5JCNA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
432
structure length
429
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPEPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFFSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Os09g0567300 protein
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
total genus 130
structure length 429
sequence length 432
chains with identical sequence B
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jcnA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jcnA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jcnA02
2R4EA 1K0IA 4ADWA 4H4UA 4O5UA 4ZCCA 2GR2A 2AAQA 1LTXR 3AWIA 3BNMA 4A6NA 2V3BA 2XFPA 1GXFA 3ZYXA 2BXSA 3KVEA 2RABA 1CHUA 2X8CA 2ACZA 3GMCA 2FBWA 5IQ4A 1KSSA 3QJ4A 2C67A 3ALLA 1GESA 3CPIG 2JAEA 2GH5A 3NK2X 3NNEA 4CY6A 2X99A 4AP3A 4H2QA 2R0CA 2XVIA 2C65A 4AT0A 4CRTA 4GF7A 3AD8B 2WETA 2BK4A 1PBFA 1KSUA 1ZDLA 5FS8A 2OALA 4X9NA 2JK6A 1JOAA 1FECA 1XDIA 3V76A 5U1OA 3CGCA 2B9WA 2WBAA 2R0GA 3GDPA 1TRBA 4U8NA 4BJZA 4EIPA 2Y6QA 1L9CA 1CC6A 3IHGA 3AE6A 2GAGB 4X9MA 3DK9A 2GEWA 4GCMA 1GRTA 3V3NA 1VG9A 4TM1A 4BK1A 3VQRA 3PO7A 1CBOA 1N4UA 4O5QA 3Q9TA 1ZKQA 4J34A 3NK1X 4GRTA 4U2LA 5DBJA 1Z6LA 2VRMA 1E1KA 2VVLA 1S2QA 3S5WA 4J56A 3RP6A 4N9XA 2XVJA 2JKCA 2XDOA 3UKPA 1H7WA 3V3OA 1PBCA 4JNQA 3LZWA 4USRA 3NTAA 4GDEA 2Q0KA 1TDFA 3DK4A 4C3XA 2JB3A 5GSNA 2WP6A 3H4KA 3OZ2A 5ER0A 3CNPA 1FOHA 1PJ7A 4RSLA 3AYIA 2CVJA 3IWAA 1TDKA 2EQ6A 3LADA 1Y56B 3KU9A 4FK1A 1Q9IA 2F5ZA 3AE5A 4U8MA 4E0VA 2WOWA 4GR1A 5TR3A 2XYOA 3BI4A 4I58A 3PS9A 1B5QA 1COYA 1IUVA 1ELIA 3AEGA 1GNDA 2QA1A 4CCRA 1TDNA 3ADAB 3P4SA 3UKAA 1PBEA 4CBQA 2YG6A 3O0HA 1ONFA 2C76A 3NYEA 1KFYA 4NZHA 3IC9A 3NT6A 4YSZA 3C4NA 1GERA 5JCKA 1H86A 4OCGA 1E1LA 4A5LA 3NKSA 2Q6UA 3G5SA 1GRFA 3GD3A 2BXRA 1B37A 2X8GA 2QA2A 1P2EA 3CTYA 4U8IA 1GETA 3UKKA 3FMWA 2GQFA 1NEKA 1ZMCA 1K0JA 4BV6A 4EMJA 4C77A 3COXA 4A99A 4CNJA 2WPFA 2Q7VA 2TMDA 3CIRA 4HB9A 1ZP0A 1LVLA 4ZN0A 2CULA 2GR1A 4H4ZA 4B67A 3ISHA 4U8PA 1GTHA 4Z43A 5C2TA 2H88A 3RHAA 4XXGA 4Y4MA 5C3JA 4A79A 2E1MA 3OC4A 3AEAA 4LA1A 3AXBA 4Z26A 2V3AA 2BC1A 3GWDA 2XLTA 4CCQA 2VQ7A 2IIDA 4EQRA 2FJDA 4H2RA 2WDVA 2RGHA 3G5RA 1GRAA 1D4DA 3B6DA 1PJ5A 4X4JA 5J60A 4KX6A 4K5RA 2FJEA 2YWLA 1OJ9A 1E1NA 4YKFA 4U8KA 3NG7X 1NHSA 1CJ4A 3RP7A 1JRZA 2YLXA 1MOKA 3E1TA 2GVCA 1EL8A 3FBSA 1XANA 4XWRA 1LQUA 3DJEA 5KVHA 1HYUA 4Z2RA 4EQWA 4YKGA 2YR5A 3AE7A 3CNDA 3K7MX 2GV8A 3UTEA 2R45A 1PXCA 2OAMA 4YTNA 4K2XA 4Z24A 4YTMA 2WU2A 1PBBA 4UDQA 3AD9B 2FJBA 1L9DA 2GQWA 2C3DA 2GAHB 4EQSA 2ZZBA 2ZZCA 4H50A 3FIMB 2AQJA 4WCTA 3QSEA 4IV9A 4Z2UA 2HQMA 4TLXA 1H81A 5FMHA 3LB8A 4EMIA 1F3PA 3UOYA 4CY8A 3NH3X 3M12A 4I59A 3UOVA 2XFUA 2YVJA 5JCLA 2GF3A 1D4EA 4MJWA 2B7RA 5KOXA 3AE3A 4OVIA 4OPCA 3CNTA 1NHRA 2XLSA 3ZDNA 4KPRA 1K4QA 5J7XA 3BHKA 2VVLG 2E5VA 1GEUA 1EL5A 1F8SA 3DMEA 2B76A 1LJ1A 3ITJA 2XLUA 4Y4NA 4H4PA 2PYXA 3SM8A 1YQ3A 4B1BA 4A6NB 3H8IA 4USQA 1DODA 3ABVA 3GWFA 4BK3A 1MO9A 3GYJA 3UOXA 4IVOB 4UP3A 4H4TA 2WESA 1GTEA 2NPXA 1FEBA 2WOIA 1CJ3A 2C66A 4D04A 2C73A 2OLOA 1PN0A 2YLRA 3AYJA 3GSIA 2O9ZA 3EANA 5JCIA 1Q1RA 1CJCA 1GV4A 4YSHA 2BA9A 4EQXA 1H83A 1XHCA 2APGA 3AE9A 3ATQA 3FPZA 3VRAA 3UCLA 2B7SA 1RYIA 4D03A 3K7QX 2YG5A 4A9WA 4Y4LA 2WOVA 1QO8A 4U2SA 1OJCA 1L9EA 2WPCA 2C70A 2XVEA 3LXDA 3P1WA 2WP5A 3QSSA 1EBDA 4H4QA 1CF3A 2XFNA 4K5SA 3GD4A 2VRLA 1GOSA 1VRQB 3QVPA 2DKHA 1OJDA 1S3EA 4U2TA 5FS7A 1GREA 1GRBA 4H4VA 1D5TA 5L46A 1P2HA 4H2PA 3RNMA 2Z5XA 2XVFA 3UTGA 2GMJA 4B69A 3SFDA 1CJ2A 1TYTA 1JRYA 5KRQA 5KOWA 4JQ9A 3AE1A 3LJPA 4H4XA 3NN6X 2XCGA 4NTCA 4AOSA 4B64A 3AECA 4JNAA 3NYFA 2EQ7A 1BF3A 4HA6A 1ZX9A 1O95A 2YG3A 2YAUA 2CFYA 3R9UA 3BI2A 4CNKA 1DOCA 1JU2A 4YSYA 3BHFA 2XLPA 1PS9A 1REOA 4J2WA 3AEFA 4OPUA 3S61A 1DXLA 3ICSA 4JDRA 2PHHA 3CNJA 2C7GA 2BC0A 2J3NA 3T37A 1GRGA 1IUUA 1JNZA 2WDQA 2R0PA 2JB2A 2VOUA 1FEAA 1OJAA 3SFEA 3UKQA 1N4WA 4YTPA 2DKIA 4UDPA 4RG3A 4Z25A 3ICTA 4ICYA 1BWCA 2CDUA 1LPFA 2X8HA 1LV0A 4TM3A 3UP4A 4K22A 3HZLA 4ZCDA 1DNCA 2GMHA 2YM2A 1H6VA 3DGZA 2QAEA 3VRBA 4H4RA 1ZOVA 1M6IA 3NRNA 4RG4A 3M0OA 2W0HA 4P9SA 3ALMA 2XFQA 3QSMA 4U8OA 2VQBA 3NTDA 1XPQA 2JBVA 1JEHA 3CGBA 1SEZA 3IF9A 3P4PA 4OPDA 5M0ZA 4YT0A 1BZLA 3URHA 1B8SA 2X3NA 3K7TA 3CNSA 5KXJA 2AR8A 2VVMA 1F8RA 3RP8A 2YQUA 1CC2A 5HHFA 3NIXA 3UKLA 1PJ6A 1KDGA 4LIIA 3D1CA 1OJTA 3F8RA 4OPGA 4GUVA 3F8DA 4BK2A 2R46A 3GMBA 4XWZA 4YWOA 4B68A 3KPFA 3UP5A 3AB1A 1BGNA 2Y6RA 2YLTA 3D8XA 5BULA 2JB1A 1N1PA 3GYIA 2H89A 3B3RA 3UKHA 2ZBWA 3VR8A 3DK8A 1B4VA 2BACA 2R4JA 5KVIA 3NN0X 3QFBA 4U8JA 1N4VA 3K30A 2YVFA 1NG3A 5U25A 1RSGA 3AEBA 3VR9A 1ZOYA 1H84A 2ZZ0A 4BURA 1UKVG 4U8LA 3GRTA 3AEEA 1YQZA 3KLJA 3P4QA 1IJHA 4LU6A 3F8PA 4FX9A 2WEUA 2Q0LA 5HYMA 1VQWA 3KKJA 5KWFA 4OPLA 1IUWA 2BCPA 5GRTA 4ECHA 1ZK7A 4AOXA 1NAAA 3PVCA 2FJAA 3C96A 4WX1A 4AP1A 3I3LA 1DOBA 2OA1A 5CKUA 2A87A 1BGJA 4EIQA 5HXIA 1FCDA 3FG2P 3DJJA 2C3CA 4JY2A 4AT2A 4H7UA 4J31A 1PBDA 4PABA 3AE8A 2C75A 5HY5A 1YQ4A 5M10A 2V60A 3EF6A 2XLRA 1FL2A 2Z5YA 3GRSA 3QVRA 4K8DA 5IQ1A 3DH9A 1CC4A 1D7LA 2WDRA 4J36A 2GB0A 4H4WA 3ATRA 1RP0A 2X50A 2WPEA 4APNA 1IUSA 2WHDA 2B9YA 2NVKX 3LOVA 1Y56A 5EOWA 4PAAA 4TLZA 3M13A 2C72A 2YVGA 4NEWA 4IVMB 1GSNA 1E1MA 1PDHA 1IUXA 2EQ9A 1QLBA 1VG0A 3NHOX 3AD7B 3H8LA 5LV9A 2BK5A 2BYBA 1PXAA 1W4XA 2B9XA 1E6EA 2VZ2A 2YG4A 4EM3A 1DJQA 1EL9A 4IA5A 2WS3A 2WP9A 2EQ8A 3II4A 4H4YA 1KF6A 4J57A 5JCMA 5EB5A 1AOGA 1NENA 4FDCB 2XVHA 4DGKA 2GR3A 4EM4A 2QCUA 2E4GA 3UTHA 1GRHA 2BS3A 2A8XA 3ICRA 1PHHA 3KD9A 2BABA 3DA1A 2IVDA 3ALJA 4YXDA 3EAOA 4OPTA 2IVEA 3DGHA 4YSXA 3L1RA 1D7YA 4IA6A 3UOZA 3CN8A 1IUTA 1K0LA 1KNPA 4B63A 4A7AA 5BVAA 2XFOA 4REKA 5FS9A 1BKWA 2YLWA 3CGEA 3REDA 3CPHG 2YLSA 1Y0PA 1YKJA 3DJGX 2YLZA 3P9UA 1Q1WA 3CPJG 3CGDA 3BI5A 1F8WA 4K7ZA 2YM1A 2I0ZA 5EBKA 1PXBA 1NG4A 2GR0A 5BRTA 4TM4A 1CL0A 4NTDA 2C64A 1GT8A 1JRXA 4B65A 1TDOA 3AE4A 4BJYA 3BNUA 3NK0X 1NDAA 2YG7A 3UKFA 2RGOA 3AYLA 3NLCA 4A65A 2UZZA 3UTFA 2BS4A 3SGLA 1YY5A 1V59A 1ZMDA 1X31B 2WQYA 4NTEA 4NEVA 2YR6A 4JN9A 3DJDA 4DNAA 1DOEA 1TYPA 1MXTA 1NHQA 2A89A 2RGJA 3VRDB 2V6OA 1TDEA 1JNRA 4GDPA 3WE0A 3G5QA 3C4AA 1KNRA 2V5ZA 4J33A 1E7PA 4Z44A 1NHPA 1D4CA 3NYCA 1LQTA 1O5WA 4H2NA 4M52A 3I6DA 3JSKA 1VDCA 3NGCX 4EMWA 3GDNA 4DSHA 2R9ZA 3EPTA 5CQFA 5U63A 5FS6A 2ARDA 4FK1C 4Z2TA 3KA7A 3SQPA 2TPRA 4UDRA 1ZY8A 2YR4A 1O94A 4C3YA 1F6MA 4H4SA 1GPEA 1E39A 1S2YA 4TM0A 3QFAA 3P4RA 1M64A 2V61A 2OLNA 2GRTA 2BK3A 1S3BA 4C5OA 3Q6JA 5BUKA 4OPIA 1EL7A 3L8KA 1GALA 5JCNA 3AEDA 1DJNA 2WU5A 4C74A 3LZXA 3IHMA 2BCGG 5EB4A 1L0VA 4JY3A 1NPXA 5IPYA 3AE2A 1QJDA 2BS2A 4B66A 1H82A 4DSGA 1H7XA
chains in the Genus database with same CATH superfamily
3TJIA 3L5OA 2W3SA 4O5UA 2GR2A 2AAQA 1NU5A 3KVEA 2RABA 1CHUA 3GMCA 2FBWA 2C67A 3V5CA 3NK2X 4CY6A 2R0CA 2XVIA 3IJQA 4GF7A 3QN3A 2PTZA 2BK4A 1KSUA 1ZDLA 5FS8A 4JN7A 4X9NA 2CHRA 2JK6A 3V76A 5U1OA 3CGCA 2B9WA 1X2GA 1TRBA 4BJZA 3DK9A 2GEWA 3V3NA 4TM1A 3PO7A 1ZKQA 2VVLA 1S2QA 3S5WA 1TKKA 4J56A 4N9XA 2OVLA 2XVJA 2JKCA 3NTAA 5KMQA 3FV9A 3DK4A 3UXLA 2WP6A 3H4KA 1FOHA 1TDKA 2EQ6A 3LADA 4GISA 4U8MA 1XPYA 4E0VA 3D47A 2AL2B 4GR1A 5TR3A 3PS9A 4G73A 1B5QA 3T2ZA 3NVVB 1MDLA 1GNDA 2QA1A 4CCRA 3P4SA 3UKAA 2ZC8A 4NZHA 4YSZA 1GERA 2PP0A 1H86A 2QJNA 2Q6UA 3T9PA 2PS2A 1P2EA 2HZGA 1NEKA 4EMJA 4C77A 2PU1A 1MDRA 3JW7A 3IJLA 3T31A 3CIRA 4GFIA 2CULA 5C2TA 1GTHA 3DG3A 3DFHA 3RHAA 4A79A 2DW6A 3OC4A 4H83A 2I5QA 4LA1A 2V3AA 4CCQA 2VQ7A 2IIDA 2WDVA 3G5RA 3I6EA 4KPLA 1GRAA 5J60A 1MRAA 4U8KA 3AM9A 3RR1A 3NG7X 2YLXA 1MOKA 2POZA 1XANA 1MUCA 1HYUA 4Z2RA 4KWSA 3AE7A 2R45A 1KKOA 2GGIA 4EQSA 4H50A 3IJIA 2HQMA 1H81A 4EMIA 4HCLA 1F3PA 3DDMA 3GC2A 2XFUA 3AE3A 4OVIA 3QTPA 2XLSA 1K4QA 5J7XA 4G6HA 3MKCA 3DMEA 3SZFA 4Y4NA 4B1BA 4USQA 3GWFA 4IVOB 2WESA 1FEBA 2WOIA 2YLRA 3AYJA 2O9ZA 1XHCA 4MKSA 3FPZA 3HYXA 4D03A 3K7QX 1R6WA 2YG5A 4U2SA 1OJCA 2C70A 2BRAA 1VRQB 1OJDA 3AMZA 5FS7A 1P2HA 3CAWA 2Z5XA 1P43A 3AE1A 1EC9A 3P0WA 3AECA 4JNAA 3NYFA 1BF3A 3T2KA 1ZX9A 2CFYA 2GL5A 4CNKA 2GGHA 2XLPA 1REOA 3R10A 3CNJA 2GGGA 3NVWB 2R0PA 1OJAA 3SFEA 3UKQA 4UDPA 3SBFA 4ICYA 1BWCA 3UP4A 4ZCDA 3NS1B 1DNCA 1H6VA 4FP1A 1ZOVA 3OPSA 1STZA 3M0OA 2JBVA 3CGBA 3P4PA 3KUMA 3V5FA 5KXJA 5J04A 2VVMA 3DESA 3KPFA 3PFRA 3R25A 3AB1A 1SJCA 2YLTA 2AKMA 4IP4A 2BACA 3MSYA 2R4JA 3NN0X 3QFBA 4U8JA 2YVFA 3AEBA 3CK5A 4U8LA 3GRTA 3KLJA 3F8PA 5HYMA 3KKJA 3CYJA 3I3LA 4EIQA 3FG2P 4GGBA 4H7UA 4PABA 3BOXA 3PG6A 4J36A 4H4WA 3NZGA 3LOVA 1E1MA 1IUXA 2EQ9A 3DFYA 1W4XA 2B9XA 2WP9A 3II4A 4GIRA 1JRPA 1AOGA 4DGKA 2QCUA 2IVDA 3SZWA 3ALJA 4YXDA 4IA6A 1EC8A 4REKA 1BKWA 1Y0PA 2PGWA 2YLZA 2YM1A 2GR0A 4G8TA 1GT8A 3TWBA 1JRXA 4B65A 1X2HA 3RRAA 1TDOA 4BJYA 1NDAA 2RGOA 3NLCA 2YR6A 2QDEA 1VQZA 2PA6A 2RGJA 5KMRA 2GSHA 1NHPA 1XS2A 4JN8A 1D4CA 4M52A 1ECQA 3EPTA 4Z2TA 1WUFA 3KA7A 3T4WA 4C3YA 1O94A 1F6MA 4H4SA 1S2YA 3QFAA 3FYYA 2GRTA 2BK3A 2PMQA 3Q6JA 3AEDA 4JY3A 5IPYA 3AXBA 1H82A 4DSGA 3SN4A 2R4EA 1K0IA 4J3ZA 3P3BA 4A6NA 1RVKA 2V3BA 2BXSA 2ACZA 2X8CA 1KSSA 3IK4A 4GYPA 3T0KA 2WETA 2OALA 1FECA 4ENLA 1CC6A 3IHGA 2GAGB 4DWDA 1GRTA 1CBOA 2P3ZA 4O5QA 4GRTA 4U2LA 4NNJA 1E1KA 3H70A 1JDFA 2XDOA 4JNQA 3LZWA 2Q0KA 1TDFA 3U9IA 5GSNA 2PTXA 3VFCA 5ER0A 3VCNA 3CNPA 1PJ7A 3AYIA 2CVJA 1Y56B 4FK1A 4DX3A 2WOWA 2XYOA 4TVWA 3NVZB 2OKTA 2OZTA 1ELIA 1TDNA 1PBEA 4F4RA 4CBQA 3BSMA 3O0HA 1ONFA 1KFYA 3NT6A 3C4NA 4OCGA 2OZ3A 1GETA 2OPJA 3UKKA 2GQFA 2XGZA 4CNJA 3EEZA 2WPFA 2PTYA 2GR1A 4H4ZA 4B67A 3ISHA 2H88A 3CMMA 4DYEA 2O56A 4H2RA 4EQRA 2FJDA 2RGHA 3CB3A 1E1NA 3RO6A 1CJ4A 3GY1A 2GVCA 4XWRA 1LQUA 3UJSA 5KVHA 3TQPA 4YKGA 2YR5A 2GGJA 3K7MX 3UTEA 3UJ2A 4Z24A 2WU2A 2FJBA 2C3DA 2GAHB 3TOYA 3QPEA 4E4UA 2AQJA 1ZXIC 4Z2UA 3V3WA 3LB8A 2OFJA 2OZ8A 4CY8A 3M12A 4MJWA 5JCLA 1D4EA 1ONEA 4OPCA 1E9IA 3ZDNA 4KPRA 3BHKA 3TCSA 2VVLG 2B76A 4HNCA 1YQ3A 3ABVA 4BK3A 1MO9A 3UOXA 1SJDA 4UP3A 4H4TA 2PPGA 1GTEA 2NPXA 1CJ3A 4D04A 2C73A 3GSIA 1Q1RA 1H2IA 3ZVHB 2BA9A 2FKPA 4KEMA 3ATQA 2HXUA 3S5SA 4A6GA 5BOEA 4Y4LA 2WOVA 3CXOA 2WPCA 3PWIA 4H4QA 1CF3A 2XFNA 4K5SA 3GD4A 7ENLA 1D5TA 3MWCA 3GD6A 3RNMA 2XVFA 1CJ2A 3LJPA 3R1ZA 2EQ7A 3P93A 4Z1YA 1DOCA 1EC7A 4YSYA 1PS9A 3UJEA 1DXLA 4JDRA 1GRGA 1JNZA 2WDQA 3MQTA 2OLAA 4RG3A 3ICTA 2CDUA 1LPFA 2X8HA 1LV0A 3HZLA 3DGZA 3EUB3 4H19A 3SX6A 4M0XA 3IF9A 4YT0A 3UGVA 2X3NA 3FXGA 2AR8A 1F8RA 3RP8A 1CC2A 3NIXA 3UKLA 4LIIA 3GYXA 3GMBA 4XWZA 2P88A 3D8XA 3B3RA 3UKHA 1YEYA 3DK8A 3ZLGA 1N4VA 3K30A 4II2A 2OX4A 3VR9A 4NWZA 2ZZ0A 2OG9A 3AEEA 3P4QA 1IJHA 2NQLA 1VQWA 3A7AA 4OPLA 5GRTA 4AP1A 5CKUA 1DOBA 4HPNA 1SJAA 3H8AA 1FCDA 3MY9A 5HY5A 2V60A 2XLRA 1FL2A 3HW2A 4K8DA 1CC4A 1MNSA 3RCYA 2WDRA 2GB0A 3UCDA 2MUCA 2WHDA 2NVKX 4PAAA 3HRDC 1GSNA 1PDHA 2AL2A 1QLBA 3RGTA 2BK5A 1E6EA 2OO6A 1DJQA 2PSNA 4H4YA 5JCMA 2XH2A 3KPKA 2GR3A 4EM4A 1GRHA 3KD9A 3ICRA 1PHHA 4OPTA 3DGHA 3NXLA 1YKJA 4GYPC 3UCCA 3T8QA 3CPJG 3CGDA 3UJFA 3CXBA 1PXBA 1FO4A 1CL0A 4NTDA 2C64A 3AE4A 3BNUA 3NK0X 2YG7A 3UKFA 3NO1A 2UZZA 2BS4A 3SGLA 1YY5A 1V59A 2WQYA 3RITA 3DJDA 1TYPA 4E5TA 2A89A 1TDEA 1WYGA 1KNRA 1O5WA 3I6DA 3JSKA 3NGCX 4EMWA 3GDNA 1N61C 4FI4A 5FS6A 2ARDA 4FK1C 3A7RA 3B9JB 4TM0A 1BKHA 1S3BA 1FIQB 2AL1A 3D9XA 3L8KA 1PDZA 1DJNA 3LZXA 3IHMA 1L0VA 3AE2A 1N5WC 2BS2A 4B66A 4H4UA 4ZCCA 3AWIA 3ENLA 3ZYXA 1GXFA 4X2PA 2DW7A 5IQ4A 2P8BA 3ALLA 4AP3A 3STPA 4H2QA 2C65A 4AT0A 4CRTA 3GO2A 4DHGA 3V4BA 3AD8B 1PBFA 1XDIA 3GDPA 2R0GA 2Y6QA 1L9CA 4X9MA 1VG9A 1N4UA 3Q9TA 2VRMA 3RP6A 3TTEA 3V3OA 4GDEA 2JB3A 3MZNA 4RSLA 3H7VA 3IWAA 3KU9A 1Q9IA 2F5ZA 2QGYA 1ELSA 4K2SA 4I58A 1COYA 1IUVA 2YG6A 4MGGA 3NYEA 1E1LA 3SXIA 4HCDA 4A5LA 3G5SA 1GRFA 3GD3A 1B37A 3CTYA 4U8IA 3VCCA 1ZMCA 1K0JA 2Q7VA 4HB9A 1ZP0A 1LVLA 4ZN0A 4U8PA 4Z43A 4XXGA 2E1MA 5FJTA 3AEAA 4Z26A 4H1ZA 2BC1A 1PDYA 3GWDA 4A3RA 2W55A 1D4DA 4X4JA 4KX6A 4K5RA 2FJEA 1OJ9A 5IDZA 3RP7A 4KT2A 3FBSA 4IZGA 1OEPA 1EBGA 3CNDA 3DERA 1FHVA 3SN0A 3ZLHA 4YTMA 2E3TA 1L9DA 2GQWA 3VA8A 4HNLA 3OW1A 2XH7A 4IV9A 1RM6B 3PWGA 4TLXA 5FMHA 3SJNA 3DGBA 3UOYA 1FFUC 2YVJA 2GF3A 2QDDA 4IL2A 1NHRA 3CNTA 2E5VA 1EL5A 1F8SA 5EU9A 2XLUA 1F9CA 2PYXA 3OZMA 2OQHA 3GYJA 3DG7A 3OZYA 3ZLFA 2C66A 2MNRA 1PN0A 3OP2A 5JCIA 3AE9A 2APGA 3VRAA 3UCLA 4A35A 1RYIA 4A9WA 3P1WA 2XVEA 3LXDA 2WP5A 2VRLA 1S3EA 4U2TA 4H4VA 3FVDA 4H2PA 3UTGA 2GMJA 2P8CA 4B69A 1JRYA 5KOWA 4JQ9A 3NN6X 2XCGA 4AOSA 5G5GB 3QLDA 3FCPA 5ENLA 2GGEA 1P48A 1O95A 2YAUA 3R9UA 1JU2A 3A7UA 4ZOHB 4OPUA 3T14A 3AEFA 3S61A 2PHHA 2C7GA 4E4FA 2J3NA 3T37A 4JHMA 1IUUA 2XH4A 3R0KA 1N4WA 1N62C 4YTPA 3JVAA 2ONEA 3I6TA 3UJRA 4TM3A 4K22A 4M6UA 2YM2A 1L8PA 4H4RA 1M6IA 4GAVA 4RG4A 4P9SA 3CT2A 4G74A 4U8OA 3AN1A 2VQBA 1JEHA 1SEZA 5M0ZA 1BZLA 3URHA 1B8SA 3K7TA 3CNSA 5HHFA 6ENLA 1KDGA 3D1CA 1OJTA 3F8RA 4GUVA 3DEQA 2R46A 4YWOA 4B68A 3I4KA 3N6JA 1S7MA 5BULA 3N4FA 2JB1A 1N1PA 4HN8A 4ROPA 3GYIA 2ZBWA 1JPDX 4J1OA 2QJJA 1RSGA 2HXTA 4YWSA 4FX9A 2WEUA 5KWFA 4ECHA 1NAAA 2E5AA 2A87A 1BGJA 3DJJA 3VDGA 2C3CA 5FJPA 4J31A 1PBDA 3AE8A 1YQ4A 3EF6A 3GRSA 3QVRA 3DH9A 1JPMA 2X50A 2PCEA 2WPEA 4APNA 1Y56A 5EOWA 4IP5A 2PTWA 2C72A 4IVMB 4HCHA 1VG0A 3NHOX 3AD7B 3H8LA 2W54A 2VZ2A 2YG4A 4IA5A 1EL9A 2WS3A 5EB5A 1NENA 4FDCB 3UTHA 2A8XA 1TE6A 2BABA 4DN1A 4YSXA 3L1RA 1D7YA 3UOZA 2ZADA 1IUTA 4B63A 5BVAA 2XFOA 2YLWA 3CGEA 2YLSA 3P9UA 1Q1WA 2I0ZA 4TM4A 1TZZA 5FJUA 3NRZB 4IT1A 3AYLA 5KMPA 3VC5A 4MMWA 4NEVA 1W6TA 3PK7A 4Z17A 1MXTA 1NHQA 3ZVIA 3VRDB 3C4AA 1T3QC 3NYCA 1LQTA 4H2NA 1VDCA 4HYRA 4DSHA 3THUA 2R9ZA 5CQFA 2QQ6A 5U63A 3SQPA 1E39A 1M64A 2GDQA 2OLNA 2V61A 4C5OA 1SB3B 5BUKA 1EL7A 2RDXA 1GALA 2WU5A 5EB4A 2BCGG 1NPXA 1QJDA 2FYMA 2Q0LA 4ADWA 1LTXR 3BNMA 2XFPA 3OTRA 4EWJA 3QJ4A 1GESA 3JZUA 3CPIG 2JAEA 2GH5A 3NNEA 2X99A 5JRBA 2P0IA 3ZVHA 1NELA 4ZCWA 1JOAA 5BOFA 3ES8A 4EIPA 4U8NA 2WBAA 3AE6A 4GCMA 3R11A 4BK1A 3VQRA 4J34A 3NK1X 1SJBA 3SN1A 5DBJA 2PU0A 1Z6LA 2W3RA 1JCTA 3TJ4A 3UKPA 1H7WA 1PBCA 4G6GA 4USRA 4C3XA 4G9KA 4H2HA 3OZ2A 3SY4A 3EKGA 3AE5A 3R0UA 3BI4A 3AEGA 3ADAB 3MUCA 2C76A 3VC6A 3IC9A 5JCKA 3NKSA 2BXRA 2X8GA 2QA2A 3FMWA 3DIPA 4BV6A 3COXA 4A99A 3K1GA 3HPFA 2TMDA 4G7FA 4Y4MA 5C3JA 3NVYB 3SR6B 2XLTA 4E8GA 4GMEA 3B97A 3B6DA 1PJ5A 2YWLA 4YKFA 1JROA 2PP3A 1NHSA 1JRZA 3E1TA 1EL8A 4IHCA 3DJEA 4EQWA 1EBHA 2GV8A 1N60C 1PXCA 3SZCA 2OAMA 4YTNA 3SYIA 4K2XA 5KNLA 1PBBA 4UDQA 3AD9B 1KD0A 3TWAA 2ZZBA 2ZZCA 3FIMB 4WCTA 3QSEA 3N4EA 3SSZA 2AKZA 3NH3X 3UOVA 3BJSA 4I59A 1V97A 2B7RA 5KOXA 3U4FA 1GEUA 1LJ1A 2BRYA 3ITJA 3SM8A 4H4PA 4A6NB 3H8IA 1DODA 4K1WA 2OLOA 3EANA 2OQYA 5FJOA 3FJ4A 1CJCA 1GV4A 4YSHA 4EQXA 1H83A 1VDVA 2B7SA 4K8GA 1QO8A 4GAPA 1L9EA 2XSXA 3QSSA 1EBDA 3T2YA 1GOSA 3QVPA 2PODA 2DKHA 1GREA 1GRBA 2XH0A 5L46A 3SFDA 1TYTA 5KRQA 4NTCA 4H4XA 4B64A 5FJRA 4HA6A 2YG3A 3BI2A 3ETRB 3BHFA 1FHUA 4J2WA 4ZA0A 3ICSA 2BC0A 3S47A 2JB2A 2VOUA 1FEAA 1WUEA 2DKIA 4Z25A 2GMHA 3D46A 2QAEA 2HNEA 3VRBA 3Q45A 3NRNA 2W0HA 3ALMA 2XFQA 3QSMA 3NTDA 1XPQA 4OPDA 2YQUA 1PJ6A 4OPGA 3F8DA 2PP1A 4BK2A 3UP5A 1BGNA 2Y6RA 1FFVC 1KN0A 2H89A 3VR8A 1B4VA 5KVIA 1NG3A 5U25A 3N6HA 1ZOYA 1H84A 4BURA 1UKVG 5KMSA 1YQZA 1KCZA 4LU6A 4GGHA 1IUWA 2BCPA 1ZK7A 4AOXA 3PVCA 2FJAA 3C96A 4WX1A 2OA1A 3Q4DA 5HXIA 2PGEA 4AT2A 4JY2A 3UXKA 2C75A 5M10A 2Z5YA 4IL0A 5IQ1A 1D7LA 1IYXA 3ATRA 1RP0A 1IUSA 2B9YA 4TLZA 3M13A 2YVGA 4NEWA 5LV9A 3T6CA 1PXAA 2BYBA 4EM3A 1DTNA 1BQGA 2EQ8A 2QJMA 1KF6A 3ES7A 4J57A 1N5XA 3SZ0A 2XVHA 1KKRA 2C4CA 2BS3A 2E4GA 3DA1A 3EAOA 2IVEA 3H12A 3CN8A 1K0LA 1KNPA 4A7AA 5FS9A 4TVYA 2QVHA 3REDA 3CPHG 4II3A 3DJGX 3QKEA 3HYWA 3BI5A 1F8WA 4K7ZA 5EBKA 1NG4A 5BRTA 1N63C 4E6MA 4A65A 3UTFA 1ZMDA 1X31B 4NTEA 4JN9A 3NFUA 4DNAA 1DOEA 2V6OA 1JNRA 4GDPA 3WE0A 3G5QA 3HYVA 2V5ZA 4J33A 1E7PA 4Z44A 5G5HB 3R07C 1R0MA 3DG6A 4UDRA 2TPRA 1ZY8A 2YR4A 1GPEA 3P4RA 3TW9A 4OPIA 4DXKA 5JCNA 4C74A 3SQSA 1H7XA
chains in the Genus database with same CATH topology
2R4EA 3L5OA 1K0IA 4ADWA 4H4UA 4O5UA 4ZCCA 2GR2A 2AAQA 1LTXR 3AWIA 3BNMA 4A6NA 2V3BA 2XFPA 1GXFA 3ZYXA 2BXSA 3KVEA 3UTHA 2RABA 1CHUA 2X8CA 2ACZA 3GMCA 2FBWA 5IQ4A 1KSSA 3QJ4A 2C67A 3ALLA 1GESA 3CPIG 2JAEA 2GH5A 3NK2X 3NNEA 4CY6A 2X99A 5JRBA 4AP3A 4H2QA 2R0CA 2XVIA 2C65A 4AT0A 4CRTA 4GF7A 3AD8B 2WETA 3T0KA 2BK4A 1PBFA 1KSUA 1ZDLA 5FS8A 2OALA 4X9NA 2JK6A 1JOAA 1FECA 1XDIA 3V76A 5U1OA 3CGCA 2B9WA 2WBAA 2R0GA 3GDPA 1TRBA 4U8NA 4BJZA 4EIPA 2Y6QA 1L9CA 1CC6A 3IHGA 3AE6A 2GAGB 4X9MA 3DK9A 2GEWA 4GCMA 1GRTA 3V3NA 1VG9A 4TM1A 4BK1A 3VQRA 3PO7A 1CBOA 1N4UA 4O5QA 3Q9TA 1ZKQA 4J34A 3NK1X 4GRTA 4U2LA 5DBJA 1Z6LA 2VRMA 4NNJA 1E1KA 2VVLA 1S2QA 3S5WA 4J56A 3RP6A 4N9XA 2XVJA 2JKCA 2XDOA 3UKPA 1H7WA 3V3OA 1PBCA 4JNQA 3LZWA 4G6GA 4USRA 3NTAA 4GDEA 5KMQA 2Q0KA 1TDFA 3DK4A 4C3XA 4G9KA 2JB3A 5GSNA 2WP6A 3H4KA 3OZ2A 5ER0A 3CNPA 3SY4A 1FOHA 1PJ7A 4RSLA 3AYIA 2CVJA 3IWAA 1TDKA 2EQ6A 3LADA 1Y56B 3KU9A 4FK1A 1Q9IA 2F5ZA 3AE5A 4U8MA 4E0VA 2WOWA 4GAPA 4GR1A 5TR3A 2XYOA 3BI4A 4I58A 3PS9A 4G73A 1B5QA 1COYA 1IUVA 3T2ZA 1ELIA 3AEGA 1GNDA 2QA1A 4CCRA 1TDNA 3ADAB 3P4SA 3UKAA 1PBEA 4CBQA 2YG6A 3O0HA 1ONFA 2C76A 3NYEA 1KFYA 4NZHA 3IC9A 3NT6A 4YSZA 3C4NA 1GERA 5JCKA 1H86A 4OCGA 1E1LA 3SXIA 3NKSA 4A5LA 2Q6UA 3G5SA 1GRFA 3GD3A 2BXRA 1B37A 2X8GA 2QA2A 1P2EA 3CTYA 4U8IA 1GETA 3UKKA 3FMWA 2GQFA 1NEKA 1ZMCA 1K0JA 4BV6A 4EMJA 4C77A 3COXA 4A99A 3T31A 4CNJA 2WPFA 2Q7VA 2TMDA 3CIRA 4HB9A 1ZP0A 1LVLA 4ZN0A 2CULA 2GR1A 4H4ZA 4B67A 3ISHA 4U8PA 1GTHA 4Z43A 5C2TA 2H88A 3RHAA 4XXGA 4Y4MA 3CMMA 5C3JA 4A79A 2E1MA 3OC4A 3AEAA 4LA1A 3AXBA 4Z26A 2V3AA 2BC1A 3GWDA 2XLTA 4CCQA 2VQ7A 2IIDA 4EQRA 2FJDA 4H2RA 2WDVA 2RGHA 3G5RA 1GRAA 1D4DA 3B6DA 1PJ5A 4X4JA 5J60A 4KX6A 4K5RA 2FJEA 2YWLA 1OJ9A 1E1NA 4YKFA 4U8KA 3NG7X 1NHSA 1CJ4A 3RP7A 1JRZA 2YLXA 1MOKA 3E1TA 2GVCA 1EL8A 3FBSA 1XANA 4XWRA 1LQUA 3DJEA 5KVHA 1HYUA 4Z2RA 4EQWA 4YKGA 2YR5A 3AE7A 3CNDA 3K7MX 2GV8A 3UTEA 2R45A 1PXCA 3SZCA 2OAMA 4YTNA 3SYIA 4K2XA 4Z24A 4YTMA 2WU2A 5KNLA 1PBBA 4UDQA 3AD9B 2FJBA 1L9DA 2GQWA 2C3DA 2GAHB 4EQSA 2ZZBA 2ZZCA 4H50A 3FIMB 2AQJA 4WCTA 3QSEA 4IV9A 4Z2UA 2HQMA 4TLXA 1H81A 5FMHA 3LB8A 4EMIA 1F3PA 3UOYA 4CY8A 3NH3X 3M12A 4I59A 3UOVA 2XFUA 2YVJA 5JCLA 2GF3A 1D4EA 4MJWA 2B7RA 5KOXA 3AE3A 4OVIA 4OPCA 3CNTA 1NHRA 2XLSA 3ZDNA 4KPRA 1K4QA 5J7XA 3BHKA 4G6HA 2VVLG 2E5VA 1GEUA 1EL5A 1F8SA 3DMEA 2B76A 1LJ1A 3SZFA 2BRYA 3ITJA 2XLUA 4Y4NA 4H4PA 2PYXA 3SM8A 1YQ3A 4B1BA 4A6NB 3H8IA 4USQA 1DODA 3ABVA 3GWFA 4BK3A 1MO9A 3GYJA 3UOXA 4IVOB 4UP3A 4H4TA 2WESA 1GTEA 2NPXA 1FEBA 2WOIA 1CJ3A 2C66A 4D04A 2C73A 2OLOA 1PN0A 2YLRA 3AYJA 3GSIA 2O9ZA 3EANA 5JCIA 1Q1RA 1H2IA 1CJCA 1GV4A 4YSHA 2BA9A 4EQXA 1H83A 1XHCA 2APGA 3AE9A 3ATQA 3FPZA 3VRAA 3UCLA 3HYXA 2B7SA 1RYIA 4D03A 3K7QX 2YG5A 4A9WA 4Y4LA 2WOVA 1QO8A 4U2SA 1OJCA 1L9EA 2WPCA 2C70A 2BRAA 3LXDA 2XVEA 2WP5A 3P1WA 1EBDA 3QSSA 4H4QA 1CF3A 2XFNA 3T2YA 4K5SA 3GD4A 2VRLA 1GOSA 1VRQB 3QVPA 2DKHA 1OJDA 1S3EA 4U2TA 5FS7A 1GREA 1GRBA 4H4VA 1D5TA 5L46A 1P2HA 4H2PA 3RNMA 2Z5XA 2XVFA 3UTGA 2GMJA 4B69A 3SFDA 1CJ2A 1TYTA 1JRYA 5KRQA 5KOWA 4JQ9A 3AE1A 3LJPA 4H4XA 3NN6X 2XCGA 4NTCA 4AOSA 4B64A 3AECA 4JNAA 3NYFA 2EQ7A 1BF3A 3T2KA 4HA6A 1ZX9A 1O95A 2YG3A 2YAUA 2CFYA 3R9UA 3BI2A 4CNKA 1DOCA 1JU2A 4YSYA 3BHFA 2XLPA 1PS9A 1REOA 4J2WA 3AEFA 4OPUA 3T14A 3S61A 1DXLA 3ICSA 4JDRA 2PHHA 3CNJA 2C7GA 2BC0A 2J3NA 3T37A 1GRGA 1IUUA 1JNZA 2WDQA 2R0PA 2JB2A 2VOUA 1FEAA 1OJAA 3SFEA 3UKQA 1N4WA 4YTPA 2DKIA 4UDPA 4RG3A 4Z25A 3ICTA 4ICYA 1BWCA 2CDUA 1LPFA 2X8HA 1LV0A 4TM3A 3UP4A 4K22A 3HZLA 4ZCDA 1DNCA 2GMHA 2YM2A 1H6VA 3DGZA 2QAEA 3VRBA 4H4RA 1ZOVA 1M6IA 3NRNA 4GAVA 4RG4A 3SX6A 3M0OA 2W0HA 4P9SA 3ALMA 2XFQA 4G74A 3QSMA 4U8OA 2VQBA 3NTDA 1XPQA 2JBVA 1JEHA 3CGBA 1SEZA 3IF9A 3P4PA 4OPDA 5M0ZA 4YT0A 1BZLA 3URHA 1B8SA 2X3NA 3K7TA 3CNSA 5KXJA 2AR8A 2VVMA 1F8RA 3RP8A 2YQUA 1CC2A 5HHFA 3NIXA 3UKLA 1PJ6A 1KDGA 4LIIA 3D1CA 1OJTA 3F8RA 4OPGA 4GUVA 3F8DA 3GYXA 4BK2A 2R46A 3GMBA 4XWZA 4YWOA 4B68A 3KPFA 3UP5A 1S7MA 3AB1A 1BGNA 2Y6RA 2YLTA 3D8XA 5BULA 2JB1A 1N1PA 1KN0A 3GYIA 2H89A 3B3RA 3UKHA 2ZBWA 3VR8A 3DK8A 1B4VA 2BACA 2R4JA 5KVIA 3NN0X 3QFBA 4U8JA 1N4VA 3K30A 4II2A 2YVFA 1NG3A 5U25A 1RSGA 3AEBA 3VR9A 4NWZA 1ZOYA 1H84A 2ZZ0A 4BURA 1UKVG 4U8LA 3GRTA 3AEEA 1YQZA 5KMSA 3KLJA 3P4QA 1IJHA 4LU6A 3F8PA 4FX9A 2WEUA 2Q0LA 5HYMA 1VQWA 3KKJA 5KWFA 4OPLA 1IUWA 2BCPA 5GRTA 4ECHA 1ZK7A 4AOXA 1NAAA 3PVCA 2FJAA 3C96A 4WX1A 4AP1A 3I3LA 1DOBA 2OA1A 5CKUA 2A87A 1BGJA 4EIQA 5HXIA 1FCDA 3FG2P 3DJJA 2C3CA 4JY2A 4AT2A 4H7UA 4J31A 1PBDA 4PABA 3AE8A 2C75A 5HY5A 1YQ4A 5M10A 2V60A 3EF6A 2XLRA 1FL2A 2Z5YA 3GRSA 3QVRA 4K8DA 5IQ1A 3DH9A 3PG6A 1CC4A 1D7LA 2WDRA 4J36A 2GB0A 4H4WA 3ATRA 1RP0A 2X50A 2WPEA 4APNA 1IUSA 2WHDA 2B9YA 2NVKX 3LOVA 1Y56A 5EOWA 4PAAA 4TLZA 3M13A 2C72A 2YVGA 4NEWA 4IVMB 1GSNA 1E1MA 1PDHA 1IUXA 2EQ9A 1QLBA 1VG0A 3NHOX 3AD7B 3H8LA 5LV9A 2BK5A 2BYBA 1PXAA 1W4XA 2B9XA 1E6EA 2VZ2A 2YG4A 4EM3A 1DJQA 1EL9A 4IA5A 2WS3A 2WP9A 2EQ8A 3II4A 4H4YA 1KF6A 3SZ0A 4J57A 5JCMA 5EB5A 1AOGA 1NENA 4FDCB 2XVHA 3KPKA 2GR3A 4DGKA 4EM4A 2QCUA 2C4CA 2E4GA 1GRHA 2BS3A 2A8XA 3ICRA 1PHHA 3KD9A 2BABA 3DA1A 2IVDA 3SZWA 3ALJA 4YXDA 3EAOA 4OPTA 2IVEA 3DGHA 4YSXA 3L1RA 1D7YA 4IA6A 3UOZA 3CN8A 1IUTA 1K0LA 1KNPA 4B63A 4A7AA 5BVAA 2XFOA 4REKA 5FS9A 1BKWA 2YLWA 3CGEA 3REDA 3CPHG 2YLSA 4II3A 1Y0PA 1YKJA 3DJGX 2YLZA 3HYWA 3P9UA 1Q1WA 3CPJG 3CGDA 3BI5A 1F8WA 4K7ZA 2YM1A 2I0ZA 5EBKA 1PXBA 1NG4A 2GR0A 5BRTA 4TM4A 1CL0A 4NTDA 2C64A 1GT8A 1JRXA 4B65A 1TDOA 3AE4A 4BJYA 3BNUA 3NK0X 1NDAA 2YG7A 3UKFA 2RGOA 3AYLA 3NLCA 4A65A 2UZZA 5KMPA 3UTFA 2BS4A 3SGLA 1YY5A 1V59A 1ZMDA 1X31B 2WQYA 4NTEA 4NEVA 2YR6A 4JN9A 3DJDA 4DNAA 1DOEA 1TYPA 1MXTA 1NHQA 2A89A 2RGJA 3VRDB 2V6OA 1TDEA 1JNRA 4GDPA 5KMRA 3WE0A 3G5QA 3C4AA 3HYVA 1KNRA 2V5ZA 4J33A 1E7PA 4Z44A 1NHPA 1D4CA 3NYCA 1LQTA 1O5WA 4H2NA 4M52A 3I6DA 3JSKA 1VDCA 3NGCX 4EMWA 3GDNA 4DSHA 2R9ZA 3EPTA 5CQFA 5U63A 5FS6A 2ARDA 4FK1C 4Z2TA 3KA7A 3SQPA 2TPRA 4UDRA 1ZY8A 2YR4A 1O94A 4C3YA 1F6MA 4H4SA 1GPEA 1E39A 1S2YA 4TM0A 3QFAA 3P4RA 1M64A 2V61A 2OLNA 2GRTA 2BK3A 1S3BA 4C5OA 3Q6JA 5BUKA 4OPIA 3D9XA 1EL7A 3L8KA 1GALA 5JCNA 3AEDA 1DJNA 2WU5A 4C74A 3LZXA 3IHMA 2BCGG 5EB4A 1L0VA 4JY3A 1NPXA 5IPYA 3AE2A 1QJDA 2BS2A 4B66A 1H82A 4DSGA 1H7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4E A;  1K0I A;  4ADW A;  4H4U A;  4O5U A;  4ZCC A;  2GR2 A;  2AAQ A;  1LTX R;  3AWI A;  3BNM A;  4A6N A;  2V3B A;  2XFP A;  1GXF A;  3ZYX A;  2BXS A;  3KVE A;  2RAB A;  1CHU A;  2X8C A;  2ACZ A;  3GMC A;  2FBW A;  5IQ4 A;  1KSS A;  3QJ4 A;  2C67 A;  3ALL A;  1GES A;  3CPI G;  2JAE A;  2GH5 A;  3NK2 X;  3NNE A;  4CY6 A;  2X99 A;  4AP3 A;  4H2Q A;  2R0C A;  2XVI A;  2C65 A;  4AT0 A;  4CRT A;  4GF7 A;  3AD8 B;  2WET A;  2BK4 A;  1PBF A;  1KSU A;  1ZDL A;  5FS8 A;  2OAL A;  4X9N A;  2JK6 A;  1JOA A;  1FEC A;  1XDI A;  3V76 A;  5U1O A;  3CGC A;  2B9W A;  2WBA A;  2R0G A;  3GDP A;  1TRB A;  4U8N A;  4BJZ A;  4EIP A;  2Y6Q A;  1L9C A;  1CC6 A;  3IHG A;  3AE6 A;  2GAG B;  4X9M A;  3DK9 A;  2GEW A;  4GCM A;  1GRT A;  3V3N A;  1VG9 A;  4TM1 A;  4BK1 A;  3VQR A;  3PO7 A;  1CBO A;  1N4U A;  4O5Q A;  3Q9T A;  1ZKQ A;  4J34 A;  3NK1 X;  4GRT A;  4U2L A;  5DBJ A;  1Z6L A;  2VRM A;  1E1K A;  2VVL A;  1S2Q A;  3S5W A;  4J56 A;  3RP6 A;  4N9X A;  2XVJ A;  2JKC A;  2XDO A;  3UKP A;  1H7W A;  3V3O A;  1PBC A;  4JNQ A;  3LZW A;  4USR A;  3NTA A;  4GDE A;  2Q0K A;  1TDF A;  3DK4 A;  4C3X A;  2JB3 A;  5GSN A;  2WP6 A;  3H4K A;  3OZ2 A;  5ER0 A;  3CNP A;  1FOH A;  1PJ7 A;  4RSL A;  3AYI A;  2CVJ A;  3IWA A;  1TDK A;  2EQ6 A;  3LAD A;  1Y56 B;  3KU9 A;  4FK1 A;  1Q9I A;  2F5Z A;  3AE5 A;  4U8M A;  4E0V A;  2WOW A;  4GR1 A;  5TR3 A;  2XYO A;  3BI4 A;  4I58 A;  3PS9 A;  1B5Q A;  1COY A;  1IUV A;  1ELI A;  3AEG A;  1GND A;  2QA1 A;  4CCR A;  1TDN A;  3ADA B;  3P4S A;  3UKA A;  1PBE A;  4CBQ A;  2YG6 A;  3O0H A;  1ONF A;  2C76 A;  3NYE A;  1KFY A;  4NZH A;  3IC9 A;  3NT6 A;  4YSZ A;  3C4N A;  1GER A;  5JCK A;  1H86 A;  4OCG A;  1E1L A;  4A5L A;  3NKS A;  2Q6U A;  3G5S A;  1GRF A;  3GD3 A;  2BXR A;  1B37 A;  2X8G A;  2QA2 A;  1P2E A;  3CTY A;  4U8I A;  1GET A;  3UKK A;  3FMW A;  2GQF A;  1NEK A;  1ZMC A;  1K0J A;  4BV6 A;  4EMJ A;  4C77 A;  3COX A;  4A99 A;  4CNJ A;  2WPF A;  2Q7V A;  2TMD A;  3CIR A;  4HB9 A;  1ZP0 A;  1LVL A;  4ZN0 A;  2CUL A;  2GR1 A;  4H4Z A;  4B67 A;  3ISH A;  4U8P A;  1GTH A;  4Z43 A;  5C2T A;  2H88 A;  3RHA A;  4XXG A;  4Y4M A;  5C3J A;  4A79 A;  2E1M A;  3OC4 A;  3AEA A;  4LA1 A;  3AXB A;  4Z26 A;  2V3A A;  2BC1 A;  3GWD A;  2XLT A;  4CCQ A;  2VQ7 A;  2IID A;  4EQR A;  2FJD A;  4H2R A;  2WDV A;  2RGH A;  3G5R A;  1GRA A;  1D4D A;  3B6D A;  1PJ5 A;  4X4J A;  5J60 A;  4KX6 A;  4K5R A;  2FJE A;  2YWL A;  1OJ9 A;  1E1N A;  4YKF A;  4U8K A;  3NG7 X;  1NHS A;  1CJ4 A;  3RP7 A;  1JRZ A;  2YLX A;  1MOK A;  3E1T A;  2GVC A;  1EL8 A;  3FBS A;  1XAN A;  4XWR A;  1LQU A;  3DJE A;  5KVH A;  1HYU A;  4Z2R A;  4EQW A;  4YKG A;  2YR5 A;  3AE7 A;  3CND A;  3K7M X;  2GV8 A;  3UTE A;  2R45 A;  1PXC A;  2OAM A;  4YTN A;  4K2X A;  4Z24 A;  4YTM A;  2WU2 A;  1PBB A;  4UDQ A;  3AD9 B;  2FJB A;  1L9D A;  2GQW A;  2C3D A;  2GAH B;  4EQS A;  2ZZB A;  2ZZC A;  4H50 A;  3FIM B;  2AQJ A;  4WCT A;  3QSE A;  4IV9 A;  4Z2U A;  2HQM A;  4TLX A;  1H81 A;  5FMH A;  3LB8 A;  4EMI A;  1F3P A;  3UOY A;  4CY8 A;  3NH3 X;  3M12 A;  4I59 A;  3UOV A;  2XFU A;  2YVJ A;  5JCL A;  2GF3 A;  1D4E A;  4MJW A;  2B7R A;  5KOX A;  3AE3 A;  4OVI A;  4OPC A;  3CNT A;  1NHR A;  2XLS A;  3ZDN A;  4KPR A;  1K4Q A;  5J7X A;  3BHK A;  2VVL G;  2E5V A;  1GEU A;  1EL5 A;  1F8S A;  3DME A;  2B76 A;  1LJ1 A;  3ITJ A;  2XLU A;  4Y4N A;  4H4P A;  2PYX A;  3SM8 A;  1YQ3 A;  4B1B A;  4A6N B;  3H8I A;  4USQ A;  1DOD A;  3ABV A;  3GWF A;  4BK3 A;  1MO9 A;  3GYJ A;  3UOX A;  4IVO B;  4UP3 A;  4H4T A;  2WES A;  1GTE A;  2NPX A;  1FEB A;  2WOI A;  1CJ3 A;  2C66 A;  4D04 A;  2C73 A;  2OLO A;  1PN0 A;  2YLR A;  3AYJ A;  3GSI A;  2O9Z A;  3EAN A;  5JCI A;  1Q1R A;  1CJC A;  1GV4 A;  4YSH A;  2BA9 A;  4EQX A;  1H83 A;  1XHC A;  2APG A;  3AE9 A;  3ATQ A;  3FPZ A;  3VRA A;  3UCL A;  2B7S A;  1RYI A;  4D03 A;  3K7Q X;  2YG5 A;  4A9W A;  4Y4L A;  2WOV A;  1QO8 A;  4U2S A;  1OJC A;  1L9E A;  2WPC A;  2C70 A;  2XVE A;  3LXD A;  3P1W A;  2WP5 A;  3QSS A;  1EBD A;  4H4Q A;  1CF3 A;  2XFN A;  4K5S A;  3GD4 A;  2VRL A;  1GOS A;  1VRQ B;  3QVP A;  2DKH A;  1OJD A;  1S3E A;  4U2T A;  5FS7 A;  1GRE A;  1GRB A;  4H4V A;  1D5T A;  5L46 A;  1P2H A;  4H2P A;  3RNM A;  2Z5X A;  2XVF A;  3UTG A;  2GMJ A;  4B69 A;  3SFD A;  1CJ2 A;  1TYT A;  1JRY A;  5KRQ A;  5KOW A;  4JQ9 A;  3AE1 A;  3LJP A;  4H4X A;  3NN6 X;  2XCG A;  4NTC A;  4AOS A;  4B64 A;  3AEC A;  4JNA A;  3NYF A;  2EQ7 A;  1BF3 A;  4HA6 A;  1ZX9 A;  1O95 A;  2YG3 A;  2YAU A;  2CFY A;  3R9U A;  3BI2 A;  4CNK A;  1DOC A;  1JU2 A;  4YSY A;  3BHF A;  2XLP A;  1PS9 A;  1REO A;  4J2W A;  3AEF A;  4OPU A;  3S61 A;  1DXL A;  3ICS A;  4JDR A;  2PHH A;  3CNJ A;  2C7G A;  2BC0 A;  2J3N A;  3T37 A;  1GRG A;  1IUU A;  1JNZ A;  2WDQ A;  2R0P A;  2JB2 A;  2VOU A;  1FEA A;  1OJA A;  3SFE A;  3UKQ A;  1N4W A;  4YTP A;  2DKI A;  4UDP A;  4RG3 A;  4Z25 A;  3ICT A;  4ICY A;  1BWC A;  2CDU A;  1LPF A;  2X8H A;  1LV0 A;  4TM3 A;  3UP4 A;  4K22 A;  3HZL A;  4ZCD A;  1DNC A;  2GMH A;  2YM2 A;  1H6V A;  3DGZ A;  2QAE A;  3VRB A;  4H4R A;  1ZOV A;  1M6I A;  3NRN A;  4RG4 A;  3M0O A;  2W0H A;  4P9S A;  3ALM A;  2XFQ A;  3QSM A;  4U8O A;  2VQB A;  3NTD A;  1XPQ A;  2JBV A;  1JEH A;  3CGB A;  1SEZ A;  3IF9 A;  3P4P A;  4OPD A;  5M0Z A;  4YT0 A;  1BZL A;  3URH A;  1B8S A;  2X3N A;  3K7T A;  3CNS A;  5KXJ A;  2AR8 A;  2VVM A;  1F8R A;  3RP8 A;  2YQU A;  1CC2 A;  5HHF A;  3NIX A;  3UKL A;  1PJ6 A;  1KDG A;  4LII A;  3D1C A;  1OJT A;  3F8R A;  4OPG A;  4GUV A;  3F8D A;  4BK2 A;  2R46 A;  3GMB A;  4XWZ A;  4YWO A;  4B68 A;  3KPF A;  3UP5 A;  3AB1 A;  1BGN A;  2Y6R A;  2YLT A;  3D8X A;  5BUL A;  2JB1 A;  1N1P A;  3GYI A;  2H89 A;  3B3R A;  3UKH A;  2ZBW A;  3VR8 A;  3DK8 A;  1B4V A;  2BAC A;  2R4J A;  5KVI A;  3NN0 X;  3QFB A;  4U8J A;  1N4V A;  3K30 A;  2YVF A;  1NG3 A;  5U25 A;  1RSG A;  3AEB A;  3VR9 A;  1ZOY A;  1H84 A;  2ZZ0 A;  4BUR A;  1UKV G;  4U8L A;  3GRT A;  3AEE A;  1YQZ A;  3KLJ A;  3P4Q A;  1IJH A;  4LU6 A;  3F8P A;  4FX9 A;  2WEU A;  2Q0L A;  5HYM A;  1VQW A;  3KKJ A;  5KWF A;  4OPL A;  1IUW A;  2BCP A;  5GRT A;  4ECH A;  1ZK7 A;  4AOX A;  1NAA A;  3PVC A;  2FJA A;  3C96 A;  4WX1 A;  4AP1 A;  3I3L A;  1DOB A;  2OA1 A;  5CKU A;  2A87 A;  1BGJ A;  4EIQ A;  5HXI A;  1FCD A;  3FG2 P;  3DJJ A;  2C3C A;  4JY2 A;  4AT2 A;  4H7U A;  4J31 A;  1PBD A;  4PAB A;  3AE8 A;  2C75 A;  5HY5 A;  1YQ4 A;  5M10 A;  2V60 A;  3EF6 A;  2XLR A;  1FL2 A;  2Z5Y A;  3GRS A;  3QVR A;  4K8D A;  5IQ1 A;  3DH9 A;  1CC4 A;  1D7L A;  2WDR A;  4J36 A;  2GB0 A;  4H4W A;  3ATR A;  1RP0 A;  2X50 A;  2WPE A;  4APN A;  1IUS A;  2WHD A;  2B9Y A;  2NVK X;  3LOV A;  1Y56 A;  5EOW A;  4PAA A;  4TLZ A;  3M13 A;  2C72 A;  2YVG A;  4NEW A;  4IVM B;  1GSN A;  1E1M A;  1PDH A;  1IUX A;  2EQ9 A;  1QLB A;  1VG0 A;  3NHO X;  3AD7 B;  3H8L A;  5LV9 A;  2BK5 A;  2BYB A;  1PXA A;  1W4X A;  2B9X A;  1E6E A;  2VZ2 A;  2YG4 A;  4EM3 A;  1DJQ A;  1EL9 A;  4IA5 A;  2WS3 A;  2WP9 A;  2EQ8 A;  3II4 A;  4H4Y A;  1KF6 A;  4J57 A;  5JCM A;  5EB5 A;  1AOG A;  1NEN A;  4FDC B;  2XVH A;  4DGK A;  2GR3 A;  4EM4 A;  2QCU A;  2E4G A;  3UTH A;  1GRH A;  2BS3 A;  2A8X A;  3ICR A;  1PHH A;  3KD9 A;  2BAB A;  3DA1 A;  2IVD A;  3ALJ A;  4YXD A;  3EAO A;  4OPT A;  2IVE A;  3DGH A;  4YSX A;  3L1R A;  1D7Y A;  4IA6 A;  3UOZ A;  3CN8 A;  1IUT A;  1K0L A;  1KNP A;  4B63 A;  4A7A A;  5BVA A;  2XFO A;  4REK A;  5FS9 A;  1BKW A;  2YLW A;  3CGE A;  3RED A;  3CPH G;  2YLS A;  1Y0P A;  1YKJ A;  3DJG X;  2YLZ A;  3P9U A;  1Q1W A;  3CPJ G;  3CGD A;  3BI5 A;  1F8W A;  4K7Z A;  2YM1 A;  2I0Z A;  5EBK A;  1PXB A;  1NG4 A;  2GR0 A;  5BRT A;  4TM4 A;  1CL0 A;  4NTD A;  2C64 A;  1GT8 A;  1JRX A;  4B65 A;  1TDO A;  3AE4 A;  4BJY A;  3BNU A;  3NK0 X;  1NDA A;  2YG7 A;  3UKF A;  2RGO A;  3AYL A;  3NLC A;  4A65 A;  2UZZ A;  3UTF A;  2BS4 A;  3SGL A;  1YY5 A;  1V59 A;  1ZMD A;  1X31 B;  2WQY A;  4NTE A;  4NEV A;  2YR6 A;  4JN9 A;  3DJD A;  4DNA A;  1DOE A;  1TYP A;  1MXT A;  1NHQ A;  2A89 A;  2RGJ A;  3VRD B;  2V6O A;  1TDE A;  1JNR A;  4GDP A;  3WE0 A;  3G5Q A;  3C4A A;  1KNR A;  2V5Z A;  4J33 A;  1E7P A;  4Z44 A;  1NHP A;  1D4C A;  3NYC A;  1LQT A;  1O5W A;  4H2N A;  4M52 A;  3I6D A;  3JSK A;  1VDC A;  3NGC X;  4EMW A;  3GDN A;  4DSH A;  2R9Z A;  3EPT A;  5CQF A;  5U63 A;  5FS6 A;  2ARD A;  4FK1 C;  4Z2T A;  3KA7 A;  3SQP A;  2TPR A;  4UDR A;  1ZY8 A;  2YR4 A;  1O94 A;  4C3Y A;  1F6M A;  4H4S A;  1GPE A;  1E39 A;  1S2Y A;  4TM0 A;  3QFA A;  3P4R A;  1M64 A;  2V61 A;  2OLN A;  2GRT A;  2BK3 A;  1S3B A;  4C5O A;  3Q6J A;  5BUK A;  4OPI A;  1EL7 A;  3L8K A;  1GAL A;  5JCN A;  3AED A;  1DJN A;  2WU5 A;  4C74 A;  3LZX A;  3IHM A;  2BCG G;  5EB4 A;  1L0V A;  4JY3 A;  1NPX A;  5IPY A;  3AE2 A;  1QJD A;  2BS2 A;  4B66 A;  1H82 A;  4DSG A;  1H7X A; 
#chains in the Genus database with same CATH topology
 3TJI A;  3L5O A;  2W3S A;  4O5U A;  2GR2 A;  2AAQ A;  1NU5 A;  3KVE A;  2RAB A;  1CHU A;  3GMC A;  2FBW A;  2C67 A;  3V5C A;  3NK2 X;  4CY6 A;  2R0C A;  2XVI A;  3IJQ A;  4GF7 A;  3QN3 A;  2PTZ A;  2BK4 A;  1KSU A;  1ZDL A;  5FS8 A;  4JN7 A;  4X9N A;  2CHR A;  2JK6 A;  3V76 A;  5U1O A;  3CGC A;  2B9W A;  1X2G A;  1TRB A;  4BJZ A;  3DK9 A;  2GEW A;  3V3N A;  4TM1 A;  3PO7 A;  1ZKQ A;  2VVL A;  1S2Q A;  3S5W A;  1TKK A;  4J56 A;  4N9X A;  2OVL A;  2XVJ A;  2JKC A;  3NTA A;  5KMQ A;  3FV9 A;  3DK4 A;  3UXL A;  2WP6 A;  3H4K A;  1FOH A;  1TDK A;  2EQ6 A;  3LAD A;  4GIS A;  4U8M A;  1XPY A;  4E0V A;  3D47 A;  2AL2 B;  4GR1 A;  5TR3 A;  3PS9 A;  4G73 A;  1B5Q A;  3T2Z A;  3NVV B;  1MDL A;  1GND A;  2QA1 A;  4CCR A;  3P4S A;  3UKA A;  2ZC8 A;  4NZH A;  4YSZ A;  1GER A;  2PP0 A;  1H86 A;  2QJN A;  2Q6U A;  3T9P A;  2PS2 A;  1P2E A;  2HZG A;  1NEK A;  4EMJ A;  4C77 A;  2PU1 A;  1MDR A;  3JW7 A;  3IJL A;  3T31 A;  3CIR A;  4GFI A;  2CUL A;  5C2T A;  1GTH A;  3DG3 A;  3DFH A;  3RHA A;  4A79 A;  2DW6 A;  3OC4 A;  4H83 A;  2I5Q A;  4LA1 A;  2V3A A;  4CCQ A;  2VQ7 A;  2IID A;  2WDV A;  3G5R A;  3I6E A;  4KPL A;  1GRA A;  5J60 A;  1MRA A;  4U8K A;  3AM9 A;  3RR1 A;  3NG7 X;  2YLX A;  1MOK A;  2POZ A;  1XAN A;  1MUC A;  1HYU A;  4Z2R A;  4KWS A;  3AE7 A;  2R45 A;  1KKO A;  2GGI A;  4EQS A;  4H50 A;  3IJI A;  2HQM A;  1H81 A;  4EMI A;  4HCL A;  1F3P A;  3DDM A;  3GC2 A;  2XFU A;  3AE3 A;  4OVI A;  3QTP A;  2XLS A;  1K4Q A;  5J7X A;  4G6H A;  3MKC A;  3DME A;  3SZF A;  4Y4N A;  4B1B A;  4USQ A;  3GWF A;  4IVO B;  2WES A;  1FEB A;  2WOI A;  2YLR A;  3AYJ A;  2O9Z A;  1XHC A;  4MKS A;  3FPZ A;  3HYX A;  4D03 A;  3K7Q X;  1R6W A;  2YG5 A;  4U2S A;  1OJC A;  2C70 A;  2BRA A;  1VRQ B;  1OJD A;  3AMZ A;  5FS7 A;  1P2H A;  3CAW A;  2Z5X A;  1P43 A;  3AE1 A;  1EC9 A;  3P0W A;  3AEC A;  4JNA A;  3NYF A;  1BF3 A;  3T2K A;  1ZX9 A;  2CFY A;  2GL5 A;  4CNK A;  2GGH A;  2XLP A;  1REO A;  3R10 A;  3CNJ A;  2GGG A;  3NVW B;  2R0P A;  1OJA A;  3SFE A;  3UKQ A;  4UDP A;  3SBF A;  4ICY A;  1BWC A;  3UP4 A;  4ZCD A;  3NS1 B;  1DNC A;  1H6V A;  4FP1 A;  1ZOV A;  3OPS A;  1STZ A;  3M0O A;  2JBV A;  3CGB A;  3P4P A;  3KUM A;  3V5F A;  5KXJ A;  5J04 A;  2VVM A;  3DES A;  3KPF A;  3PFR A;  3R25 A;  3AB1 A;  1SJC A;  2YLT A;  2AKM A;  4IP4 A;  2BAC A;  3MSY A;  2R4J A;  3NN0 X;  3QFB A;  4U8J A;  2YVF A;  3AEB A;  3CK5 A;  4U8L A;  3GRT A;  3KLJ A;  3F8P A;  5HYM A;  3KKJ A;  3CYJ A;  3I3L A;  4EIQ A;  3FG2 P;  4GGB A;  4H7U A;  4PAB A;  3BOX A;  3PG6 A;  4J36 A;  4H4W A;  3NZG A;  3LOV A;  1E1M A;  1IUX A;  2EQ9 A;  3DFY A;  1W4X A;  2B9X A;  2WP9 A;  3II4 A;  4GIR A;  1JRP A;  1AOG A;  4DGK A;  2QCU A;  2IVD A;  3SZW A;  3ALJ A;  4YXD A;  4IA6 A;  1EC8 A;  4REK A;  1BKW A;  1Y0P A;  2PGW A;  2YLZ A;  2YM1 A;  2GR0 A;  4G8T A;  1GT8 A;  3TWB A;  1JRX A;  4B65 A;  1X2H A;  3RRA A;  1TDO A;  4BJY A;  1NDA A;  2RGO A;  3NLC A;  2YR6 A;  2QDE A;  1VQZ A;  2PA6 A;  2RGJ A;  5KMR A;  2GSH A;  1NHP A;  1XS2 A;  4JN8 A;  1D4C A;  4M52 A;  1ECQ A;  3EPT A;  4Z2T A;  1WUF A;  3KA7 A;  3T4W A;  4C3Y A;  1O94 A;  1F6M A;  4H4S A;  1S2Y A;  3QFA A;  3FYY A;  2GRT A;  2BK3 A;  2PMQ A;  3Q6J A;  3AED A;  4JY3 A;  5IPY A;  3AXB A;  1H82 A;  4DSG A;  3SN4 A;  2R4E A;  1K0I A;  4J3Z A;  3P3B A;  4A6N A;  1RVK A;  2V3B A;  2BXS A;  2ACZ A;  2X8C A;  1KSS A;  3IK4 A;  4GYP A;  3T0K A;  2WET A;  2OAL A;  1FEC A;  4ENL A;  1CC6 A;  3IHG A;  2GAG B;  4DWD A;  1GRT A;  1CBO A;  2P3Z A;  4O5Q A;  4GRT A;  4U2L A;  4NNJ A;  1E1K A;  3H70 A;  1JDF A;  2XDO A;  4JNQ A;  3LZW A;  2Q0K A;  1TDF A;  3U9I A;  5GSN A;  2PTX A;  3VFC A;  5ER0 A;  3VCN A;  3CNP A;  1PJ7 A;  3AYI A;  2CVJ A;  1Y56 B;  4FK1 A;  4DX3 A;  2WOW A;  2XYO A;  4TVW A;  3NVZ B;  2OKT A;  2OZT A;  1ELI A;  1TDN A;  1PBE A;  4F4R A;  4CBQ A;  3BSM A;  3O0H A;  1ONF A;  1KFY A;  3NT6 A;  3C4N A;  4OCG A;  2OZ3 A;  1GET A;  2OPJ A;  3UKK A;  2GQF A;  2XGZ A;  4CNJ A;  3EEZ A;  2WPF A;  2PTY A;  2GR1 A;  4H4Z A;  4B67 A;  3ISH A;  2H88 A;  3CMM A;  4DYE A;  2O56 A;  4H2R A;  4EQR A;  2FJD A;  2RGH A;  3CB3 A;  1E1N A;  3RO6 A;  1CJ4 A;  3GY1 A;  2GVC A;  4XWR A;  1LQU A;  3UJS A;  5KVH A;  3TQP A;  4YKG A;  2YR5 A;  2GGJ A;  3K7M X;  3UTE A;  3UJ2 A;  4Z24 A;  2WU2 A;  2FJB A;  2C3D A;  2GAH B;  3TOY A;  3QPE A;  4E4U A;  2AQJ A;  1ZXI C;  4Z2U A;  3V3W A;  3LB8 A;  2OFJ A;  2OZ8 A;  4CY8 A;  3M12 A;  4MJW A;  5JCL A;  1D4E A;  1ONE A;  4OPC A;  1E9I A;  3ZDN A;  4KPR A;  3BHK A;  3TCS A;  2VVL G;  2B76 A;  4HNC A;  1YQ3 A;  3ABV A;  4BK3 A;  1MO9 A;  3UOX A;  1SJD A;  4UP3 A;  4H4T A;  2PPG A;  1GTE A;  2NPX A;  1CJ3 A;  4D04 A;  2C73 A;  3GSI A;  1Q1R A;  1H2I A;  3ZVH B;  2BA9 A;  2FKP A;  4KEM A;  3ATQ A;  2HXU A;  3S5S A;  4A6G A;  5BOE A;  4Y4L A;  2WOV A;  3CXO A;  2WPC A;  3PWI A;  4H4Q A;  1CF3 A;  2XFN A;  4K5S A;  3GD4 A;  7ENL A;  1D5T A;  3MWC A;  3GD6 A;  3RNM A;  2XVF A;  1CJ2 A;  3LJP A;  3R1Z A;  2EQ7 A;  3P93 A;  4Z1Y A;  1DOC A;  1EC7 A;  4YSY A;  1PS9 A;  3UJE A;  1DXL A;  4JDR A;  1GRG A;  1JNZ A;  2WDQ A;  3MQT A;  2OLA A;  4RG3 A;  3ICT A;  2CDU A;  1LPF A;  2X8H A;  1LV0 A;  3HZL A;  3DGZ A;  3EUB 3;  4H19 A;  3SX6 A;  4M0X A;  3IF9 A;  4YT0 A;  3UGV A;  2X3N A;  3FXG A;  2AR8 A;  1F8R A;  3RP8 A;  1CC2 A;  3NIX A;  3UKL A;  4LII A;  3GYX A;  3GMB A;  4XWZ A;  2P88 A;  3D8X A;  3B3R A;  3UKH A;  1YEY A;  3DK8 A;  3ZLG A;  1N4V A;  3K30 A;  4II2 A;  2OX4 A;  3VR9 A;  4NWZ A;  2ZZ0 A;  2OG9 A;  3AEE A;  3P4Q A;  1IJH A;  2NQL A;  1VQW A;  3A7A A;  4OPL A;  5GRT A;  4AP1 A;  5CKU A;  1DOB A;  4HPN A;  1SJA A;  3H8A A;  1FCD A;  3MY9 A;  5HY5 A;  2V60 A;  2XLR A;  1FL2 A;  3HW2 A;  4K8D A;  1CC4 A;  1MNS A;  3RCY A;  2WDR A;  2GB0 A;  3UCD A;  2MUC A;  2WHD A;  2NVK X;  4PAA A;  3HRD C;  1GSN A;  1PDH A;  2AL2 A;  1QLB A;  3RGT A;  2BK5 A;  1E6E A;  2OO6 A;  1DJQ A;  2PSN A;  4H4Y A;  5JCM A;  2XH2 A;  3KPK A;  2GR3 A;  4EM4 A;  1GRH A;  3KD9 A;  3ICR A;  1PHH A;  4OPT A;  3DGH A;  3NXL A;  1YKJ A;  4GYP C;  3UCC A;  3T8Q A;  3CPJ G;  3CGD A;  3UJF A;  3CXB A;  1PXB A;  1FO4 A;  1CL0 A;  4NTD A;  2C64 A;  3AE4 A;  3BNU A;  3NK0 X;  2YG7 A;  3UKF A;  3NO1 A;  2UZZ A;  2BS4 A;  3SGL A;  1YY5 A;  1V59 A;  2WQY A;  3RIT A;  3DJD A;  1TYP A;  4E5T A;  2A89 A;  1TDE A;  1WYG A;  1KNR A;  1O5W A;  3I6D A;  3JSK A;  3NGC X;  4EMW A;  3GDN A;  1N61 C;  4FI4 A;  5FS6 A;  2ARD A;  4FK1 C;  3A7R A;  3B9J B;  4TM0 A;  1BKH A;  1S3B A;  1FIQ B;  2AL1 A;  3D9X A;  3L8K A;  1PDZ A;  1DJN A;  3LZX A;  3IHM A;  1L0V A;  3AE2 A;  1N5W C;  2BS2 A;  4B66 A;  4H4U A;  4ZCC A;  3AWI A;  3ENL A;  3ZYX A;  1GXF A;  4X2P A;  2DW7 A;  5IQ4 A;  2P8B A;  3ALL A;  4AP3 A;  3STP A;  4H2Q A;  2C65 A;  4AT0 A;  4CRT A;  3GO2 A;  4DHG A;  3V4B A;  3AD8 B;  1PBF A;  1XDI A;  3GDP A;  2R0G A;  2Y6Q A;  1L9C A;  4X9M A;  1VG9 A;  1N4U A;  3Q9T A;  2VRM A;  3RP6 A;  3TTE A;  3V3O A;  4GDE A;  2JB3 A;  3MZN A;  4RSL A;  3H7V A;  3IWA A;  3KU9 A;  1Q9I A;  2F5Z A;  2QGY A;  1ELS A;  4K2S A;  4I58 A;  1COY A;  1IUV A;  2YG6 A;  4MGG A;  3NYE A;  1E1L A;  3SXI A;  4HCD A;  4A5L A;  3G5S A;  1GRF A;  3GD3 A;  1B37 A;  3CTY A;  4U8I A;  3VCC A;  1ZMC A;  1K0J A;  2Q7V A;  4HB9 A;  1ZP0 A;  1LVL A;  4ZN0 A;  4U8P A;  4Z43 A;  4XXG A;  2E1M A;  5FJT A;  3AEA A;  4Z26 A;  4H1Z A;  2BC1 A;  1PDY A;  3GWD A;  4A3R A;  2W55 A;  1D4D A;  4X4J A;  4KX6 A;  4K5R A;  2FJE A;  1OJ9 A;  5IDZ A;  3RP7 A;  4KT2 A;  3FBS A;  4IZG A;  1OEP A;  1EBG A;  3CND A;  3DER A;  1FHV A;  3SN0 A;  3ZLH A;  4YTM A;  2E3T A;  1L9D A;  2GQW A;  3VA8 A;  4HNL A;  3OW1 A;  2XH7 A;  4IV9 A;  1RM6 B;  3PWG A;  4TLX A;  5FMH A;  3SJN A;  3DGB A;  3UOY A;  1FFU C;  2YVJ A;  2GF3 A;  2QDD A;  4IL2 A;  1NHR A;  3CNT A;  2E5V A;  1EL5 A;  1F8S A;  5EU9 A;  2XLU A;  1F9C A;  2PYX A;  3OZM A;  2OQH A;  3GYJ A;  3DG7 A;  3OZY A;  3ZLF A;  2C66 A;  2MNR A;  1PN0 A;  3OP2 A;  5JCI A;  3AE9 A;  2APG A;  3VRA A;  3UCL A;  4A35 A;  1RYI A;  4A9W A;  3P1W A;  2XVE A;  3LXD A;  2WP5 A;  2VRL A;  1S3E A;  4U2T A;  4H4V A;  3FVD A;  4H2P A;  3UTG A;  2GMJ A;  2P8C A;  4B69 A;  1JRY A;  5KOW A;  4JQ9 A;  3NN6 X;  2XCG A;  4AOS A;  5G5G B;  3QLD A;  3FCP A;  5ENL A;  2GGE A;  1P48 A;  1O95 A;  2YAU A;  3R9U A;  1JU2 A;  3A7U A;  4ZOH B;  4OPU A;  3T14 A;  3AEF A;  3S61 A;  2PHH A;  2C7G A;  4E4F A;  2J3N A;  3T37 A;  4JHM A;  1IUU A;  2XH4 A;  3R0K A;  1N4W A;  1N62 C;  4YTP A;  3JVA A;  2ONE A;  3I6T A;  3UJR A;  4TM3 A;  4K22 A;  4M6U A;  2YM2 A;  1L8P A;  4H4R A;  1M6I A;  4GAV A;  4RG4 A;  4P9S A;  3CT2 A;  4G74 A;  4U8O A;  3AN1 A;  2VQB A;  1JEH A;  1SEZ A;  5M0Z A;  1BZL A;  3URH A;  1B8S A;  3K7T A;  3CNS A;  5HHF A;  6ENL A;  1KDG A;  3D1C A;  1OJT A;  3F8R A;  4GUV A;  3DEQ A;  2R46 A;  4YWO A;  4B68 A;  3I4K A;  3N6J A;  1S7M A;  5BUL A;  3N4F A;  2JB1 A;  1N1P A;  4HN8 A;  4ROP A;  3GYI A;  2ZBW A;  1JPD X;  4J1O A;  2QJJ A;  1RSG A;  2HXT A;  4YWS A;  4FX9 A;  2WEU A;  5KWF A;  4ECH A;  1NAA A;  2E5A A;  2A87 A;  1BGJ A;  3DJJ A;  3VDG A;  2C3C A;  5FJP A;  4J31 A;  1PBD A;  3AE8 A;  1YQ4 A;  3EF6 A;  3GRS A;  3QVR A;  3DH9 A;  1JPM A;  2X50 A;  2PCE A;  2WPE A;  4APN A;  1Y56 A;  5EOW A;  4IP5 A;  2PTW A;  2C72 A;  4IVM B;  4HCH A;  1VG0 A;  3NHO X;  3AD7 B;  3H8L A;  2W54 A;  2VZ2 A;  2YG4 A;  4IA5 A;  1EL9 A;  2WS3 A;  5EB5 A;  1NEN A;  4FDC B;  3UTH A;  2A8X A;  1TE6 A;  2BAB A;  4DN1 A;  4YSX A;  3L1R A;  1D7Y A;  3UOZ A;  2ZAD A;  1IUT A;  4B63 A;  5BVA A;  2XFO A;  2YLW A;  3CGE A;  2YLS A;  3P9U A;  1Q1W A;  2I0Z A;  4TM4 A;  1TZZ A;  5FJU A;  3NRZ B;  4IT1 A;  3AYL A;  5KMP A;  3VC5 A;  4MMW A;  4NEV A;  1W6T A;  3PK7 A;  4Z17 A;  1MXT A;  1NHQ A;  3ZVI A;  3VRD B;  3C4A A;  1T3Q C;  3NYC A;  1LQT A;  4H2N A;  1VDC A;  4HYR A;  4DSH A;  3THU A;  2R9Z A;  5CQF A;  2QQ6 A;  5U63 A;  3SQP A;  1E39 A;  1M64 A;  2GDQ A;  2OLN A;  2V61 A;  4C5O A;  1SB3 B;  5BUK A;  1EL7 A;  2RDX A;  1GAL A;  2WU5 A;  5EB4 A;  2BCG G;  1NPX A;  1QJD A;  2FYM A;  2Q0L A;  4ADW A;  1LTX R;  3BNM A;  2XFP A;  3OTR A;  4EWJ A;  3QJ4 A;  1GES A;  3JZU A;  3CPI G;  2JAE A;  2GH5 A;  3NNE A;  2X99 A;  5JRB A;  2P0I A;  3ZVH A;  1NEL A;  4ZCW A;  1JOA A;  5BOF A;  3ES8 A;  4EIP A;  4U8N A;  2WBA A;  3AE6 A;  4GCM A;  3R11 A;  4BK1 A;  3VQR A;  4J34 A;  3NK1 X;  1SJB A;  3SN1 A;  5DBJ A;  2PU0 A;  1Z6L A;  2W3R A;  1JCT A;  3TJ4 A;  3UKP A;  1H7W A;  1PBC A;  4G6G A;  4USR A;  4C3X A;  4G9K A;  4H2H A;  3OZ2 A;  3SY4 A;  3EKG A;  3AE5 A;  3R0U A;  3BI4 A;  3AEG A;  3ADA B;  3MUC A;  2C76 A;  3VC6 A;  3IC9 A;  5JCK A;  3NKS A;  2BXR A;  2X8G A;  2QA2 A;  3FMW A;  3DIP A;  4BV6 A;  3COX A;  4A99 A;  3K1G A;  3HPF A;  2TMD A;  4G7F A;  4Y4M A;  5C3J A;  3NVY B;  3SR6 B;  2XLT A;  4E8G A;  4GME A;  3B97 A;  3B6D A;  1PJ5 A;  2YWL A;  4YKF A;  1JRO A;  2PP3 A;  1NHS A;  1JRZ A;  3E1T A;  1EL8 A;  4IHC A;  3DJE A;  4EQW A;  1EBH A;  2GV8 A;  1N60 C;  1PXC A;  3SZC A;  2OAM A;  4YTN A;  3SYI A;  4K2X A;  5KNL A;  1PBB A;  4UDQ A;  3AD9 B;  1KD0 A;  3TWA A;  2ZZB A;  2ZZC A;  3FIM B;  4WCT A;  3QSE A;  3N4E A;  3SSZ A;  2AKZ A;  3NH3 X;  3UOV A;  3BJS A;  4I59 A;  1V97 A;  2B7R A;  5KOX A;  3U4F A;  1GEU A;  1LJ1 A;  2BRY A;  3ITJ A;  3SM8 A;  4H4P A;  4A6N B;  3H8I A;  1DOD A;  4K1W A;  2OLO A;  3EAN A;  2OQY A;  5FJO A;  3FJ4 A;  1CJC A;  1GV4 A;  4YSH A;  4EQX A;  1H83 A;  1VDV A;  2B7S A;  4K8G A;  1QO8 A;  4GAP A;  1L9E A;  2XSX A;  3QSS A;  1EBD A;  3T2Y A;  1GOS A;  3QVP A;  2POD A;  2DKH A;  1GRE A;  1GRB A;  2XH0 A;  5L46 A;  3SFD A;  1TYT A;  5KRQ A;  4NTC A;  4H4X A;  4B64 A;  5FJR A;  4HA6 A;  2YG3 A;  3BI2 A;  3ETR B;  3BHF A;  1FHU A;  4J2W A;  4ZA0 A;  3ICS A;  2BC0 A;  3S47 A;  2JB2 A;  2VOU A;  1FEA A;  1WUE A;  2DKI A;  4Z25 A;  2GMH A;  3D46 A;  2QAE A;  2HNE A;  3VRB A;  3Q45 A;  3NRN A;  2W0H A;  3ALM A;  2XFQ A;  3QSM A;  3NTD A;  1XPQ A;  4OPD A;  2YQU A;  1PJ6 A;  4OPG A;  3F8D A;  2PP1 A;  4BK2 A;  3UP5 A;  1BGN A;  2Y6R A;  1FFV C;  1KN0 A;  2H89 A;  3VR8 A;  1B4V A;  5KVI A;  1NG3 A;  5U25 A;  3N6H A;  1ZOY A;  1H84 A;  4BUR A;  1UKV G;  5KMS A;  1YQZ A;  1KCZ A;  4LU6 A;  4GGH A;  1IUW A;  2BCP A;  1ZK7 A;  4AOX A;  3PVC A;  2FJA A;  3C96 A;  4WX1 A;  2OA1 A;  3Q4D A;  5HXI A;  2PGE A;  4AT2 A;  4JY2 A;  3UXK A;  2C75 A;  5M10 A;  2Z5Y A;  4IL0 A;  5IQ1 A;  1D7L A;  1IYX A;  3ATR A;  1RP0 A;  1IUS A;  2B9Y A;  4TLZ A;  3M13 A;  2YVG A;  4NEW A;  5LV9 A;  3T6C A;  1PXA A;  2BYB A;  4EM3 A;  1DTN A;  1BQG A;  2EQ8 A;  2QJM A;  1KF6 A;  3ES7 A;  4J57 A;  1N5X A;  3SZ0 A;  2XVH A;  1KKR A;  2C4C A;  2BS3 A;  2E4G A;  3DA1 A;  3EAO A;  2IVE A;  3H12 A;  3CN8 A;  1K0L A;  1KNP A;  4A7A A;  5FS9 A;  4TVY A;  2QVH A;  3RED A;  3CPH G;  4II3 A;  3DJG X;  3QKE A;  3HYW A;  3BI5 A;  1F8W A;  4K7Z A;  5EBK A;  1NG4 A;  5BRT A;  1N63 C;  4E6M A;  4A65 A;  3UTF A;  1ZMD A;  1X31 B;  4NTE A;  4JN9 A;  3NFU A;  4DNA A;  1DOE A;  2V6O A;  1JNR A;  4GDP A;  3WE0 A;  3G5Q A;  3HYV A;  2V5Z A;  4J33 A;  1E7P A;  4Z44 A;  5G5H B;  3R07 C;  1R0M A;  3DG6 A;  4UDR A;  2TPR A;  1ZY8 A;  2YR4 A;  1GPE A;  3P4R A;  3TW9 A;  4OPI A;  4DXK A;  5JCN A;  4C74 A;  3SQS A;  1H7X A; 
#chains in the Genus database with same CATH homology
 2R4E A;  3L5O A;  1K0I A;  4ADW A;  4H4U A;  4O5U A;  4ZCC A;  2GR2 A;  2AAQ A;  1LTX R;  3AWI A;  3BNM A;  4A6N A;  2V3B A;  2XFP A;  1GXF A;  3ZYX A;  2BXS A;  3KVE A;  3UTH A;  2RAB A;  1CHU A;  2X8C A;  2ACZ A;  3GMC A;  2FBW A;  5IQ4 A;  1KSS A;  3QJ4 A;  2C67 A;  3ALL A;  1GES A;  3CPI G;  2JAE A;  2GH5 A;  3NK2 X;  3NNE A;  4CY6 A;  2X99 A;  5JRB A;  4AP3 A;  4H2Q A;  2R0C A;  2XVI A;  2C65 A;  4AT0 A;  4CRT A;  4GF7 A;  3AD8 B;  2WET A;  3T0K A;  2BK4 A;  1PBF A;  1KSU A;  1ZDL A;  5FS8 A;  2OAL A;  4X9N A;  2JK6 A;  1JOA A;  1FEC A;  1XDI A;  3V76 A;  5U1O A;  3CGC A;  2B9W A;  2WBA A;  2R0G A;  3GDP A;  1TRB A;  4U8N A;  4BJZ A;  4EIP A;  2Y6Q A;  1L9C A;  1CC6 A;  3IHG A;  3AE6 A;  2GAG B;  4X9M A;  3DK9 A;  2GEW A;  4GCM A;  1GRT A;  3V3N A;  1VG9 A;  4TM1 A;  4BK1 A;  3VQR A;  3PO7 A;  1CBO A;  1N4U A;  4O5Q A;  3Q9T A;  1ZKQ A;  4J34 A;  3NK1 X;  4GRT A;  4U2L A;  5DBJ A;  1Z6L A;  2VRM A;  4NNJ A;  1E1K A;  2VVL A;  1S2Q A;  3S5W A;  4J56 A;  3RP6 A;  4N9X A;  2XVJ A;  2JKC A;  2XDO A;  3UKP A;  1H7W A;  3V3O A;  1PBC A;  4JNQ A;  3LZW A;  4G6G A;  4USR A;  3NTA A;  4GDE A;  5KMQ A;  2Q0K A;  1TDF A;  3DK4 A;  4C3X A;  4G9K A;  2JB3 A;  5GSN A;  2WP6 A;  3H4K A;  3OZ2 A;  5ER0 A;  3CNP A;  3SY4 A;  1FOH A;  1PJ7 A;  4RSL A;  3AYI A;  2CVJ A;  3IWA A;  1TDK A;  2EQ6 A;  3LAD A;  1Y56 B;  3KU9 A;  4FK1 A;  1Q9I A;  2F5Z A;  3AE5 A;  4U8M A;  4E0V A;  2WOW A;  4GAP A;  4GR1 A;  5TR3 A;  2XYO A;  3BI4 A;  4I58 A;  3PS9 A;  4G73 A;  1B5Q A;  1COY A;  1IUV A;  3T2Z A;  1ELI A;  3AEG A;  1GND A;  2QA1 A;  4CCR A;  1TDN A;  3ADA B;  3P4S A;  3UKA A;  1PBE A;  4CBQ A;  2YG6 A;  3O0H A;  1ONF A;  2C76 A;  3NYE A;  1KFY A;  4NZH A;  3IC9 A;  3NT6 A;  4YSZ A;  3C4N A;  1GER A;  5JCK A;  1H86 A;  4OCG A;  1E1L A;  3SXI A;  3NKS A;  4A5L A;  2Q6U A;  3G5S A;  1GRF A;  3GD3 A;  2BXR A;  1B37 A;  2X8G A;  2QA2 A;  1P2E A;  3CTY A;  4U8I A;  1GET A;  3UKK A;  3FMW A;  2GQF A;  1NEK A;  1ZMC A;  1K0J A;  4BV6 A;  4EMJ A;  4C77 A;  3COX A;  4A99 A;  3T31 A;  4CNJ A;  2WPF A;  2Q7V A;  2TMD A;  3CIR A;  4HB9 A;  1ZP0 A;  1LVL A;  4ZN0 A;  2CUL A;  2GR1 A;  4H4Z A;  4B67 A;  3ISH A;  4U8P A;  1GTH A;  4Z43 A;  5C2T A;  2H88 A;  3RHA A;  4XXG A;  4Y4M A;  3CMM A;  5C3J A;  4A79 A;  2E1M A;  3OC4 A;  3AEA A;  4LA1 A;  3AXB A;  4Z26 A;  2V3A A;  2BC1 A;  3GWD A;  2XLT A;  4CCQ A;  2VQ7 A;  2IID A;  4EQR A;  2FJD A;  4H2R A;  2WDV A;  2RGH A;  3G5R A;  1GRA A;  1D4D A;  3B6D A;  1PJ5 A;  4X4J A;  5J60 A;  4KX6 A;  4K5R A;  2FJE A;  2YWL A;  1OJ9 A;  1E1N A;  4YKF A;  4U8K A;  3NG7 X;  1NHS A;  1CJ4 A;  3RP7 A;  1JRZ A;  2YLX A;  1MOK A;  3E1T A;  2GVC A;  1EL8 A;  3FBS A;  1XAN A;  4XWR A;  1LQU A;  3DJE A;  5KVH A;  1HYU A;  4Z2R A;  4EQW A;  4YKG A;  2YR5 A;  3AE7 A;  3CND A;  3K7M X;  2GV8 A;  3UTE A;  2R45 A;  1PXC A;  3SZC A;  2OAM A;  4YTN A;  3SYI A;  4K2X A;  4Z24 A;  4YTM A;  2WU2 A;  5KNL A;  1PBB A;  4UDQ A;  3AD9 B;  2FJB A;  1L9D A;  2GQW A;  2C3D A;  2GAH B;  4EQS A;  2ZZB A;  2ZZC A;  4H50 A;  3FIM B;  2AQJ A;  4WCT A;  3QSE A;  4IV9 A;  4Z2U A;  2HQM A;  4TLX A;  1H81 A;  5FMH A;  3LB8 A;  4EMI A;  1F3P A;  3UOY A;  4CY8 A;  3NH3 X;  3M12 A;  4I59 A;  3UOV A;  2XFU A;  2YVJ A;  5JCL A;  2GF3 A;  1D4E A;  4MJW A;  2B7R A;  5KOX A;  3AE3 A;  4OVI A;  4OPC A;  3CNT A;  1NHR A;  2XLS A;  3ZDN A;  4KPR A;  1K4Q A;  5J7X A;  3BHK A;  4G6H A;  2VVL G;  2E5V A;  1GEU A;  1EL5 A;  1F8S A;  3DME A;  2B76 A;  1LJ1 A;  3SZF A;  2BRY A;  3ITJ A;  2XLU A;  4Y4N A;  4H4P A;  2PYX A;  3SM8 A;  1YQ3 A;  4B1B A;  4A6N B;  3H8I A;  4USQ A;  1DOD A;  3ABV A;  3GWF A;  4BK3 A;  1MO9 A;  3GYJ A;  3UOX A;  4IVO B;  4UP3 A;  4H4T A;  2WES A;  1GTE A;  2NPX A;  1FEB A;  2WOI A;  1CJ3 A;  2C66 A;  4D04 A;  2C73 A;  2OLO A;  1PN0 A;  2YLR A;  3AYJ A;  3GSI A;  2O9Z A;  3EAN A;  5JCI A;  1Q1R A;  1H2I A;  1CJC A;  1GV4 A;  4YSH A;  2BA9 A;  4EQX A;  1H83 A;  1XHC A;  2APG A;  3AE9 A;  3ATQ A;  3FPZ A;  3VRA A;  3UCL A;  3HYX A;  2B7S A;  1RYI A;  4D03 A;  3K7Q X;  2YG5 A;  4A9W A;  4Y4L A;  2WOV A;  1QO8 A;  4U2S A;  1OJC A;  1L9E A;  2WPC A;  2C70 A;  2BRA A;  3LXD A;  2XVE A;  2WP5 A;  3P1W A;  1EBD A;  3QSS A;  4H4Q A;  1CF3 A;  2XFN A;  3T2Y A;  4K5S A;  3GD4 A;  2VRL A;  1GOS A;  1VRQ B;  3QVP A;  2DKH A;  1OJD A;  1S3E A;  4U2T A;  5FS7 A;  1GRE A;  1GRB A;  4H4V A;  1D5T A;  5L46 A;  1P2H A;  4H2P A;  3RNM A;  2Z5X A;  2XVF A;  3UTG A;  2GMJ A;  4B69 A;  3SFD A;  1CJ2 A;  1TYT A;  1JRY A;  5KRQ A;  5KOW A;  4JQ9 A;  3AE1 A;  3LJP A;  4H4X A;  3NN6 X;  2XCG A;  4NTC A;  4AOS A;  4B64 A;  3AEC A;  4JNA A;  3NYF A;  2EQ7 A;  1BF3 A;  3T2K A;  4HA6 A;  1ZX9 A;  1O95 A;  2YG3 A;  2YAU A;  2CFY A;  3R9U A;  3BI2 A;  4CNK A;  1DOC A;  1JU2 A;  4YSY A;  3BHF A;  2XLP A;  1PS9 A;  1REO A;  4J2W A;  3AEF A;  4OPU A;  3T14 A;  3S61 A;  1DXL A;  3ICS A;  4JDR A;  2PHH A;  3CNJ A;  2C7G A;  2BC0 A;  2J3N A;  3T37 A;  1GRG A;  1IUU A;  1JNZ A;  2WDQ A;  2R0P A;  2JB2 A;  2VOU A;  1FEA A;  1OJA A;  3SFE A;  3UKQ A;  1N4W A;  4YTP A;  2DKI A;  4UDP A;  4RG3 A;  4Z25 A;  3ICT A;  4ICY A;  1BWC A;  2CDU A;  1LPF A;  2X8H A;  1LV0 A;  4TM3 A;  3UP4 A;  4K22 A;  3HZL A;  4ZCD A;  1DNC A;  2GMH A;  2YM2 A;  1H6V A;  3DGZ A;  2QAE A;  3VRB A;  4H4R A;  1ZOV A;  1M6I A;  3NRN A;  4GAV A;  4RG4 A;  3SX6 A;  3M0O A;  2W0H A;  4P9S A;  3ALM A;  2XFQ A;  4G74 A;  3QSM A;  4U8O A;  2VQB A;  3NTD A;  1XPQ A;  2JBV A;  1JEH A;  3CGB A;  1SEZ A;  3IF9 A;  3P4P A;  4OPD A;  5M0Z A;  4YT0 A;  1BZL A;  3URH A;  1B8S A;  2X3N A;  3K7T A;  3CNS A;  5KXJ A;  2AR8 A;  2VVM A;  1F8R A;  3RP8 A;  2YQU A;  1CC2 A;  5HHF A;  3NIX A;  3UKL A;  1PJ6 A;  1KDG A;  4LII A;  3D1C A;  1OJT A;  3F8R A;  4OPG A;  4GUV A;  3F8D A;  3GYX A;  4BK2 A;  2R46 A;  3GMB A;  4XWZ A;  4YWO A;  4B68 A;  3KPF A;  3UP5 A;  1S7M A;  3AB1 A;  1BGN A;  2Y6R A;  2YLT A;  3D8X A;  5BUL A;  2JB1 A;  1N1P A;  1KN0 A;  3GYI A;  2H89 A;  3B3R A;  3UKH A;  2ZBW A;  3VR8 A;  3DK8 A;  1B4V A;  2BAC A;  2R4J A;  5KVI A;  3NN0 X;  3QFB A;  4U8J A;  1N4V A;  3K30 A;  4II2 A;  2YVF A;  1NG3 A;  5U25 A;  1RSG A;  3AEB A;  3VR9 A;  4NWZ A;  1ZOY A;  1H84 A;  2ZZ0 A;  4BUR A;  1UKV G;  4U8L A;  3GRT A;  3AEE A;  1YQZ A;  5KMS A;  3KLJ A;  3P4Q A;  1IJH A;  4LU6 A;  3F8P A;  4FX9 A;  2WEU A;  2Q0L A;  5HYM A;  1VQW A;  3KKJ A;  5KWF A;  4OPL A;  1IUW A;  2BCP A;  5GRT A;  4ECH A;  1ZK7 A;  4AOX A;  1NAA A;  3PVC A;  2FJA A;  3C96 A;  4WX1 A;  4AP1 A;  3I3L A;  1DOB A;  2OA1 A;  5CKU A;  2A87 A;  1BGJ A;  4EIQ A;  5HXI A;  1FCD A;  3FG2 P;  3DJJ A;  2C3C A;  4JY2 A;  4AT2 A;  4H7U A;  4J31 A;  1PBD A;  4PAB A;  3AE8 A;  2C75 A;  5HY5 A;  1YQ4 A;  5M10 A;  2V60 A;  3EF6 A;  2XLR A;  1FL2 A;  2Z5Y A;  3GRS A;  3QVR A;  4K8D A;  5IQ1 A;  3DH9 A;  3PG6 A;  1CC4 A;  1D7L A;  2WDR A;  4J36 A;  2GB0 A;  4H4W A;  3ATR A;  1RP0 A;  2X50 A;  2WPE A;  4APN A;  1IUS A;  2WHD A;  2B9Y A;  2NVK X;  3LOV A;  1Y56 A;  5EOW A;  4PAA A;  4TLZ A;  3M13 A;  2C72 A;  2YVG A;  4NEW A;  4IVM B;  1GSN A;  1E1M A;  1PDH A;  1IUX A;  2EQ9 A;  1QLB A;  1VG0 A;  3NHO X;  3AD7 B;  3H8L A;  5LV9 A;  2BK5 A;  2BYB A;  1PXA A;  1W4X A;  2B9X A;  1E6E A;  2VZ2 A;  2YG4 A;  4EM3 A;  1DJQ A;  1EL9 A;  4IA5 A;  2WS3 A;  2WP9 A;  2EQ8 A;  3II4 A;  4H4Y A;  1KF6 A;  3SZ0 A;  4J57 A;  5JCM A;  5EB5 A;  1AOG A;  1NEN A;  4FDC B;  2XVH A;  3KPK A;  2GR3 A;  4DGK A;  4EM4 A;  2QCU A;  2C4C A;  2E4G A;  1GRH A;  2BS3 A;  2A8X A;  3ICR A;  1PHH A;  3KD9 A;  2BAB A;  3DA1 A;  2IVD A;  3SZW A;  3ALJ A;  4YXD A;  3EAO A;  4OPT A;  2IVE A;  3DGH A;  4YSX A;  3L1R A;  1D7Y A;  4IA6 A;  3UOZ A;  3CN8 A;  1IUT A;  1K0L A;  1KNP A;  4B63 A;  4A7A A;  5BVA A;  2XFO A;  4REK A;  5FS9 A;  1BKW A;  2YLW A;  3CGE A;  3RED A;  3CPH G;  2YLS A;  4II3 A;  1Y0P A;  1YKJ A;  3DJG X;  2YLZ A;  3HYW A;  3P9U A;  1Q1W A;  3CPJ G;  3CGD A;  3BI5 A;  1F8W A;  4K7Z A;  2YM1 A;  2I0Z A;  5EBK A;  1PXB A;  1NG4 A;  2GR0 A;  5BRT A;  4TM4 A;  1CL0 A;  4NTD A;  2C64 A;  1GT8 A;  1JRX A;  4B65 A;  1TDO A;  3AE4 A;  4BJY A;  3BNU A;  3NK0 X;  1NDA A;  2YG7 A;  3UKF A;  2RGO A;  3AYL A;  3NLC A;  4A65 A;  2UZZ A;  5KMP A;  3UTF A;  2BS4 A;  3SGL A;  1YY5 A;  1V59 A;  1ZMD A;  1X31 B;  2WQY A;  4NTE A;  4NEV A;  2YR6 A;  4JN9 A;  3DJD A;  4DNA A;  1DOE A;  1TYP A;  1MXT A;  1NHQ A;  2A89 A;  2RGJ A;  3VRD B;  2V6O A;  1TDE A;  1JNR A;  4GDP A;  5KMR A;  3WE0 A;  3G5Q A;  3C4A A;  3HYV A;  1KNR A;  2V5Z A;  4J33 A;  1E7P A;  4Z44 A;  1NHP A;  1D4C A;  3NYC A;  1LQT A;  1O5W A;  4H2N A;  4M52 A;  3I6D A;  3JSK A;  1VDC A;  3NGC X;  4EMW A;  3GDN A;  4DSH A;  2R9Z A;  3EPT A;  5CQF A;  5U63 A;  5FS6 A;  2ARD A;  4FK1 C;  4Z2T A;  3KA7 A;  3SQP A;  2TPR A;  4UDR A;  1ZY8 A;  2YR4 A;  1O94 A;  4C3Y A;  1F6M A;  4H4S A;  1GPE A;  1E39 A;  1S2Y A;  4TM0 A;  3QFA A;  3P4R A;  1M64 A;  2V61 A;  2OLN A;  2GRT A;  2BK3 A;  1S3B A;  4C5O A;  3Q6J A;  5BUK A;  4OPI A;  3D9X A;  1EL7 A;  3L8K A;  1GAL A;  5JCN A;  3AED A;  1DJN A;  2WU5 A;  4C74 A;  3LZX A;  3IHM A;  2BCG G;  5EB4 A;  1L0V A;  4JY3 A;  1NPX A;  5IPY A;  3AE2 A;  1QJD A;  2BS2 A;  4B66 A;  1H82 A;  4DSG A;  1H7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...