5KVHA

Crystal structure of human apoptosis-inducing factor with w196a mutation
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
487
structure length
438
Chain Sequence
DKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQANGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Defining NADH-Driven Allostery Regulating Apoptosis-Inducing Factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 139
structure length 438
sequence length 487
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5kvhA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kvhA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kvhA01
3NK1X 3ZYXA 3ISHA 1DODA 2WDVA 3ITJA 5JCKA 3II4A 4D04A 2GAGB 3CPJG 2BACA 4OPUA 4BV6A 4U8LA 3H8IA 1GRGA 1H7XA 2FJEA 2A87A 4RSLA 3ALLA 2Q7VA 1MO9A 1GRTA 3H4KA 1GT8A 1QLBA 2YG7A 2F5ZA 2EQ9A 3NRNA 4DSGA 2R4JA 4BK1A 4WX1A 3M12A 3NTAA 3GYJA 2VVLA 4H2NA 3KLJA 2YLXA 3SM8A 1YQZA 4B69A 4TM1A 5CQFA 3VRDB 1K0JA 3ALJA 1OJCA 2Z5XA 3AECA 2C75A 5HXIA 2YR5A 1IJHA 1F3PA 3DK9A 1FECA 3CGBA 4H4ZA 2XVFA 2YM1A 3CNDA 3DJGX 4YTMA 4GF7A 4C74A 2WPFA 5TR3A 4YSXA 4K22A 1ONFA 1PJ6A 5J7XA 1D4EA 3B3RA 1NG4A 1ZOYA 5BUKA 3NT6A 2WU5A 4MJWA 4C3XA 3GWDA 2QA2A 1S3EA 3DMEA 1GRHA 1F8SA 4O5QA 4Y4LA 3UKPA 4YTNA 2WOVA 4CY8A 4EQRA 2OALA 3P4SA 3RHAA 2CFYA 2HQMA 3GYIA 1TRBA 2IVEA 3AE3A 4CCQA 3DGZA 1ZDLA 4K8DA 3CNJA 4U2TA 5JCNA 1L9CA 2EQ6A 4EM3A 2GH5A 1OJDA 1KNPA 3G5SA 3PS9A 4C77A 3UKLA 4H4UA 3AEBA 3V76A 1E1LA 2W0HA 1CHUA 1E1KA 3CGEA 1GESA 2ZZ0A 5FS8A 2QCUA 4EQXA 3DJDA 3K7MX 4K5RA 2XLRA 5J60A 3AE2A 2V3BA 3LOVA 1GV4A 4NTDA 3UP5A 4IV9A 1GRAA 1YKJA 1D5TA 4H4VA 2RGHA 3AE8A 3LADA 5GRTA 3P4PA 4XXGA 1H83A 4H2RA 4Z44A 4KPRA 4C3YA 2XFUA 1Q1RA 3AE4A 2EQ8A 1CL0A 3LZXA 4B66A 1QO8A 2VZ2A 1H7WA 4EIPA 2YLRA 2JK6A 4GRTA 5FS7A 1O95A 4ZCDA 4DGKA 3G5QA 3VRAA 1NENA 3UOYA 4KX6A 4A65A 1B5QA 3DJJA 2YR6A 2C70A 1E1NA 4JNAA 3D1CA 1E7PA 2EQ7A 1DJQA 1PN0A 1L9EA 3EPTA 4J34A 3ABVA 1N4VA 3AE6A 1BKWA 4U8MA 2B9WA 4A6NA 3NLCA 2AAQA 1XPQA 4PABA 2WDQA 4H4XA 2VRMA 1N4WA 3BI4A 2H88A 4BURA 3L8KA 4P9SA 2BK5A 3CN8A 4K5SA 3BNMA 3VRBA 2WHDA 4OPTA 1OJAA 4Z26A 3WE0A 3VR9A 3P9UA 4D03A 2Y6QA 4Y4NA 2CDUA 3QSSA 2GV8A 1O94A 4GDEA 5BRTA 5BVAA 3EF6A 3KA7A 4UDRA 1IUVA 4Z2RA 3NHOX 4H4YA 2BS2A 4APNA 1JNZA 5LV9A 1NPXA 1ZX9A 2R0CA 5KVIA 2VQBA 2RGOA 1FL2A 3D8XA 4H4SA 1VG9A 4U8JA 1PBBA 4A5LA 2WPCA 3RNMA 1CC4A 4YXDA 3UTGA 1OJ9A 2XVHA 5KXJA 2XVEA 1FOHA 1DNCA 2C7GA 1E6EA 1V59A 3UTHA 1NHSA 4YWOA 1TDKA 2GAHB 2B76A 2XDOA 3GMBA 3QVRA 2X8GA 4BK2A 2WP5A 3QFBA 1REOA 1GSNA 3ICRA 1GNDA 2VVMA 3IHMA 2Q0KA 2J3NA 3IF9A 1XHCA 4USRA 3UCLA 2XVIA 4TM3A 2FJBA 1COYA 1IUWA 3KU9A 2WETA 3UTFA 2A89A 3NYEA 4X9MA 4NEWA 1PXBA 1EL5A 4GUVA 4H2QA 2R9ZA 4J2WA 2YG3A 1Q1WA 3AXBA 4GDPA 3HZLA 5IPYA 1N1PA 2YVFA 4XWZA 3BNUA 2QAEA 4X9NA 4Z43A 4H2PA 4DSHA 3AE9A 1KSSA 1D4DA 4EQWA 2GQFA 4JQ9A 5KVHA 3ICTA 3ADAB 1ZMCA 3GDPA 2R0GA 1ZMDA 2GEWA 2OA1A 1TYTA 3M0OA 2VOUA 1ZY8A 1EL7A 2BABA 2ZZBA 2E5VA 4B65A 1PJ7A 4B68A 1PBCA 2OAMA 3E1TA 1E39A 2TPRA 1LV0A 3IHGA 3NG7X 2C3DA 2WP9A 4O5UA 2B9YA 3S61A 3COXA 4JNQA 1LPFA 4U8NA 3FG2P 2YWLA 3RP7A 3AYJA 1B8SA 4TM0A 1H86A 4B1BA 3NIXA 1KNRA 1DOBA 1DJNA 3ZDNA 3QSEA 4FK1C 1TYPA 4U8PA 4CRTA 3FPZA 1GXFA 2JB1A 3KKJA 3UTEA 4Y4MA 3DA1A 3NKSA 2A8XA 1VQWA 1XDIA 4IVMB 5EBKA 4OPLA 5JCMA 2WESA 4REKA 3GWFA 5KRQA 4CNKA 1F8RA 3AYIA 2BK4A 4HB9A 1IUSA 2GR3A 4BJYA 3CIRA 2FJDA 4A6NB 1DOCA 1NDAA 2OLOA 1CJ3A 3DJEA 2YLSA 4AT0A 4X4JA 3ATQA 1VG0A 1EL8A 5C3JA 1P2EA 1D7LA 1TDEA 3DK4A 2ACZA 2PHHA 3K7QX 2GMHA 2AR8A 5JCLA 1S3BA 1YQ4A 4JY3A 4NTEA 1LTXR 2R45A 3AWIA 3Q6JA 4OCGA 4DNAA 1ZK7A 1JU2A 1VDCA 1W4XA 3QFAA 1CC2A 4WCTA 4J57A 2JAEA 3F8DA 2C66A 2YR4A 1BGNA 3AEFA 1M6IA 2TMDA 4RG3A 4U8KA 2C67A 3AD7B 4TLXA 4USQA 1GEUA 2GR2A 1DXLA 2YM2A 4ZCCA 1GOSA 2ZZCA 4CY6A 1DOEA 4JDRA 3C4NA 4FK1A 3AB1A 2R0PA 4H4WA 3I3LA 3Q9TA 5L46A 3KPFA 4YKGA 1JEHA 1YY5A 3NH3X 3NYCA 4TM4A 3UKFA 1JRYA 3P4RA 4H50A 2NVKX 1GTEA 2BXSA 2GR1A 2JB2A 1GREA 2XYOA 2GR0A 3GSIA 1S2QA 1D4CA 1CC6A 1PXCA 4BK3A 4H4RA 5KOWA 1IUUA 1Y56A 3CTYA 2FBWA 1CBOA 2C65A 4H4PA 1LQTA 2AQJA 4J33A 1IUTA 1VRQB 3QJ4A 2YVJA 2PYXA 5FS9A 1X31B 4YSZA 5EB4A 3CPHG 3BHKA 3FMWA 3NK0X 3GD3A 1L0VA 3B6DA 3LJPA 4ZN0A 3JSKA 1E1MA 1RYIA 2V60A 2YQUA 2XFOA 3EAOA 4NEVA 3F8PA 2BYBA 5ER0A 4Z2UA 3DH9A 2R4EA 2GMJA 1EBDA 3LB8A 4OPGA 3NN6X 2YVGA 2XLUA 4PAAA 2DKIA 3FIMB 2C64A 3P1WA 1GRBA 1Z6LA 4IA6A 2E4GA 2WOWA 3VR8A 2GF3A 1TDFA 3QVPA 4EMWA 3LXDA 1AOGA 2RGJA 5IQ1A 5KWFA 2BCPA 1KSUA 2YLWA 3CNPA 3LZWA 4H4TA 1PBFA 2B7SA 1RSGA 3CPIG 4AP3A 2NPXA 2CULA 2XCGA 3I6DA 1NHQA 5GSNA 1KDGA 4ICYA 3SFDA 3EANA 2XLPA 4YT0A 3M13A 4C5OA 1NG3A 2XVJA 1F6MA 2YG6A 3G5RA 2YG5A 4B64A 4FX9A 2BCGG 2O9ZA 3UKAA 1PS9A 2BK3A 2Q0LA 2C73A 1JRXA 5U1OA 3UKQA 1FEAA 2YG4A 4GCMA 4B63A 3CNSA 5M10A 4OPIA 2WEUA 1OJTA 2X8CA 3NTDA 2IVDA 3CNTA 3QSMA 3IC9A 2JB3A 3AE7A 3AD8B 4H7UA 5DBJA 1BZLA 3AEGA 3PVCA 5FMHA 4AOXA 1CF3A 5CKUA 1KFYA 5IQ4A 2XFQA 2IIDA 3ICSA 1K4QA 4OPCA 3DK8A 3P4QA 3AYLA 3V3NA 4M52A 1M64A 2UZZA 1PXAA 2BS4A 1TDOA 2X3NA 3NK2X 3R9UA 4CBQA 1P2HA 3K7TA 4Z2TA 5HY5A 4CNJA 3FBSA 4EMIA 1NHRA 3ALMA 1FCDA 5HHFA 5BULA 4LIIA 3K30A 3V3OA 1BF3A 1UKVG 3AE1A 4NZHA 2I0ZA 2VRLA 3UP4A 2QA1A 3T37A 3GMCA 2RABA 4FDCB 1HYUA 1GERA 3NN0X 5EOWA 4E0VA 5KOXA 1K0IA 4A9WA 1GRFA 2WOIA 1PJ5A 3UKHA 3UOVA 3VQRA 1NHPA 2XLSA 1FEBA 2BC0A 3REDA 2B9XA 3PO7A 3O0HA 1EL9A 1SEZA 1JOAA 1TDNA 1ZOVA 4HA6A 4XWRA 4J36A 4IA5A 4Z24A 3RP6A 2XFNA 3AEEA 1YQ3A 4UDQA 4I59A 1XANA 1H84A 2GVCA 3S5WA 1B4VA 4UP3A 2V5ZA 2Y6RA 3AE5A 3AEDA 3UKKA 3DGHA 2BS3A 1Y56B 1JRZA 1F8WA 4N9XA 5FS6A 2Q6UA 4TLZA 3H8LA 2FJAA 3RP8A 4A7AA 4ADWA 1B37A 4ECHA 2WPEA 4JN9A 3IWAA 3AEAA 3CGDA 1RP0A 4U8IA 1Q9IA 2YLZA 1ZP0A 4J56A 3KVEA 4CCRA 1N4UA 4UDPA 4U2LA 1PBDA 1QJDA 5C2TA 4I58A 2C76A 1IUXA 4JY2A 4K7ZA 1LQUA 2X99A 3BI5A 3GD4A 4LU6A 4K2XA 4YTPA 1MOKA 4H4QA 5HYMA 1GPEA 1NEKA 4A99A 4YSHA 5U63A 2V61A 1D7YA 2WQYA 3L1RA 2X50A 4RG4A 1K0LA 1PHHA 2YLTA 5EB5A 4AP1A 1O5WA 5U25A 4B67A 4EQSA 1L9DA 2JKCA 3OZ2A 5JCIA 3AD9B 4U2SA 4J31A 4GR1A 4A79A 4EIQA 2BC1A 2BA9A 2YAUA 1ELIA 2V3AA 1BWCA 1KF6A 2GB0A 2H89A 2ZBWA 4U8OA 4Z25A 2C3CA 1PDHA 2XFPA 3GRTA 3BHFA 1CJ4A 2CVJA 2VVLG 2WU2A 3UOXA 4YSYA 1MXTA 3GRSA 2WP6A 1GTHA 2GRTA 4LA1A 5M0ZA 1Y0PA 2JBVA 3URHA 2X8HA 3UOZA 4EM4A 1S2YA 3KD9A 2VQ7A 3NYFA 4OPDA 3F8RA 4AOSA 1CJCA 4AT2A 2ARDA 3OC4A 1H82A 2B7RA 3ATRA 3SFEA 2GQWA 4NTCA 2V6OA 1LVLA 1H6VA 2WDRA 2OLNA 2Z5YA 1NAAA 4YKFA 1GETA 2WBAA 3SGLA 1GALA 2R46A 1JNRA 2XLTA 1ZKQA 1LJ1A 2APGA 1BGJA 3CGCA 1PBEA 2E1MA 1CJ2A 3SQPA 2WS3A 3GDNA 4BJZA 3C96A 2C72A 3BI2A 3C4AA 4IVOB 1H81A 3NGCX 3NNEA 4OVIA 4EMJA 2BXRA 2DKHA
chains in the Genus database with same CATH superfamily
3ZYXA 3TJ4A 2XH2A 3ISHA 3SN1A 4BV6A 4U8LA 2W3RA 3H8IA 1H7XA 2FJEA 3ALLA 1MO9A 1GRTA 1N61C 2F5ZA 3NRNA 4BK1A 2VVLA 3VRDB 5HXIA 2YR5A 3R11A 4IHCA 4H4ZA 1SJCA 2MNRA 4C74A 4YSXA 1ONFA 3FXGA 3B3RA 5BUKA 4MJWA 1S3EA 1F8SA 2OALA 3RHAA 2CFYA 2HQMA 3AE3A 3NVYB 4GMEA 4CCQA 5JCNA 1XPYA 2GH5A 3SJNA 1KNPA 1OJDA 3AEBA 2OKTA 1CHUA 1GESA 3LOVA 1YKJA 1D5TA 5GRTA 4XXGA 4C3YA 5FJRA 3RITA 3OW1A 2EQ8A 1QO8A 4G73A 4GRTA 3T2YA 3H12A 4A65A 2YR6A 1E1NA 3I6TA 1MRAA 1XPQA 4PABA 2VRMA 3BI4A 4BURA 3B9JB 2WHDA 1OJAA 3VR9A 3L5OA 3MUCA 2CDUA 3QSSA 4UDRA 4Z2RA 3NHOX 4H4YA 5LV9A 2VQBA 2WPCA 3UTGA 2XVHA 5KXJA 1E6EA 7ENLA 4YWOA 1TDKA 2B76A 3QVRA 3QFBA 1REOA 1GSNA 3T6CA 1GNDA 3IHMA 2OVLA 2W55A 4DWDA 3R07C 1IUWA 3NYEA 2PTXA 5EU9A 1EL5A 3AXBA 4GDPA 2QAEA 4DSHA 3AE9A 1PDYA 3UJ2A 1KSSA 4JQ9A 5KVHA 3ADAB 3NRZB 3NZGA 5FJUA 3HYWA 2E5VA 4B65A 1PBCA 2PGEA 1LV0A 2B9YA 4JNQA 1LPFA 2FKPA 3AYJA 4TM0A 1H86A 2AL2B 1KNRA 1GXFA 1T3QC 1N60C 3DA1A 4MGGA 2A8XA 1VQWA 5EBKA 3D46A 1BQGA 3GWFA 4CNKA 2GR3A 1N63C 1DOCA 2YLSA 4ZA0A 3RCYA 3PG6A 5G5HB 3SY4A 4ZCWA 1EL8A 1D7LA 2ACZA 3K7QX 5JCLA 4NTEA 4OCGA 4DNAA 4J57A 2C66A 3AEFA 1YEYA 2PODA 4U8KA 2GR2A 4KPLA 3JW7A 4JDRA 4H4WA 3Q9TA 4YKGA 3CMMA 3P4RA 4H50A 1GREA 4H4RA 5KOWA 1SJBA 2OFJA 2OPJA 3CAWA 5FJPA 2HXUA 3QJ4A 2PYXA 5FS9A 1X31B 3BHKA 1RYIA 2YQUA 3DG3A 3F8PA 5ER0A 3DH9A 2R4EA 2XLUA 2DKIA 1GRBA 3CYJA 1PDZA 2YLWA 4H4TA 1PBFA 2NPXA 2CULA 1NHQA 4HYRA 4ICYA 2XLPA 4C5OA 4GISA 4FX9A 2O9ZA 2Q0LA 5M10A 5FJTA 1OJTA 2IVDA 4H7UA 5DBJA 3I4KA 3AN1A 5FMHA 4AOXA 3DK8A 3P4QA 3V3NA 3SN0A 2BS4A 1TDOA 3R9UA 1P2HA 4CNJA 3FBSA 4EMIA 2AKZA 3AE1A 2QA1A 3T37A 1GERA 4E0VA 1EBGA 2WOIA 2BC0A 3D47A 1EL9A 1SEZA 1JOAA 3RP6A 4UDQA 3AEEA 1YQ3A 1XANA 3KUMA 3S47A 4UP3A 2V5ZA 2Y6RA 3AE5A 1JRZA 3ZVHA 4ECHA 4JN9A 3CXOA 3KVEA 3MZNA 2OZ8A 1IUXA 4K7ZA 1MOKA 4H4QA 4A99A 5U63A 3DFYA 1O5WA 3VC5A 1ECQA 4U2SA 1BWCA 1KF6A 2XH4A 2C3CA 1PDHA 1MXTA 3NVVB 1Y0PA 1ELSA 1S2YA 3NYFA 4OPDA 3F8RA 4NTCA 4Z17A 2WDRA 2Z5YA 2WBAA 3EEZA 2R46A 1JNRA 2APGA 1BGJA 1OEPA 2E1MA 5KNLA 2WS3A 4BJZA 3C96A 3NGCX 4OVIA 4J3ZA 3GD6A 3NK1X 3ITJA 1DODA 2QJNA 2BACA 2A87A 4RSLA 2EQ9A 3T4WA 2R4JA 4WX1A 3SN4A 3M12A 3GYJA 3KLJA 2YLXA 3SM8A 1YQZA 3ALJA 3AECA 3SR6B 1IJHA 2DW6A 3ZVHB 1FECA 5TR3A 1P48A 2HXTA 3GWDA 3ES8A 3V3WA 4O5QA 4TVYA 1WUEA 4EQRA 3P4SA 3GYIA 2OZTA 4K8DA 4FI4A 4C77A 3UKLA 4H4UA 1E1LA 1E1KA 3DJDA 4EQXA 3AE2A 2V3BA 4NTDA 1H83A 4H2RA 4Z44A 1KN0A 4IZGA 2AL1A 2YLRA 3BJSA 4M6UA 5FS7A 1O95A 4ZCDA 4DGKA 3G5QA 1NENA 3DJJA 2C70A 4JNAA 3D1CA 2EQ7A 1DJQA 1PN0A 4J1OA 3AE6A 4U8MA 3SX6A 3NLCA 2AAQA 3BNMA 4OPTA 4Z26A 3WE0A 3R10A 4D03A 2Y6QA 4KEMA 4GDEA 5BRTA 1IUVA 3N4FA 2RGOA 1VG9A 1PBBA 4A5LA 3R0KA 1CC4A 3RNMA 4YXDA 1OJ9A 2XVEA 1FOHA 1V59A 1NHSA 2XDOA 2X8GA 4BK2A 2WP5A 4GYPC 3ICRA 3BOXA 2VVMA 2J3NA 3IF9A 4USRA 4TM3A 1L8PA 1COYA 3KU9A 1WYGA 4GUVA 3SYIA 4XWZA 3PFRA 4EQWA 3NVWB 3GDPA 2R0GA 2OA1A 1SJAA 3E1TA 1E39A 3IHGA 4U8NA 3FG2P 3RP7A 4B1BA 3HW2A 3ZDNA 4FK1C 2E3TA 4Y4MA 3NKSA 1XDIA 4REKA 3JVAA 2QJJA 2GGJA 4K8GA 1FHUA 4GFIA 1NDAA 2P3ZA 2OLOA 3VA8A 3DJEA 3FV9A 2ZADA 3P0WA 3DK4A 1MUCA 2GMHA 1YQ4A 3AWIA 2GGEA 1VDCA 4E4FA 3F8DA 3HYXA 1BGNA 4TLXA 3DGBA 2YM2A 2ZZCA 4FK1A 3I3LA 3T2ZA 5L46A 3TWAA 3KPFA 1JEHA 3NYCA 2JB2A 2GR1A 2XYOA 2GR0A 1D4CA 1CC6A 1IUUA 1Y56A 3CTYA 1VQZA 3P93A 4J33A 1IUTA 1VRQB 1KKRA 3DERA 5EB4A 3HPFA 4HCLA 5JRBA 1L0VA 3LJPA 4G6HA 3JSKA 2V60A 2BYBA 3GY1A 3LB8A 4OPGA 3P1WA 2P8BA 4IA6A 2GF3A 1TDFA 5IQ1A 3I6EA 5KWFA 2BCPA 3CNPA 3LZWA 4HN8A 3SFDA 3EANA 4YT0A 3RR1A 1NG3A 2YG6A 3VDGA 1JPDX 2BCGG 3GC2A 1PS9A 5U1OA 3UKQA 1FEAA 2WEUA 2X8CA 3NTDA 4FP1A 3EKGA 3IJIA 4OPCA 3AMZA 4KT2A 1M64A 3Q4DA 2X3NA 4CBQA 3K7TA 3ETRB 3KPKA 5BULA 2OX4A 4NZHA 4Z25A 4FDCB 1HYUA 5KOXA 2C4CA 1K0IA 3UOVA 3QLDA 3REDA 2B9XA 2AKMA 4HA6A 2P0IA 4IA5A 1B4VA 3SBFA 2QQ6A 2BS3A 1Y56B 3GO2A 1F8WA 3UJFA 1B37A 2WPEA 2PU0A 1Q9IA 1ZP0A 4GGBA 4CCRA 4GGHA 3A7AA 1QJDA 4I58A 4JY2A 1R6WA 1GPEA 2V61A 4HNCA 2X50A 5EB5A 4AP1A 5U25A 3OZ2A 5JCIA 4J31A 4EIQA 2BA9A 2YAUA 1N5XA 2HNEA 3IJLA 2CVJA 2VVLG 3GRSA 2WP6A 1GTHA 2GRTA 2RDXA 4LA1A 3URHA 2X8HA 4EM4A 1BKHA 3NXLA 2B7RA 3ATRA 3NVZB 3QTPA 4YWSA 4YKFA 1GETA 3V5CA 1GALA 2MUCA 3ENLA 5BOEA 2C72A 2BXRA 2PA6A 4DX3A 4A35A 2WDVA 5JCKA 1E9IA 2GAGB 1GRGA 3OTRA 1TE6A 2Q7VA 3V4BA 3BSMA 2BRYA 3H4KA 1QLBA 2YG7A 1MDRA 4DSGA 1SJDA 4B69A 4TM1A 2Z5XA 2PMQA 4MKSA 3DK9A 3CGBA 3CT2A 3CNDA 1JDFA 2I5QA 4GF7A 2WPFA 1PJ6A 1ZOYA 4C3XA 4Y4LA 4YTNA 3SZWA 4E4UA 4HPNA 1L9CA 3G5SA 3V76A 2W0HA 2PTZA 5FS8A 2QCUA 4K5RA 5J60A 4IV9A 1GRAA 3TJIA 4F4RA 5KMSA 1Q1RA 3AE4A 1CL0A 2PU1A 3LZXA 3SZFA 2VZ2A 1H7WA 2JK6A 3AM9A 1S7MA 3VCNA 4DN1A 1MNSA 1E7PA 1ONEA 4A6NA 1BKWA 2PTWA 2B9WA 1P43A 3QKEA 2BK5A 4K5SA 3VRBA 2QVHA 2XGZA 2QGYA 3P9UA 2QDEA 4Y4NA 2GV8A 3EF6A 3KA7A 3DIPA 4APNA 1JNZA 1NPXA 3NS1B 2R0CA 5KVIA 4U8JA 3D8XA 1FL2A 4H4SA 4HCDA 4E5TA 1DNCA 3MSYA 2C7GA 3UTHA 4IL2A 2XH7A 3GMBA 3ZLGA 4IT1A 3RGTA 1XHCA 3UCLA 1NELA 2FJBA 1NU5A 2WETA 2A89A 4X9MA 4NEWA 1N5WC 1PXBA 4J2WA 2YG3A 5ENLA 3HZLA 5IPYA 3B97A 2YVFA 4Z43A 4DHGA 4H2PA 4II3A 2PP3A 1D4DA 2GQFA 1ZMCA 1ZMDA 3M0OA 2VOUA 1ZY8A 2OAMA 3MWCA 3NG7X 3PWGA 2C3DA 2WP9A 4O5UA 3UCDA 3VC6A 2PTYA 3UJSA 3NIXA 3U9IA 2E5AA 1TYPA 4U8PA 3FPZA 3A7UA 3DFHA 4GAVA 4IVMB 2WESA 1F8RA 1IUSA 4A6NB 1CJ3A 2QJMA 3ATQA 2XH0A 5C3JA 2PHHA 1S3BA 2GSHA 4JY3A 2W54A 3Q6JA 4K1WA 1W4XA 3QFAA 1CC2A 2JAEA 2YR4A 1SB3B 4ZCCA 1GOSA 1DOEA 2R0PA 3CB3A 1YY5A 3NH3X 1JRYA 3UJEA 1GTEA 2BXSA 1KD0A 3GSIA 3T8QA 1PXCA 3H8AA 3H70A 2AQJA 4YSZA 3CK5A 3FMWA 3NK0X 3GD3A 3B6DA 3A7RA 3GYXA 3U4FA 4G6GA 1EBDA 2E4GA 3TQPA 4EMWA 3LXDA 1AOGA 2OQHA 1EC8A 1RSGA 4AP3A 3I6DA 4H83A 3MY9A 1F6MA 4B64A 3UKAA 2C73A 3PK7A 1JRXA 3H7VA 2YG4A 4GCMA 3CNSA 5BOFA 1RM6B 1VDVA 3CNTA 3AE7A 1BZLA 3AEGA 3PVCA 5CKUA 1KFYA 2XFQA 3ICSA 1K4QA 4NNJA 2POZA 4GYPA 2UZZA 1PXAA 5HY5A 3ALMA 5HHFA 4G9KA 1BF3A 3UP4A 2I0ZA 2VRLA 3GMCA 2RABA 3NN0X 5EOWA 1WUFA 4A9WA 1JROA 1GRFA 3VQRA 2XLSA 3NFUA 3O0HA 1TDNA 4XWRA 4J36A 3FYYA 3VCCA 1H84A 3DGHA 2Q6UA 4TLZA 4A7AA 2FJAA 4ADWA 3ZLFA 3IWAA 3AEAA 1RP0A 4U8IA 2YLZA 2ZC8A 3V5FA 1N4UA 4UDPA 2AL2A 2C76A 1JCTA 2X99A 3BI5A 4YTPA 4K2XA 5IDZA 3DDMA 5HYMA 1NEKA 4EWJA 1D7YA 1PHHA 4B67A 1L9DA 2JKCA 3SQSA 3OPSA 2V3AA 3T9PA 2GB0A 2H89A 3JZUA 3TOYA 4U8OA 3GRTA 3BHFA 4M0XA 2CHRA 3STPA 5M0ZA 1JRPA 1MDLA 3KD9A 2VQ7A 1FIQB 3FVDA 3OC4A 1H82A 4DYEA 2GQWA 2V6OA 1H6VA 1EC9A 3T31A 3SGLA 1LJ1A 4HCHA 1PBEA 1JPMA 3CGCA 3SQPA 1F9CA 3ZLHA 3BI2A 3C4AA 5J04A 1H81A 3NNEA 4EMJA 3II4A 4D04A 3CPJG 4OPUA 3T0KA 3THUA 1GT8A 3MQTA 3NTAA 4H2NA 5CQFA 1K0JA 1OJCA 2C75A 3S5SA 1F3PA 2XVFA 2YM1A 3DJGX 4JN7A 4YTMA 4K22A 5J7XA 1D4EA 1NG4A 3NT6A 2WU5A 2QA2A 3DMEA 3UKPA 1GRHA 2WOVA 4CY8A 1TRBA 2IVEA 3DGZA 1ZDLA 3CNJA 4U2TA 2EQ6A 4G74A 4EM3A 3PS9A 3CGEA 3QPEA 3K7MX 2ZZ0A 2XLRA 1GV4A 3UP5A 2FYMA 2RGHA 4H4VA 3AE8A 3LADA 3P4PA 4KPRA 2XFUA 4B66A 4EIPA 3UXLA 2ONEA 4ROPA 3VRAA 3OZMA 3UOYA 1KCZA 4KX6A 1B5QA 4GAPA 2OO6A 1L9EA 3NO1A 3EPTA 3ABVA 4J34A 1N4VA 2PS2A 2WDQA 4H4XA 1N4WA 2H88A 3L8KA 2GGHA 4P9SA 3CN8A 2BRAA 3K1GA 1IYXA 2OQYA 2P8CA 3CXBA 4DXKA 1O94A 5BVAA 2BS2A 1ZX9A 3TW9A 3UXKA 2GGGA 2P88A 3T2KA 2W3SA 3N6HA 2GAHB 4G8TA 2Q0KA 2XVIA 4A6GA 3UTFA 3UCCA 4H2QA 2R9ZA 4MMWA 1Q1WA 1DTNA 3R0UA 1N1PA 1TKKA 3BNUA 4X9NA 4H19A 2GGIA 3ICTA 4X2PA 3SZ0A 2GEWA 4II2A 1TYTA 3VFCA 2BABA 1EL7A 3D9XA 1XS2A 2ZZBA 4B68A 1PJ7A 2TPRA 3S61A 3UGVA 3COXA 2PSNA 2YWLA 1B8SA 1DOBA 1DJNA 3QSEA 4CRTA 1FFVC 2JB1A 3DESA 3KKJA 3UTEA 1V97A 4H1ZA 4HNLA 4OPLA 5JCMA 5KRQA 2OZ3A 3FCPA 3AYIA 2BK4A 4HB9A 4BJYA 3P3BA 3CIRA 2FJDA 4AT0A 4X4JA 1VG0A 1P2EA 3OP2A 1TDEA 2AR8A 1FFUC 1LTXR 2R45A 1ZK7A 1JU2A 1TZZA 4WCTA 3N4EA 1M6IA 2TMDA 4RG3A 2C67A 3AD7B 4USQA 1GEUA 1DXLA 4CY6A 3C4NA 3AB1A 4E8GA 2OLAA 4TM4A 3UKFA 6ENLA 2NVKX 1S2QA 3N6JA 2PP1A 4BK3A 3R1ZA 2FBWA 4G7FA 1CBOA 4A3RA 2C65A 4H4PA 1LQTA 1R0MA 2YVJA 4E6MA 1W6TA 3CPHG 3SSZA 1KKOA 3T14A 4ZN0A 1E1MA 2XFOA 3EAOA 4NEVA 3TCSA 5KMPA 2QDDA 4Z2UA 4TVWA 2GMJA 3NN6X 2PGWA 2YVGA 4PAAA 3Q45A 3FIMB 2C64A 1Z6LA 3VR8A 2WOWA 3QVPA 3PWIA 1FO4A 2RGJA 1KSUA 3FJ4A 2B7SA 3CPIG 2XCGA 2PP0A 2PPGA 5GSNA 1KDGA 3M13A 1H2IA 2XVJA 4H2HA 3G5RA 2YG5A 5FJOA 2BK3A 3RO6A 3DG6A 4B63A 3ZVIA 4ENLA 4OPIA 3QSMA 3IC9A 2JB3A 3AD8B 2NQLA 3IK4A 1CF3A 5IQ4A 2IIDA 3AYLA 1STZA 4M52A 3SXIA 3EUB3 3NK2X 3TTEA 5KMQA 4Z2TA 4ZOHB 4IP5A 1NHRA 2XSXA 3HRDC 1FCDA 4LIIA 3K30A 1ZXIC 3V3OA 1UKVG 3UKHA 1PJ5A 1NHPA 3MKCA 1FEBA 4IP4A 1EC7A 3PO7A 1FHVA 1X2GA 1ZOVA 4Z24A 2XFNA 2DW7A 4I59A 3S5WA 2GVCA 3AEDA 3UKKA 4IL0A 1RVKA 4N9XA 5FS6A 3H8LA 3RP8A 2PCEA 1N62C 2HZGA 3DEQA 3TWBA 3CGDA 4J56A 4U2LA 1PBDA 4Z1YA 5C2TA 1X2HA 2OG9A 1LQUA 3GD4A 4LU6A 3R25A 3SZCA 4YSHA 2WQYA 3L1RA 4RG4A 5KMRA 1K0LA 2YLTA 3HYVA 5G5GB 4EQSA 3UJRA 3AD9B 3IJQA 4GR1A 4A79A 2BC1A 1ELIA 2ZBWA 2XFPA 1CJ4A 4YSYA 2WU2A 3UOXA 3RRAA 4KWSA 2GL5A 2JBVA 3UOZA 4GIRA 1EBHA 4AOSA 1CJCA 4AT2A 2ARDA 3QN3A 3SFEA 1LVLA 3DG7A 4NWZA 2OLNA 4JHMA 1NAAA 4JN8A 2XLTA 1ZKQA 3ES7A 4K2SA 1CJ2A 3GDNA 2GDQA 2O56A 4IVOB 3OZYA 2DKHA
chains in the Genus database with same CATH topology
3NK1X 3ZYXA 3ISHA 1DODA 2WDVA 3ITJA 5JCKA 3II4A 4D04A 2GAGB 3CPJG 2BACA 4OPUA 4BV6A 4U8LA 3T0KA 3H8IA 1GRGA 1H7XA 2FJEA 2A87A 4RSLA 3ALLA 2Q7VA 1MO9A 1GRTA 2BRYA 3H4KA 1GT8A 1QLBA 2YG7A 2F5ZA 2EQ9A 3NRNA 4DSGA 2R4JA 4BK1A 4WX1A 3M12A 3NTAA 3GYJA 2VVLA 4H2NA 3KLJA 2YLXA 3SM8A 1YQZA 4B69A 4TM1A 5CQFA 3VRDB 1K0JA 3ALJA 1OJCA 2Z5XA 3AECA 2C75A 5HXIA 2YR5A 1IJHA 1F3PA 3DK9A 1FECA 3CGBA 4H4ZA 2XVFA 2YM1A 3CNDA 3DJGX 4YTMA 4GF7A 4C74A 2WPFA 5TR3A 4YSXA 4K22A 1ONFA 1PJ6A 5J7XA 1D4EA 3B3RA 1NG4A 1ZOYA 5BUKA 3NT6A 2WU5A 4MJWA 4C3XA 3GWDA 2QA2A 1S3EA 3DMEA 1GRHA 1F8SA 4O5QA 4Y4LA 3UKPA 4YTNA 2WOVA 4CY8A 3SZWA 4EQRA 2OALA 3P4SA 3RHAA 2CFYA 2HQMA 3GYIA 1TRBA 2IVEA 3AE3A 4CCQA 3DGZA 1ZDLA 4K8DA 3CNJA 4U2TA 5JCNA 1L9CA 2EQ6A 4G74A 4EM3A 2GH5A 1OJDA 1KNPA 3G5SA 3PS9A 4C77A 3UKLA 4H4UA 3AEBA 3V76A 1E1LA 2W0HA 1CHUA 1E1KA 3CGEA 1GESA 2ZZ0A 5FS8A 2QCUA 4EQXA 3DJDA 3K7MX 4K5RA 2XLRA 5J60A 3AE2A 2V3BA 3LOVA 1GV4A 4NTDA 3UP5A 4IV9A 1GRAA 1YKJA 1D5TA 4H4VA 2RGHA 3AE8A 3LADA 5GRTA 3P4PA 4XXGA 1H83A 4H2RA 4Z44A 4KPRA 4C3YA 5KMSA 2XFUA 1KN0A 1Q1RA 3AE4A 2EQ8A 1CL0A 3LZXA 3SZFA 1QO8A 2VZ2A 4B66A 1H7WA 4G73A 4EIPA 2YLRA 2JK6A 4GRTA 5FS7A 1O95A 4ZCDA 3T2YA 4DGKA 3G5QA 3VRAA 1S7MA 1NENA 3UOYA 4KX6A 4A65A 1B5QA 3DJJA 2YR6A 2C70A 4GAPA 1E1NA 4JNAA 3D1CA 1E7PA 2EQ7A 1DJQA 1PN0A 1L9EA 3EPTA 4J34A 3ABVA 1N4VA 3AE6A 1BKWA 4U8MA 2B9WA 3SX6A 3NLCA 4A6NA 2AAQA 1XPQA 4PABA 2WDQA 4H4XA 2VRMA 1N4WA 3BI4A 2H88A 4BURA 3L8KA 4P9SA 2BK5A 3CN8A 4K5SA 3BNMA 3VRBA 2BRAA 2WHDA 4OPTA 1OJAA 4Z26A 3WE0A 3VR9A 3P9UA 3L5OA 4D03A 2Y6QA 4Y4NA 2CDUA 3QSSA 2GV8A 1O94A 4GDEA 5BRTA 5BVAA 3EF6A 3KA7A 4UDRA 1IUVA 4Z2RA 3NHOX 4H4YA 2BS2A 4APNA 1JNZA 5LV9A 1NPXA 1ZX9A 2R0CA 5KVIA 2VQBA 2RGOA 1FL2A 3D8XA 4H4SA 1VG9A 4U8JA 1PBBA 4A5LA 2WPCA 3RNMA 1CC4A 4YXDA 3UTGA 1OJ9A 2XVHA 5KXJA 2XVEA 1FOHA 1DNCA 2C7GA 1E6EA 1V59A 3T2KA 3UTHA 1NHSA 4YWOA 1TDKA 2GAHB 2B76A 2XDOA 3GMBA 3QVRA 2X8GA 4BK2A 2WP5A 3QFBA 1REOA 1GSNA 3ICRA 1GNDA 2VVMA 3IHMA 2Q0KA 2J3NA 3IF9A 1XHCA 4USRA 3UCLA 2XVIA 4TM3A 2FJBA 1COYA 1IUWA 3KU9A 2WETA 3UTFA 2A89A 3NYEA 4X9MA 4NEWA 1PXBA 1EL5A 4GUVA 4H2QA 2R9ZA 4J2WA 3SYIA 2YG3A 1Q1WA 3AXBA 4GDPA 3HZLA 5IPYA 1N1PA 2YVFA 4XWZA 3BNUA 2QAEA 4X9NA 4Z43A 4H2PA 4II3A 4DSHA 3AE9A 1KSSA 1D4DA 4EQWA 2GQFA 4JQ9A 5KVHA 3ICTA 3ADAB 1ZMCA 3HYWA 3GDPA 2R0GA 3SZ0A 1ZMDA 2GEWA 4II2A 2OA1A 1TYTA 3M0OA 2VOUA 1ZY8A 1EL7A 2BABA 3D9XA 2ZZBA 2E5VA 4B65A 1PJ7A 4B68A 1PBCA 2OAMA 3E1TA 1E39A 2TPRA 1LV0A 3IHGA 3NG7X 2C3DA 2WP9A 4O5UA 2B9YA 3S61A 3COXA 4JNQA 1LPFA 4U8NA 3FG2P 2YWLA 3RP7A 3AYJA 1B8SA 4TM0A 1H86A 4B1BA 3NIXA 1KNRA 1DOBA 1DJNA 3ZDNA 3QSEA 4FK1C 1TYPA 4U8PA 4CRTA 3FPZA 1GXFA 2JB1A 3KKJA 3UTEA 4Y4MA 3DA1A 3NKSA 2A8XA 1VQWA 1XDIA 4GAVA 4IVMB 5EBKA 4OPLA 5JCMA 2WESA 4REKA 3GWFA 5KRQA 4CNKA 1F8RA 3AYIA 2BK4A 4HB9A 1IUSA 2GR3A 4BJYA 3CIRA 2FJDA 4A6NB 1DOCA 1NDAA 2OLOA 1CJ3A 3DJEA 2YLSA 4AT0A 4X4JA 3PG6A 3SY4A 3ATQA 1VG0A 1EL8A 5C3JA 1P2EA 1D7LA 1TDEA 3DK4A 2ACZA 2PHHA 3K7QX 2GMHA 2AR8A 5JCLA 1S3BA 1YQ4A 4JY3A 4NTEA 1LTXR 2R45A 3AWIA 3Q6JA 4OCGA 4DNAA 1ZK7A 1JU2A 1VDCA 1W4XA 3QFAA 1CC2A 4WCTA 4J57A 2JAEA 3F8DA 2C66A 3HYXA 2YR4A 1BGNA 3AEFA 1M6IA 2TMDA 4RG3A 4U8KA 2C67A 3AD7B 4TLXA 4USQA 1GEUA 2GR2A 1DXLA 2YM2A 4ZCCA 1GOSA 2ZZCA 4CY6A 1DOEA 4JDRA 3C4NA 4FK1A 3AB1A 2R0PA 4H4WA 3I3LA 3Q9TA 3T2ZA 5L46A 3KPFA 4YKGA 1JEHA 1YY5A 3NH3X 3NYCA 4TM4A 3UKFA 1JRYA 3CMMA 3P4RA 4H50A 2NVKX 1GTEA 2BXSA 2GR1A 2JB2A 1GREA 2XYOA 2GR0A 3GSIA 1S2QA 1D4CA 1CC6A 1PXCA 4BK3A 4H4RA 5KOWA 1IUUA 1Y56A 3CTYA 2FBWA 1CBOA 2C65A 4H4PA 1LQTA 2AQJA 4J33A 1IUTA 1VRQB 3QJ4A 2YVJA 2PYXA 5FS9A 1X31B 4YSZA 5EB4A 5JRBA 3CPHG 3BHKA 3FMWA 3NK0X 3GD3A 1L0VA 3B6DA 3LJPA 4G6HA 3T14A 3JSKA 1E1MA 1RYIA 2V60A 2YQUA 2XFOA 3EAOA 4NEVA 4ZN0A 3F8PA 2BYBA 5KMPA 3GYXA 5ER0A 4Z2UA 4G6GA 3DH9A 2R4EA 2GMJA 1EBDA 3LB8A 4OPGA 3NN6X 2YVGA 2XLUA 4PAAA 2DKIA 3FIMB 2C64A 3P1WA 1GRBA 1Z6LA 4IA6A 2E4GA 2WOWA 3VR8A 2GF3A 1TDFA 3QVPA 4EMWA 3LXDA 1AOGA 2RGJA 5IQ1A 5KWFA 2BCPA 1KSUA 2YLWA 3CNPA 3LZWA 4H4TA 1PBFA 2B7SA 1RSGA 3CPIG 4AP3A 2NPXA 2CULA 2XCGA 3I6DA 1NHQA 5GSNA 1KDGA 4ICYA 3SFDA 3EANA 2XLPA 4YT0A 3M13A 1H2IA 1NG3A 2XVJA 4C5OA 1F6MA 2YG6A 3G5RA 2YG5A 4B64A 4FX9A 2BCGG 2O9ZA 3UKAA 1PS9A 2BK3A 2Q0LA 2C73A 1JRXA 5U1OA 3UKQA 1FEAA 2YG4A 4GCMA 4B63A 3CNSA 5M10A 4OPIA 2WEUA 1OJTA 2X8CA 3NTDA 2IVDA 3CNTA 3QSMA 3IC9A 2JB3A 3AE7A 3AD8B 4H7UA 5DBJA 1BZLA 3AEGA 3PVCA 5FMHA 4AOXA 1CF3A 5CKUA 1KFYA 5IQ4A 2XFQA 2IIDA 3ICSA 1K4QA 4OPCA 3DK8A 4NNJA 3P4QA 3AYLA 3V3NA 4M52A 1M64A 3SXIA 2UZZA 1PXAA 2BS4A 1TDOA 2X3NA 3NK2X 5KMQA 3R9UA 4CBQA 1P2HA 3K7TA 4Z2TA 5HY5A 4CNJA 3FBSA 4EMIA 1NHRA 3ALMA 3KPKA 1FCDA 5HHFA 5BULA 4LIIA 3K30A 4G9KA 3V3OA 1BF3A 1UKVG 3AE1A 4NZHA 2I0ZA 2VRLA 3UP4A 2QA1A 3T37A 3GMCA 2RABA 4FDCB 1HYUA 1GERA 3NN0X 5EOWA 4E0VA 5KOXA 2C4CA 1K0IA 4A9WA 1GRFA 2WOIA 1PJ5A 3UKHA 3UOVA 3VQRA 1NHPA 2XLSA 1FEBA 2BC0A 3REDA 2B9XA 3PO7A 3O0HA 1EL9A 1SEZA 1JOAA 1TDNA 1ZOVA 4HA6A 4XWRA 4J36A 4IA5A 4Z24A 3RP6A 2XFNA 3AEEA 1YQ3A 4UDQA 4I59A 1XANA 1H84A 2GVCA 3S5WA 1B4VA 4UP3A 2V5ZA 2Y6RA 3AE5A 3AEDA 3UKKA 3DGHA 2BS3A 1Y56B 1JRZA 1F8WA 4N9XA 5FS6A 2Q6UA 4TLZA 3H8LA 2FJAA 3RP8A 4A7AA 4ADWA 1B37A 4ECHA 2WPEA 4JN9A 3IWAA 3AEAA 3CGDA 1RP0A 4U8IA 1Q9IA 2YLZA 1ZP0A 4J56A 3KVEA 4CCRA 1N4UA 4UDPA 4U2LA 1PBDA 1QJDA 5C2TA 4I58A 2C76A 1IUXA 4JY2A 4K7ZA 1LQUA 2X99A 3BI5A 3GD4A 4LU6A 4K2XA 4YTPA 1MOKA 4H4QA 5HYMA 1GPEA 1NEKA 4A99A 3SZCA 4YSHA 5U63A 2V61A 1D7YA 2WQYA 3L1RA 2X50A 4RG4A 1K0LA 1PHHA 2YLTA 5EB5A 4AP1A 5KMRA 3HYVA 1O5WA 5U25A 4B67A 4EQSA 1L9DA 2JKCA 3OZ2A 5JCIA 3AD9B 4U2SA 4J31A 4GR1A 4A79A 4EIQA 2BC1A 2BA9A 2YAUA 2V3AA 1ELIA 1BWCA 1KF6A 2GB0A 2H89A 2ZBWA 4U8OA 4Z25A 2C3CA 1PDHA 2XFPA 3GRTA 3BHFA 1CJ4A 2CVJA 2VVLG 2WU2A 3UOXA 4YSYA 1MXTA 3GRSA 2WP6A 1GTHA 2GRTA 4LA1A 5M0ZA 1Y0PA 2JBVA 3URHA 2X8HA 3UOZA 4EM4A 1S2YA 3KD9A 2VQ7A 3NYFA 4OPDA 3F8RA 4AOSA 1CJCA 4AT2A 2ARDA 3OC4A 1H82A 2B7RA 3ATRA 3SFEA 2GQWA 4NTCA 2V6OA 1LVLA 1H6VA 2WDRA 2OLNA 4NWZA 3T31A 2Z5YA 1NAAA 4YKFA 1GETA 2WBAA 3SGLA 1GALA 2R46A 1JNRA 2XLTA 1ZKQA 1LJ1A 2APGA 1BGJA 3CGCA 1PBEA 2E1MA 1CJ2A 5KNLA 3SQPA 2WS3A 3GDNA 4BJZA 3C96A 2C72A 3BI2A 3C4AA 4IVOB 1H81A 3NGCX 3NNEA 4OVIA 4EMJA 2BXRA 2DKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NK1 X;  3ZYX A;  3ISH A;  1DOD A;  2WDV A;  3ITJ A;  5JCK A;  3II4 A;  4D04 A;  2GAG B;  3CPJ G;  2BAC A;  4OPU A;  4BV6 A;  4U8L A;  3H8I A;  1GRG A;  1H7X A;  2FJE A;  2A87 A;  4RSL A;  3ALL A;  2Q7V A;  1MO9 A;  1GRT A;  3H4K A;  1GT8 A;  1QLB A;  2YG7 A;  2F5Z A;  2EQ9 A;  3NRN A;  4DSG A;  2R4J A;  4BK1 A;  4WX1 A;  3M12 A;  3NTA A;  3GYJ A;  2VVL A;  4H2N A;  3KLJ A;  2YLX A;  3SM8 A;  1YQZ A;  4B69 A;  4TM1 A;  5CQF A;  3VRD B;  1K0J A;  3ALJ A;  1OJC A;  2Z5X A;  3AEC A;  2C75 A;  5HXI A;  2YR5 A;  1IJH A;  1F3P A;  3DK9 A;  1FEC A;  3CGB A;  4H4Z A;  2XVF A;  2YM1 A;  3CND A;  3DJG X;  4YTM A;  4GF7 A;  4C74 A;  2WPF A;  5TR3 A;  4YSX A;  4K22 A;  1ONF A;  1PJ6 A;  5J7X A;  1D4E A;  3B3R A;  1NG4 A;  1ZOY A;  5BUK A;  3NT6 A;  2WU5 A;  4MJW A;  4C3X A;  3GWD A;  2QA2 A;  1S3E A;  3DME A;  1GRH A;  1F8S A;  4O5Q A;  4Y4L A;  3UKP A;  4YTN A;  2WOV A;  4CY8 A;  4EQR A;  2OAL A;  3P4S A;  3RHA A;  2CFY A;  2HQM A;  3GYI A;  1TRB A;  2IVE A;  3AE3 A;  4CCQ A;  3DGZ A;  1ZDL A;  4K8D A;  3CNJ A;  4U2T A;  5JCN A;  1L9C A;  2EQ6 A;  4EM3 A;  2GH5 A;  1OJD A;  1KNP A;  3G5S A;  3PS9 A;  4C77 A;  3UKL A;  4H4U A;  3AEB A;  3V76 A;  1E1L A;  2W0H A;  1CHU A;  1E1K A;  3CGE A;  1GES A;  2ZZ0 A;  5FS8 A;  2QCU A;  4EQX A;  3DJD A;  3K7M X;  4K5R A;  2XLR A;  5J60 A;  3AE2 A;  2V3B A;  3LOV A;  1GV4 A;  4NTD A;  3UP5 A;  4IV9 A;  1GRA A;  1YKJ A;  1D5T A;  4H4V A;  2RGH A;  3AE8 A;  3LAD A;  5GRT A;  3P4P A;  4XXG A;  1H83 A;  4H2R A;  4Z44 A;  4KPR A;  4C3Y A;  2XFU A;  1Q1R A;  3AE4 A;  2EQ8 A;  1CL0 A;  3LZX A;  4B66 A;  1QO8 A;  2VZ2 A;  1H7W A;  4EIP A;  2YLR A;  2JK6 A;  4GRT A;  5FS7 A;  1O95 A;  4ZCD A;  4DGK A;  3G5Q A;  3VRA A;  1NEN A;  3UOY A;  4KX6 A;  4A65 A;  1B5Q A;  3DJJ A;  2YR6 A;  2C70 A;  1E1N A;  4JNA A;  3D1C A;  1E7P A;  2EQ7 A;  1DJQ A;  1PN0 A;  1L9E A;  3EPT A;  4J34 A;  3ABV A;  1N4V A;  3AE6 A;  1BKW A;  4U8M A;  2B9W A;  4A6N A;  3NLC A;  2AAQ A;  1XPQ A;  4PAB A;  2WDQ A;  4H4X A;  2VRM A;  1N4W A;  3BI4 A;  2H88 A;  4BUR A;  3L8K A;  4P9S A;  2BK5 A;  3CN8 A;  4K5S A;  3BNM A;  3VRB A;  2WHD A;  4OPT A;  1OJA A;  4Z26 A;  3WE0 A;  3VR9 A;  3P9U A;  4D03 A;  2Y6Q A;  4Y4N A;  2CDU A;  3QSS A;  2GV8 A;  1O94 A;  4GDE A;  5BRT A;  5BVA A;  3EF6 A;  3KA7 A;  4UDR A;  1IUV A;  4Z2R A;  3NHO X;  4H4Y A;  2BS2 A;  4APN A;  1JNZ A;  5LV9 A;  1NPX A;  1ZX9 A;  2R0C A;  5KVI A;  2VQB A;  2RGO A;  1FL2 A;  3D8X A;  4H4S A;  1VG9 A;  4U8J A;  1PBB A;  4A5L A;  2WPC A;  3RNM A;  1CC4 A;  4YXD A;  3UTG A;  1OJ9 A;  2XVH A;  5KXJ A;  2XVE A;  1FOH A;  1DNC A;  2C7G A;  1E6E A;  1V59 A;  3UTH A;  1NHS A;  4YWO A;  1TDK A;  2GAH B;  2B76 A;  2XDO A;  3GMB A;  3QVR A;  2X8G A;  4BK2 A;  2WP5 A;  3QFB A;  1REO A;  1GSN A;  3ICR A;  1GND A;  2VVM A;  3IHM A;  2Q0K A;  2J3N A;  3IF9 A;  1XHC A;  4USR A;  3UCL A;  2XVI A;  4TM3 A;  2FJB A;  1COY A;  1IUW A;  3KU9 A;  2WET A;  3UTF A;  2A89 A;  3NYE A;  4X9M A;  4NEW A;  1PXB A;  1EL5 A;  4GUV A;  4H2Q A;  2R9Z A;  4J2W A;  2YG3 A;  1Q1W A;  3AXB A;  4GDP A;  3HZL A;  5IPY A;  1N1P A;  2YVF A;  4XWZ A;  3BNU A;  2QAE A;  4X9N A;  4Z43 A;  4H2P A;  4DSH A;  3AE9 A;  1KSS A;  1D4D A;  4EQW A;  2GQF A;  4JQ9 A;  5KVH A;  3ICT A;  3ADA B;  1ZMC A;  3GDP A;  2R0G A;  1ZMD A;  2GEW A;  2OA1 A;  1TYT A;  3M0O A;  2VOU A;  1ZY8 A;  1EL7 A;  2BAB A;  2ZZB A;  2E5V A;  4B65 A;  1PJ7 A;  4B68 A;  1PBC A;  2OAM A;  3E1T A;  1E39 A;  2TPR A;  1LV0 A;  3IHG A;  3NG7 X;  2C3D A;  2WP9 A;  4O5U A;  2B9Y A;  3S61 A;  3COX A;  4JNQ A;  1LPF A;  4U8N A;  3FG2 P;  2YWL A;  3RP7 A;  3AYJ A;  1B8S A;  4TM0 A;  1H86 A;  4B1B A;  3NIX A;  1KNR A;  1DOB A;  1DJN A;  3ZDN A;  3QSE A;  4FK1 C;  1TYP A;  4U8P A;  4CRT A;  3FPZ A;  1GXF A;  2JB1 A;  3KKJ A;  3UTE A;  4Y4M A;  3DA1 A;  3NKS A;  2A8X A;  1VQW A;  1XDI A;  4IVM B;  5EBK A;  4OPL A;  5JCM A;  2WES A;  4REK A;  3GWF A;  5KRQ A;  4CNK A;  1F8R A;  3AYI A;  2BK4 A;  4HB9 A;  1IUS A;  2GR3 A;  4BJY A;  3CIR A;  2FJD A;  4A6N B;  1DOC A;  1NDA A;  2OLO A;  1CJ3 A;  3DJE A;  2YLS A;  4AT0 A;  4X4J A;  3ATQ A;  1VG0 A;  1EL8 A;  5C3J A;  1P2E A;  1D7L A;  1TDE A;  3DK4 A;  2ACZ A;  2PHH A;  3K7Q X;  2GMH A;  2AR8 A;  5JCL A;  1S3B A;  1YQ4 A;  4JY3 A;  4NTE A;  1LTX R;  2R45 A;  3AWI A;  3Q6J A;  4OCG A;  4DNA A;  1ZK7 A;  1JU2 A;  1VDC A;  1W4X A;  3QFA A;  1CC2 A;  4WCT A;  4J57 A;  2JAE A;  3F8D A;  2C66 A;  2YR4 A;  1BGN A;  3AEF A;  1M6I A;  2TMD A;  4RG3 A;  4U8K A;  2C67 A;  3AD7 B;  4TLX A;  4USQ A;  1GEU A;  2GR2 A;  1DXL A;  2YM2 A;  4ZCC A;  1GOS A;  2ZZC A;  4CY6 A;  1DOE A;  4JDR A;  3C4N A;  4FK1 A;  3AB1 A;  2R0P A;  4H4W A;  3I3L A;  3Q9T A;  5L46 A;  3KPF A;  4YKG A;  1JEH A;  1YY5 A;  3NH3 X;  3NYC A;  4TM4 A;  3UKF A;  1JRY A;  3P4R A;  4H50 A;  2NVK X;  1GTE A;  2BXS A;  2GR1 A;  2JB2 A;  1GRE A;  2XYO A;  2GR0 A;  3GSI A;  1S2Q A;  1D4C A;  1CC6 A;  1PXC A;  4BK3 A;  4H4R A;  5KOW A;  1IUU A;  1Y56 A;  3CTY A;  2FBW A;  1CBO A;  2C65 A;  4H4P A;  1LQT A;  2AQJ A;  4J33 A;  1IUT A;  1VRQ B;  3QJ4 A;  2YVJ A;  2PYX A;  5FS9 A;  1X31 B;  4YSZ A;  5EB4 A;  3CPH G;  3BHK A;  3FMW A;  3NK0 X;  3GD3 A;  1L0V A;  3B6D A;  3LJP A;  4ZN0 A;  3JSK A;  1E1M A;  1RYI A;  2V60 A;  2YQU A;  2XFO A;  3EAO A;  4NEV A;  3F8P A;  2BYB A;  5ER0 A;  4Z2U A;  3DH9 A;  2R4E A;  2GMJ A;  1EBD A;  3LB8 A;  4OPG A;  3NN6 X;  2YVG A;  2XLU A;  4PAA A;  2DKI A;  3FIM B;  2C64 A;  3P1W A;  1GRB A;  1Z6L A;  4IA6 A;  2E4G A;  2WOW A;  3VR8 A;  2GF3 A;  1TDF A;  3QVP A;  4EMW A;  3LXD A;  1AOG A;  2RGJ A;  5IQ1 A;  5KWF A;  2BCP A;  1KSU A;  2YLW A;  3CNP A;  3LZW A;  4H4T A;  1PBF A;  2B7S A;  1RSG A;  3CPI G;  4AP3 A;  2NPX A;  2CUL A;  2XCG A;  3I6D A;  1NHQ A;  5GSN A;  1KDG A;  4ICY A;  3SFD A;  3EAN A;  2XLP A;  4YT0 A;  3M13 A;  4C5O A;  1NG3 A;  2XVJ A;  1F6M A;  2YG6 A;  3G5R A;  2YG5 A;  4B64 A;  4FX9 A;  2BCG G;  2O9Z A;  3UKA A;  1PS9 A;  2BK3 A;  2Q0L A;  2C73 A;  1JRX A;  5U1O A;  3UKQ A;  1FEA A;  2YG4 A;  4GCM A;  4B63 A;  3CNS A;  5M10 A;  4OPI A;  2WEU A;  1OJT A;  2X8C A;  3NTD A;  2IVD A;  3CNT A;  3QSM A;  3IC9 A;  2JB3 A;  3AE7 A;  3AD8 B;  4H7U A;  5DBJ A;  1BZL A;  3AEG A;  3PVC A;  5FMH A;  4AOX A;  1CF3 A;  5CKU A;  1KFY A;  5IQ4 A;  2XFQ A;  2IID A;  3ICS A;  1K4Q A;  4OPC A;  3DK8 A;  3P4Q A;  3AYL A;  3V3N A;  4M52 A;  1M64 A;  2UZZ A;  1PXA A;  2BS4 A;  1TDO A;  2X3N A;  3NK2 X;  3R9U A;  4CBQ A;  1P2H A;  3K7T A;  4Z2T A;  5HY5 A;  4CNJ A;  3FBS A;  4EMI A;  1NHR A;  3ALM A;  1FCD A;  5HHF A;  5BUL A;  4LII A;  3K30 A;  3V3O A;  1BF3 A;  1UKV G;  3AE1 A;  4NZH A;  2I0Z A;  2VRL A;  3UP4 A;  2QA1 A;  3T37 A;  3GMC A;  2RAB A;  4FDC B;  1HYU A;  1GER A;  3NN0 X;  5EOW A;  4E0V A;  5KOX A;  1K0I A;  4A9W A;  1GRF A;  2WOI A;  1PJ5 A;  3UKH A;  3UOV A;  3VQR A;  1NHP A;  2XLS A;  1FEB A;  2BC0 A;  3RED A;  2B9X A;  3PO7 A;  3O0H A;  1EL9 A;  1SEZ A;  1JOA A;  1TDN A;  1ZOV A;  4HA6 A;  4XWR A;  4J36 A;  4IA5 A;  4Z24 A;  3RP6 A;  2XFN A;  3AEE A;  1YQ3 A;  4UDQ A;  4I59 A;  1XAN A;  1H84 A;  2GVC A;  3S5W A;  1B4V A;  4UP3 A;  2V5Z A;  2Y6R A;  3AE5 A;  3AED A;  3UKK A;  3DGH A;  2BS3 A;  1Y56 B;  1JRZ A;  1F8W A;  4N9X A;  5FS6 A;  2Q6U A;  4TLZ A;  3H8L A;  2FJA A;  3RP8 A;  4A7A A;  4ADW A;  1B37 A;  4ECH A;  2WPE A;  4JN9 A;  3IWA A;  3AEA A;  3CGD A;  1RP0 A;  4U8I A;  1Q9I A;  2YLZ A;  1ZP0 A;  4J56 A;  3KVE A;  4CCR A;  1N4U A;  4UDP A;  4U2L A;  1PBD A;  1QJD A;  5C2T A;  4I58 A;  2C76 A;  1IUX A;  4JY2 A;  4K7Z A;  1LQU A;  2X99 A;  3BI5 A;  3GD4 A;  4LU6 A;  4K2X A;  4YTP A;  1MOK A;  4H4Q A;  5HYM A;  1GPE A;  1NEK A;  4A99 A;  4YSH A;  5U63 A;  2V61 A;  1D7Y A;  2WQY A;  3L1R A;  2X50 A;  4RG4 A;  1K0L A;  1PHH A;  2YLT A;  5EB5 A;  4AP1 A;  1O5W A;  5U25 A;  4B67 A;  4EQS A;  1L9D A;  2JKC A;  3OZ2 A;  5JCI A;  3AD9 B;  4U2S A;  4J31 A;  4GR1 A;  4A79 A;  4EIQ A;  2BC1 A;  2BA9 A;  2YAU A;  1ELI A;  2V3A A;  1BWC A;  1KF6 A;  2GB0 A;  2H89 A;  2ZBW A;  4U8O A;  4Z25 A;  2C3C A;  1PDH A;  2XFP A;  3GRT A;  3BHF A;  1CJ4 A;  2CVJ A;  2VVL G;  2WU2 A;  3UOX A;  4YSY A;  1MXT A;  3GRS A;  2WP6 A;  1GTH A;  2GRT A;  4LA1 A;  5M0Z A;  1Y0P A;  2JBV A;  3URH A;  2X8H A;  3UOZ A;  4EM4 A;  1S2Y A;  3KD9 A;  2VQ7 A;  3NYF A;  4OPD A;  3F8R A;  4AOS A;  1CJC A;  4AT2 A;  2ARD A;  3OC4 A;  1H82 A;  2B7R A;  3ATR A;  3SFE A;  2GQW A;  4NTC A;  2V6O A;  1LVL A;  1H6V A;  2WDR A;  2OLN A;  2Z5Y A;  1NAA A;  4YKF A;  1GET A;  2WBA A;  3SGL A;  1GAL A;  2R46 A;  1JNR A;  2XLT A;  1ZKQ A;  1LJ1 A;  2APG A;  1BGJ A;  3CGC A;  1PBE A;  2E1M A;  1CJ2 A;  3SQP A;  2WS3 A;  3GDN A;  4BJZ A;  3C96 A;  2C72 A;  3BI2 A;  3C4A A;  4IVO B;  1H81 A;  3NGC X;  3NNE A;  4OVI A;  4EMJ A;  2BXR A;  2DKH A; 
#chains in the Genus database with same CATH topology
 3ZYX A;  3TJ4 A;  2XH2 A;  3ISH A;  3SN1 A;  4BV6 A;  4U8L A;  2W3R A;  3H8I A;  1H7X A;  2FJE A;  3ALL A;  1MO9 A;  1GRT A;  1N61 C;  2F5Z A;  3NRN A;  4BK1 A;  2VVL A;  3VRD B;  5HXI A;  2YR5 A;  3R11 A;  4IHC A;  4H4Z A;  1SJC A;  2MNR A;  4C74 A;  4YSX A;  1ONF A;  3FXG A;  3B3R A;  5BUK A;  4MJW A;  1S3E A;  1F8S A;  2OAL A;  3RHA A;  2CFY A;  2HQM A;  3AE3 A;  3NVY B;  4GME A;  4CCQ A;  5JCN A;  1XPY A;  2GH5 A;  3SJN A;  1KNP A;  1OJD A;  3AEB A;  2OKT A;  1CHU A;  1GES A;  3LOV A;  1YKJ A;  1D5T A;  5GRT A;  4XXG A;  4C3Y A;  5FJR A;  3RIT A;  3OW1 A;  2EQ8 A;  1QO8 A;  4G73 A;  4GRT A;  3T2Y A;  3H12 A;  4A65 A;  2YR6 A;  1E1N A;  3I6T A;  1MRA A;  1XPQ A;  4PAB A;  2VRM A;  3BI4 A;  4BUR A;  3B9J B;  2WHD A;  1OJA A;  3VR9 A;  3L5O A;  3MUC A;  2CDU A;  3QSS A;  4UDR A;  4Z2R A;  3NHO X;  4H4Y A;  5LV9 A;  2VQB A;  2WPC A;  3UTG A;  2XVH A;  5KXJ A;  1E6E A;  7ENL A;  4YWO A;  1TDK A;  2B76 A;  3QVR A;  3QFB A;  1REO A;  1GSN A;  3T6C A;  1GND A;  3IHM A;  2OVL A;  2W55 A;  4DWD A;  3R07 C;  1IUW A;  3NYE A;  2PTX A;  5EU9 A;  1EL5 A;  3AXB A;  4GDP A;  2QAE A;  4DSH A;  3AE9 A;  1PDY A;  3UJ2 A;  1KSS A;  4JQ9 A;  5KVH A;  3ADA B;  3NRZ B;  3NZG A;  5FJU A;  3HYW A;  2E5V A;  4B65 A;  1PBC A;  2PGE A;  1LV0 A;  2B9Y A;  4JNQ A;  1LPF A;  2FKP A;  3AYJ A;  4TM0 A;  1H86 A;  2AL2 B;  1KNR A;  1GXF A;  1T3Q C;  1N60 C;  3DA1 A;  4MGG A;  2A8X A;  1VQW A;  5EBK A;  3D46 A;  1BQG A;  3GWF A;  4CNK A;  2GR3 A;  1N63 C;  1DOC A;  2YLS A;  4ZA0 A;  3RCY A;  3PG6 A;  5G5H B;  3SY4 A;  4ZCW A;  1EL8 A;  1D7L A;  2ACZ A;  3K7Q X;  5JCL A;  4NTE A;  4OCG A;  4DNA A;  4J57 A;  2C66 A;  3AEF A;  1YEY A;  2POD A;  4U8K A;  2GR2 A;  4KPL A;  3JW7 A;  4JDR A;  4H4W A;  3Q9T A;  4YKG A;  3CMM A;  3P4R A;  4H50 A;  1GRE A;  4H4R A;  5KOW A;  1SJB A;  2OFJ A;  2OPJ A;  3CAW A;  5FJP A;  2HXU A;  3QJ4 A;  2PYX A;  5FS9 A;  1X31 B;  3BHK A;  1RYI A;  2YQU A;  3DG3 A;  3F8P A;  5ER0 A;  3DH9 A;  2R4E A;  2XLU A;  2DKI A;  1GRB A;  3CYJ A;  1PDZ A;  2YLW A;  4H4T A;  1PBF A;  2NPX A;  2CUL A;  1NHQ A;  4HYR A;  4ICY A;  2XLP A;  4C5O A;  4GIS A;  4FX9 A;  2O9Z A;  2Q0L A;  5M10 A;  5FJT A;  1OJT A;  2IVD A;  4H7U A;  5DBJ A;  3I4K A;  3AN1 A;  5FMH A;  4AOX A;  3DK8 A;  3P4Q A;  3V3N A;  3SN0 A;  2BS4 A;  1TDO A;  3R9U A;  1P2H A;  4CNJ A;  3FBS A;  4EMI A;  2AKZ A;  3AE1 A;  2QA1 A;  3T37 A;  1GER A;  4E0V A;  1EBG A;  2WOI A;  2BC0 A;  3D47 A;  1EL9 A;  1SEZ A;  1JOA A;  3RP6 A;  4UDQ A;  3AEE A;  1YQ3 A;  1XAN A;  3KUM A;  3S47 A;  4UP3 A;  2V5Z A;  2Y6R A;  3AE5 A;  1JRZ A;  3ZVH A;  4ECH A;  4JN9 A;  3CXO A;  3KVE A;  3MZN A;  2OZ8 A;  1IUX A;  4K7Z A;  1MOK A;  4H4Q A;  4A99 A;  5U63 A;  3DFY A;  1O5W A;  3VC5 A;  1ECQ A;  4U2S A;  1BWC A;  1KF6 A;  2XH4 A;  2C3C A;  1PDH A;  1MXT A;  3NVV B;  1Y0P A;  1ELS A;  1S2Y A;  3NYF A;  4OPD A;  3F8R A;  4NTC A;  4Z17 A;  2WDR A;  2Z5Y A;  2WBA A;  3EEZ A;  2R46 A;  1JNR A;  2APG A;  1BGJ A;  1OEP A;  2E1M A;  5KNL A;  2WS3 A;  4BJZ A;  3C96 A;  3NGC X;  4OVI A;  4J3Z A;  3GD6 A;  3NK1 X;  3ITJ A;  1DOD A;  2QJN A;  2BAC A;  2A87 A;  4RSL A;  2EQ9 A;  3T4W A;  2R4J A;  4WX1 A;  3SN4 A;  3M12 A;  3GYJ A;  3KLJ A;  2YLX A;  3SM8 A;  1YQZ A;  3ALJ A;  3AEC A;  3SR6 B;  1IJH A;  2DW6 A;  3ZVH B;  1FEC A;  5TR3 A;  1P48 A;  2HXT A;  3GWD A;  3ES8 A;  3V3W A;  4O5Q A;  4TVY A;  1WUE A;  4EQR A;  3P4S A;  3GYI A;  2OZT A;  4K8D A;  4FI4 A;  4C77 A;  3UKL A;  4H4U A;  1E1L A;  1E1K A;  3DJD A;  4EQX A;  3AE2 A;  2V3B A;  4NTD A;  1H83 A;  4H2R A;  4Z44 A;  1KN0 A;  4IZG A;  2AL1 A;  2YLR A;  3BJS A;  4M6U A;  5FS7 A;  1O95 A;  4ZCD A;  4DGK A;  3G5Q A;  1NEN A;  3DJJ A;  2C70 A;  4JNA A;  3D1C A;  2EQ7 A;  1DJQ A;  1PN0 A;  4J1O A;  3AE6 A;  4U8M A;  3SX6 A;  3NLC A;  2AAQ A;  3BNM A;  4OPT A;  4Z26 A;  3WE0 A;  3R10 A;  4D03 A;  2Y6Q A;  4KEM A;  4GDE A;  5BRT A;  1IUV A;  3N4F A;  2RGO A;  1VG9 A;  1PBB A;  4A5L A;  3R0K A;  1CC4 A;  3RNM A;  4YXD A;  1OJ9 A;  2XVE A;  1FOH A;  1V59 A;  1NHS A;  2XDO A;  2X8G A;  4BK2 A;  2WP5 A;  4GYP C;  3ICR A;  3BOX A;  2VVM A;  2J3N A;  3IF9 A;  4USR A;  4TM3 A;  1L8P A;  1COY A;  3KU9 A;  1WYG A;  4GUV A;  3SYI A;  4XWZ A;  3PFR A;  4EQW A;  3NVW B;  3GDP A;  2R0G A;  2OA1 A;  1SJA A;  3E1T A;  1E39 A;  3IHG A;  4U8N A;  3FG2 P;  3RP7 A;  4B1B A;  3HW2 A;  3ZDN A;  4FK1 C;  2E3T A;  4Y4M A;  3NKS A;  1XDI A;  4REK A;  3JVA A;  2QJJ A;  2GGJ A;  4K8G A;  1FHU A;  4GFI A;  1NDA A;  2P3Z A;  2OLO A;  3VA8 A;  3DJE A;  3FV9 A;  2ZAD A;  3P0W A;  3DK4 A;  1MUC A;  2GMH A;  1YQ4 A;  3AWI A;  2GGE A;  1VDC A;  4E4F A;  3F8D A;  3HYX A;  1BGN A;  4TLX A;  3DGB A;  2YM2 A;  2ZZC A;  4FK1 A;  3I3L A;  3T2Z A;  5L46 A;  3TWA A;  3KPF A;  1JEH A;  3NYC A;  2JB2 A;  2GR1 A;  2XYO A;  2GR0 A;  1D4C A;  1CC6 A;  1IUU A;  1Y56 A;  3CTY A;  1VQZ A;  3P93 A;  4J33 A;  1IUT A;  1VRQ B;  1KKR A;  3DER A;  5EB4 A;  3HPF A;  4HCL A;  5JRB A;  1L0V A;  3LJP A;  4G6H A;  3JSK A;  2V60 A;  2BYB A;  3GY1 A;  3LB8 A;  4OPG A;  3P1W A;  2P8B A;  4IA6 A;  2GF3 A;  1TDF A;  5IQ1 A;  3I6E A;  5KWF A;  2BCP A;  3CNP A;  3LZW A;  4HN8 A;  3SFD A;  3EAN A;  4YT0 A;  3RR1 A;  1NG3 A;  2YG6 A;  3VDG A;  1JPD X;  2BCG G;  3GC2 A;  1PS9 A;  5U1O A;  3UKQ A;  1FEA A;  2WEU A;  2X8C A;  3NTD A;  4FP1 A;  3EKG A;  3IJI A;  4OPC A;  3AMZ A;  4KT2 A;  1M64 A;  3Q4D A;  2X3N A;  4CBQ A;  3K7T A;  3ETR B;  3KPK A;  5BUL A;  2OX4 A;  4NZH A;  4Z25 A;  4FDC B;  1HYU A;  5KOX A;  2C4C A;  1K0I A;  3UOV A;  3QLD A;  3RED A;  2B9X A;  2AKM A;  4HA6 A;  2P0I A;  4IA5 A;  1B4V A;  3SBF A;  2QQ6 A;  2BS3 A;  1Y56 B;  3GO2 A;  1F8W A;  3UJF A;  1B37 A;  2WPE A;  2PU0 A;  1Q9I A;  1ZP0 A;  4GGB A;  4CCR A;  4GGH A;  3A7A A;  1QJD A;  4I58 A;  4JY2 A;  1R6W A;  1GPE A;  2V61 A;  4HNC A;  2X50 A;  5EB5 A;  4AP1 A;  5U25 A;  3OZ2 A;  5JCI A;  4J31 A;  4EIQ A;  2BA9 A;  2YAU A;  1N5X A;  2HNE A;  3IJL A;  2CVJ A;  2VVL G;  3GRS A;  2WP6 A;  1GTH A;  2GRT A;  2RDX A;  4LA1 A;  3URH A;  2X8H A;  4EM4 A;  1BKH A;  3NXL A;  2B7R A;  3ATR A;  3NVZ B;  3QTP A;  4YWS A;  4YKF A;  1GET A;  3V5C A;  1GAL A;  2MUC A;  3ENL A;  5BOE A;  2C72 A;  2BXR A;  2PA6 A;  4DX3 A;  4A35 A;  2WDV A;  5JCK A;  1E9I A;  2GAG B;  1GRG A;  3OTR A;  1TE6 A;  2Q7V A;  3V4B A;  3BSM A;  2BRY A;  3H4K A;  1QLB A;  2YG7 A;  1MDR A;  4DSG A;  1SJD A;  4B69 A;  4TM1 A;  2Z5X A;  2PMQ A;  4MKS A;  3DK9 A;  3CGB A;  3CT2 A;  3CND A;  1JDF A;  2I5Q A;  4GF7 A;  2WPF A;  1PJ6 A;  1ZOY A;  4C3X A;  4Y4L A;  4YTN A;  3SZW A;  4E4U A;  4HPN A;  1L9C A;  3G5S A;  3V76 A;  2W0H A;  2PTZ A;  5FS8 A;  2QCU A;  4K5R A;  5J60 A;  4IV9 A;  1GRA A;  3TJI A;  4F4R A;  5KMS A;  1Q1R A;  3AE4 A;  1CL0 A;  2PU1 A;  3LZX A;  3SZF A;  2VZ2 A;  1H7W A;  2JK6 A;  3AM9 A;  1S7M A;  3VCN A;  4DN1 A;  1MNS A;  1E7P A;  1ONE A;  4A6N A;  1BKW A;  2PTW A;  2B9W A;  1P43 A;  3QKE A;  2BK5 A;  4K5S A;  3VRB A;  2QVH A;  2XGZ A;  2QGY A;  3P9U A;  2QDE A;  4Y4N A;  2GV8 A;  3EF6 A;  3KA7 A;  3DIP A;  4APN A;  1JNZ A;  1NPX A;  3NS1 B;  2R0C A;  5KVI A;  4U8J A;  3D8X A;  1FL2 A;  4H4S A;  4HCD A;  4E5T A;  1DNC A;  3MSY A;  2C7G A;  3UTH A;  4IL2 A;  2XH7 A;  3GMB A;  3ZLG A;  4IT1 A;  3RGT A;  1XHC A;  3UCL A;  1NEL A;  2FJB A;  1NU5 A;  2WET A;  2A89 A;  4X9M A;  4NEW A;  1N5W C;  1PXB A;  4J2W A;  2YG3 A;  5ENL A;  3HZL A;  5IPY A;  3B97 A;  2YVF A;  4Z43 A;  4DHG A;  4H2P A;  4II3 A;  2PP3 A;  1D4D A;  2GQF A;  1ZMC A;  1ZMD A;  3M0O A;  2VOU A;  1ZY8 A;  2OAM A;  3MWC A;  3NG7 X;  3PWG A;  2C3D A;  2WP9 A;  4O5U A;  3UCD A;  3VC6 A;  2PTY A;  3UJS A;  3NIX A;  3U9I A;  2E5A A;  1TYP A;  4U8P A;  3FPZ A;  3A7U A;  3DFH A;  4GAV A;  4IVM B;  2WES A;  1F8R A;  1IUS A;  4A6N B;  1CJ3 A;  2QJM A;  3ATQ A;  2XH0 A;  5C3J A;  2PHH A;  1S3B A;  2GSH A;  4JY3 A;  2W54 A;  3Q6J A;  4K1W A;  1W4X A;  3QFA A;  1CC2 A;  2JAE A;  2YR4 A;  1SB3 B;  4ZCC A;  1GOS A;  1DOE A;  2R0P A;  3CB3 A;  1YY5 A;  3NH3 X;  1JRY A;  3UJE A;  1GTE A;  2BXS A;  1KD0 A;  3GSI A;  3T8Q A;  1PXC A;  3H8A A;  3H70 A;  2AQJ A;  4YSZ A;  3CK5 A;  3FMW A;  3NK0 X;  3GD3 A;  3B6D A;  3A7R A;  3GYX A;  3U4F A;  4G6G A;  1EBD A;  2E4G A;  3TQP A;  4EMW A;  3LXD A;  1AOG A;  2OQH A;  1EC8 A;  1RSG A;  4AP3 A;  3I6D A;  4H83 A;  3MY9 A;  1F6M A;  4B64 A;  3UKA A;  2C73 A;  3PK7 A;  1JRX A;  3H7V A;  2YG4 A;  4GCM A;  3CNS A;  5BOF A;  1RM6 B;  1VDV A;  3CNT A;  3AE7 A;  1BZL A;  3AEG A;  3PVC A;  5CKU A;  1KFY A;  2XFQ A;  3ICS A;  1K4Q A;  4NNJ A;  2POZ A;  4GYP A;  2UZZ A;  1PXA A;  5HY5 A;  3ALM A;  5HHF A;  4G9K A;  1BF3 A;  3UP4 A;  2I0Z A;  2VRL A;  3GMC A;  2RAB A;  3NN0 X;  5EOW A;  1WUF A;  4A9W A;  1JRO A;  1GRF A;  3VQR A;  2XLS A;  3NFU A;  3O0H A;  1TDN A;  4XWR A;  4J36 A;  3FYY A;  3VCC A;  1H84 A;  3DGH A;  2Q6U A;  4TLZ A;  4A7A A;  2FJA A;  4ADW A;  3ZLF A;  3IWA A;  3AEA A;  1RP0 A;  4U8I A;  2YLZ A;  2ZC8 A;  3V5F A;  1N4U A;  4UDP A;  2AL2 A;  2C76 A;  1JCT A;  2X99 A;  3BI5 A;  4YTP A;  4K2X A;  5IDZ A;  3DDM A;  5HYM A;  1NEK A;  4EWJ A;  1D7Y A;  1PHH A;  4B67 A;  1L9D A;  2JKC A;  3SQS A;  3OPS A;  2V3A A;  3T9P A;  2GB0 A;  2H89 A;  3JZU A;  3TOY A;  4U8O A;  3GRT A;  3BHF A;  4M0X A;  2CHR A;  3STP A;  5M0Z A;  1JRP A;  1MDL A;  3KD9 A;  2VQ7 A;  1FIQ B;  3FVD A;  3OC4 A;  1H82 A;  4DYE A;  2GQW A;  2V6O A;  1H6V A;  1EC9 A;  3T31 A;  3SGL A;  1LJ1 A;  4HCH A;  1PBE A;  1JPM A;  3CGC A;  3SQP A;  1F9C A;  3ZLH A;  3BI2 A;  3C4A A;  5J04 A;  1H81 A;  3NNE A;  4EMJ A;  3II4 A;  4D04 A;  3CPJ G;  4OPU A;  3T0K A;  3THU A;  1GT8 A;  3MQT A;  3NTA A;  4H2N A;  5CQF A;  1K0J A;  1OJC A;  2C75 A;  3S5S A;  1F3P A;  2XVF A;  2YM1 A;  3DJG X;  4JN7 A;  4YTM A;  4K22 A;  5J7X A;  1D4E A;  1NG4 A;  3NT6 A;  2WU5 A;  2QA2 A;  3DME A;  3UKP A;  1GRH A;  2WOV A;  4CY8 A;  1TRB A;  2IVE A;  3DGZ A;  1ZDL A;  3CNJ A;  4U2T A;  2EQ6 A;  4G74 A;  4EM3 A;  3PS9 A;  3CGE A;  3QPE A;  3K7M X;  2ZZ0 A;  2XLR A;  1GV4 A;  3UP5 A;  2FYM A;  2RGH A;  4H4V A;  3AE8 A;  3LAD A;  3P4P A;  4KPR A;  2XFU A;  4B66 A;  4EIP A;  3UXL A;  2ONE A;  4ROP A;  3VRA A;  3OZM A;  3UOY A;  1KCZ A;  4KX6 A;  1B5Q A;  4GAP A;  2OO6 A;  1L9E A;  3NO1 A;  3EPT A;  3ABV A;  4J34 A;  1N4V A;  2PS2 A;  2WDQ A;  4H4X A;  1N4W A;  2H88 A;  3L8K A;  2GGH A;  4P9S A;  3CN8 A;  2BRA A;  3K1G A;  1IYX A;  2OQY A;  2P8C A;  3CXB A;  4DXK A;  1O94 A;  5BVA A;  2BS2 A;  1ZX9 A;  3TW9 A;  3UXK A;  2GGG A;  2P88 A;  3T2K A;  2W3S A;  3N6H A;  2GAH B;  4G8T A;  2Q0K A;  2XVI A;  4A6G A;  3UTF A;  3UCC A;  4H2Q A;  2R9Z A;  4MMW A;  1Q1W A;  1DTN A;  3R0U A;  1N1P A;  1TKK A;  3BNU A;  4X9N A;  4H19 A;  2GGI A;  3ICT A;  4X2P A;  3SZ0 A;  2GEW A;  4II2 A;  1TYT A;  3VFC A;  2BAB A;  1EL7 A;  3D9X A;  1XS2 A;  2ZZB A;  4B68 A;  1PJ7 A;  2TPR A;  3S61 A;  3UGV A;  3COX A;  2PSN A;  2YWL A;  1B8S A;  1DOB A;  1DJN A;  3QSE A;  4CRT A;  1FFV C;  2JB1 A;  3DES A;  3KKJ A;  3UTE A;  1V97 A;  4H1Z A;  4HNL A;  4OPL A;  5JCM A;  5KRQ A;  2OZ3 A;  3FCP A;  3AYI A;  2BK4 A;  4HB9 A;  4BJY A;  3P3B A;  3CIR A;  2FJD A;  4AT0 A;  4X4J A;  1VG0 A;  1P2E A;  3OP2 A;  1TDE A;  2AR8 A;  1FFU C;  1LTX R;  2R45 A;  1ZK7 A;  1JU2 A;  1TZZ A;  4WCT A;  3N4E A;  1M6I A;  2TMD A;  4RG3 A;  2C67 A;  3AD7 B;  4USQ A;  1GEU A;  1DXL A;  4CY6 A;  3C4N A;  3AB1 A;  4E8G A;  2OLA A;  4TM4 A;  3UKF A;  6ENL A;  2NVK X;  1S2Q A;  3N6J A;  2PP1 A;  4BK3 A;  3R1Z A;  2FBW A;  4G7F A;  1CBO A;  4A3R A;  2C65 A;  4H4P A;  1LQT A;  1R0M A;  2YVJ A;  4E6M A;  1W6T A;  3CPH G;  3SSZ A;  1KKO A;  3T14 A;  4ZN0 A;  1E1M A;  2XFO A;  3EAO A;  4NEV A;  3TCS A;  5KMP A;  2QDD A;  4Z2U A;  4TVW A;  2GMJ A;  3NN6 X;  2PGW A;  2YVG A;  4PAA A;  3Q45 A;  3FIM B;  2C64 A;  1Z6L A;  3VR8 A;  2WOW A;  3QVP A;  3PWI A;  1FO4 A;  2RGJ A;  1KSU A;  3FJ4 A;  2B7S A;  3CPI G;  2XCG A;  2PP0 A;  2PPG A;  5GSN A;  1KDG A;  3M13 A;  1H2I A;  2XVJ A;  4H2H A;  3G5R A;  2YG5 A;  5FJO A;  2BK3 A;  3RO6 A;  3DG6 A;  4B63 A;  3ZVI A;  4ENL A;  4OPI A;  3QSM A;  3IC9 A;  2JB3 A;  3AD8 B;  2NQL A;  3IK4 A;  1CF3 A;  5IQ4 A;  2IID A;  3AYL A;  1STZ A;  4M52 A;  3SXI A;  3EUB 3;  3NK2 X;  3TTE A;  5KMQ A;  4Z2T A;  4ZOH B;  4IP5 A;  1NHR A;  2XSX A;  3HRD C;  1FCD A;  4LII A;  3K30 A;  1ZXI C;  3V3O A;  1UKV G;  3UKH A;  1PJ5 A;  1NHP A;  3MKC A;  1FEB A;  4IP4 A;  1EC7 A;  3PO7 A;  1FHV A;  1X2G A;  1ZOV A;  4Z24 A;  2XFN A;  2DW7 A;  4I59 A;  3S5W A;  2GVC A;  3AED A;  3UKK A;  4IL0 A;  1RVK A;  4N9X A;  5FS6 A;  3H8L A;  3RP8 A;  2PCE A;  1N62 C;  2HZG A;  3DEQ A;  3TWB A;  3CGD A;  4J56 A;  4U2L A;  1PBD A;  4Z1Y A;  5C2T A;  1X2H A;  2OG9 A;  1LQU A;  3GD4 A;  4LU6 A;  3R25 A;  3SZC A;  4YSH A;  2WQY A;  3L1R A;  4RG4 A;  5KMR A;  1K0L A;  2YLT A;  3HYV A;  5G5G B;  4EQS A;  3UJR A;  3AD9 B;  3IJQ A;  4GR1 A;  4A79 A;  2BC1 A;  1ELI A;  2ZBW A;  2XFP A;  1CJ4 A;  4YSY A;  2WU2 A;  3UOX A;  3RRA A;  4KWS A;  2GL5 A;  2JBV A;  3UOZ A;  4GIR A;  1EBH A;  4AOS A;  1CJC A;  4AT2 A;  2ARD A;  3QN3 A;  3SFE A;  1LVL A;  3DG7 A;  4NWZ A;  2OLN A;  4JHM A;  1NAA A;  4JN8 A;  2XLT A;  1ZKQ A;  3ES7 A;  4K2S A;  1CJ2 A;  3GDN A;  2GDQ A;  2O56 A;  4IVO B;  3OZY A;  2DKH A; 
#chains in the Genus database with same CATH homology
 3NK1 X;  3ZYX A;  3ISH A;  1DOD A;  2WDV A;  3ITJ A;  5JCK A;  3II4 A;  4D04 A;  2GAG B;  3CPJ G;  2BAC A;  4OPU A;  4BV6 A;  4U8L A;  3T0K A;  3H8I A;  1GRG A;  1H7X A;  2FJE A;  2A87 A;  4RSL A;  3ALL A;  2Q7V A;  1MO9 A;  1GRT A;  2BRY A;  3H4K A;  1GT8 A;  1QLB A;  2YG7 A;  2F5Z A;  2EQ9 A;  3NRN A;  4DSG A;  2R4J A;  4BK1 A;  4WX1 A;  3M12 A;  3NTA A;  3GYJ A;  2VVL A;  4H2N A;  3KLJ A;  2YLX A;  3SM8 A;  1YQZ A;  4B69 A;  4TM1 A;  5CQF A;  3VRD B;  1K0J A;  3ALJ A;  1OJC A;  2Z5X A;  3AEC A;  2C75 A;  5HXI A;  2YR5 A;  1IJH A;  1F3P A;  3DK9 A;  1FEC A;  3CGB A;  4H4Z A;  2XVF A;  2YM1 A;  3CND A;  3DJG X;  4YTM A;  4GF7 A;  4C74 A;  2WPF A;  5TR3 A;  4YSX A;  4K22 A;  1ONF A;  1PJ6 A;  5J7X A;  1D4E A;  3B3R A;  1NG4 A;  1ZOY A;  5BUK A;  3NT6 A;  2WU5 A;  4MJW A;  4C3X A;  3GWD A;  2QA2 A;  1S3E A;  3DME A;  1GRH A;  1F8S A;  4O5Q A;  4Y4L A;  3UKP A;  4YTN A;  2WOV A;  4CY8 A;  3SZW A;  4EQR A;  2OAL A;  3P4S A;  3RHA A;  2CFY A;  2HQM A;  3GYI A;  1TRB A;  2IVE A;  3AE3 A;  4CCQ A;  3DGZ A;  1ZDL A;  4K8D A;  3CNJ A;  4U2T A;  5JCN A;  1L9C A;  2EQ6 A;  4G74 A;  4EM3 A;  2GH5 A;  1OJD A;  1KNP A;  3G5S A;  3PS9 A;  4C77 A;  3UKL A;  4H4U A;  3AEB A;  3V76 A;  1E1L A;  2W0H A;  1CHU A;  1E1K A;  3CGE A;  1GES A;  2ZZ0 A;  5FS8 A;  2QCU A;  4EQX A;  3DJD A;  3K7M X;  4K5R A;  2XLR A;  5J60 A;  3AE2 A;  2V3B A;  3LOV A;  1GV4 A;  4NTD A;  3UP5 A;  4IV9 A;  1GRA A;  1YKJ A;  1D5T A;  4H4V A;  2RGH A;  3AE8 A;  3LAD A;  5GRT A;  3P4P A;  4XXG A;  1H83 A;  4H2R A;  4Z44 A;  4KPR A;  4C3Y A;  5KMS A;  2XFU A;  1KN0 A;  1Q1R A;  3AE4 A;  2EQ8 A;  1CL0 A;  3LZX A;  3SZF A;  1QO8 A;  2VZ2 A;  4B66 A;  1H7W A;  4G73 A;  4EIP A;  2YLR A;  2JK6 A;  4GRT A;  5FS7 A;  1O95 A;  4ZCD A;  3T2Y A;  4DGK A;  3G5Q A;  3VRA A;  1S7M A;  1NEN A;  3UOY A;  4KX6 A;  4A65 A;  1B5Q A;  3DJJ A;  2YR6 A;  2C70 A;  4GAP A;  1E1N A;  4JNA A;  3D1C A;  1E7P A;  2EQ7 A;  1DJQ A;  1PN0 A;  1L9E A;  3EPT A;  4J34 A;  3ABV A;  1N4V A;  3AE6 A;  1BKW A;  4U8M A;  2B9W A;  3SX6 A;  3NLC A;  4A6N A;  2AAQ A;  1XPQ A;  4PAB A;  2WDQ A;  4H4X A;  2VRM A;  1N4W A;  3BI4 A;  2H88 A;  4BUR A;  3L8K A;  4P9S A;  2BK5 A;  3CN8 A;  4K5S A;  3BNM A;  3VRB A;  2BRA A;  2WHD A;  4OPT A;  1OJA A;  4Z26 A;  3WE0 A;  3VR9 A;  3P9U A;  3L5O A;  4D03 A;  2Y6Q A;  4Y4N A;  2CDU A;  3QSS A;  2GV8 A;  1O94 A;  4GDE A;  5BRT A;  5BVA A;  3EF6 A;  3KA7 A;  4UDR A;  1IUV A;  4Z2R A;  3NHO X;  4H4Y A;  2BS2 A;  4APN A;  1JNZ A;  5LV9 A;  1NPX A;  1ZX9 A;  2R0C A;  5KVI A;  2VQB A;  2RGO A;  1FL2 A;  3D8X A;  4H4S A;  1VG9 A;  4U8J A;  1PBB A;  4A5L A;  2WPC A;  3RNM A;  1CC4 A;  4YXD A;  3UTG A;  1OJ9 A;  2XVH A;  5KXJ A;  2XVE A;  1FOH A;  1DNC A;  2C7G A;  1E6E A;  1V59 A;  3T2K A;  3UTH A;  1NHS A;  4YWO A;  1TDK A;  2GAH B;  2B76 A;  2XDO A;  3GMB A;  3QVR A;  2X8G A;  4BK2 A;  2WP5 A;  3QFB A;  1REO A;  1GSN A;  3ICR A;  1GND A;  2VVM A;  3IHM A;  2Q0K A;  2J3N A;  3IF9 A;  1XHC A;  4USR A;  3UCL A;  2XVI A;  4TM3 A;  2FJB A;  1COY A;  1IUW A;  3KU9 A;  2WET A;  3UTF A;  2A89 A;  3NYE A;  4X9M A;  4NEW A;  1PXB A;  1EL5 A;  4GUV A;  4H2Q A;  2R9Z A;  4J2W A;  3SYI A;  2YG3 A;  1Q1W A;  3AXB A;  4GDP A;  3HZL A;  5IPY A;  1N1P A;  2YVF A;  4XWZ A;  3BNU A;  2QAE A;  4X9N A;  4Z43 A;  4H2P A;  4II3 A;  4DSH A;  3AE9 A;  1KSS A;  1D4D A;  4EQW A;  2GQF A;  4JQ9 A;  5KVH A;  3ICT A;  3ADA B;  1ZMC A;  3HYW A;  3GDP A;  2R0G A;  3SZ0 A;  1ZMD A;  2GEW A;  4II2 A;  2OA1 A;  1TYT A;  3M0O A;  2VOU A;  1ZY8 A;  1EL7 A;  2BAB A;  3D9X A;  2ZZB A;  2E5V A;  4B65 A;  1PJ7 A;  4B68 A;  1PBC A;  2OAM A;  3E1T A;  1E39 A;  2TPR A;  1LV0 A;  3IHG A;  3NG7 X;  2C3D A;  2WP9 A;  4O5U A;  2B9Y A;  3S61 A;  3COX A;  4JNQ A;  1LPF A;  4U8N A;  3FG2 P;  2YWL A;  3RP7 A;  3AYJ A;  1B8S A;  4TM0 A;  1H86 A;  4B1B A;  3NIX A;  1KNR A;  1DOB A;  1DJN A;  3ZDN A;  3QSE A;  4FK1 C;  1TYP A;  4U8P A;  4CRT A;  3FPZ A;  1GXF A;  2JB1 A;  3KKJ A;  3UTE A;  4Y4M A;  3DA1 A;  3NKS A;  2A8X A;  1VQW A;  1XDI A;  4GAV A;  4IVM B;  5EBK A;  4OPL A;  5JCM A;  2WES A;  4REK A;  3GWF A;  5KRQ A;  4CNK A;  1F8R A;  3AYI A;  2BK4 A;  4HB9 A;  1IUS A;  2GR3 A;  4BJY A;  3CIR A;  2FJD A;  4A6N B;  1DOC A;  1NDA A;  2OLO A;  1CJ3 A;  3DJE A;  2YLS A;  4AT0 A;  4X4J A;  3PG6 A;  3SY4 A;  3ATQ A;  1VG0 A;  1EL8 A;  5C3J A;  1P2E A;  1D7L A;  1TDE A;  3DK4 A;  2ACZ A;  2PHH A;  3K7Q X;  2GMH A;  2AR8 A;  5JCL A;  1S3B A;  1YQ4 A;  4JY3 A;  4NTE A;  1LTX R;  2R45 A;  3AWI A;  3Q6J A;  4OCG A;  4DNA A;  1ZK7 A;  1JU2 A;  1VDC A;  1W4X A;  3QFA A;  1CC2 A;  4WCT A;  4J57 A;  2JAE A;  3F8D A;  2C66 A;  3HYX A;  2YR4 A;  1BGN A;  3AEF A;  1M6I A;  2TMD A;  4RG3 A;  4U8K A;  2C67 A;  3AD7 B;  4TLX A;  4USQ A;  1GEU A;  2GR2 A;  1DXL A;  2YM2 A;  4ZCC A;  1GOS A;  2ZZC A;  4CY6 A;  1DOE A;  4JDR A;  3C4N A;  4FK1 A;  3AB1 A;  2R0P A;  4H4W A;  3I3L A;  3Q9T A;  3T2Z A;  5L46 A;  3KPF A;  4YKG A;  1JEH A;  1YY5 A;  3NH3 X;  3NYC A;  4TM4 A;  3UKF A;  1JRY A;  3CMM A;  3P4R A;  4H50 A;  2NVK X;  1GTE A;  2BXS A;  2GR1 A;  2JB2 A;  1GRE A;  2XYO A;  2GR0 A;  3GSI A;  1S2Q A;  1D4C A;  1CC6 A;  1PXC A;  4BK3 A;  4H4R A;  5KOW A;  1IUU A;  1Y56 A;  3CTY A;  2FBW A;  1CBO A;  2C65 A;  4H4P A;  1LQT A;  2AQJ A;  4J33 A;  1IUT A;  1VRQ B;  3QJ4 A;  2YVJ A;  2PYX A;  5FS9 A;  1X31 B;  4YSZ A;  5EB4 A;  5JRB A;  3CPH G;  3BHK A;  3FMW A;  3NK0 X;  3GD3 A;  1L0V A;  3B6D A;  3LJP A;  4G6H A;  3T14 A;  3JSK A;  1E1M A;  1RYI A;  2V60 A;  2YQU A;  2XFO A;  3EAO A;  4NEV A;  4ZN0 A;  3F8P A;  2BYB A;  5KMP A;  3GYX A;  5ER0 A;  4Z2U A;  4G6G A;  3DH9 A;  2R4E A;  2GMJ A;  1EBD A;  3LB8 A;  4OPG A;  3NN6 X;  2YVG A;  2XLU A;  4PAA A;  2DKI A;  3FIM B;  2C64 A;  3P1W A;  1GRB A;  1Z6L A;  4IA6 A;  2E4G A;  2WOW A;  3VR8 A;  2GF3 A;  1TDF A;  3QVP A;  4EMW A;  3LXD A;  1AOG A;  2RGJ A;  5IQ1 A;  5KWF A;  2BCP A;  1KSU A;  2YLW A;  3CNP A;  3LZW A;  4H4T A;  1PBF A;  2B7S A;  1RSG A;  3CPI G;  4AP3 A;  2NPX A;  2CUL A;  2XCG A;  3I6D A;  1NHQ A;  5GSN A;  1KDG A;  4ICY A;  3SFD A;  3EAN A;  2XLP A;  4YT0 A;  3M13 A;  1H2I A;  1NG3 A;  2XVJ A;  4C5O A;  1F6M A;  2YG6 A;  3G5R A;  2YG5 A;  4B64 A;  4FX9 A;  2BCG G;  2O9Z A;  3UKA A;  1PS9 A;  2BK3 A;  2Q0L A;  2C73 A;  1JRX A;  5U1O A;  3UKQ A;  1FEA A;  2YG4 A;  4GCM A;  4B63 A;  3CNS A;  5M10 A;  4OPI A;  2WEU A;  1OJT A;  2X8C A;  3NTD A;  2IVD A;  3CNT A;  3QSM A;  3IC9 A;  2JB3 A;  3AE7 A;  3AD8 B;  4H7U A;  5DBJ A;  1BZL A;  3AEG A;  3PVC A;  5FMH A;  4AOX A;  1CF3 A;  5CKU A;  1KFY A;  5IQ4 A;  2XFQ A;  2IID A;  3ICS A;  1K4Q A;  4OPC A;  3DK8 A;  4NNJ A;  3P4Q A;  3AYL A;  3V3N A;  4M52 A;  1M64 A;  3SXI A;  2UZZ A;  1PXA A;  2BS4 A;  1TDO A;  2X3N A;  3NK2 X;  5KMQ A;  3R9U A;  4CBQ A;  1P2H A;  3K7T A;  4Z2T A;  5HY5 A;  4CNJ A;  3FBS A;  4EMI A;  1NHR A;  3ALM A;  3KPK A;  1FCD A;  5HHF A;  5BUL A;  4LII A;  3K30 A;  4G9K A;  3V3O A;  1BF3 A;  1UKV G;  3AE1 A;  4NZH A;  2I0Z A;  2VRL A;  3UP4 A;  2QA1 A;  3T37 A;  3GMC A;  2RAB A;  4FDC B;  1HYU A;  1GER A;  3NN0 X;  5EOW A;  4E0V A;  5KOX A;  2C4C A;  1K0I A;  4A9W A;  1GRF A;  2WOI A;  1PJ5 A;  3UKH A;  3UOV A;  3VQR A;  1NHP A;  2XLS A;  1FEB A;  2BC0 A;  3RED A;  2B9X A;  3PO7 A;  3O0H A;  1EL9 A;  1SEZ A;  1JOA A;  1TDN A;  1ZOV A;  4HA6 A;  4XWR A;  4J36 A;  4IA5 A;  4Z24 A;  3RP6 A;  2XFN A;  3AEE A;  1YQ3 A;  4UDQ A;  4I59 A;  1XAN A;  1H84 A;  2GVC A;  3S5W A;  1B4V A;  4UP3 A;  2V5Z A;  2Y6R A;  3AE5 A;  3AED A;  3UKK A;  3DGH A;  2BS3 A;  1Y56 B;  1JRZ A;  1F8W A;  4N9X A;  5FS6 A;  2Q6U A;  4TLZ A;  3H8L A;  2FJA A;  3RP8 A;  4A7A A;  4ADW A;  1B37 A;  4ECH A;  2WPE A;  4JN9 A;  3IWA A;  3AEA A;  3CGD A;  1RP0 A;  4U8I A;  1Q9I A;  2YLZ A;  1ZP0 A;  4J56 A;  3KVE A;  4CCR A;  1N4U A;  4UDP A;  4U2L A;  1PBD A;  1QJD A;  5C2T A;  4I58 A;  2C76 A;  1IUX A;  4JY2 A;  4K7Z A;  1LQU A;  2X99 A;  3BI5 A;  3GD4 A;  4LU6 A;  4K2X A;  4YTP A;  1MOK A;  4H4Q A;  5HYM A;  1GPE A;  1NEK A;  4A99 A;  3SZC A;  4YSH A;  5U63 A;  2V61 A;  1D7Y A;  2WQY A;  3L1R A;  2X50 A;  4RG4 A;  1K0L A;  1PHH A;  2YLT A;  5EB5 A;  4AP1 A;  5KMR A;  3HYV A;  1O5W A;  5U25 A;  4B67 A;  4EQS A;  1L9D A;  2JKC A;  3OZ2 A;  5JCI A;  3AD9 B;  4U2S A;  4J31 A;  4GR1 A;  4A79 A;  4EIQ A;  2BC1 A;  2BA9 A;  2YAU A;  2V3A A;  1ELI A;  1BWC A;  1KF6 A;  2GB0 A;  2H89 A;  2ZBW A;  4U8O A;  4Z25 A;  2C3C A;  1PDH A;  2XFP A;  3GRT A;  3BHF A;  1CJ4 A;  2CVJ A;  2VVL G;  2WU2 A;  3UOX A;  4YSY A;  1MXT A;  3GRS A;  2WP6 A;  1GTH A;  2GRT A;  4LA1 A;  5M0Z A;  1Y0P A;  2JBV A;  3URH A;  2X8H A;  3UOZ A;  4EM4 A;  1S2Y A;  3KD9 A;  2VQ7 A;  3NYF A;  4OPD A;  3F8R A;  4AOS A;  1CJC A;  4AT2 A;  2ARD A;  3OC4 A;  1H82 A;  2B7R A;  3ATR A;  3SFE A;  2GQW A;  4NTC A;  2V6O A;  1LVL A;  1H6V A;  2WDR A;  2OLN A;  4NWZ A;  3T31 A;  2Z5Y A;  1NAA A;  4YKF A;  1GET A;  2WBA A;  3SGL A;  1GAL A;  2R46 A;  1JNR A;  2XLT A;  1ZKQ A;  1LJ1 A;  2APG A;  1BGJ A;  3CGC A;  1PBE A;  2E1M A;  1CJ2 A;  5KNL A;  3SQP A;  2WS3 A;  3GDN A;  4BJZ A;  3C96 A;  2C72 A;  3BI2 A;  3C4A A;  4IVO B;  1H81 A;  3NGC X;  3NNE A;  4OVI A;  4EMJ A;  2BXR A;  2DKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...