA 3NK1X 3AYJA 4U8KA 5M0ZA 1AOGA 3DJJA 4J56A 3D8XA 1IJHA 2BYBA 4EQXA 5JRBA 4JY2A 3T37A 4BJZA 3K7MX 4CY6A 1DJQA 3AE4A 3KU9A 3OZ2A 4MJWA 1XHCA 1DOCA 3EF6A 3CNPA 3UTHA 5KOWA 1KF6A 1F8SA 3GYJA 1QO8A 1CC6A 2GF3A 4K2XA 2QAEA 2CVJA 5LV9A 1B4VA 2ACZA 2DKIA 3C4NA 2FJDA 2XFUA 1H86A 3P4QA 2XVIA 1ZKQA 5KVIA 4I59A 3G5SA 2WDQA 2VRLA 2GH5A 1COYA 1ZX9A 3QVPA 3ICTA 3QFAA 4IVOB 4UDRA 4A6NA 4YSZA 4J33A 2RGOA 3GD4A 1X31B 2GB0A 1LQUA 1RP0A 3ITJA 2B7SA 5J60A 3GDNA 2V3AA 4TM4A 2Y6RA 3REDA 3UKHA 3I6DA 1GRTA 1KSSA 4EM3A 2BCGG 1Q1RA 1GREA 1RSGA 3OC4A 1LJ1A 1YKJA 3FMWA 1D4EA 3F8RA 4J36A 4REKA 5CQFA 1L9EA 4A6NB 1LV0A 2TPRA 1KNPA 2BS4A 2BC0A 1BGNA 4HB9A 3CPHG 4BK2A 4EM4A 5EOWA 2EQ6A 1ZP0A 1D4CA 4U2LA 3DJGX 1PJ6A 3IF9A 1BKWA 4I58A 2B7RA 3ZDNA 5KMPA 4XWZA 2RABA 3T0KA 1E7PA 2C70A 5KXJA 1K0LA 5L46A 2Q0LA 1H7WA 3C96A 1D5TA 4GCMA 2Y6QA 4Z44A 1L9DA 3AE9A 3NTAA 1FL2A 4G74A 2APGA 2XVEA 4U8MA 3VRDB 3S5WA 3CNDA 4YTMA 2WP9A 4ZN0A 1VQWA 5KVHA 3UKLA 4A65A 4J57A 1N4WA 1PXAA 3KA7A 4ADWA 3KPFA 3V76A 4YKGA 3BI4A 1HYUA 1GV4A 4H4QA 4H4TA 1JU2A 1NG3A 2YM2A 2C66A 2WQYA 1BZLA 3NK2X 4TM3A 3AEBA 2RGJA 2XDOA 2C4CA 1CL0A 1REOA 4OPCA 2V60A 4Z2UA 1O5WA 4K22A 2Z5YA 4G9KA 2YVJA 3VRAA 2W0HA 2C7GA 2JB1A 3RP6A 1YQ3A 2VRMA 3GMBA 4AT0A 1JOAA 4YXDA 1PBFA 3K7TA 1EL8A 3URHA 3BI5A 4JNAA 3ALMA 1FECA 1DJNA 1PXCA 3G5RA 4AOSA 4RG3A 3AE8A 1S3BA 4XWRA 2GMJA 1GXFA 4FDCB 2GQWA 3II4A 3T2KA 4B69A 2AAQA 4DNAA 3AEAA 4YSYA 2EQ8A 4D04A 4EMIA 1GRHA 2IVEA 3BI2A 2WPEA 1EL7A 1E39A 1JRXA 3AE6A 4N9XA 4OPGA 4OPDA 3DK9A 2GR1A 2XLSA 5DBJA 2A87A 3H8LA 1CF3A 1RYIA 3I3LA 1DOBA 3RNMA 1PBEA 3QSEA 2BK5A 2B9WA 3QSSA 4LIIA 4X9NA 1TDEA 2WDVA 2PHHA 4TM0A 2E5VA 1P2EA 3SM8A 3B3RA 3SXIA 2YG5A 1XDIA 2YLTA 3NRNA 2NPXA 2DKHA 2R0CA 3T2YA 1ONFA 3CGDA 4Z43A 2Q7VA 3AEEA 4OCGA 1FEAA 4Z26A 3Q9TA 1MOKA 4LA1A 2CDUA 4B65A 4II2A 4H4VA 3DJEA 3CTYA 3EANA 5U63A 1DXLA 2X8GA 3NGCX 3C4AA 4OPTA 1PJ5A 5BULA 2BXSA 3NN0X 1OJ9A 2XLRA 3GWDA 1F3PA 3VQRA 3ISHA 1F8WA 4G73A 3P9UA 3UOYA 4WX1A 5HY5A 3T31A 1GTEA 1QJDA 2GEWA 1NHPA 1LTXR 3QJ4A 2Z5XA 1KSUA 1PHHA 3M13A 1F6MA 3UOXA 4C77A 2WP6A 4A5LA 2JB3A 2R0PA 2R46A 3GMCA 2I0ZA 3EAOA 2V61A 2GAHB 2VVMA 1PN0A 1H7XA 2TMDA 5KRQA 5IQ1A 2YVFA 2GR3A 1NHQA 1M6IA 2OLNA 4NEWA 4K5RA 1L0VA 2XLTA 2XYOA 4U8OA 5EB5A 4FK1A 2WPFA 2V6OA 1PBCA 3ATQA 4NTCA 3AEDA 3ALLA 2C67A 2JBVA 5HXIA 1EBDA 4LU6A 2YLSA 3AE1A 3SFEA 4AT2A 2X8CA 4UDPA 4P9SA 1E1MA 3COXA 4TLXA 4BK1A 3CN8A 1FEBA 5U25A 2VVLA 2XVHA 3LOVA 4XXGA 1B8SA 2R45A 3RHAA 3UTGA 5U1OA 3NN6X 2E1MA 5KMSA 2WOVA 3HYWA 1GOSA 3UTEA 3RP8A 1GRAA 1IUVA 4CCQA 2FBWA 1Y56A 1H81A 3VR9A 1NHRA 1TDNA 3LJPA 4Y4MA 2GR0A 1KFYA 1E1KA 4EIQA 3UCLA 4Y4NA 2YWLA 3M12A 1FOHA 1GEUA 2H89A 3GRSA 2YR5A 2YQUA 3NHOX 1OJDA 5BUKA 3GWFA 2YG3A 3DA1A 4PAAA 1Q9IA 3KLJA 1H83A 3LZXA 1CBOA 2AQJA 1MO9A 4IA6A 2R9ZA 1PBDA 1Y56B 4NNJA 2QCUA 4BURA 4JNQA 3G5QA 2V3BA 4YSXA 4GRTA 2AR8A 5JCMA 3PO7A 4YTNA 3DGHA 1TYTA 1KN0A 1XPQA 3GYXA 2GR2A 5IQ4A 3ALJA 2YVGA 3UOZA 1YQZA 2BA9A 4USQA 1VDCA 3NH3X 2C3CA 2OALA 1LPFA 1IUTA 5BRTA 5CKUA 5EBKA 3SZWA 3NTDA 1P2HA 1DODA 4H2PA 1GRGA 4ICYA 2V5ZA 4DGKA 2XFNA 4H50A 1GT8A 1TDKA 3F8DA 3K7QX 4KX6A 5JCLA 3AB1A 2WU5A 1PJ7A 4JQ9A 4Z2RA 3ICSA 1QLBA 5KOXA 2XCGA 4J31A 2XLUA 1IUXA 2XVJA 2X99A 4GDEA 2A8XA 4IV9A 1VG0A 4AP3A 4C74A 3AYIA 3LB8A 2EQ7A 4WCTA 2H88A 2OLOA 4ZCCA 4GF7A 2BABA 2ZZ0A 4Z2TA 4H4ZA 2X8HA 3GD3A 5FS8A 3T14A 2WESA 2BK4A 3P1WA 4FX9A 3ABVA 4O5UA 3ADAB 4EMJA 4GDPA 3BHFA 4J34A 3CGCA 1FCDA 3NYEA 4CCRA 3NNEA 5JCIA 4H4UA 2XFOA 1K0IA 2QA1A 1BF3A 3H8IA 3HYVA 4H2RA 2WBAA 2IIDA 3B6DA 2A89A 1ZOVA 4J2WA 4BK3A 1N1PA 4YWOA 1GRFA 1MXTA 1CC4A 2Q6UA 3T2ZA 2ZBWA 3NKSA 4O5QA 2YLRA 1H2IA 2XVFA 1M64A 2YG6A 1LQTA 3AXBA 2CFYA 4OPLA 3ICRA 4X4JA 5HHFA 3P4PA 3SFDA 2BC1A 5JCNA 2X50A 2FJEA 2Q0KA 2J3NA 4RSLA 3AWIA 4OVIA 2CULA 2XFQA 3LXDA 1JNZA 3P4RA 5FMHA 3EPTA 3NYFA 3V3NA 3DJDA 1V59A 3AE7A 2EQ9A 2BS2A 2YG4A 3PG6A 4U8NA 2C64A 2JB2A 2ARDA 2WDRA 2BS3A 2HQMA 3BNMA 1K4QA 1DOEA 2WPCA 1ELIA 1PDHA 3NK0X 2GMHA 3HZLA 1IUSA 3HYXA 4U8PA 4EIPA 4Z25A 2YLXA 1NEKA 2RGHA 2VQ7A 2WU2A 3NG7X 4U8JA 5GRTA 3NIXA 5BVAA 2YG7A 3GSIA 1NHSA 4AP1A 3L8KA 2QA2A 3AYLA 4U2SA 4E0VA 4TLZA 3UKQA 3UKKA 1N4UA 1JRZA 1CC2A 3NYCA 1UKVG 4JDRA 2B9YA 4H4RA 4KPRA 4EQWA 1TDOA 1O94A 1GPEA 2BCPA 2BXRA 2FJAA 2ZZBA 2FJBA 2B76A 4GAPA 1H82A 1Q1WA 1GETA 5GSNA 1OJTA 4OPUA 3UKAA 4AOXA 3FG2P 1ZK7A 4DSHA 2BK3A 4RG4A 3S61A 3FIMB 3L5OA 4U2TA 1IUUA 3CNTA 3ATRA 3QSMA 3UP4A 3VRBA 1ZY8A 1NENA 1ZMCA 2WHDA 2WETA 1KNRA 4FK1C 4GUVA 5C2TA 2B9XA 1B37A 2C75A 4JN9A 5KMRA 4H4PA 1EL9A 4UDQA 4YKFA 4A7AA 4B63A 2GAGB 4C3XA 2WEUA 4EQSA 3KVEA 2C76A 1OJCA 3F8PA 1GALA 3JSKA 3NT6A 4H4WA 3CMMA 3UKPA 4H2NA 1PBBA 1GSNA 1YQ4A 1ZDLA 1IUWA 3AE2A 4K5SA 4GR1A 3L1RA 1N4VA 4UP3A 5IPYA 1ZOYA 1S7MA 1O95A 2O9ZA 2R0GA 3SZFA 4B64A 2YAUA 1NPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YR6 A;  3AEC A;  3AEG A;  2IVD A;  1GER A;  4U8I A;  2XFP A;  3AEF A;  1E6E A;  1Y0P A;  1NAA A;  1KDG A;  2YM1 A;  3BHK A;  1JEH A;  1BGJ A;  3CPI G;  5KWF A;  2YLZ A;  2OAM A;  2BAC A;  3AD8 B;  2GV8 A;  3Q6J A;  2VVL G;  5C3J A;  4H4S A;  1VRQ B;  1S2Q A;  1GRB A;  4A79 A;  3H4K A;  2E4G A;  3AE3 A;  4APN A;  1F8R A;  2R4J A;  3FBS A;  4K8D A;  3CNS A;  1GTH A;  5EB4 A;  3SQP A;  2JAE A;  3CIR A;  4YT0 A;  4IA5 A;  4EMW A;  4NTD A;  3ZYX A;  4K7Z A;  3GRT A;  3LZW A;  4ECH A;  1PXB A;  5JCK A;  4IVM B;  4A99 A;  3IC9 A;  2X3N A;  3E1T A;  4EQR A;  1LVL A;  1TYP A;  3DH9 A;  2PYX A;  1TDF A;  2GQF A;  2YR4 A;  2VQB A;  1CJC A;  1W4X A;  2GVC A;  2ZZC A;  5FS9 A;  4JY3 A;  4YTP A;  3DK4 A;  3PVC A;  4H4X A;  3K30 A;  3CNJ A;  1BWC A;  2WOI A;  1OJA A;  3KKJ A;  4YSH A;  2XLP A;  1H84 A;  3O0H A;  4B68 A;  1PS9 A;  3IWA A;  1JNR A;  3GDP A;  2F5Z A;  3KD9 A;  4NEV A;  4NTE A;  1D7Y A;  4B67 A;  3D1C A;  2C3D A;  3UTF A;  4CBQ A;  4CNJ A;  1SEZ A;  1JRY A;  4C3Y A;  4C5O A;  3QVR A;  1D4D A;  4Y4L A;  4U8L A;  4BV6 A;  1D7L A;  3GYI A;  3RP7 A;  3SGL A;  4OPI A;  4X9M A;  3P4S A;  3FPZ A;  3R9U A;  5HYM A;  3CPJ G;  3CGB A;  4CRT A;  5FS7 A;  1Z6L A;  2WS3 A;  3LAD A;  1CHU A;  4TM1 A;  4BJY A;  3WE0 A;  1GND A;  1B5Q A;  3UOV A;  1VG9 A;  2GRT A;  1NDA A;  4H7U A;  2NVK X;  1K0J A;  1ZMD A;  4B66 A;  3DME A;  5FS6 A;  1XAN A;  1EL5 A;  2C65 A;  1YY5 A;  3UKF A;  4ZCD A;  3VR8 A;  4H2Q A;  2WOW A;  1E1N A;  1CJ3 A;  2C72 A;  3NLC A;  4HA6 A;  1S3E A;  4M52 A;  1DNC A;  3PS9 A;  4CNK A;  4Z24 A;  1E1L A;  2C73 A;  3AD9 B;  4USR A;  3UP5 A;  2WP5 A;  1H6V A;  1CJ4 A;  4CY8 A;  3AE5 A;  3DGZ A;  3IHG A;  4B1B A;  4PAB A;  1TRB A;  1L9C A;  5TR3 A;  2YLW A;  4NZH A;  4A9W A;  3V3O A;  2R4E A;  3DK8 A;  3IHM A;  5M10 A;  4D03 A;  2JKC A;  2UZZ A;  5ER0 A;  4DSG A;  2VZ2 A;  2JK6 A;  3CGE A;  3M0O A;  3AD7 B;  1CJ2 A;  1GES A;  1S2Y A;  2OA1 A;  3QFB A;  2VOU A;  1NG4 A;  5J7X A;  3BNU A;  4H4Y A;  3NK1 X;  3AYJ A;  4U8K A;  5M0Z A;  1AOG A;  3DJJ A;  4J56 A;  3D8X A;  1IJH A;  2BYB A;  4EQX A;  4JY2 A;  3T37 A;  4BJZ A;  3K7M X;  4CY6 A;  1DJQ A;  3AE4 A;  3KU9 A;  3OZ2 A;  4MJW A;  1XHC A;  1DOC A;  3EF6 A;  3CNP A;  3UTH A;  5KOW A;  1KF6 A;  1F8S A;  3GYJ A;  1QO8 A;  1CC6 A;  2GF3 A;  4K2X A;  2QAE A;  2CVJ A;  5LV9 A;  1B4V A;  2ACZ A;  2DKI A;  3C4N A;  2FJD A;  2XFU A;  1H86 A;  3P4Q A;  2XVI A;  1ZKQ A;  5KVI A;  4I59 A;  3G5S A;  2WDQ A;  2VRL A;  2GH5 A;  1COY A;  1ZX9 A;  3QVP A;  3ICT A;  3QFA A;  4IVO B;  4UDR A;  4A6N A;  4YSZ A;  4J33 A;  2RGO A;  3GD4 A;  1X31 B;  2GB0 A;  1LQU A;  1RP0 A;  3ITJ A;  2B7S A;  5J60 A;  3GDN A;  2V3A A;  4TM4 A;  2Y6R A;  3RED A;  3UKH A;  3I6D A;  1GRT A;  1KSS A;  4EM3 A;  2BCG G;  1Q1R A;  1GRE A;  1RSG A;  3OC4 A;  1LJ1 A;  1YKJ A;  3FMW A;  1D4E A;  3F8R A;  4J36 A;  4REK A;  5CQF A;  1L9E A;  4A6N B;  1LV0 A;  2TPR A;  1KNP A;  2BS4 A;  2BC0 A;  1BGN A;  4HB9 A;  3CPH G;  4BK2 A;  4EM4 A;  5EOW A;  2EQ6 A;  1ZP0 A;  1D4C A;  4U2L A;  3DJG X;  1PJ6 A;  3IF9 A;  1BKW A;  4I58 A;  2B7R A;  3ZDN A;  4XWZ A;  2RAB A;  5KXJ A;  1E7P A;  2C70 A;  1K0L A;  5L46 A;  2Q0L A;  1H7W A;  3C96 A;  1D5T A;  4GCM A;  2Y6Q A;  4Z44 A;  1L9D A;  3AE9 A;  3NTA A;  1FL2 A;  2APG A;  2XVE A;  4U8M A;  3VRD B;  3S5W A;  3CND A;  4YTM A;  2WP9 A;  4ZN0 A;  1VQW A;  5KVH A;  3UKL A;  4A65 A;  4J57 A;  1N4W A;  1PXA A;  3KA7 A;  4ADW A;  3KPF A;  3V76 A;  4YKG A;  3BI4 A;  1HYU A;  1GV4 A;  4H4Q A;  4H4T A;  1JU2 A;  1NG3 A;  2YM2 A;  2C66 A;  2WQY A;  1BZL A;  3NK2 X;  4TM3 A;  3AEB A;  2RGJ A;  2XDO A;  1CL0 A;  1REO A;  4OPC A;  2V60 A;  4Z2U A;  1O5W A;  4K22 A;  2Z5Y A;  2YVJ A;  3VRA A;  2W0H A;  2C7G A;  2JB1 A;  3RP6 A;  1YQ3 A;  2VRM A;  3GMB A;  4AT0 A;  1JOA A;  4YXD A;  1PBF A;  3K7T A;  1EL8 A;  3URH A;  3BI5 A;  4JNA A;  3ALM A;  1FEC A;  1DJN A;  1PXC A;  3G5R A;  4AOS A;  4RG3 A;  3AE8 A;  1S3B A;  4XWR A;  2GMJ A;  1GXF A;  4FDC B;  2GQW A;  3II4 A;  4B69 A;  2AAQ A;  4DNA A;  3AEA A;  4YSY A;  2EQ8 A;  4D04 A;  4EMI A;  1GRH A;  2IVE A;  3BI2 A;  2WPE A;  1EL7 A;  1E39 A;  1JRX A;  3AE6 A;  4N9X A;  4OPG A;  4OPD A;  3DK9 A;  2GR1 A;  2XLS A;  5DBJ A;  2A87 A;  3H8L A;  1CF3 A;  1RYI A;  3I3L A;  1DOB A;  3RNM A;  1PBE A;  3QSE A;  2BK5 A;  2B9W A;  3QSS A;  4LII A;  4X9N A;  1TDE A;  2WDV A;  2PHH A;  4TM0 A;  2E5V A;  1P2E A;  3SM8 A;  3B3R A;  2YG5 A;  1XDI A;  2YLT A;  3NRN A;  2NPX A;  2DKH A;  2R0C A;  1ONF A;  3CGD A;  4Z43 A;  2Q7V A;  3AEE A;  4OCG A;  1FEA A;  4Z26 A;  3Q9T A;  1MOK A;  4LA1 A;  2CDU A;  4B65 A;  4H4V A;  3DJE A;  3CTY A;  3EAN A;  5U63 A;  1DXL A;  2X8G A;  3NGC X;  3C4A A;  4OPT A;  1PJ5 A;  5BUL A;  2BXS A;  3NN0 X;  1OJ9 A;  2XLR A;  3GWD A;  1F3P A;  3VQR A;  3ISH A;  1F8W A;  3P9U A;  3UOY A;  4WX1 A;  5HY5 A;  1GTE A;  1QJD A;  2GEW A;  1NHP A;  1LTX R;  3QJ4 A;  2Z5X A;  1KSU A;  1PHH A;  3M13 A;  1F6M A;  3UOX A;  4C77 A;  2WP6 A;  4A5L A;  2JB3 A;  2R0P A;  2R46 A;  3GMC A;  2I0Z A;  3EAO A;  2V61 A;  2GAH B;  2VVM A;  1PN0 A;  1H7X A;  2TMD A;  5KRQ A;  5IQ1 A;  2YVF A;  2GR3 A;  1NHQ A;  1M6I A;  2OLN A;  4NEW A;  4K5R A;  1L0V A;  2XLT A;  2XYO A;  4U8O A;  5EB5 A;  4FK1 A;  2WPF A;  2V6O A;  1PBC A;  3ATQ A;  4NTC A;  3AED A;  3ALL A;  2C67 A;  2JBV A;  5HXI A;  1EBD A;  4LU6 A;  2YLS A;  3AE1 A;  3SFE A;  4AT2 A;  2X8C A;  4UDP A;  4P9S A;  1E1M A;  3COX A;  4TLX A;  4BK1 A;  3CN8 A;  1FEB A;  5U25 A;  2VVL A;  2XVH A;  3LOV A;  4XXG A;  1B8S A;  2R45 A;  3RHA A;  3UTG A;  5U1O A;  3NN6 X;  2E1M A;  2WOV A;  1GOS A;  3UTE A;  3RP8 A;  1GRA A;  1IUV A;  4CCQ A;  2FBW A;  1Y56 A;  1H81 A;  3VR9 A;  1NHR A;  1TDN A;  3LJP A;  4Y4M A;  2GR0 A;  1KFY A;  1E1K A;  4EIQ A;  3UCL A;  4Y4N A;  2YWL A;  3M12 A;  1FOH A;  1GEU A;  2H89 A;  3GRS A;  2YR5 A;  2YQU A;  3NHO X;  1OJD A;  5BUK A;  3GWF A;  2YG3 A;  3DA1 A;  4PAA A;  1Q9I A;  3KLJ A;  1H83 A;  3LZX A;  1CBO A;  2AQJ A;  1MO9 A;  4IA6 A;  2R9Z A;  1PBD A;  1Y56 B;  2QCU A;  4BUR A;  4JNQ A;  3G5Q A;  2V3B A;  4YSX A;  4GRT A;  2AR8 A;  5JCM A;  3PO7 A;  4YTN A;  3DGH A;  1TYT A;  1XPQ A;  2GR2 A;  5IQ4 A;  3ALJ A;  2YVG A;  3UOZ A;  1YQZ A;  2BA9 A;  4USQ A;  1VDC A;  3NH3 X;  2C3C A;  2OAL A;  1LPF A;  1IUT A;  5BRT A;  5CKU A;  5EBK A;  3NTD A;  1P2H A;  1DOD A;  4H2P A;  1GRG A;  4ICY A;  2V5Z A;  4DGK A;  2XFN A;  4H50 A;  1GT8 A;  1TDK A;  3F8D A;  3K7Q X;  4KX6 A;  5JCL A;  3AB1 A;  2WU5 A;  1PJ7 A;  4JQ9 A;  4Z2R A;  3ICS A;  1QLB A;  5KOX A;  2XCG A;  4J31 A;  2XLU A;  1IUX A;  2XVJ A;  2X99 A;  4GDE A;  2A8X A;  4IV9 A;  1VG0 A;  4AP3 A;  4C74 A;  3AYI A;  3LB8 A;  2EQ7 A;  4WCT A;  2H88 A;  2OLO A;  4ZCC A;  4GF7 A;  2BAB A;  2ZZ0 A;  4Z2T A;  4H4Z A;  2X8H A;  3GD3 A;  5FS8 A;  2WES A;  2BK4 A;  3P1W A;  4FX9 A;  3ABV A;  4O5U A;  3ADA B;  4EMJ A;  4GDP A;  3BHF A;  4J34 A;  3CGC A;  1FCD A;  3NYE A;  4CCR A;  3NNE A;  5JCI A;  4H4U A;  2XFO A;  1K0I A;  2QA1 A;  1BF3 A;  3H8I A;  4H2R A;  2WBA A;  2IID A;  3B6D A;  2A89 A;  1ZOV A;  4J2W A;  4BK3 A;  1N1P A;  4YWO A;  1GRF A;  1MXT A;  1CC4 A;  2Q6U A;  2ZBW A;  3NKS A;  4O5Q A;  2YLR A;  2XVF A;  1M64 A;  2YG6 A;  1LQT A;  3AXB A;  2CFY A;  4OPL A;  3ICR A;  4X4J A;  5HHF A;  3P4P A;  3SFD A;  2BC1 A;  5JCN A;  2X50 A;  2FJE A;  2Q0K A;  2J3N A;  4RSL A;  3AWI A;  4OVI A;  2CUL A;  2XFQ A;  3LXD A;  1JNZ A;  3P4R A;  5FMH A;  3EPT A;  3NYF A;  3V3N A;  3DJD A;  1V59 A;  3AE7 A;  2EQ9 A;  2BS2 A;  2YG4 A;  4U8N A;  2C64 A;  2JB2 A;  2ARD A;  2WDR A;  2BS3 A;  2HQM A;  3BNM A;  1K4Q A;  1DOE A;  2WPC A;  1ELI A;  1PDH A;  3NK0 X;  2GMH A;  3HZL A;  1IUS A;  4U8P A;  4EIP A;  4Z25 A;  2YLX A;  1NEK A;  2RGH A;  2VQ7 A;  2WU2 A;  3NG7 X;  4U8J A;  5GRT A;  3NIX A;  5BVA A;  2YG7 A;  3GSI A;  1NHS A;  4AP1 A;  3L8K A;  2QA2 A;  3AYL A;  4U2S A;  4E0V A;  4TLZ A;  3UKQ A;  3UKK A;  1N4U A;  1JRZ A;  1CC2 A;  3NYC A;  1UKV G;  4JDR A;  2B9Y A;  4H4R A;  4KPR A;  4EQW A;  1TDO A;  1O94 A;  1GPE A;  2BCP A;  2BXR A;  2FJA A;  2ZZB A;  2FJB A;  2B76 A;  1H82 A;  1Q1W A;  1GET A;  5GSN A;  1OJT A;  4OPU A;  3UKA A;  4AOX A;  3FG2 P;  1ZK7 A;  4DSH A;  2BK3 A;  4RG4 A;  3S61 A;  3FIM B;  4U2T A;  1IUU A;  3CNT A;  3ATR A;  3QSM A;  3UP4 A;  3VRB A;  1ZY8 A;  1NEN A;  1ZMC A;  2WHD A;  2WET A;  1KNR A;  4FK1 C;  4GUV A;  5C2T A;  2B9X A;  1B37 A;  2C75 A;  4JN9 A;  4H4P A;  1EL9 A;  4UDQ A;  4YKF A;  4A7A A;  4B63 A;  2GAG B;  4C3X A;  2WEU A;  4EQS A;  3KVE A;  2C76 A;  1OJC A;  3F8P A;  1GAL A;  3JSK A;  3NT6 A;  4H4W A;  3UKP A;  4H2N A;  1PBB A;  1GSN A;  1YQ4 A;  1ZDL A;  1IUW A;  3AE2 A;  4K5S A;  4GR1 A;  3L1R A;  1N4V A;  4UP3 A;  5IPY A;  1ZOY A;  1O95 A;  2O9Z A;  2R0G A;  4B64 A;  2YAU A;  1NPX A; 
#chains in the Genus database with same CATH topology
 3R25 A;  1KDG A;  2DW7 A;  2VVL G;  1S2Q A;  3FVD A;  1GRB A;  3H4K A;  4YT0 A;  4K7Z A;  5JCK A;  3P93 A;  2NQL A;  2X3N A;  1JDF A;  3E1T A;  1TDF A;  1CJC A;  4GYP A;  2GVC A;  4H4X A;  4GYP C;  5IDZ A;  3O0H A;  3KD9 A;  4C5O A;  1D7L A;  3R07 C;  3SGL A;  4JN8 A;  1N61 C;  4OPI A;  5HYM A;  4CRT A;  1Z6L A;  4E4F A;  4GGB A;  3WE0 A;  1GND A;  2NVK X;  1K0J A;  2BRA A;  3DME A;  5FS6 A;  3SZ0 A;  1XAN A;  1EL5 A;  3UKF A;  4H2Q A;  2WOW A;  3MQT A;  1DNC A;  3PS9 A;  4Z24 A;  3AD9 B;  3AE5 A;  3IHG A;  5TR3 A;  4NZH A;  3SY4 A;  3V3O A;  3SJN A;  3NVW B;  4D03 A;  2JKC A;  2BRY A;  2JK6 A;  1GES A;  2OA1 A;  5J7X A;  3NK1 X;  2PGW A;  1AOG A;  4ROP A;  1IJH A;  4CY6 A;  4MJW A;  2QJM A;  3CNP A;  1F8S A;  3GYJ A;  1VQZ A;  2CVJ A;  2ACZ A;  1H86 A;  3Q45 A;  3G5S A;  1ZX9 A;  3QFA A;  4UDR A;  4J33 A;  3CK5 A;  2RGO A;  1RP0 A;  5J60 A;  4TM4 A;  3UKH A;  2OKT A;  1D4E A;  4IP4 A;  4REK A;  4A6N B;  2BC0 A;  4BK2 A;  2XH2 A;  3MWC A;  3ES7 A;  2EQ6 A;  3IF9 A;  3ZDN A;  3T0K A;  2OZ8 A;  1E7P A;  2Q0L A;  3S5W A;  5FJU A;  4YTM A;  4H83 A;  4J57 A;  3KA7 A;  1PXA A;  4ADW A;  3BI4 A;  2OPJ A;  1WUF A;  2YM2 A;  1BZL A;  3SR6 B;  4TM3 A;  2XDO A;  1CL0 A;  4OPC A;  3V3W A;  2HZG A;  2Z5Y A;  4G9K A;  3OPS A;  2JB1 A;  3RP6 A;  1YQ3 A;  3G5R A;  4DWD A;  1GXF A;  2AAQ A;  1EL7 A;  1JRX A;  4OPG A;  4OPD A;  3DK9 A;  2GR1 A;  3FV9 A;  2A87 A;  3V5C A;  4X9N A;  3H7V A;  2WDV A;  4TM0 A;  2E5V A;  3B3R A;  1EC9 A;  3SXI A;  1XDI A;  3NRN A;  2NPX A;  2R0C A;  4Z43 A;  3VCC A;  3D46 A;  4OCG A;  1FEA A;  4Z26 A;  1MOK A;  1VDV A;  1KKR A;  3DJE A;  3CTY A;  3DEQ A;  5U63 A;  1DXL A;  2P88 A;  3UJR A;  3NN0 X;  3GWD A;  4G73 A;  3UOY A;  1SJC A;  4WX1 A;  2GEW A;  1NHP A;  3QJ4 A;  3N4F A;  1KSU A;  1PHH A;  3DIP A;  2JB3 A;  2R46 A;  2GAH B;  1PN0 A;  1M6I A;  2OLN A;  5EB5 A;  4HCH A;  4NTC A;  4IT1 A;  5HXI A;  1JPM A;  3SFE A;  1N63 C;  4UDP A;  3DG6 A;  3TJI A;  3CN8 A;  1FEB A;  2VVL A;  4XXG A;  3RHA A;  3UTG A;  3NN6 X;  3HYW A;  3RP8 A;  1GRA A;  1IUV A;  2MUC A;  3VR9 A;  4Y4M A;  4J3Z A;  3PWI A;  3RGT A;  1STZ A;  3M12 A;  1KKO A;  1GEU A;  3EUB 3;  3GRS A;  2H89 A;  2YR5 A;  5BUK A;  3GWF A;  2YG3 A;  2AL1 A;  2OQY A;  1MO9 A;  2R9Z A;  4JNQ A;  3ES8 A;  4YSX A;  5IQ4 A;  3ALJ A;  2YVG A;  3IJI A;  1R6W A;  3A7A A;  2BA9 A;  3VC5 A;  1VDC A;  3TW9 A;  1LPF A;  1IUT A;  5CKU A;  5EBK A;  2GL5 A;  3ZLH A;  2XFN A;  3AB1 A;  3SN1 A;  2XVJ A;  3MY9 A;  2PP3 A;  1VG0 A;  3AYI A;  1R0M A;  2PSN A;  4GF7 A;  2ZZ0 A;  3EKG A;  2X8H A;  2P3Z A;  4EMJ A;  4EWJ A;  4J34 A;  3PFR A;  1FHV A;  1XS2 A;  4H4U A;  3GY1 A;  3H8I A;  2IID A;  2GDQ A;  2PTY A;  1CC4 A;  2PTW A;  2ZBW A;  1H2I A;  2XFQ A;  3R11 A;  3LXD A;  2CHR A;  2P8C A;  2EQ9 A;  2BS2 A;  2C64 A;  1PDH A;  4Z25 A;  2WU2 A;  5BVA A;  3UKK A;  1N4U A;  4DHG A;  4E8G A;  4JDR A;  1DTN A;  1O94 A;  2FJB A;  1H82 A;  1Q1W A;  2W3S A;  3DER A;  3FG2 P;  3H8A A;  2BK3 A;  3S61 A;  3FIM B;  3L5O A;  5FJT A;  3UP4 A;  3VRB A;  4GUV A;  3VFC A;  4A7A A;  3VCN A;  4EQS A;  1OJC A;  3JSK A;  1MUC A;  3OTR A;  1IUW A;  4K5S A;  4GR1 A;  1SJD A;  3P0W A;  4UP3 A;  1ZOY A;  1S7M A;  3RRA A;  4B64 A;  2YR6 A;  2XFP A;  3AEF A;  1E6E A;  1Y0P A;  3CPI G;  5KWF A;  2OAM A;  3AD8 B;  2GV8 A;  3Q6J A;  5C3J A;  3TQP A;  4H19 A;  3FBS A;  2JAE A;  4G6H A;  4EMW A;  3GRT A;  3N6H A;  3TOY A;  3NVZ B;  3OZY A;  4MKS A;  1LVL A;  1TYP A;  2ZZC A;  4YTP A;  3DK4 A;  1BWC A;  2WOI A;  2PA6 A;  4YSH A;  3KPK A;  4B68 A;  1JNR A;  2F5Z A;  2XH4 A;  1JRO A;  3ZVH B;  4B67 A;  3SBF A;  3D1C A;  4CNJ A;  4CBQ A;  1SEZ A;  4C3Y A;  3QVR A;  4Y4L A;  4BV6 A;  5EU9 A;  3R9U A;  3FPZ A;  3CPJ G;  3LAD A;  3VDG A;  1YEY A;  2OZT A;  1B5Q A;  1NDA A;  4H7U A;  3Q4D A;  1YY5 A;  3VR8 A;  1CJ3 A;  1E1L A;  3UP5 A;  1H6V A;  3DGZ A;  1TRB A;  1L9C A;  4A9W A;  4DSG A;  2VZ2 A;  1X2G A;  3UJE A;  1NG4 A;  3D9X A;  4GAV A;  3D8X A;  2BYB A;  4EQX A;  2OLA A;  4JY2 A;  4BJZ A;  1DJQ A;  3OZ2 A;  1XHC A;  1DOC A;  3UJS A;  1CC6 A;  2GF3 A;  1B4V A;  2DKI A;  2XFU A;  3P4Q A;  4KWS A;  2WDQ A;  2GGJ A;  3ICT A;  4YSZ A;  2ZC8 A;  3GD4 A;  3I4K A;  3K1G A;  3GDN A;  2V3A A;  2Y6R A;  2PU1 A;  4EM3 A;  1WYG A;  1RSG A;  1GRE A;  1YKJ A;  3GO2 A;  1L9E A;  5EOW A;  1ZP0 A;  4U2L A;  3V4B A;  2QDD A;  2B7R A;  5KMP A;  2C70 A;  4JHM A;  3HPF A;  3C96 A;  4GCM A;  4Z44 A;  4G74 A;  3AE9 A;  1FL2 A;  3QPE A;  3RCY A;  3CND A;  2QDE A;  3V76 A;  2PTZ A;  3CT2 A;  3NK2 X;  2C4C A;  1REO A;  1N60 C;  4K22 A;  3TCS A;  3VRA A;  4AT0 A;  1PBF A;  3K7T A;  3BI5 A;  3ENL A;  1BQG A;  3QTP A;  1PXC A;  4RG3 A;  3AE8 A;  3UJ2 A;  4TVY A;  4B69 A;  4DNA A;  3AEA A;  4YSY A;  2IVE A;  2WPE A;  4N9X A;  4FI4 A;  4HCD A;  5DBJ A;  3I3L A;  1DOB A;  2B9W A;  3QSS A;  1P2E A;  5G5H B;  2YG5 A;  2YLT A;  1ONF A;  3CGD A;  3AEE A;  1SJA A;  1JCT A;  4B65 A;  4II2 A;  2AL2 A;  1N5X A;  4GME A;  3NGC X;  4MMW A;  4OPT A;  3T6C A;  1OJ9 A;  1F3P A;  1OEP A;  1F8W A;  3T31 A;  1QJD A;  3GD6 A;  3M13 A;  1F6M A;  4C77 A;  2WP6 A;  4A5L A;  2OQH A;  2R0P A;  3GMC A;  3EAO A;  2V61 A;  4HCL A;  2TMD A;  5IQ1 A;  1NHQ A;  1L0V A;  4U8O A;  4FK1 A;  3ATQ A;  2WPF A;  3AED A;  2JBV A;  1EBD A;  3AE1 A;  4KEM A;  4YWS A;  4BK1 A;  4KT2 A;  5U25 A;  1B8S A;  5KMS A;  3JW7 A;  4CCQ A;  2FBW A;  1Y56 A;  1FO4 A;  1KFY A;  1E1K A;  6ENL A;  1OJD A;  4MGG A;  4PAA A;  3KLJ A;  1H83 A;  4K2S A;  1CBO A;  3LZX A;  1PBD A;  4HYR A;  2QCU A;  4BUR A;  4HNC A;  5FJO A;  3DGH A;  1N62 C;  1YQZ A;  4USQ A;  3VA8 A;  2OX4 A;  2C3C A;  2ONE A;  1FFV C;  2OAL A;  5BRT A;  2PCE A;  1DOD A;  4DGK A;  3F8D A;  1GT8 A;  1MNS A;  2WU5 A;  1QLB A;  2XCG A;  2XLU A;  2X99 A;  4AP3 A;  3LB8 A;  1BKH A;  2HXT A;  3GD3 A;  5FS8 A;  3T14 A;  2BK4 A;  4O5U A;  4FX9 A;  4ZOH B;  3CGC A;  4CCR A;  3STP A;  2WBA A;  1N1P A;  4ZCW A;  4HPN A;  1M64 A;  3AXB A;  2CFY A;  3ICR A;  3SFD A;  2X50 A;  2CUL A;  3CB3 A;  1ELS A;  3AE7 A;  2XH0 A;  4U8N A;  2WDR A;  2JB2 A;  2HQM A;  1MDR A;  3NK0 X;  2GMH A;  3HZL A;  1IUS A;  4U8P A;  2VQ7 A;  3NG7 X;  3QLD A;  2YG7 A;  3GSI A;  1NHS A;  3L8K A;  2QA2 A;  3AYL A;  1XPY A;  4GIR A;  4U2S A;  3UKQ A;  3NYC A;  4KPR A;  4EQW A;  1TDO A;  2BXR A;  2ZZB A;  3NS1 B;  1OJT A;  2XGZ A;  3UKA A;  2PGE A;  1ZY8 A;  2WET A;  5C2T A;  2C75 A;  4H4P A;  4UDQ A;  4B63 A;  4C3X A;  2FKP A;  3NT6 A;  1GSN A;  3AE2 A;  3I6E A;  1O95 A;  2R0G A;  4HNL A;  1NPX A;  3AEC A;  2IVD A;  1GER A;  4U8I A;  2YM1 A;  1JEH A;  5BOF A;  2YLZ A;  2BAC A;  1JPD X;  3B9J B;  4NWZ A;  2R4J A;  4K8D A;  1GTH A;  5EB4 A;  3CIR A;  4IA5 A;  3LZW A;  4GIS A;  1X2H A;  4IVM B;  4A99 A;  2PYX A;  3DH9 A;  3NFU A;  4II3 A;  3DES A;  4JY3 A;  3DG7 A;  1EBH A;  2GGG A;  1OJA A;  1H84 A;  3SZC A;  1PS9 A;  5BOE A;  4KPL A;  3GDP A;  4NTE A;  2C3D A;  3UTF A;  1D4D A;  4U8L A;  3RP7 A;  3P4S A;  3CGB A;  5FS7 A;  3UXL A;  3SX6 A;  3ZVI A;  3NZG A;  3U4F A;  4BJY A;  2GRT A;  3KUM A;  4G6G A;  1ZMD A;  2AKM A;  4B66 A;  2C72 A;  2W3R A;  3IJQ A;  4CNK A;  1TKK A;  3UCC A;  2WP5 A;  4CY8 A;  4B1B A;  2GGE A;  2R4E A;  3IHM A;  5FJR A;  2UZZ A;  5ER0 A;  3SYI A;  3CGE A;  2DW6 A;  4DX3 A;  3QFB A;  2VOU A;  2PS2 A;  5M0Z A;  3DJJ A;  3S47 A;  4J56 A;  2OG9 A;  5JRB A;  3AE4 A;  2E3T A;  3EF6 A;  5KOW A;  4ENL A;  2QAE A;  5LV9 A;  3C4N A;  3TTE A;  4Z1Y A;  2FJD A;  2XVI A;  1ZKQ A;  3OW1 A;  2PTX A;  4I59 A;  1COY A;  3QVP A;  2I5Q A;  4IL2 A;  4A6N A;  2GB0 A;  3MZN A;  3RED A;  1EBG A;  2BCG G;  3FMW A;  3OC4 A;  3F8R A;  5CQF A;  3RO6 A;  2BS4 A;  4HB9 A;  4DN1 A;  2P8B A;  3NRZ B;  4M6U A;  1NU5 A;  1H7W A;  1D5T A;  2Y6Q A;  3NO1 A;  3R10 A;  4U8M A;  2POD A;  2WP9 A;  4ZN0 A;  5KVH A;  3UKL A;  3KPF A;  4YKG A;  3A7R A;  1HYU A;  4H4Q A;  1JU2 A;  1NG3 A;  2WQY A;  2MNR A;  3AEB A;  2RGJ A;  4Z2U A;  3V5F A;  2YVJ A;  2W0H A;  4YXD A;  4H2H A;  1EL8 A;  4JNA A;  3IJL A;  3AM9 A;  3ALM A;  4GFI A;  4AOS A;  2OVL A;  4XWR A;  2GMJ A;  3QKE A;  4FDC B;  3II4 A;  3T2K A;  2EQ8 A;  4D04 A;  4EMI A;  1GRH A;  3BI2 A;  1PDY A;  1FHU A;  2XLS A;  1CF3 A;  1RYI A;  3QSE A;  2BK5 A;  2GSH A;  3I6T A;  4LII A;  2PHH A;  2DKH A;  3T4W A;  2Q7V A;  4LA1 A;  2RDX A;  2CDU A;  3OZM A;  3B97 A;  3EAN A;  2X8G A;  3A7U A;  3OP2 A;  1PJ5 A;  3VQR A;  3ZLF A;  3P9U A;  1GTE A;  1LTX R;  1V97 A;  1JRP A;  1TE6 A;  3UOX A;  2I0Z A;  2VVM A;  3T9P A;  5KRQ A;  2YVF A;  2GR3 A;  4K5R A;  2XYO A;  1W6T A;  2V6O A;  3ALL A;  3SN0 A;  3COX A;  2XVH A;  2R45 A;  5G5G B;  5U1O A;  1GOS A;  1H81 A;  1NHR A;  1TDN A;  2QVH A;  4DXK A;  4EIQ A;  4HN8 A;  2YWL A;  1RVK A;  1Q9I A;  2AQJ A;  4IA6 A;  4NNJ A;  3G5Q A;  2AR8 A;  5JCM A;  4YTN A;  1TYT A;  1KN0 A;  1XPQ A;  2QJJ A;  3N4E A;  3GYX A;  3UOZ A;  3NH3 X;  3HRD C;  4X2P A;  3P3B A;  3NTD A;  3UGV A;  3EEZ A;  4ICY A;  1T3Q C;  4KX6 A;  1IYX A;  1PJ7 A;  4Z2R A;  3ICS A;  3THU A;  3HW2 A;  4J31 A;  2GGI A;  1IUX A;  4IV9 A;  4C74 A;  2EQ7 A;  4WCT A;  2H88 A;  4ZCC A;  2BAB A;  4Z2T A;  4FP1 A;  3ADA B;  4GDP A;  1FCD A;  2XFO A;  1K0I A;  5FJP A;  2QA1 A;  1BF3 A;  3UXK A;  4H2R A;  3B6D A;  2A89 A;  4E4U A;  3PWG A;  2Q6U A;  2YLR A;  2YG6 A;  1LQT A;  5HHF A;  2BC1 A;  5JCN A;  2FJE A;  4RSL A;  2J3N A;  3AWI A;  4OVI A;  1JNZ A;  5FMH A;  3EPT A;  3NYF A;  3V3N A;  3DJD A;  1V59 A;  2YG4 A;  2ARD A;  2BS3 A;  1ELI A;  3JZU A;  4EIP A;  3HYX A;  2YLX A;  2RGH A;  2O56 A;  4E0V A;  4TLZ A;  4ZA0 A;  1JRZ A;  1CC2 A;  4H4R A;  2BCP A;  2B76 A;  4GAP A;  3S5S A;  1GET A;  4AOX A;  1ZK7 A;  4DSH A;  4RG4 A;  1KD0 A;  3CNT A;  3ATR A;  3CXB A;  2WHD A;  4FK1 C;  1KNR A;  2B9X A;  1B37 A;  4TVW A;  7ENL A;  4YKF A;  3KVE A;  3F8P A;  1GAL A;  3MKC A;  3UKP A;  1PBB A;  1YQ4 A;  1ZDL A;  1N4V A;  5IPY A;  4E6M A;  3GC2 A;  3AEG A;  3U9I A;  3BHK A;  1NAA A;  1BGJ A;  5KMQ A;  3SN4 A;  4H4S A;  1VRQ B;  4A79 A;  2E4G A;  5KNL A;  3AE3 A;  2OFJ A;  4APN A;  1F8R A;  3CNS A;  2QQ6 A;  3SQP A;  1MDL A;  4NTD A;  3ZYX A;  4ECH A;  1PXB A;  3IC9 A;  4EQR A;  2GQF A;  2YR4 A;  2VQB A;  1W4X A;  3ZVH A;  5FS9 A;  3PVC A;  3CXO A;  3K30 A;  3CNJ A;  3D47 A;  3KKJ A;  3FXG A;  2XLP A;  3IWA A;  4NEV A;  1D7Y A;  3NXL A;  1JRY A;  1EC8 A;  3GYI A;  3JVA A;  4X9M A;  4Z17 A;  2WS3 A;  1ECQ A;  1P48 A;  1CHU A;  4TM1 A;  3UOV A;  1VG9 A;  2OO6 A;  3BSM A;  2FYM A;  4G7F A;  2C65 A;  4K8G A;  4ZCD A;  1E1N A;  3NLC A;  4HA6 A;  1S3E A;  3NVV B;  4M52 A;  2C73 A;  4USR A;  1CJ4 A;  4PAB A;  2YLW A;  1TZZ A;  4E5T A;  3DK8 A;  2QJN A;  5M10 A;  2ZAD A;  1SJB A;  2QGY A;  3FCP A;  2XSX A;  3M0O A;  3TWB A;  1CJ2 A;  3AD7 B;  1S2Y A;  3BNU A;  4H4Y A;  3AYJ A;  4U8K A;  3T37 A;  3K7M X;  3KU9 A;  3UTH A;  1KF6 A;  1QO8 A;  4K2X A;  5KVI A;  2VRL A;  2GH5 A;  3ETR B;  4IVO B;  3BOX A;  1X31 B;  1LQU A;  3ITJ A;  2B7S A;  3RR1 A;  2HNE A;  4H1Z A;  1GRT A;  3AN1 A;  1KSS A;  3I6D A;  1Q1R A;  1LJ1 A;  4J36 A;  1MRA A;  1LV0 A;  2TPR A;  1KNP A;  1BGN A;  3CPH G;  1NEL A;  2PU0 A;  4EM4 A;  4A35 A;  1D4C A;  3DJG X;  1PJ6 A;  1BKW A;  4I58 A;  4XWZ A;  2RAB A;  3NVY B;  5KXJ A;  1K0L A;  5L46 A;  3H12 A;  1L9D A;  3NTA A;  2APG A;  2XVE A;  3VRD B;  1VQW A;  3RIT A;  3N6J A;  4A65 A;  1N4W A;  1GV4 A;  4IL0 A;  4H4T A;  2C66 A;  5J04 A;  2POZ A;  2V60 A;  1O5W A;  3H70 A;  2C7G A;  4IZG A;  2VRM A;  1ONE A;  3GMB A;  1JOA A;  3URH A;  1FEC A;  1DJN A;  1L8P A;  1ZXI C;  4J1O A;  1S3B A;  2GQW A;  1F9C A;  1PDZ A;  1EC7 A;  1E39 A;  3DG3 A;  3AE6 A;  3H8L A;  3RNM A;  1PBE A;  3CAW A;  1TDE A;  3DFY A;  3SM8 A;  3T2Y A;  1E9I A;  3Q9T A;  2W54 A;  1WUE A;  4H4V A;  2PPG A;  3C4A A;  5BUL A;  2BXS A;  2XLR A;  3ISH A;  2E5A A;  5HY5 A;  2XH7 A;  3PK7 A;  2Z5X A;  3SQS A;  2AL2 B;  3T8Q A;  2P0I A;  1H7X A;  4JN7 A;  4NEW A;  2XLT A;  1RM6 B;  4M0X A;  1FFU C;  1PBC A;  2C67 A;  4LU6 A;  2YLS A;  4AT2 A;  2X8C A;  3AMZ A;  4P9S A;  1E1M A;  5ENL A;  4TLX A;  1KCZ A;  3LOV A;  2PP0 A;  2E1M A;  3BJS A;  2WOV A;  3UTE A;  3R1Z A;  3LJP A;  2GR0 A;  3UCL A;  4Y4N A;  1FOH A;  2YQU A;  3NHO X;  3DA1 A;  1Y56 B;  2V3B A;  4GRT A;  3PO7 A;  3DDM A;  4G8T A;  4DYE A;  4A6G A;  2GR2 A;  2HXU A;  3UJF A;  3CYJ A;  3IK4 A;  3SZW A;  3SSZ A;  1P2H A;  4GGH A;  4H2P A;  1GRG A;  2V5Z A;  1N5W C;  4H50 A;  1TDK A;  3K7Q X;  5JCL A;  4JQ9 A;  5KOX A;  3DFH A;  4GDE A;  2A8X A;  4K1W A;  2AKZ A;  2OLO A;  4H4Z A;  2WES A;  3P1W A;  3ABV A;  2W55 A;  3BHF A;  2PMQ A;  3NYE A;  3NNE A;  5JCI A;  2PP1 A;  3R0U A;  3HYV A;  3TJ4 A;  1ZOV A;  4J2W A;  3QN3 A;  4BK3 A;  4YWO A;  1GRF A;  1MXT A;  3T2Z A;  3NKS A;  4O5Q A;  2XVF A;  4X4J A;  3VC6 A;  4OPL A;  1FIQ B;  3ZLG A;  3P4P A;  2Q0K A;  3R0K A;  1SB3 B;  3P4R A;  2OZ3 A;  3UCD A;  2GGH A;  3PG6 A;  3BNM A;  1K4Q A;  1DOE A;  2WPC A;  4U8J A;  1NEK A;  5GRT A;  3NIX A;  4AP1 A;  4A3R A;  3FJ4 A;  4IP5 A;  3TWA A;  1UKV G;  2B9Y A;  1GPE A;  1P43 A;  2FJA A;  4F4R A;  5GSN A;  4OPU A;  3DGB A;  4U2T A;  1IUU A;  3QSM A;  3MUC A;  1NEN A;  1ZMC A;  4JN9 A;  5KMR A;  1EL9 A;  4IHC A;  2GAG B;  2WEU A;  3FYY A;  2C76 A;  4H4W A;  3CMM A;  4H2N A;  3L1R A;  2O9Z A;  3SZF A;  3MSY A;  2YAU A; 
#chains in the Genus database with same CATH homology
 2YR6 A;  3AEC A;  3AEG A;  2IVD A;  1GER A;  4U8I A;  2XFP A;  3AEF A;  1E6E A;  1Y0P A;  1NAA A;  1KDG A;  2YM1 A;  3BHK A;  1JEH A;  1BGJ A;  3CPI G;  5KWF A;  2YLZ A;  2OAM A;  5KMQ A;  2BAC A;  3AD8 B;  2GV8 A;  3Q6J A;  2VVL G;  5C3J A;  4H4S A;  1VRQ B;  4NWZ A;  1S2Q A;  1GRB A;  4A79 A;  3H4K A;  2E4G A;  5KNL A;  3AE3 A;  4APN A;  1F8R A;  2R4J A;  3FBS A;  4K8D A;  3CNS A;  1GTH A;  5EB4 A;  3SQP A;  2JAE A;  3CIR A;  4YT0 A;  4G6H A;  4IA5 A;  4EMW A;  4NTD A;  3ZYX A;  4K7Z A;  3GRT A;  3LZW A;  4ECH A;  1PXB A;  5JCK A;  4IVM B;  4A99 A;  3IC9 A;  2X3N A;  3E1T A;  4EQR A;  1LVL A;  1TYP A;  3DH9 A;  2PYX A;  1TDF A;  2GQF A;  4II3 A;  2YR4 A;  2VQB A;  1CJC A;  1W4X A;  2GVC A;  2ZZC A;  5FS9 A;  4JY3 A;  4YTP A;  3DK4 A;  3PVC A;  4H4X A;  3K30 A;  3CNJ A;  1BWC A;  2WOI A;  1OJA A;  3KKJ A;  4YSH A;  2XLP A;  1H84 A;  3O0H A;  3SZC A;  3KPK A;  4B68 A;  1PS9 A;  3IWA A;  1JNR A;  3GDP A;  2F5Z A;  3KD9 A;  4NEV A;  4NTE A;  1D7Y A;  4B67 A;  3D1C A;  2C3D A;  3UTF A;  4CBQ A;  4CNJ A;  1SEZ A;  1JRY A;  4C3Y A;  4C5O A;  3QVR A;  1D4D A;  4Y4L A;  4U8L A;  4BV6 A;  1D7L A;  3GYI A;  3RP7 A;  3SGL A;  4OPI A;  4X9M A;  3P4S A;  3FPZ A;  3R9U A;  5HYM A;  3CPJ G;  3CGB A;  4CRT A;  5FS7 A;  1Z6L A;  2WS3 A;  3SX6 A;  3LAD A;  1CHU A;  4TM1 A;  4BJY A;  3WE0 A;  1GND A;  1B5Q A;  3UOV A;  1VG9 A;  2GRT A;  1NDA A;  4G6G A;  2NVK X;  4H7U A;  1K0J A;  1ZMD A;  2BRA A;  4B66 A;  3DME A;  5FS6 A;  3SZ0 A;  1XAN A;  1EL5 A;  2C65 A;  1YY5 A;  3UKF A;  4ZCD A;  3VR8 A;  4H2Q A;  2WOW A;  1E1N A;  1CJ3 A;  2C72 A;  3NLC A;  4HA6 A;  1S3E A;  4M52 A;  1DNC A;  3PS9 A;  4CNK A;  4Z24 A;  1E1L A;  2C73 A;  3AD9 B;  4USR A;  3UP5 A;  2WP5 A;  1H6V A;  1CJ4 A;  4CY8 A;  3AE5 A;  3DGZ A;  3IHG A;  4B1B A;  4PAB A;  1TRB A;  1L9C A;  5TR3 A;  2YLW A;  4NZH A;  3SY4 A;  4A9W A;  3V3O A;  2R4E A;  3DK8 A;  3IHM A;  5M10 A;  4D03 A;  2JKC A;  2BRY A;  2UZZ A;  5ER0 A;  4DSG A;  2VZ2 A;  3SYI A;  2JK6 A;  3CGE A;  3M0O A;  3AD7 B;  1CJ2 A;  1GES A;  1S2Y A;  2OA1 A;  3QFB A;  2VOU A;  1NG4 A;  5J7X A;  3D9X A;  3BNU A;  4GAV A;  4H4Y A;  3NK1 X;  3AYJ A;  4U8K A;  5M0Z A;  1AOG A;  3DJJ A;  4J56 A;  3D8X A;  1IJH A;  2BYB A;  4EQX A;  5JRB A;  4JY2 A;  3T37 A;  4BJZ A;  3K7M X;  4CY6 A;  1DJQ A;  3AE4 A;  3KU9 A;  3OZ2 A;  4MJW A;  1XHC A;  1DOC A;  3EF6 A;  3CNP A;  3UTH A;  5KOW A;  1KF6 A;  1F8S A;  3GYJ A;  1QO8 A;  1CC6 A;  2GF3 A;  4K2X A;  2QAE A;  2CVJ A;  5LV9 A;  1B4V A;  2ACZ A;  2DKI A;  3C4N A;  2FJD A;  2XFU A;  1H86 A;  3P4Q A;  2XVI A;  1ZKQ A;  5KVI A;  4I59 A;  3G5S A;  2WDQ A;  2VRL A;  2GH5 A;  1COY A;  1ZX9 A;  3QVP A;  3ICT A;  3QFA A;  4IVO B;  4UDR A;  4A6N A;  4YSZ A;  4J33 A;  2RGO A;  3GD4 A;  1X31 B;  2GB0 A;  1LQU A;  1RP0 A;  3ITJ A;  2B7S A;  5J60 A;  3GDN A;  2V3A A;  4TM4 A;  2Y6R A;  3RED A;  3UKH A;  3I6D A;  1GRT A;  1KSS A;  4EM3 A;  2BCG G;  1Q1R A;  1GRE A;  1RSG A;  3OC4 A;  1LJ1 A;  1YKJ A;  3FMW A;  1D4E A;  3F8R A;  4J36 A;  4REK A;  5CQF A;  1L9E A;  4A6N B;  1LV0 A;  2TPR A;  1KNP A;  2BS4 A;  2BC0 A;  1BGN A;  4HB9 A;  3CPH G;  4BK2 A;  4EM4 A;  5EOW A;  2EQ6 A;  1ZP0 A;  1D4C A;  4U2L A;  3DJG X;  1PJ6 A;  3IF9 A;  1BKW A;  4I58 A;  2B7R A;  3ZDN A;  5KMP A;  4XWZ A;  2RAB A;  3T0K A;  1E7P A;  2C70 A;  5KXJ A;  1K0L A;  5L46 A;  2Q0L A;  1H7W A;  3C96 A;  1D5T A;  4GCM A;  2Y6Q A;  4Z44 A;  1L9D A;  3AE9 A;  3NTA A;  1FL2 A;  4G74 A;  2APG A;  2XVE A;  4U8M A;  3VRD B;  3S5W A;  3CND A;  4YTM A;  2WP9 A;  4ZN0 A;  1VQW A;  5KVH A;  3UKL A;  4A65 A;  4J57 A;  1N4W A;  1PXA A;  3KA7 A;  4ADW A;  3KPF A;  3V76 A;  4YKG A;  3BI4 A;  1HYU A;  1GV4 A;  4H4Q A;  4H4T A;  1JU2 A;  1NG3 A;  2YM2 A;  2C66 A;  2WQY A;  1BZL A;  3NK2 X;  4TM3 A;  3AEB A;  2RGJ A;  2XDO A;  2C4C A;  1CL0 A;  1REO A;  4OPC A;  2V60 A;  4Z2U A;  1O5W A;  4K22 A;  2Z5Y A;  4G9K A;  2YVJ A;  3VRA A;  2W0H A;  2C7G A;  2JB1 A;  3RP6 A;  1YQ3 A;  2VRM A;  3GMB A;  4AT0 A;  1JOA A;  4YXD A;  1PBF A;  3K7T A;  1EL8 A;  3URH A;  3BI5 A;  4JNA A;  3ALM A;  1FEC A;  1DJN A;  1PXC A;  3G5R A;  4AOS A;  4RG3 A;  3AE8 A;  1S3B A;  4XWR A;  2GMJ A;  1GXF A;  4FDC B;  2GQW A;  3II4 A;  3T2K A;  4B69 A;  2AAQ A;  4DNA A;  3AEA A;  4YSY A;  2EQ8 A;  4D04 A;  4EMI A;  1GRH A;  2IVE A;  3BI2 A;  2WPE A;  1EL7 A;  1E39 A;  1JRX A;  3AE6 A;  4N9X A;  4OPG A;  4OPD A;  3DK9 A;  2GR1 A;  2XLS A;  5DBJ A;  2A87 A;  3H8L A;  1CF3 A;  1RYI A;  3I3L A;  1DOB A;  3RNM A;  1PBE A;  3QSE A;  2BK5 A;  2B9W A;  3QSS A;  4LII A;  4X9N A;  1TDE A;  2WDV A;  2PHH A;  4TM0 A;  2E5V A;  1P2E A;  3SM8 A;  3B3R A;  3SXI A;  2YG5 A;  1XDI A;  2YLT A;  3NRN A;  2NPX A;  2DKH A;  2R0C A;  3T2Y A;  1ONF A;  3CGD A;  4Z43 A;  2Q7V A;  3AEE A;  4OCG A;  1FEA A;  4Z26 A;  3Q9T A;  1MOK A;  4LA1 A;  2CDU A;  4B65 A;  4II2 A;  4H4V A;  3DJE A;  3CTY A;  3EAN A;  5U63 A;  1DXL A;  2X8G A;  3NGC X;  3C4A A;  4OPT A;  1PJ5 A;  5BUL A;  2BXS A;  3NN0 X;  1OJ9 A;  2XLR A;  3GWD A;  1F3P A;  3VQR A;  3ISH A;  1F8W A;  4G73 A;  3P9U A;  3UOY A;  4WX1 A;  5HY5 A;  3T31 A;  1GTE A;  1QJD A;  2GEW A;  1NHP A;  1LTX R;  3QJ4 A;  2Z5X A;  1KSU A;  1PHH A;  3M13 A;  1F6M A;  3UOX A;  4C77 A;  2WP6 A;  4A5L A;  2JB3 A;  2R0P A;  2R46 A;  3GMC A;  2I0Z A;  3EAO A;  2V61 A;  2GAH B;  2VVM A;  1PN0 A;  1H7X A;  2TMD A;  5KRQ A;  5IQ1 A;  2YVF A;  2GR3 A;  1NHQ A;  1M6I A;  2OLN A;  4NEW A;  4K5R A;  1L0V A;  2XLT A;  2XYO A;  4U8O A;  5EB5 A;  4FK1 A;  2WPF A;  2V6O A;  1PBC A;  3ATQ A;  4NTC A;  3AED A;  3ALL A;  2C67 A;  2JBV A;  5HXI A;  1EBD A;  4LU6 A;  2YLS A;  3AE1 A;  3SFE A;  4AT2 A;  2X8C A;  4UDP A;  4P9S A;  1E1M A;  3COX A;  4TLX A;  4BK1 A;  3CN8 A;  1FEB A;  5U25 A;  2VVL A;  2XVH A;  3LOV A;  4XXG A;  1B8S A;  2R45 A;  3RHA A;  3UTG A;  5U1O A;  3NN6 X;  2E1M A;  5KMS A;  2WOV A;  3HYW A;  1GOS A;  3UTE A;  3RP8 A;  1GRA A;  1IUV A;  4CCQ A;  2FBW A;  1Y56 A;  1H81 A;  3VR9 A;  1NHR A;  1TDN A;  3LJP A;  4Y4M A;  2GR0 A;  1KFY A;  1E1K A;  4EIQ A;  3UCL A;  4Y4N A;  2YWL A;  3M12 A;  1FOH A;  1GEU A;  2H89 A;  3GRS A;  2YR5 A;  2YQU A;  3NHO X;  1OJD A;  5BUK A;  3GWF A;  2YG3 A;  3DA1 A;  4PAA A;  1Q9I A;  3KLJ A;  1H83 A;  3LZX A;  1CBO A;  2AQJ A;  1MO9 A;  4IA6 A;  2R9Z A;  1PBD A;  1Y56 B;  4NNJ A;  2QCU A;  4BUR A;  4JNQ A;  3G5Q A;  2V3B A;  4YSX A;  4GRT A;  2AR8 A;  5JCM A;  3PO7 A;  4YTN A;  3DGH A;  1TYT A;  1KN0 A;  1XPQ A;  3GYX A;  2GR2 A;  5IQ4 A;  3ALJ A;  2YVG A;  3UOZ A;  1YQZ A;  2BA9 A;  4USQ A;  1VDC A;  3NH3 X;  2C3C A;  2OAL A;  1LPF A;  1IUT A;  5BRT A;  5CKU A;  5EBK A;  3SZW A;  3NTD A;  1P2H A;  1DOD A;  4H2P A;  1GRG A;  4ICY A;  2V5Z A;  4DGK A;  2XFN A;  4H50 A;  1GT8 A;  1TDK A;  3F8D A;  3K7Q X;  4KX6 A;  5JCL A;  3AB1 A;  2WU5 A;  1PJ7 A;  4JQ9 A;  4Z2R A;  3ICS A;  1QLB A;  5KOX A;  2XCG A;  4J31 A;  2XLU A;  1IUX A;  2XVJ A;  2X99 A;  4GDE A;  2A8X A;  4IV9 A;  1VG0 A;  4AP3 A;  4C74 A;  3AYI A;  3LB8 A;  2EQ7 A;  4WCT A;  2H88 A;  2OLO A;  4ZCC A;  4GF7 A;  2BAB A;  2ZZ0 A;  4Z2T A;  4H4Z A;  2X8H A;  3GD3 A;  5FS8 A;  3T14 A;  2WES A;  2BK4 A;  3P1W A;  4FX9 A;  3ABV A;  4O5U A;  3ADA B;  4EMJ A;  4GDP A;  3BHF A;  4J34 A;  3CGC A;  1FCD A;  3NYE A;  4CCR A;  3NNE A;  5JCI A;  4H4U A;  2XFO A;  1K0I A;  2QA1 A;  1BF3 A;  3H8I A;  3HYV A;  4H2R A;  2WBA A;  2IID A;  3B6D A;  2A89 A;  1ZOV A;  4J2W A;  4BK3 A;  1N1P A;  4YWO A;  1GRF A;  1MXT A;  1CC4 A;  2Q6U A;  3T2Z A;  2ZBW A;  3NKS A;  4O5Q A;  2YLR A;  1H2I A;  2XVF A;  1M64 A;  2YG6 A;  1LQT A;  3AXB A;  2CFY A;  4OPL A;  3ICR A;  4X4J A;  5HHF A;  3P4P A;  3SFD A;  2BC1 A;  5JCN A;  2X50 A;  2FJE A;  2Q0K A;  2J3N A;  4RSL A;  3AWI A;  4OVI A;  2CUL A;  2XFQ A;  3LXD A;  1JNZ A;  3P4R A;  5FMH A;  3EPT A;  3NYF A;  3V3N A;  3DJD A;  1V59 A;  3AE7 A;  2EQ9 A;  2BS2 A;  2YG4 A;  3PG6 A;  4U8N A;  2C64 A;  2JB2 A;  2ARD A;  2WDR A;  2BS3 A;  2HQM A;  3BNM A;  1K4Q A;  1DOE A;  2WPC A;  1ELI A;  1PDH A;  3NK0 X;  2GMH A;  3HZL A;  1IUS A;  3HYX A;  4U8P A;  4EIP A;  4Z25 A;  2YLX A;  1NEK A;  2RGH A;  2VQ7 A;  2WU2 A;  3NG7 X;  4U8J A;  5GRT A;  3NIX A;  5BVA A;  2YG7 A;  3GSI A;  1NHS A;  4AP1 A;  3L8K A;  2QA2 A;  3AYL A;  4U2S A;  4E0V A;  4TLZ A;  3UKQ A;  3UKK A;  1N4U A;  1JRZ A;  1CC2 A;  3NYC A;  1UKV G;  4JDR A;  2B9Y A;  4H4R A;  4KPR A;  4EQW A;  1TDO A;  1O94 A;  1GPE A;  2BCP A;  2BXR A;  2FJA A;  2ZZB A;  2FJB A;  2B76 A;  4GAP A;  1H82 A;  1Q1W A;  1GET A;  5GSN A;  1OJT A;  4OPU A;  3UKA A;  4AOX A;  3FG2 P;  1ZK7 A;  4DSH A;  2BK3 A;  4RG4 A;  3S61 A;  3FIM B;  3L5O A;  4U2T A;  1IUU A;  3CNT A;  3ATR A;  3QSM A;  3UP4 A;  3VRB A;  1ZY8 A;  1NEN A;  1ZMC A;  2WHD A;  2WET A;  1KNR A;  4FK1 C;  4GUV A;  5C2T A;  2B9X A;  1B37 A;  2C75 A;  4JN9 A;  5KMR A;  4H4P A;  1EL9 A;  4UDQ A;  4YKF A;  4A7A A;  4B63 A;  2GAG B;  4C3X A;  2WEU A;  4EQS A;  3KVE A;  2C76 A;  1OJC A;  3F8P A;  1GAL A;  3JSK A;  3NT6 A;  4H4W A;  3CMM A;  3UKP A;  4H2N A;  1PBB A;  1GSN A;  1YQ4 A;  1ZDL A;  1IUW A;  3AE2 A;  4K5S A;  4GR1 A;  3L1R A;  1N4V A;  4UP3 A;  5IPY A;  1ZOY A;  1S7M A;  1O95 A;  2O9Z A;  2R0G A;  3SZF A;  4B64 A;  2YAU A;  1NPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...